BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85374_g1_i1 len=1139 path=[1117:0-1138]

Length=1139
                                                                      Score     E

ref|XP_009362767.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    363   2e-121   
ref|XP_004307750.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    362   6e-121   
emb|CDY08572.1|  BnaA05g28080D                                          361   2e-120   
emb|CDY65412.1|  BnaCnng46950D                                          361   2e-120   
ref|XP_006371323.1|  Hydroxyacylglutathione hydrolase cytoplasmic...    361   2e-120   
ref|XP_008375337.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    362   2e-120   
ref|XP_011084787.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    359   1e-119   
ref|XP_007011400.1|  Metallo-hydrolase/oxidoreductase superfamily...    358   3e-119   
ref|XP_010999633.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    358   4e-119   
ref|XP_010109176.1|  Hydroxyacylglutathione hydrolase cytoplasmic       357   7e-119   
emb|CBI25515.3|  unnamed protein product                                357   8e-119   
ref|XP_010491593.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    356   2e-118   
ref|XP_002267471.2|  PREDICTED: hydroxyacylglutathione hydrolase ...    356   3e-118   Vitis vinifera
ref|XP_002520895.1|  hydroxyacylglutathione hydrolase, putative         355   5e-118   Ricinus communis
gb|KFK38474.1|  hypothetical protein AALP_AA3G117500                    355   5e-118   
ref|XP_010464773.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    355   5e-118   
gb|ABB29955.1|  hydroxyacylglutathione hydrolase cytoplasmic-like       355   6e-118   Solanum tuberosum [potatoes]
ref|XP_006357301.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    355   6e-118   
ref|XP_010228670.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    355   8e-118   
ref|XP_009781128.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    354   8e-118   
ref|XP_010228672.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    354   2e-117   
ref|NP_187696.1|  hydroxyacylglutathione hydrolase                      353   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298374.1|  hypothetical protein CARUB_v10014444mg             353   4e-117   
ref|XP_010486705.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    352   5e-117   
ref|XP_009146800.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    352   5e-117   
ref|XP_007141335.1|  hypothetical protein PHAVU_008G187100g             352   8e-117   
ref|XP_008456973.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    351   1e-116   
ref|XP_003615463.1|  Hydroxyacylglutathione hydrolase                   351   1e-116   
gb|KDP21620.1|  hypothetical protein JCGZ_03291                         351   2e-116   
ref|XP_004490514.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    351   2e-116   
ref|XP_006407499.1|  hypothetical protein EUTSA_v10021361mg             350   3e-116   
ref|NP_001050016.1|  Os03g0332400                                       350   3e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002884816.1|  glyoxalase 2-2                                     350   4e-116   
ref|XP_010670038.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    350   4e-116   
ref|XP_006842570.1|  hypothetical protein AMTR_s00077p00150130          350   4e-116   
ref|XP_010558112.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    349   8e-116   
gb|AFK42856.1|  unknown                                                 349   8e-116   
ref|XP_004240841.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    349   1e-115   
emb|CDP13879.1|  unnamed protein product                                349   1e-115   
gb|EYU35184.1|  hypothetical protein MIMGU_mgv1a012213mg                348   2e-115   
ref|XP_010278945.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    348   2e-115   
ref|XP_006595529.1|  PREDICTED: uncharacterized protein LOC100527...    348   2e-115   
ref|XP_006486126.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    348   2e-115   
ref|XP_007218221.1|  hypothetical protein PRUPE_ppa007897mg             352   2e-115   
ref|XP_006435967.1|  hypothetical protein CICLE_v10032268mg             349   3e-115   
ref|XP_010911346.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    347   6e-115   
ref|XP_004146429.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    347   1e-114   
ref|XP_006650035.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    346   2e-114   
gb|KHN40009.1|  Hydroxyacylglutathione hydrolase cytoplasmic            343   2e-113   
ref|XP_004307749.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    343   3e-113   
dbj|BAJ87343.1|  predicted protein                                      343   3e-113   
gb|EPS73265.1|  hypothetical protein M569_01492                         343   3e-113   
ref|XP_004984491.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    342   4e-113   
ref|XP_002465318.1|  hypothetical protein SORBIDRAFT_01g036340          342   5e-113   Sorghum bicolor [broomcorn]
gb|KHG16215.1|  Hydroxyacylglutathione hydrolase cytoplasmic -lik...    342   7e-113   
gb|ABK23771.1|  unknown                                                 342   7e-113   Picea sitchensis
ref|XP_004984490.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    342   8e-113   
gb|AFK34093.1|  unknown                                                 341   1e-112   
ref|NP_001132380.1|  uncharacterized protein LOC100193826               341   2e-112   Zea mays [maize]
ref|XP_008657238.1|  PREDICTED: uncharacterized protein LOC100193...    341   3e-112   
ref|NP_001235365.1|  uncharacterized protein LOC100527131               339   8e-112   
gb|ACG31465.1|  hydroxyacylglutathione hydrolase                        339   1e-111   Zea mays [maize]
ref|XP_010031061.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    337   6e-111   
ref|XP_010464772.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    338   1e-110   
ref|XP_008782702.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    336   2e-110   
ref|XP_010228673.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    333   7e-110   
ref|XP_010228671.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    334   8e-110   
ref|XP_008234181.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxyacylg...    333   1e-109   
ref|XP_009416328.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    333   2e-109   
ref|XP_009600781.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    330   3e-108   
gb|AAC49867.1|  glyoxalase II cytoplasmic isozyme                       328   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001275099.1|  uncharacterized protein LOC102584437               325   3e-106   
ref|XP_001769411.1|  predicted protein                                  302   2e-97    
ref|XP_002974130.1|  hypothetical protein SELMODRAFT_149526             288   9e-92    
ref|XP_008328136.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    264   1e-81    
ref|XP_008328137.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    264   1e-81    
ref|XP_008415030.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    260   7e-81    
tpg|DAA45199.1|  TPA: hypothetical protein ZEAMMB73_732063              257   8e-81    
gb|EFN67738.1|  Hydroxyacylglutathione hydrolase                        261   9e-81    
ref|XP_008415029.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    261   1e-80    
ref|XP_007557435.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    259   1e-80    
ref|XP_007557434.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    260   3e-80    
ref|XP_005808795.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    259   4e-80    
ref|XP_008286134.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    259   5e-80    
ref|XP_005461151.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    257   8e-80    
gb|EFX88128.1|  hypothetical protein DAPPUDRAFT_96363                   257   1e-79    
ref|XP_011063845.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    256   2e-79    
ref|XP_003456418.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    258   2e-79    
ref|XP_783848.2|  PREDICTED: hydroxyacylglutathione hydrolase, mi...    256   2e-79    Strongylocentrotus purpuratus [purple urchin]
ref|XP_010872543.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    258   2e-79    
ref|XP_011063844.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    257   4e-79    
ref|XP_003702211.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    256   5e-79    
gb|ACQ57952.1|  Hydroxyacylglutathione hydrolase                        255   7e-79    Anoplopoma fimbria
gb|EZA56493.1|  Hydroxyacylglutathione hydrolase, mitochondrial         256   1e-78    
gb|EFZ09440.1|  hypothetical protein SINV_15790                         253   2e-78    
ref|XP_005734677.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    253   3e-78    
ref|XP_005707034.1|  hydroxyacylglutathione hydrolase                   253   3e-78    
ref|XP_004071735.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    255   4e-78    
ref|XP_003396987.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    252   5e-78    
ref|XP_005734676.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    254   6e-78    
ref|XP_010872544.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    252   8e-78    
ref|XP_002130731.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    253   1e-77    Ciona intestinalis [sea vase]
ref|XP_003396986.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    253   1e-77    
ref|XP_004558408.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    251   1e-77    
ref|XP_010872542.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    253   2e-77    
gb|ELT90617.1|  hypothetical protein CAPTEDRAFT_151639                  251   2e-77    
ref|XP_008210304.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    251   2e-77    
ref|XP_004558407.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    253   3e-77    
ref|XP_008579768.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    251   3e-77    
ref|XP_001602195.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    252   4e-77    Nasonia vitripennis
ref|NP_001188161.1|  hydroxyacylglutathione hydrolase-like protein      251   5e-77    
ref|XP_004522027.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    251   6e-77    
ref|XP_008551511.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    251   6e-77    
ref|XP_005081650.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    250   6e-77    
ref|XP_005697452.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    249   7e-77    
ref|XP_006971708.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    249   9e-77    
ref|NP_001153098.1|  hydroxyacylglutathione hydrolase, mitochondr...    249   1e-76    Mus musculus [mouse]
ref|XP_004522028.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    249   1e-76    
ref|XP_004902582.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    249   1e-76    
gb|AAH04749.1|  Hydroxyacyl glutathione hydrolase                       249   1e-76    Mus musculus [mouse]
ref|NP_956337.1|  hydroxyacylglutathione hydrolase, mitochondrial       249   1e-76    Danio rerio [leopard danio]
ref|XP_004522026.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    251   2e-76    
ref|XP_004596674.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    248   2e-76    
ref|XP_004627942.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    250   2e-76    
ref|XP_006763982.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    248   2e-76    
ref|XP_005163922.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    249   3e-76    
gb|ACO10962.1|  Hydroxyacylglutathione hydrolase                        248   3e-76    Caligus rogercresseyi
ref|XP_005081649.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    249   3e-76    
ref|XP_005886877.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    248   4e-76    
ref|XP_010595725.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    248   4e-76    
ref|XP_006245961.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    248   4e-76    
ref|XP_007640382.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    248   5e-76    
ref|XP_005866624.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    248   5e-76    
ref|XP_004652230.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    249   5e-76    
ref|NP_077246.2|  hydroxyacylglutathione hydrolase, mitochondrial...    249   5e-76    Mus musculus [mouse]
ref|XP_006971707.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    249   5e-76    
ref|NP_001030351.1|  hydroxyacylglutathione hydrolase, mitochondrial    249   5e-76    Bos taurus [bovine]
sp|Q99KB8.2|GLO2_MOUSE  RecName: Full=Hydroxyacylglutathione hydr...    249   6e-76    Mus musculus [mouse]
ref|XP_005349197.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    247   7e-76    
gb|ELR62865.1|  Hydroxyacylglutathione hydrolase, mitochondrial         248   7e-76    
ref|XP_007606645.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    247   8e-76    
gb|AIZ09001.1|  mitochondrial hydroxyacylglutathione hydrolase pr...    249   8e-76    
ref|XP_010618769.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    247   8e-76    
ref|XP_008579781.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    247   9e-76    
ref|XP_004438245.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    247   9e-76    
ref|XP_004873740.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    249   9e-76    
gb|KFM77441.1|  Hydroxyacylglutathione hydrolase, mitochondrial         247   9e-76    
ref|XP_008144612.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    248   1e-75    
gb|ACO10827.1|  Hydroxyacylglutathione hydrolase                        247   1e-75    Caligus rogercresseyi
gb|EXX72543.1|  hydroxyacylglutathione hydrolase GLO2                   247   1e-75    
gb|ELK30111.1|  Hydroxyacylglutathione hydrolase, mitochondrial         248   1e-75    
gb|ESA19588.1|  hypothetical protein GLOINDRAFT_344042                  246   1e-75    
ref|XP_004020757.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    248   2e-75    
dbj|BAE38377.1|  unnamed protein product                                246   2e-75    Mus musculus [mouse]
ref|XP_007655412.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxyacylg...    246   2e-75    
ref|XP_006076917.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    246   2e-75    
gb|AAH97301.1|  Hagh protein                                            247   2e-75    Rattus norvegicus [brown rat]
ref|XP_007100154.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    246   2e-75    
ref|NP_203500.2|  hydroxyacylglutathione hydrolase, mitochondrial...    247   2e-75    Rattus norvegicus [brown rat]
ref|XP_006611214.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    246   2e-75    
ref|XP_003417826.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    247   3e-75    
ref|XP_003790829.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    247   3e-75    
ref|XP_003964596.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxyacylg...    247   3e-75    
ref|XP_007528076.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    247   3e-75    
ref|XP_007606644.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    246   3e-75    
ref|XP_005349196.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    247   4e-75    
ref|XP_005391566.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    245   4e-75    
emb|CDI95494.1|  hydroxyacylglutathione hydrolase                       246   4e-75    
ref|XP_008504781.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    245   5e-75    
ref|XP_007606643.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    246   5e-75    
ref|XP_006611213.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    246   5e-75    
ref|XP_006568363.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    244   5e-75    
gb|AAC39944.1|  RSP29                                                   244   7e-75    Rattus norvegicus [brown rat]
ref|XP_004604249.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    246   7e-75    
ref|XP_003693139.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    246   7e-75    
ref|XP_005599127.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    244   7e-75    
ref|XP_006204322.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    244   8e-75    
ref|XP_005096292.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    244   8e-75    
ref|XP_008068509.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    246   9e-75    
ref|XP_009090000.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    244   9e-75    
ref|XP_006100952.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    246   1e-74    
ref|XP_002402678.1|  hydroxyacylglutathione hydrolase, putative         244   1e-74    Ixodes scapularis [blacklegged tick]
ref|XP_008926338.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    244   1e-74    
ref|XP_008854439.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    245   1e-74    
ref|XP_006174077.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    244   1e-74    
ref|XP_006568362.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    245   2e-74    
ref|XP_007181750.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    244   2e-74    
ref|XP_010337341.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    243   2e-74    
ref|XP_005096291.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    244   2e-74    
ref|XP_008488463.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    244   2e-74    
ref|XP_005096289.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    244   3e-74    
ref|XP_005391565.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    246   3e-74    
ref|XP_008631635.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    243   3e-74    
emb|CDJ39071.1|  hydroxyacylglutathione hydrolase, putative             243   3e-74    
ref|XP_005523137.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    243   3e-74    
ref|XP_010390601.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    243   3e-74    
dbj|BAF82844.1|  unnamed protein product                                243   4e-74    Homo sapiens [man]
ref|XP_008854438.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    245   4e-74    
ref|XP_005391564.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    246   4e-74    
ref|XP_005096290.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    244   4e-74    
sp|O35952.2|GLO2_RAT  RecName: Full=Hydroxyacylglutathione hydrol...    244   4e-74    Rattus norvegicus [brown rat]
ref|XP_009284756.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    243   4e-74    
gb|KFP72720.1|  Hydroxyacylglutathione hydrolase-like                   242   5e-74    
gb|KFO58952.1|  hypothetical protein N302_11765                         243   6e-74    
ref|XP_010193210.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    242   6e-74    
ref|XP_004270372.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    244   6e-74    
ref|XP_001362982.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    244   6e-74    Monodelphis domestica
ref|XP_003269190.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    242   7e-74    
emb|CDJ66855.1|  hydroxyacylglutathione hydrolase, putative             242   7e-74    
emb|CDI82141.1|  hydroxyacylglutathione hydrolase, putative             244   8e-74    
ref|XP_003762055.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    242   8e-74    
gb|EFB17173.1|  hypothetical protein PANDA_008978                       243   9e-74    Ailuropoda melanoleuca
ref|XP_004403198.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    241   9e-74    
ref|XP_006637198.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    241   1e-73    
ref|XP_010990925.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    243   1e-73    
ref|XP_004158977.1|  PREDICTED: hydroxyacylglutathione hydrolase ...    239   1e-73    
ref|XP_010948207.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    243   1e-73    
gb|KFQ20623.1|  hypothetical protein N332_07325                         242   1e-73    
ref|XP_005590963.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    241   1e-73    
ref|XP_009080922.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    242   1e-73    
ref|XP_005426013.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    241   1e-73    
ref|NP_001270343.1|  hydroxyacylglutathione hydrolase, mitochondrial    243   1e-73    
ref|NP_001035517.1|  hydroxyacylglutathione hydrolase, mitochondr...    241   1e-73    Homo sapiens [man]
ref|XP_002428405.1|  Hydroxyacylglutathione hydrolase, putative         243   1e-73    Pediculus humanus corporis [human body lice]
ref|XP_006024077.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    242   2e-73    
ref|XP_010386141.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    241   2e-73    
ref|XP_005523136.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    243   2e-73    
ref|XP_006901960.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    243   2e-73    
ref|XP_001090793.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    241   2e-73    Macaca mulatta [rhesus macaque]
ref|XP_005523135.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    241   2e-73    
ref|XP_002920271.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    243   2e-73    
ref|XP_009193952.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    241   2e-73    
ref|XP_010568749.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    241   2e-73    
gb|EHJ68016.1|  putative hydroxyacyl glutathione hydrolase              241   2e-73    
gb|EHH60051.1|  Hydroxyacylglutathione hydrolase, mitochondrial         241   3e-73    
ref|XP_007453627.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    242   3e-73    
ref|XP_006146444.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    240   3e-73    
ref|XP_008115012.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    240   3e-73    
ref|XP_005337877.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    241   3e-73    
ref|XP_010157348.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    240   3e-73    
ref|XP_010133508.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    240   3e-73    
ref|XP_510739.5|  PREDICTED: hydroxyacylglutathione hydrolase, mi...    242   3e-73    Pan troglodytes
ref|XP_008943983.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    240   3e-73    
ref|XP_007937707.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    242   3e-73    
ref|XP_005495864.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    240   3e-73    
ref|XP_007980058.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    240   4e-73    
ref|XP_972438.1|  PREDICTED: hydroxyacylglutathione hydrolase, mi...    241   4e-73    Tribolium castaneum [rust-red flour beetle]
ref|XP_006274231.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    241   4e-73    
ref|XP_005337876.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    241   4e-73    
ref|XP_009466116.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    241   5e-73    
gb|KFO89151.1|  hypothetical protein N320_06453                         241   5e-73    
ref|XP_003456417.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    240   5e-73    
ref|NP_005317.2|  hydroxyacylglutathione hydrolase, mitochondrial...    241   6e-73    Homo sapiens [man]
ref|XP_008887602.1|  hydroxyacylglutathione hydrolase                   240   6e-73    
gb|KFQ20298.1|  hypothetical protein N331_06860                         240   6e-73    
ref|XP_004750811.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    239   6e-73    
gb|KFW12152.1|  hypothetical protein N326_09273                         240   6e-73    
ref|XP_003478512.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    241   6e-73    
ref|XP_004403197.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    241   6e-73    
ref|XP_009008754.1|  hypothetical protein HELRODRAFT_155548             239   7e-73    
dbj|BAE01354.1|  unnamed protein product                                239   7e-73    Macaca fascicularis [crab eating macaque]
ref|XP_009934274.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    240   7e-73    
ref|XP_009513365.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    239   7e-73    
ref|XP_001090907.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    241   7e-73    Macaca mulatta [rhesus macaque]
ref|XP_005007446.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    241   8e-73    
ref|XP_010168214.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    239   8e-73    
ref|XP_010001847.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    239   8e-73    
gb|KFD54642.1|  hypothetical protein M513_04342                         239   8e-73    
gb|EYU35185.1|  hypothetical protein MIMGU_mgv1a012213mg                238   9e-73    
ref|XP_007058626.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    240   9e-73    
ref|XP_009808020.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    239   9e-73    
ref|XP_010386140.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    241   9e-73    
gb|EKC35971.1|  Hydroxyacylglutathione hydrolase, mitochondrial         240   9e-73    
gb|ACH44196.1|  putative hydroxyacyl glutathione hydrolase              239   9e-73    Taeniopygia guttata
ref|XP_005054051.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    239   9e-73    
gb|KHJ40295.1|  hydroxyacylglutathione hydrolase                        239   1e-72    
ref|XP_009964042.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    239   1e-72    
ref|XP_002607243.1|  hypothetical protein BRAFLDRAFT_104472             249   1e-72    Branchiostoma floridae
ref|XP_003916396.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    240   1e-72    
emb|CDJ50449.1|  hydroxyacylglutathione hydrolase, putative             243   1e-72    
gb|KFU94095.1|  hypothetical protein M959_09448                         239   1e-72    
ref|XP_010078336.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    239   1e-72    
ref|XP_009284754.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    239   1e-72    
gb|KFZ60072.1|  hypothetical protein N321_03353                         239   1e-72    
ref|XP_006873923.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    240   1e-72    
ref|XP_004373216.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    240   1e-72    
ref|XP_008631634.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    239   1e-72    
ref|XP_008488470.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    238   1e-72    
gb|KFW86724.1|  hypothetical protein N336_08910                         239   1e-72    
ref|XP_009638706.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    238   2e-72    
emb|CCD81676.1|  putative glyoxalase II (Hydroxyacylglutathione h...    238   2e-72    
ref|NP_001089873.1|  hydroxyacylglutathione hydrolase                   238   2e-72    
ref|XP_010304690.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    238   2e-72    
ref|XP_009892945.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    239   2e-72    
ref|XP_009693961.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    238   2e-72    
ref|XP_010208175.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    238   2e-72    
ref|XP_006791568.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    239   2e-72    
ref|XP_007980038.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    240   2e-72    
dbj|BAG61219.1|  unnamed protein product                                240   2e-72    
gb|KFP47153.1|  hypothetical protein N323_03228                         239   2e-72    
ref|XP_006873922.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    240   2e-72    
ref|XP_005444151.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    238   2e-72    
gb|EPQ07984.1|  Hydroxyacylglutathione hydrolase, mitochondrial         248   2e-72    
ref|XP_010281313.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    238   2e-72    
gb|KFV49508.1|  hypothetical protein N341_07242                         239   2e-72    
gb|KFV41883.1|  hypothetical protein N328_06398                         239   2e-72    
ref|XP_009466118.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    238   2e-72    
gb|KFV12491.1|  hypothetical protein N339_10670                         239   3e-72    
gb|KFO95530.1|  hypothetical protein N300_14182                         239   3e-72    
ref|XP_001957319.1|  GF10361                                            239   3e-72    
gb|KFP17354.1|  hypothetical protein Z169_10374                         239   3e-72    
gb|KFG41273.1|  hydroxyacylglutathione hydrolase                        244   3e-72    
gb|KFW70873.1|  hypothetical protein AS28_11221                         238   3e-72    
ref|XP_006003150.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    239   3e-72    
gb|KFO12828.1|  hypothetical protein N312_01702                         238   3e-72    
gb|KFM12460.1|  hypothetical protein AS27_12340                         238   3e-72    
gb|KFP23384.1|  hypothetical protein N325_06589                         238   4e-72    
gb|EPT30349.1|  hydroxyacylglutathione hydrolase                        243   4e-72    
gb|KGB38220.1|  putative hydroxyacylglutathione hydrolase               238   4e-72    
gb|KFH00219.1|  hydroxyacylglutathione hydrolase                        243   4e-72    
gb|KFG57416.1|  hydroxyacylglutathione hydrolase                        243   4e-72    
ref|XP_006611211.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    246   4e-72    
ref|XP_009664319.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    237   4e-72    
gb|KFO77120.1|  Hydroxyacylglutathione hydrolase-like                   237   4e-72    
gb|KFP62799.1|  hypothetical protein N322_02424                         238   5e-72    
ref|XP_006791567.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxyacylg...    239   5e-72    
ref|XP_005023400.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    237   5e-72    
gb|ESS32843.1|  hydroxyacylglutathione hydrolase                        243   5e-72    
gb|KFQ66201.1|  hypothetical protein N335_09381                         238   6e-72    
ref|XP_010568753.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    237   6e-72    
ref|XP_007499431.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    243   6e-72    
ref|NP_001025808.1|  hydroxyacylglutathione hydrolase-like protein      238   6e-72    
ref|XP_009977825.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    237   6e-72    
ref|XP_006129353.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    238   7e-72    
ref|XP_006611210.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    246   7e-72    
ref|XP_003964627.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    238   7e-72    
ref|XP_005830006.1|  hypothetical protein GUITHDRAFT_159817             237   7e-72    
dbj|BAG61813.1|  unnamed protein product                                238   7e-72    
ref|XP_009560466.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    237   8e-72    
ref|XP_003224801.2|  PREDICTED: hydroxyacylglutathione hydrolase,...    239   9e-72    
gb|KFV76360.1|  hypothetical protein N308_15696                         237   9e-72    
ref|XP_009894859.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    236   1e-71    
ref|XP_009177338.1|  hypothetical protein T265_12101                    237   1e-71    
ref|XP_001639978.1|  predicted protein                                  236   1e-71    
ref|XP_006568361.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    245   1e-71    
ref|XP_006942629.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    239   1e-71    
gb|AAP06491.1|  SJCHGC05735 protein                                     236   1e-71    
ref|XP_005621754.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    236   1e-71    
ref|XP_010717836.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    236   1e-71    
gb|EOA98495.1|  Hydroxyacylglutathione hydrolase                        237   1e-71    
ref|XP_008328134.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    237   1e-71    
dbj|GAA53914.1|  hydroxyacylglutathione hydrolase                       236   1e-71    
ref|XP_005145090.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    236   1e-71    
gb|KFV10765.1|  hypothetical protein N340_11456                         237   1e-71    
ref|NP_001254670.1|  hydroxyacylglutathione hydrolase, mitochondrial    236   1e-71    
ref|XP_003390374.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    238   1e-71    
ref|XP_002095415.1|  GE19704                                            239   2e-71    
ref|XP_010013929.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    236   2e-71    
ref|XP_005023399.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    237   2e-71    
ref|XP_006024076.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    236   2e-71    
ref|XP_005504508.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    236   2e-71    
ref|XP_005985894.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxyacylg...    236   2e-71    
gb|KFV61372.1|  hypothetical protein N307_07653                         236   2e-71    
ref|XP_002110104.1|  hypothetical protein TRIADDRAFT_20939              236   2e-71    
ref|XP_001973539.1|  GG16137                                            238   2e-71    
ref|XP_008926339.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    235   2e-71    
gb|EPR61790.1|  hydroxyacylglutathione hydrolase                        241   2e-71    
ref|XP_010568751.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    237   3e-71    
ref|XP_010568748.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    236   3e-71    
sp|Q28333.2|GLO2_CALJA  RecName: Full=Hydroxyacylglutathione hydr...    236   3e-71    
ref|XP_007098767.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    239   3e-71    
ref|XP_006024075.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    236   3e-71    
gb|KFW84507.1|  hypothetical protein N305_14927                         236   3e-71    
gb|KFQ50559.1|  hypothetical protein N333_05897                         236   4e-71    
ref|XP_002095411.1|  GE19707                                            238   4e-71    
ref|NP_001012807.1|  hydroxyacylglutathione hydrolase, mitochondr...    236   4e-71    
ref|NP_649258.1|  CG4365, isoform A                                     236   5e-71    
ref|XP_537013.2|  PREDICTED: hydroxyacylglutathione hydrolase, mi...    236   5e-71    
ref|NP_730569.1|  CG4365, isoform B                                     235   5e-71    
ref|XP_009576350.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    234   6e-71    
ref|XP_005145089.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    236   7e-71    
ref|XP_006274233.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    234   7e-71    
ref|XP_007499430.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    243   8e-71    
ref|XP_010120899.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    234   9e-71    
ref|XP_002735677.2|  PREDICTED: LOW QUALITY PROTEIN: hydroxyacylg...    234   9e-71    
ref|XP_002068089.1|  GK10504                                            236   9e-71    
ref|XP_009843420.1|  hydroxyacylglutathione hydrolase, variant          234   1e-70    
ref|XP_006274232.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    234   1e-70    
ref|XP_007429449.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    234   1e-70    
gb|KFV92401.1|  hypothetical protein N327_08839                         234   1e-70    
ref|XP_009478281.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    234   1e-70    
gb|KFP43004.1|  hypothetical protein N324_07454                         234   1e-70    
ref|XP_002008306.1|  GI13415                                            235   1e-70    
ref|XP_009914803.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    233   1e-70    
gb|ERE68721.1|  insulin-like growth factor-binding protein comple...    247   2e-70    
ref|XP_001353016.2|  GA18136                                            235   2e-70    
gb|KFQ59876.1|  hypothetical protein N334_08872                         234   2e-70    
gb|ADR71718.1|  AT09325p                                                236   2e-70    
ref|XP_001610385.1|  hydroxyacylglutathione hydrolase                   235   2e-70    
ref|XP_008286129.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    233   2e-70    
ref|XP_002085704.1|  GD14908                                            236   2e-70    
gb|EAW85610.1|  hydroxyacylglutathione hydrolase, isoform CRA_b         235   2e-70    
ref|XP_005504507.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    233   2e-70    
ref|XP_002040718.1|  GM22320                                            236   2e-70    
dbj|GAM21542.1|  hypothetical protein SAMD00019534_047170               233   3e-70    
ref|XP_008694952.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    233   3e-70    
ref|NP_730568.1|  CG4365, isoform C                                     236   3e-70    
gb|AEX91655.1|  FI19313p1                                               236   3e-70    
ref|XP_008162993.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    233   3e-70    
ref|NP_001135503.1|  hydroxyacylglutathione hydrolase, mitochondrial    234   3e-70    
gb|KFO34727.1|  Insulin-like growth factor-binding protein comple...    247   3e-70    
ref|XP_007058627.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    234   5e-70    
ref|XP_004932543.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    233   5e-70    
gb|EMC88429.1|  Hydroxyacylglutathione hydrolase, mitochondrial         233   5e-70    
ref|XP_002026907.1|  GL12815                                            233   5e-70    
emb|CDS23029.1|  hydroxyacylglutathione hydrolase                       232   8e-70    
gb|KDR09065.1|  Hydroxyacylglutathione hydrolase, mitochondrial         233   9e-70    
ref|XP_005651251.1|  hydroxyacylglutathione hydrolase                   231   9e-70    
gb|KFO77119.1|  hypothetical protein N303_05107                         231   9e-70    
gb|EUB61550.1|  Hydroxyacylglutathione hydrolase                        232   9e-70    
gb|KFQ99928.1|  hypothetical protein Y956_00667                         232   1e-69    
gb|KGL85988.1|  hypothetical protein N301_13364                         232   1e-69    
ref|XP_005289021.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    233   1e-69    
ref|XP_009074765.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    231   1e-69    
ref|XP_005289019.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    233   1e-69    
ref|XP_005289020.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    233   1e-69    
ref|XP_006129352.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    231   2e-69    
gb|AAZ32844.1|  hydroxyacylglutathione hydrolase                        228   2e-69    
ref|XP_009560499.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    230   2e-69    
emb|CDJ02229.1|  hydroxyacylglutathione hydrolase                       231   2e-69    
ref|XP_005289023.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    231   2e-69    
gb|KFQ01976.1|  hypothetical protein N329_02418                         231   2e-69    
ref|XP_010728989.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    231   2e-69    
gb|KFP70559.1|  hypothetical protein N310_12025                         231   2e-69    
ref|XP_005182235.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    231   2e-69    
gb|EPY88932.1|  hydroxyacylglutathione hydrolase, mitochondrial-l...    233   4e-69    
ref|XP_005182234.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    231   5e-69    
gb|KFZ59861.1|  hypothetical protein N338_11988                         230   5e-69    
ref|XP_002048081.1|  GJ11540                                            231   5e-69    
gb|KHN79372.1|  Hydroxyacylglutathione hydrolase, mitochondrial         230   7e-69    
dbj|BAN20634.1|  hydroxyacylglutathione hydrolase                       230   8e-69    
ref|XP_004354925.1|  hydroxyacylglutathione hydrolase                   229   9e-69    
ref|XP_005712097.1|  unnamed protein product                            229   2e-68    
emb|CDJ56604.1|  hydroxyacylglutathione hydrolase, putative             226   2e-68    
gb|KFR11785.1|  hypothetical protein N306_08128                         228   3e-68    
ref|NP_001120090.1|  hydroxyacylglutathione hydrolase-like protein      228   4e-68    
ref|XP_004995709.1|  hypothetical protein PTSG_03122                    227   4e-68    
ref|XP_010791958.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    226   5e-68    
gb|ETE66616.1|  Hydroxyacylglutathione hydrolase, mitochondrial         232   7e-68    
ref|XP_007557433.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxyacylg...    229   7e-68    
ref|XP_006914026.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    226   8e-68    
ref|XP_008415027.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxyacylg...    229   9e-68    
ref|XP_001984915.1|  GH16754                                            228   1e-67    
gb|ERG79689.1|  hydroxyacylglutathione                                  226   1e-67    
ref|XP_003742337.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    227   1e-67    
ref|XP_003742339.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    227   1e-67    
ref|XP_009835365.1|  hydroxyacylglutathione hydrolase                   228   1e-67    
ref|XP_010728991.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    227   1e-67    
ref|XP_009959454.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    226   2e-67    
gb|EHH31307.1|  Hydroxyacylglutathione hydrolase, mitochondrial         229   2e-67    
ref|XP_003762013.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    226   3e-67    
gb|KFQ04761.1|  hypothetical protein N330_06787                         226   3e-67    
ref|XP_786600.3|  PREDICTED: hydroxyacylglutathione hydrolase, mi...    225   3e-67    
ref|XP_005229084.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    225   4e-67    
ref|XP_006914024.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    226   4e-67    
ref|XP_003742338.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    225   5e-67    
ref|XP_008866942.1|  hydroxyacylglutathione hydrolase                   224   6e-67    
emb|CDR95897.1|  hydroxyacylglutathione hydrolase, putative             225   1e-66    
gb|EFA75013.1|  hydroxyacylglutathione hydrolase                        223   2e-66    
ref|XP_003137817.1|  hydroxyacylglutathione hydrolase                   223   3e-66    
ref|XP_009843419.1|  hydroxyacylglutathione hydrolase                   222   4e-66    
ref|XP_001365859.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    222   6e-66    
gb|AET50697.1|  hypothetical protein                                    220   7e-66    
emb|CDW55936.1|  zf-C3HC4 and Lactamase B and zf-CCCH domain cont...    231   8e-66    
ref|XP_005808796.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    223   1e-65    
ref|NP_001090483.1|  hydroxyacylglutathione hydrolase-like              222   1e-65    
ref|XP_003882599.1|  putative hydroxyacylglutathione hydrolase          221   2e-65    
emb|CCA26998.1|  hydroxyacylglutathione hydrolase putative              220   2e-65    
emb|CDQ00723.1|  Protein Bm6299, isoform d                              221   2e-65    
gb|KFM76382.1|  Hydroxyacylglutathione hydrolase, mitochondrial         219   7e-65    
ref|XP_008608810.1|  hydroxyacylglutathione hydrolase                   218   7e-65    
ref|XP_001899455.1|  Chain A, Human Glyoxalase Ii With Cacodylate...    219   1e-64    
ref|XP_003287608.1|  hypothetical protein DICPUDRAFT_151708             218   1e-64    
gb|EMP36897.1|  Hydroxyacylglutathione hydrolase                        224   1e-64    
emb|CDS12335.1|  hypothetical protein LRAMOSA04530                      218   2e-64    
ref|XP_008616900.1|  hydroxyacylglutathione hydrolase                   218   2e-64    
gb|KFH68914.1|  hydroxyacylglutathione hydrolase                        217   2e-64    
gb|EWM21343.1|  hydroxyacylglutathione hydrolase                        217   3e-64    
ref|XP_007904287.1|  PREDICTED: hydroxyacylglutathione hydrolase,...    218   3e-64    
gb|KDO20332.1|  hydroxyacylglutathione hydrolase                        217   5e-64    
ref|XP_005771440.1|  hypothetical protein EMIHUDRAFT_75585              217   5e-64    
gb|KFO06555.1|  Hydroxyacylglutathione hydrolase-like                   215   6e-64    
ref|XP_001746929.1|  hypothetical protein                               219   7e-64    
ref|XP_010309988.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    215   1e-63    
ref|XP_003762014.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    216   2e-63    
emb|CBJ28354.1|  conserved unknown protein                              214   3e-63    
ref|XP_004829974.1|  hydroxyacylglutathione hydrolase, putative         214   3e-63    
ref|XP_007499308.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    214   4e-63    
ref|XP_007429451.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    215   4e-63    
ref|XP_007499309.1|  PREDICTED: hydroxyacylglutathione hydrolase-...    213   1e-62    



>ref|XP_009362767.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Pyrus 
x bretschneideri]
Length=258

 Score =   363 bits (933),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 212/255 (83%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C ED+ YSYLIIDEST+EAA VDP + EKVL+AA  +  +IK+VLTTHHH  H
Sbjct  1     MKIHHVACLEDN-YSYLIIDESTKEAAVVDPVEPEKVLKAAQEHGVDIKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+K++VP ++VYGG++D+V GCT+ V++GD I+LGA   I CL TPCHT GHISY
Sbjct  60    AGGNEKIKQLVPVIKVYGGSIDNVNGCTNKVENGDKISLGADVHILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKEG  PAVFTGDTLF  GCGKFFEGTAEQM++SLC TLA+LPK T VYC HEYTVK
Sbjct  120   YVTSKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMHQSLCVTLASLPKPTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN ++K+KL WA+QQR+  LPT+PSTIE+E+ETNPF+R DLP++Q+++  
Sbjct  180   NLQFAQTVEPDNAKIKQKLSWAQQQRQAGLPTVPSTIEEEMETNPFIRADLPELQERVGC  239

Query  306   KSPVEALKKLRQLKD  262
             K+ VEAL+++RQ KD
Sbjct  240   KTAVEALREIRQRKD  254



>ref|XP_004307750.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=258

 Score =   362 bits (930),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 211/255 (83%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C ED+ Y+YLIIDEST+EAA VDP + EKVL+AA  + A++KIVLTTHHH  H
Sbjct  1     MKIHHVACLEDN-YAYLIIDESTKEAAVVDPVEPEKVLKAAQEHGAQVKIVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+KE+VPG++VYGG++D+V+GCT  V +GD I LGA T I  L TPCHT GHISY
Sbjct  60    AGGNEKIKELVPGIKVYGGSVDNVKGCTDKVDNGDKITLGADTQILSLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKEG +PAVFTGDTLF  GCGKFFEGTAEQM++SLC TLA+LPK T VYC HEYTVK
Sbjct  120   YVTSKEGEEPAVFTGDTLFVAGCGKFFEGTAEQMHQSLCVTLASLPKPTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EP N ++K+KL WA+QQR+  LPT+PSTIE E+ETNPF+R D+P++Q+K+  
Sbjct  180   NLQFAQTVEPHNAKIKQKLSWAQQQREAGLPTVPSTIESEMETNPFVRADMPELQEKVGC  239

Query  306   KSPVEALKKLRQLKD  262
             ++ VEAL+++RQ KD
Sbjct  240   QNAVEALREIRQRKD  254



>emb|CDY08572.1| BnaA05g28080D [Brassica napus]
Length=258

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/256 (66%), Positives = 211/256 (82%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C +D+ YSYLIIDEST +AAAVDP + EKV+Q+A+ + A+IK VLTTHHH  H
Sbjct  1     MKIFHVPCLQDN-YSYLIIDESTGDAAAVDPVEPEKVIQSAEHHHAKIKFVLTTHHHSDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKMK++VPG++VYGG+LD V+GCT  V +GDT++LG    I  L TPCHT GHISY
Sbjct  60    AGGNEKMKQLVPGIKVYGGSLDKVKGCTDAVDNGDTLSLGQNINILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ K+G  PAVFTGDTLF  GCGKFFEGTAEQM++SLC TLA+LPK T VYC HEYTVK
Sbjct  120   YVTGKDGETPAVFTGDTLFVAGCGKFFEGTAEQMHQSLCVTLASLPKPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NLEF  T+EP+N ++++KL WARQQR+ NLPTIPST+E+ELETNPF+RV+ P+IQ+KL  
Sbjct  180   NLEFALTVEPNNEKIQQKLSWARQQRQANLPTIPSTLEEELETNPFMRVNNPEIQEKLGC  239

Query  306   KSPVEALKKLRQLKDK  259
             KSP++ L+++R  KD+
Sbjct  240   KSPIDTLREIRNKKDQ  255



>emb|CDY65412.1| BnaCnng46950D [Brassica napus]
Length=258

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/256 (66%), Positives = 209/256 (82%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C ED+ YSYLIIDEST +AA VDP D EKV+Q+A+ ++A IK VLTTHHH  H
Sbjct  1     MKISHVPCLEDN-YSYLIIDESTGDAAVVDPVDPEKVIQSAEQHSANIKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKMK++VPG++VYGG+LD V+GCT  V +GDT++LG    I  L TPCHT GHISY
Sbjct  60    AGGNEKMKQLVPGIKVYGGSLDKVKGCTDAVDNGDTLSLGHDVNILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ K+G  PAVFTGDTLF  GCGKFFEGTAEQM++SLC TLA+LPK T VYC HEYTVK
Sbjct  120   YVTGKDGETPAVFTGDTLFVAGCGKFFEGTAEQMHQSLCVTLASLPKPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NLEF  T+EP+N ++++KL WARQQR+ NLPTIPST+E+ELETNPF+RV  P+IQ+KL  
Sbjct  180   NLEFALTVEPNNEKIQQKLSWARQQRQANLPTIPSTLEEELETNPFMRVTNPEIQEKLGC  239

Query  306   KSPVEALKKLRQLKDK  259
             KSP++ L+++R  KD+
Sbjct  240   KSPIDTLREIRNKKDQ  255



>ref|XP_006371323.1| Hydroxyacylglutathione hydrolase cytoplasmic family protein [Populus 
trichocarpa]
 gb|ERP49120.1| Hydroxyacylglutathione hydrolase cytoplasmic family protein [Populus 
trichocarpa]
Length=258

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 210/255 (82%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI+ V C ED+ YSYLIIDEST+EAA VDP + EK++ AA+ +   +K+VLTTHHH  H
Sbjct  1     MKILHVPCLEDN-YSYLIIDESTKEAAVVDPVEPEKLVNAANEHGLHLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+KEMVPG++VYGG+LD+V+GCT+ V++GD ++LGA   I  L TPCHT GHISY
Sbjct  60    AGGNEKIKEMVPGIKVYGGSLDNVKGCTNKVENGDKVSLGADVNILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTGKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPD+V+++EKL WA++QR+  LPTIPSTIE+E+ETNPF+R +LP +Q K+  
Sbjct  180   NLQFALTVEPDSVKIQEKLSWAQKQRRAGLPTIPSTIEEEMETNPFMRAELPDVQAKVGC  239

Query  306   KSPVEALKKLRQLKD  262
              SPVEAL+K+R +KD
Sbjct  240   HSPVEALRKIRLMKD  254



>ref|XP_008375337.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Malus 
domestica]
Length=299

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 212/255 (83%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C ED+ YSYLI+DEST+EAA VDP + EKVL+AA  +  ++K+VLTTHHH  H
Sbjct  1     MKIHHVACLEDN-YSYLIVDESTKEAAVVDPVEPEKVLKAAQEHGVDVKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             +GGNEK+K++VPG++VYGG++D+V+GCT  V++GD I+LGA   I CL TPCHT GHISY
Sbjct  60    SGGNEKIKQLVPGIKVYGGSIDNVKGCTDKVENGDKISLGADVHILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKEG  PAVFTGDTLF  GCGKFFEGTAEQM++SLC TLA+LPK T VYC HEYTVK
Sbjct  120   YVTSKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMHQSLCVTLASLPKPTXVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN ++K+KL WA+QQR+  LPT PSTIE+E+ETNPF+R DLP++Q+++  
Sbjct  180   NLQFAQTVEPDNAKIKQKLSWAQQQREAGLPTXPSTIEEEMETNPFIRADLPELQERVGC  239

Query  306   KSPVEALKKLRQLKD  262
             K+ VEAL+++RQ KD
Sbjct  240   KTAVEALREIRQRKD  254



>ref|XP_011084787.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Sesamum 
indicum]
Length=258

 Score =   359 bits (922),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 210/256 (82%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             M+I+ + C ED+ YSY+IIDE+T+EAA VDP +  K+L+ A  N  ++K+VLTTHHH  H
Sbjct  1     MQILHIPCLEDN-YSYMIIDEATKEAAVVDPVEPHKILRVAQENGVDLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+K+K++VP ++++GG++D+V+GCT+ V++GD ++LG    I CL TPCHT GHISY
Sbjct  60    AGGNDKIKQLVPQIKIFGGSVDNVQGCTNKVENGDKLSLGTGIDILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTGKEGDDPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCVTLGSLPKPTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F ST+EPDNVR+ +KL WA Q+R   LPT+PSTIE+ELETNPF+RVDLP++Q+K+  
Sbjct  180   NLQFASTVEPDNVRISQKLSWAEQKRHTGLPTVPSTIEEELETNPFMRVDLPEVQEKVGC  239

Query  306   KSPVEALKKLRQLKDK  259
             +SPVEAL+++RQ KD 
Sbjct  240   RSPVEALREIRQRKDN  255



>ref|XP_007011400.1| Metallo-hydrolase/oxidoreductase superfamily protein [Theobroma 
cacao]
 gb|EOY20210.1| Metallo-hydrolase/oxidoreductase superfamily protein [Theobroma 
cacao]
Length=258

 Score =   358 bits (919),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 163/256 (64%), Positives = 210/256 (82%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI+ V C ED+ YSYLIIDEST+EAAAVDPA+ +KV++AA+     +K+VLTTHHH  H
Sbjct  1     MKILEVPCLEDN-YSYLIIDESTKEAAAVDPAEPQKVVEAANQQGVVLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+K+KE+VPG++VYGG+LD+V+GCT  +Q+GD + L ++  +  L TPCHT GHISY
Sbjct  60    AGGNDKIKELVPGIKVYGGSLDNVKGCTDQLQNGDNLQLSSHINVLSLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK T V+C HEYTVK
Sbjct  120   YVTGKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTRVFCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EP N R+++KL WA  QR+  LPTIPSTIE+ELETNPF+RVDLP++Q ++  
Sbjct  180   NLQFALTVEPKNARIQQKLAWATSQRQAGLPTIPSTIEEELETNPFMRVDLPELQGRIGC  239

Query  306   KSPVEALKKLRQLKDK  259
             +SPVEAL+++R++KD 
Sbjct  240   QSPVEALREIRRMKDN  255



>ref|XP_010999633.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Populus 
euphratica]
Length=258

 Score =   358 bits (918),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 206/255 (81%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C ED+ YSYLIIDEST+EAA VDP + EK++ AA+ +   +K+VLTTHHH  H
Sbjct  1     MKIFHVPCLEDN-YSYLIIDESTKEAAVVDPVEPEKLVNAANEHGLHLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+KEMVPG++VYGG+LD+V+GCT  V +GD ++LGA   I  L TPCHT GHISY
Sbjct  60    AGGNEKIKEMVPGIKVYGGSLDNVKGCTDKVGNGDKVSLGADVNILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTGKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDNV+++EKL WA++Q +  LPTIPSTIE+E+ETNPF+R +LP +Q K+  
Sbjct  180   NLQFALTVEPDNVKIQEKLSWAQKQHRAGLPTIPSTIEEEMETNPFMRAELPDVQAKVGC  239

Query  306   KSPVEALKKLRQLKD  262
              SPVEAL+K+R +KD
Sbjct  240   HSPVEALRKIRLMKD  254



>ref|XP_010109176.1| Hydroxyacylglutathione hydrolase cytoplasmic [Morus notabilis]
 gb|EXC21105.1| Hydroxyacylglutathione hydrolase cytoplasmic [Morus notabilis]
Length=258

 Score =   357 bits (917),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 207/255 (81%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C ED+ YSYLIIDEST+EAA VDP + EKV+  A  +   +K+VLTTHHH  H
Sbjct  1     MKIHYVPCLEDN-YSYLIIDESTKEAAVVDPVEPEKVVGVAQQHGVLLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+K++VPG++VYGG+ D+V+GCT  V++GD I+LGA   I  L TPCHT GH+SY
Sbjct  60    AGGNEKLKQLVPGIKVYGGSKDNVKGCTDSVENGDKISLGADVNILSLHTPCHTKGHVSY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKEG  PAVFTGDTLF  GCGKFFEGTAEQM++SLC TLA+LPK T VYC HEYTVK
Sbjct  120   YVTSKEGEDPAVFTGDTLFVAGCGKFFEGTAEQMHQSLCVTLASLPKPTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN R+++KL WA+QQR+  LPTIPSTIE+ELETNPF+RVDLP IQ K+  
Sbjct  180   NLQFALTVEPDNARIQQKLSWAQQQRQAGLPTIPSTIEEELETNPFMRVDLPDIQKKVGC  239

Query  306   KSPVEALKKLRQLKD  262
              S VEA++++R+LKD
Sbjct  240   HSAVEAIREIRRLKD  254



>emb|CBI25515.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   357 bits (916),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 164/256 (64%), Positives = 210/256 (82%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKIVPV C ED+ YSYLIIDES++EAA VDP + +KVLQAA      +K+VLTTHHH  H
Sbjct  1     MKIVPVPCLEDN-YSYLIIDESSKEAAVVDPVEPQKVLQAAYEYGVHLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+K++VPG+ VYGG++D+V+GCTH +Q+GD ++LG+   +  L TPCHT GHISY
Sbjct  60    AGGNEKIKQLVPGIEVYGGSVDNVKGCTHPLQNGDKLSLGSDLAVLALHTPCHTRGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KE   PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TLA+LPK T VYC HEYTVK
Sbjct  120   YVTGKEEDVPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCVTLASLPKPTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDNVRV +KL WA+ QR+  LPTIPSTI++E+ETNPF+RVDLP++Q+++  
Sbjct  180   NLQFALTVEPDNVRVGQKLSWAQHQRQAGLPTIPSTIDEEMETNPFMRVDLPELQERVGC  239

Query  306   KSPVEALKKLRQLKDK  259
             +S ++AL+++R+ KD 
Sbjct  240   QSAIDALQEIRRQKDN  255



>ref|XP_010491593.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Camelina 
sativa]
Length=258

 Score =   356 bits (913),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/256 (65%), Positives = 205/256 (80%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C ED+ YSYLIIDEST +AA VDP D EKV+ +A+ +  +IK VLTTHHH  H
Sbjct  1     MKIFHVPCLEDN-YSYLIIDESTGDAAVVDPVDPEKVIASAEQHQVKIKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+K++VPG++VYGG+LD V+GCT  V +GD ++LG    I  L TPCHT GHISY
Sbjct  60    AGGNEKIKQLVPGIKVYGGSLDKVKGCTDAVDNGDKLSLGQDVNILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQM++SLC TLAALPK T VYC HEYTVK
Sbjct  120   YVTGKEGENPAVFTGDTLFVAGCGKFFEGTAEQMHQSLCVTLAALPKPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NLEF  T+EP+N ++++KL WARQQR+ NLPTIPST+E+ELETNPF+RVD P+IQ+KL  
Sbjct  180   NLEFALTVEPNNEKIQQKLSWARQQRQANLPTIPSTLEEELETNPFMRVDKPEIQEKLGC  239

Query  306   KSPVEALKKLRQLKDK  259
              SP + L+++R  KD+
Sbjct  240   NSPTDTLREIRNKKDQ  255



>ref|XP_002267471.2| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Vitis 
vinifera]
Length=281

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 164/256 (64%), Positives = 210/256 (82%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKIVPV C ED+ YSYLIIDES++EAA VDP + +KVLQAA      +K+VLTTHHH  H
Sbjct  24    MKIVPVPCLEDN-YSYLIIDESSKEAAVVDPVEPQKVLQAAYEYGVHLKLVLTTHHHWDH  82

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+K++VPG+ VYGG++D+V+GCTH +Q+GD ++LG+   +  L TPCHT GHISY
Sbjct  83    AGGNEKIKQLVPGIEVYGGSVDNVKGCTHPLQNGDKLSLGSDLAVLALHTPCHTRGHISY  142

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KE   PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TLA+LPK T VYC HEYTVK
Sbjct  143   YVTGKEEDVPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCVTLASLPKPTRVYCGHEYTVK  202

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDNVRV +KL WA+ QR+  LPTIPSTI++E+ETNPF+RVDLP++Q+++  
Sbjct  203   NLQFALTVEPDNVRVGQKLSWAQHQRQAGLPTIPSTIDEEMETNPFMRVDLPELQERVGC  262

Query  306   KSPVEALKKLRQLKDK  259
             +S ++AL+++R+ KD 
Sbjct  263   QSAIDALQEIRRQKDN  278



>ref|XP_002520895.1| hydroxyacylglutathione hydrolase, putative [Ricinus communis]
 gb|EEF41604.1| hydroxyacylglutathione hydrolase, putative [Ricinus communis]
Length=258

 Score =   355 bits (911),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 209/255 (82%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C ED+ Y+YLIIDE+T+EAA VDP D +K+LQAA+ + A +K++LTTHHH  H
Sbjct  1     MKIYEVPCLEDN-YAYLIIDEATKEAAVVDPVDPDKILQAANHHGAHLKLLLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN KMKE+ PG+++ GG+LD+V+GCTH + +GD + LG++  I  L TPCHT GHISY
Sbjct  60    AGGNVKMKELFPGIQICGGSLDNVKGCTHQLDNGDKLTLGSHVNILSLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK T VYC HEYT+K
Sbjct  120   YVTGKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTKVYCGHEYTLK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDNV++++KL+WA++QR+  LPTIPSTIE+E ETNPF+R DLP+++ ++  
Sbjct  180   NLQFAQTVEPDNVKIQQKLQWAQKQRQAGLPTIPSTIEEEWETNPFMRADLPELKARVGC  239

Query  306   KSPVEALKKLRQLKD  262
             +SPVE L+K+RQLKD
Sbjct  240   ESPVETLQKIRQLKD  254



>gb|KFK38474.1| hypothetical protein AALP_AA3G117500 [Arabis alpina]
Length=258

 Score =   355 bits (911),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 164/256 (64%), Positives = 208/256 (81%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C +D+ YSYL+IDEST +AA VDP + EKV+ AA+ ++A+IK VLTTHHH  H
Sbjct  1     MKIFHVPCLQDN-YSYLLIDESTGDAAVVDPVNPEKVIAAAEQHSAKIKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             + GNEKMKE+VPG++VYGG++D V+GCT  V +GD ++LG    I  L TPCHT GHISY
Sbjct  60    SSGNEKMKELVPGIKVYGGSIDKVKGCTDEVDNGDKLSLGQNVNILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQM++SLC TLA+LPK T VYC HEYTVK
Sbjct  120   YVTGKEGESPAVFTGDTLFVAGCGKFFEGTAEQMHQSLCVTLASLPKPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NLEF  T+EP+N ++++KL WARQQR+ NLPTIPST+E+ELETNPF+RVD P+IQ+KL  
Sbjct  180   NLEFALTVEPNNEKIQQKLSWARQQRQANLPTIPSTLEEELETNPFMRVDNPEIQEKLGC  239

Query  306   KSPVEALKKLRQLKDK  259
             KSP++ ++++R  KD+
Sbjct  240   KSPIDTMREVRNKKDQ  255



>ref|XP_010464773.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like 
isoform X2 [Camelina sativa]
Length=258

 Score =   355 bits (911),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 167/256 (65%), Positives = 205/256 (80%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C  DD YSYLIIDEST +AA VDP D EKV+ +A+ +  +IK VLTTHHH  H
Sbjct  1     MKIFHVPCL-DDNYSYLIIDESTGDAAVVDPVDPEKVIASAEEHQVKIKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+K++VPG++VYGG+LD V+GCT  V +GD ++LG    I  L TPCHT GHISY
Sbjct  60    AGGNEKIKQLVPGIKVYGGSLDKVKGCTDAVDNGDKLSLGQDVNICALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ K G  PAVFTGDTLF  GCGKFFEGTAEQM++SLC TLAALPK T VYC HEYTVK
Sbjct  120   YVTGKVGETPAVFTGDTLFVAGCGKFFEGTAEQMHQSLCVTLAALPKPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NLEF  T+EP+N ++++KL WARQQR+ NLPTIPST+E+ELETNPF+RVD P+IQ+KL  
Sbjct  180   NLEFALTVEPNNEKIQQKLSWARQQRQANLPTIPSTLEEELETNPFMRVDKPEIQEKLGC  239

Query  306   KSPVEALKKLRQLKDK  259
             KSP++ L+++R  KD+
Sbjct  240   KSPIDTLREIRNKKDQ  255



>gb|ABB29955.1| hydroxyacylglutathione hydrolase cytoplasmic-like [Solanum tuberosum]
Length=258

 Score =   355 bits (910),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 206/255 (81%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK++ + C  DD YSY+IIDE+T+EAA VDP +  KVL+ A  N  ++K VLTTHHH  H
Sbjct  1     MKVLHIPCL-DDNYSYMIIDETTKEAAVVDPVEPHKVLRVAQENEVDLKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+K+K++VPG+++YGG++D+V GCT  V++GD I+LG   +I  L TP HT GHISY
Sbjct  60    AGGNDKIKQLVPGIKIYGGSVDNVRGCTDKVENGDRISLGVDISILSLHTPAHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK TLVYC HEYTVK
Sbjct  120   YVTDKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTLVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN ++ +KL WA +QR+  LPTIPSTI++ELE+NPF+RVDLP++QDK+  
Sbjct  180   NLQFALTVEPDNAKIAQKLAWAERQRRVGLPTIPSTIQEELESNPFMRVDLPEVQDKVGC  239

Query  306   KSPVEALKKLRQLKD  262
             KSPVEA++++RQ KD
Sbjct  240   KSPVEAMREIRQRKD  254



>ref|XP_006357301.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like 
[Solanum tuberosum]
 gb|ABA46778.1| unknown [Solanum tuberosum]
Length=258

 Score =   355 bits (910),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 206/255 (81%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK++ + C  DD YSY+IIDE+T+EAA VDP +  KVL+ A  N  ++K VLTTHHH  H
Sbjct  1     MKVLHIPCL-DDNYSYMIIDETTKEAAVVDPVEPHKVLRVAQENEVDLKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+K+K++VPG+++YGG++D+V GCT  V++GD I+LG   +I  L TP HT GHISY
Sbjct  60    AGGNDKIKQLVPGIKIYGGSVDNVRGCTDKVENGDRISLGVDISILSLHTPAHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK TLVYC HEYTVK
Sbjct  120   YVTDKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTLVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN ++ +KL WA +QR+  LPTIPSTI++ELE+NPF+RVDLP++QDK+  
Sbjct  180   NLQFALTVEPDNAKIAQKLAWAERQRRVGLPTIPSTIQEELESNPFMRVDLPEVQDKVGC  239

Query  306   KSPVEALKKLRQLKD  262
             KSPVEA++++RQ KD
Sbjct  240   KSPVEAMREIRQRKD  254



>ref|XP_010228670.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic isoform 
X1 [Brachypodium distachyon]
Length=267

 Score =   355 bits (910),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 169/267 (63%), Positives = 208/267 (78%), Gaps = 1/267 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKIVPV C ED+ YSYLI+DEST+ AAAVDP + EKVL AA    A +  +LTTHHH  H
Sbjct  1     MKIVPVACLEDN-YSYLIVDESTKAAAAVDPVEPEKVLAAASEVGAYVDCILTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKM+ +VPG++VYGG++D+V+GCT+ V++G  ++LG  T I CL TPCHT GHISY
Sbjct  60    AGGNEKMRLLVPGIKVYGGSMDNVKGCTNQVENGTKLSLGKDTEILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKE   PAVFTGDTLF  GCG+FFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTSKEEEDPAVFTGDTLFIAGCGRFFEGTAEQMYQSLCVTLGSLPKSTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EP+N +VK+KLEWA++QR+ N PT+PSTI DE E N F+RVDLP++Q K  +
Sbjct  180   NLQFVLTVEPENEKVKQKLEWAQKQRQANQPTVPSTIRDEFEINTFMRVDLPEVQAKFGA  239

Query  306   KSPVEALKKLRQLKDKNLS*IYDERWK  226
             KSPVEAL+ +R  KD     IY  R K
Sbjct  240   KSPVEALRTVRNTKDTWKGGIYSCRAK  266



>ref|XP_009781128.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Nicotiana 
sylvestris]
Length=258

 Score =   354 bits (909),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 204/255 (80%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK++ + C  DD YSY+IIDE+T+EAA VDP +  KVL+ A  N  ++K VLTTHHH  H
Sbjct  1     MKVLHIPCL-DDNYSYMIIDETTKEAAVVDPVEPHKVLRVAQENEVDLKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+KMK++VPG+++YGG++D+V GCT  V++GD I+LGA  +I  L TP HT GHISY
Sbjct  60    AGGNDKMKQLVPGIKIYGGSVDNVRGCTDKVENGDKISLGADISILSLHTPSHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTGKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN ++ +KL WA  QR+  LPTIPSTIE+E+ETNPF+R DLP++Q+K+  
Sbjct  180   NLQFALTVEPDNAKIAQKLAWAEHQRRVGLPTIPSTIEEEMETNPFMRADLPEVQEKVGF  239

Query  306   KSPVEALKKLRQLKD  262
             KSPVEAL+++RQ KD
Sbjct  240   KSPVEALREIRQRKD  254



>ref|XP_010228672.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic isoform 
X3 [Brachypodium distachyon]
Length=258

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 204/255 (80%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKIVPV C ED+ YSYLI+DEST+ AAAVDP + EKVL AA    A +  +LTTHHH  H
Sbjct  1     MKIVPVACLEDN-YSYLIVDESTKAAAAVDPVEPEKVLAAASEVGAYVDCILTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKM+ +VPG++VYGG++D+V+GCT+ V++G  ++LG  T I CL TPCHT GHISY
Sbjct  60    AGGNEKMRLLVPGIKVYGGSMDNVKGCTNQVENGTKLSLGKDTEILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKE   PAVFTGDTLF  GCG+FFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTSKEEEDPAVFTGDTLFIAGCGRFFEGTAEQMYQSLCVTLGSLPKSTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EP+N +VK+KLEWA++QR+ N PT+PSTI DE E N F+RVDLP++Q K  +
Sbjct  180   NLQFVLTVEPENEKVKQKLEWAQKQRQANQPTVPSTIRDEFEINTFMRVDLPEVQAKFGA  239

Query  306   KSPVEALKKLRQLKD  262
             KSPVEAL+ +R  KD
Sbjct  240   KSPVEALRTVRNTKD  254



>ref|NP_187696.1| hydroxyacylglutathione hydrolase [Arabidopsis thaliana]
 sp|O24496.2|GLO2C_ARATH RecName: Full=Hydroxyacylglutathione hydrolase cytoplasmic; AltName: 
Full=Glyoxalase II; Short=Glx II [Arabidopsis thaliana]
 gb|AAF19564.1|AC011708_7 hydroxyacylglutathione hydrolase cytoplasmic (glyoxalase II) 
(GLX II) [Arabidopsis thaliana]
 emb|CAA69644.1| hydroxyacylglutathione hydrolase [Arabidopsis thaliana]
 gb|AAK96522.1| AT3g10850/T7M13_7 [Arabidopsis thaliana]
 gb|AAN38686.1| At3g10850/T7M13_7 [Arabidopsis thaliana]
 dbj|BAF00463.1| hydroxyacylglutathione hydrolase cytoplasmic [Arabidopsis thaliana]
 gb|AEE74963.1| hydroxyacylglutathione hydrolase [Arabidopsis thaliana]
Length=258

 Score =   353 bits (907),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/256 (65%), Positives = 206/256 (80%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C +D+ YSYLIIDEST +AA VDP D EKV+ +A+ + A+IK VLTTHHH  H
Sbjct  1     MKIFHVPCLQDN-YSYLIIDESTGDAAVVDPVDPEKVIASAEKHQAKIKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+K++VP ++VYGG+LD V+GCT  V +GD + LG    I  L TPCHT GHISY
Sbjct  60    AGGNEKIKQLVPDIKVYGGSLDKVKGCTDAVDNGDKLTLGQDINILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TLAALPK T VYC HEYTVK
Sbjct  120   YVNGKEGENPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCVTLAALPKPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NLEF  T+EP+N ++++KL WARQQR+ +LPTIPST+E+ELETNPF+RVD P+IQ+KL  
Sbjct  180   NLEFALTVEPNNGKIQQKLAWARQQRQADLPTIPSTLEEELETNPFMRVDKPEIQEKLGC  239

Query  306   KSPVEALKKLRQLKDK  259
             KSP++ ++++R  KD+
Sbjct  240   KSPIDTMREVRNKKDQ  255



>ref|XP_006298374.1| hypothetical protein CARUB_v10014444mg [Capsella rubella]
 gb|EOA31272.1| hypothetical protein CARUB_v10014444mg [Capsella rubella]
Length=258

 Score =   353 bits (905),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 164/256 (64%), Positives = 205/256 (80%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C +D+ YSYLIIDE+T +AA VDP D EK++ +A+ +  +IK VLTTHHH  H
Sbjct  1     MKIFHVPCLQDN-YSYLIIDETTGDAAVVDPVDPEKLIASAEQHQVKIKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+K++VPG++VYGG+LD V+GCT  V +GD ++LG    I  L TPCHT GHISY
Sbjct  60    AGGNEKIKQLVPGIKVYGGSLDKVKGCTDAVDNGDKVSLGQDVNILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
              V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQM++SLC TLAALPK T VYC HEYTVK
Sbjct  120   HVTGKEGETPAVFTGDTLFVAGCGKFFEGTAEQMHQSLCLTLAALPKTTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NLEF  T+EP+N ++++KL WARQQR+ NLPTIPST+E+ELETNPF+R D P+IQ+KL  
Sbjct  180   NLEFALTVEPNNEKIQQKLSWARQQRQANLPTIPSTLEEELETNPFMRADKPEIQEKLGC  239

Query  306   KSPVEALKKLRQLKDK  259
             KSP++ L+++R  KD+
Sbjct  240   KSPIDTLREIRNKKDQ  255



>ref|XP_010486705.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like 
[Camelina sativa]
Length=258

 Score =   352 bits (904),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/256 (65%), Positives = 205/256 (80%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C ED+ YSYLIIDEST +AA VDP D EKV+ +A+ +  +IK VLTTHHH  H
Sbjct  1     MKIFHVPCLEDN-YSYLIIDESTGDAAVVDPVDPEKVIASAEEHQVKIKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+K +VPG++VYGG+LD V+GCT  V DGD ++LG    I  L T CHT GHISY
Sbjct  60    AGGNEKIKLLVPGIKVYGGSLDKVKGCTDAVDDGDKLSLGQDVNILALHTSCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQM++SLC TLAALPK T VYC HEYTVK
Sbjct  120   YVTCKEGENPAVFTGDTLFVAGCGKFFEGTAEQMHQSLCVTLAALPKPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NLEF  T+EP+N ++++KL WARQQR+ NLPTIPST+E+EL+TNPF+RVD P+IQ+KL  
Sbjct  180   NLEFALTVEPNNEKIQQKLSWARQQRQENLPTIPSTLEEELKTNPFMRVDKPEIQEKLGC  239

Query  306   KSPVEALKKLRQLKDK  259
             KSP++ L+++R  KD+
Sbjct  240   KSPIDTLREIRNKKDQ  255



>ref|XP_009146800.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Brassica 
rapa]
Length=258

 Score =   352 bits (904),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 164/256 (64%), Positives = 208/256 (81%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C ED+ YSYLIIDEST +AA VDP + EKV+++A+ ++A IK VLTTHHH  H
Sbjct  1     MKISHVPCLEDN-YSYLIIDESTGDAAVVDPVEPEKVIKSAEQHSANIKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKMK++V G++VYGG+LD V+GCT  V +GDT++LG    I  L TPCHT GHISY
Sbjct  60    AGGNEKMKQLVSGIKVYGGSLDKVKGCTDAVDNGDTLSLGQNINILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ K+G  PAVFTGDTLF  GCG+ FEGTAEQM++SLC TLA+LPK T VYC HEYTVK
Sbjct  120   YVTGKDGETPAVFTGDTLFVAGCGEVFEGTAEQMHQSLCVTLASLPKPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NLEF  T+EP+N ++++KL WARQQR+ NLPTIPST+E+ELETNPF+RV+ P+IQ+KL  
Sbjct  180   NLEFALTVEPNNEKIQQKLSWARQQRQANLPTIPSTLEEELETNPFMRVNNPEIQEKLGC  239

Query  306   KSPVEALKKLRQLKDK  259
             KSP++ L+++R  KD+
Sbjct  240   KSPIDTLREIRNKKDQ  255



>ref|XP_007141335.1| hypothetical protein PHAVU_008G187100g [Phaseolus vulgaris]
 gb|AGV54469.1| hydroxyacylglutathione hydrolase [Phaseolus vulgaris]
 gb|ESW13329.1| hypothetical protein PHAVU_008G187100g [Phaseolus vulgaris]
Length=258

 Score =   352 bits (903),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 208/255 (82%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  + C ED+ YSYLI+DEST+EAAAVDP + EK+L+AA+++   +K+VLTTHHH  H
Sbjct  1     MKIQHIPCLEDN-YSYLIVDESTKEAAAVDPVEPEKILEAANSHGLTLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+K++VPG++VYGG++D+V+GCT  V++GD ++LGA  TI  L TPCHT GHISY
Sbjct  60    AGGNEKIKQLVPGIKVYGGSIDNVKGCTDKVENGDKVSLGADVTILALHTPCHTQGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KE   PAVFTGDTLF   CGKFFEGTAEQMY+SL  TLA+LPK T VYC HEY+VK
Sbjct  120   YVTGKEDEHPAVFTGDTLFIASCGKFFEGTAEQMYQSLNVTLASLPKTTRVYCGHEYSVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN R ++KL WA+ QR+    T+PSTIEDELETNPF+RVDLP+IQ+K+  
Sbjct  180   NLQFALTLEPDNSRTQQKLTWAQNQRQAGQATVPSTIEDELETNPFMRVDLPEIQEKVGC  239

Query  306   KSPVEALKKLRQLKD  262
             KSPVEAL ++R+ KD
Sbjct  240   KSPVEALGEIRKKKD  254



>ref|XP_008456973.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Cucumis 
melo]
Length=258

 Score =   351 bits (901),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/255 (64%), Positives = 206/255 (81%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  ++C ED+ YSYLIIDEST+EAA VDP + EK++  A+ +   +K+VLTTHHH  H
Sbjct  1     MKIHYIRCLEDN-YSYLIIDESTKEAAVVDPVEPEKIVNVANEHGVHLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             +GGNEK+K++VPG++VYGG++D V+ CT  V++GD IALGA   I  L TPCHT GHISY
Sbjct  60    SGGNEKIKQLVPGIKVYGGSIDKVKACTDAVENGDKIALGADVVILSLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +VS KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVSGKEGEDPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCVTLGSLPKQTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN ++K KL WA+ QR+    T+PSTIE+E+ETNPF+RVDLP+IQ+K+ +
Sbjct  180   NLQFALTVEPDNEKIKGKLLWAQGQRQAGQATVPSTIEEEMETNPFMRVDLPQIQEKVGN  239

Query  306   KSPVEALKKLRQLKD  262
              SPVEA++++R+LKD
Sbjct  240   HSPVEAIREIRRLKD  254



>ref|XP_003615463.1| Hydroxyacylglutathione hydrolase [Medicago truncatula]
 gb|AES98421.1| hydroxyacylglutathione hydrolase [Medicago truncatula]
Length=258

 Score =   351 bits (901),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/256 (65%), Positives = 205/256 (80%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C ED+ YSYLI+DEST+EAAAVDP + EKVL+A+++    IK VLTTHHH  H
Sbjct  1     MKIYHVPCLEDN-YSYLIVDESTKEAAAVDPVEPEKVLEASNSLGLTIKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+KE+VPG++VYGG++D+V+GCT+ +++GD + LGA   I  L TPCHT GHISY
Sbjct  60    AGGNEKIKELVPGIKVYGGSIDNVKGCTNALENGDKVHLGADINILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KE   PAVFTGDTLF  GCGKFFEGTAEQMY+SL  TL +LPK T VYC HEY+VK
Sbjct  120   YVTGKEDEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLSVTLGSLPKPTRVYCGHEYSVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN+R+ EKL WA+ QR+   PTIPSTI DELE+NPF+RVDLP IQ+K+  
Sbjct  180   NLQFALTVEPDNLRILEKLTWAQNQRQTGQPTIPSTIGDELESNPFMRVDLPAIQEKMGF  239

Query  306   KSPVEALKKLRQLKDK  259
              SPVEAL +LR++KD 
Sbjct  240   NSPVEALGELRKVKDN  255



>gb|KDP21620.1| hypothetical protein JCGZ_03291 [Jatropha curcas]
Length=258

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/256 (63%), Positives = 201/256 (79%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  + C ED+ Y+YLIIDE T+EAA VDP + +K+LQ A+ +   +K VLTTHHH  H
Sbjct  1     MKIFHIPCLEDN-YAYLIIDEGTKEAAVVDPVEPDKILQTANQHGVNLKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNE MK+ VPG+ V GG++D+V+GCT  + +GD I LG+ T I  L TPCHT GHISY
Sbjct  60    AGGNETMKQRVPGIEVCGGSIDNVKGCTRKLDNGDKITLGSTTNILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             + S  EG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YASGNEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCLTLGSLPKPTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EP+NV++++KL WA+QQR+  LPTIPSTIEDELETNPF+RVDLP IQ ++  
Sbjct  180   NLQFALTVEPENVKIQQKLSWAQQQRQEGLPTIPSTIEDELETNPFMRVDLPDIQARMGC  239

Query  306   KSPVEALKKLRQLKDK  259
             +SPV+ ++K+RQLKD 
Sbjct  240   QSPVQTIQKIRQLKDN  255



>ref|XP_004490514.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like 
[Cicer arietinum]
Length=258

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 206/255 (81%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  + C ED+ YSYLI++EST+EAAAVDP + EKVL+A+++    +K VLTTHHH  H
Sbjct  1     MKIYHIPCLEDN-YSYLIVNESTKEAAAVDPVEPEKVLEASNSYGLTLKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+K+KE+VPG++VYGG+LD+V+GCT  V++GD + LGA  T+  L TPCHT GHISY
Sbjct  60    AGGNDKIKELVPGIKVYGGSLDNVKGCTDAVENGDKVHLGADITVLALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KE   PAVFTGDTLF  GCGKFFEGTAEQMY+SL  TL +LPK T VYC HEYT K
Sbjct  120   YVTGKEDEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLNVTLGSLPKPTRVYCGHEYTAK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN+++ +KL WA+ QR+   PTIPSTIEDELETNPF+RVDL  IQ+K+ S
Sbjct  180   NLQFALTVEPDNLKILQKLTWAQNQRQVGQPTIPSTIEDELETNPFMRVDLHAIQEKMGS  239

Query  306   KSPVEALKKLRQLKD  262
             KSPV+AL +LR+LKD
Sbjct  240   KSPVQALGELRKLKD  254



>ref|XP_006407499.1| hypothetical protein EUTSA_v10021361mg [Eutrema salsugineum]
 dbj|BAJ34075.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48952.1| hypothetical protein EUTSA_v10021361mg [Eutrema salsugineum]
Length=258

 Score =   350 bits (899),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/256 (65%), Positives = 205/256 (80%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             M+I  V C +D+ YSYLIIDEST +AA VDP D EKV+ +A  + A IK VLTTHHH  H
Sbjct  1     MEIFHVPCLQDN-YSYLIIDESTGDAAVVDPVDPEKVIISAQQHGANIKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKMKE+VPG++VYGG+LD V+GCT+ V +GD ++LG    I  L TPCHT GHISY
Sbjct  60    AGGNEKMKELVPGIKVYGGSLDKVKGCTNEVDNGDKLSLGHGVNILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ K+G  P VFTGDTLF  GCGKFFEGTAEQM++SLC TLA+LPK T VYC HEYTVK
Sbjct  120   YVTCKDGENPTVFTGDTLFVAGCGKFFEGTAEQMHQSLCVTLASLPKPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NLEF  T+EP+N ++++KL WA QQR+ NLPTIPSTIE+ELETNPF+RVD P+IQ+KL  
Sbjct  180   NLEFALTVEPNNEKIQQKLSWACQQRQENLPTIPSTIEEELETNPFMRVDNPEIQEKLGC  239

Query  306   KSPVEALKKLRQLKDK  259
             KSP++ L+++R  KD+
Sbjct  240   KSPIDTLREIRNKKDQ  255



>ref|NP_001050016.1| Os03g0332400 [Oryza sativa Japonica Group]
 gb|ABF95772.1| Hydroxyacylglutathione hydrolase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11930.1| Os03g0332400 [Oryza sativa Japonica Group]
 dbj|BAG95927.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75188.1| hypothetical protein OsI_11422 [Oryza sativa Indica Group]
 gb|EEE59001.1| hypothetical protein OsJ_10718 [Oryza sativa Japonica Group]
Length=258

 Score =   350 bits (899),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 203/255 (80%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI+PV C ED+ Y+YLI+DEST+ AAAVDP + EKVL AA      I  VLTTHHH  H
Sbjct  1     MKIIPVACLEDN-YAYLIVDESTKSAAAVDPVEPEKVLAAAAEVGVRIDCVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKM + VPG++VYGG+LD+V+GCT  V++G  ++LG    I CL TPCHT GHISY
Sbjct  60    AGGNEKMAQSVPGIKVYGGSLDNVKGCTDQVENGTKLSLGKDIEILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKE   PAVFTGDTLF  GCG+FFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTSKEEEDPAVFTGDTLFIAGCGRFFEGTAEQMYQSLCVTLGSLPKPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN +VK+KLEWA++QR+ N PTIPSTI +E ETN F+RVDLP+IQ K  +
Sbjct  180   NLKFILTVEPDNEKVKQKLEWAQKQREANQPTIPSTIGEEFETNTFMRVDLPEIQAKFGA  239

Query  306   KSPVEALKKLRQLKD  262
             KSPVEAL+++R+ KD
Sbjct  240   KSPVEALREVRKTKD  254



>ref|XP_002884816.1| glyoxalase 2-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61075.1| glyoxalase 2-2 [Arabidopsis lyrata subsp. lyrata]
Length=258

 Score =   350 bits (898),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/256 (64%), Positives = 205/256 (80%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C +D+ YSYLIIDEST +AA VDP D EKV+ +A+ + A+IK VLTTHHH  H
Sbjct  1     MKIFHVPCLQDN-YSYLIIDESTGDAAVVDPVDPEKVIASAEQHQAKIKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+K++VP ++VYGG+LD V+GCT  V +GD + LG    I  L TPCHT GHISY
Sbjct  60    AGGNEKIKQLVPEIKVYGGSLDKVKGCTDAVDNGDKLTLGQDVNILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TLA+LPK T VYC HEYTVK
Sbjct  120   YVTGKEGENPAVFTGDTLFVAGCGKFFEGTAEQMYKSLCVTLASLPKPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NLEF  T+EP+N ++++KL WARQQR+ +L TIPST+E+ELETNPF+RVD P+IQ+KL  
Sbjct  180   NLEFALTVEPNNEKIQQKLAWARQQRQADLQTIPSTLEEELETNPFMRVDKPEIQEKLGC  239

Query  306   KSPVEALKKLRQLKDK  259
             KSP++ L+++R  KD+
Sbjct  240   KSPIDTLREVRNKKDQ  255



>ref|XP_010670038.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Beta 
vulgaris subsp. vulgaris]
Length=258

 Score =   350 bits (898),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 201/255 (79%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  + C ED+ YSYLIID+ST+EAA VDP + EKVL+ A  N A+IK+VLTTHHH  H
Sbjct  1     MKIFHIPCLEDN-YSYLIIDDSTKEAAVVDPVEPEKVLEVAKQNGADIKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+KMKE+VPG++V+GG++D+V+GCT  + +GD ++LGA   I  L TPCHT GHISY
Sbjct  60    AGGNDKMKELVPGIKVFGGSIDNVKGCTDKLDNGDKLSLGAEVNILSLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KE   PAVFTGDT+F  GCGKFFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTGKEDESPAVFTGDTMFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+E +N ++ EKL WA+ QR    PTIPSTI +ELETNPF+RVD  +IQ K  S
Sbjct  180   NLQFALTVESENAKIAEKLAWAQSQRNAGFPTIPSTIAEELETNPFMRVDTSEIQRKAGS  239

Query  306   KSPVEALKKLRQLKD  262
              SPVEAL+KLR+LKD
Sbjct  240   DSPVEALQKLRKLKD  254



>ref|XP_006842570.1| hypothetical protein AMTR_s00077p00150130 [Amborella trichopoda]
 gb|ERN04245.1| hypothetical protein AMTR_s00077p00150130 [Amborella trichopoda]
Length=258

 Score =   350 bits (898),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 204/255 (80%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI+ + C ED+ Y+YLI+DE TREAA VDP + EKVL+ A+A  A+IK+VLTTHHH  H
Sbjct  1     MKILHIPCLEDN-YAYLILDEKTREAAVVDPVEPEKVLKVAEAVHADIKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+K+KE+VPG++VYGGALD+V G T+ ++ GD ++ G+   +  L TPCHT GHISY
Sbjct  60    AGGNDKIKELVPGIKVYGGALDNVRGFTNKLESGDKLSFGSDVNVLALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             FV+SKE    AVFTGDTLF  GCGKFFEGTA+QMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   FVTSKEDDDQAVFTGDTLFVAGCGKFFEGTADQMYKSLCVTLGSLPKPTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EP+N R+++KL WA +QRK N PTIPSTIEDELETNPF+RVDLP++Q  L  
Sbjct  180   NLQFAKTVEPENERIEKKLAWAMEQRKANEPTIPSTIEDELETNPFMRVDLPQLQAHLGY  239

Query  306   KSPVEALKKLRQLKD  262
              SPVEAL +LRQ KD
Sbjct  240   SSPVEALTELRQKKD  254



>ref|XP_010558112.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Tarenaya 
hassleriana]
Length=258

 Score =   349 bits (896),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 208/255 (82%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             M+I  V C +D+ YSYLIIDES+ +AAAVDP + +KV+ AA+ + A+IK+VLTTHHH  H
Sbjct  1     MQIFHVPCLQDN-YSYLIIDESSGDAAAVDPVEPDKVIGAAEQHGAQIKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+K++VPG++VYGG+LD V+GCT  V +GD +ALG    I  L TPCHT GHISY
Sbjct  60    AGGNEKIKQLVPGIKVYGGSLDKVKGCTDTVDNGDNLALGVNLNILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEGG PAVFTGDTLF  GCG+FFEGTAEQM++SLC TLA+LPK T +YC HEYTVK
Sbjct  120   YVTDKEGGNPAVFTGDTLFIAGCGRFFEGTAEQMHQSLCVTLASLPKPTQIYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NLEF  T+EPDN ++ +KL WAR+Q +  LPTIPSTIE+ELETNPF+RVD P+IQ+K+  
Sbjct  180   NLEFALTVEPDNEKIHQKLSWARRQVQAGLPTIPSTIEEELETNPFMRVDNPEIQEKVGC  239

Query  306   KSPVEALKKLRQLKD  262
             ++ +E L+++R++KD
Sbjct  240   QTAIEVLREIRKMKD  254



>gb|AFK42856.1| unknown [Lotus japonicus]
Length=258

 Score =   349 bits (896),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 206/255 (81%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  + C ED+ YSYLI DEST+EAA VDP + EKVL+AA+ +   +K+VLTTHHH  H
Sbjct  1     MKIYHIPCLEDN-YSYLIEDESTKEAAVVDPVEPEKVLEAANLHGLTLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+KE+VPG++VYGG++D V+GCT  V++GD ++LGA  +I  L TPCHT GHISY
Sbjct  60    AGGNEKIKELVPGIKVYGGSIDKVKGCTDKVENGDKVSLGADISILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KE   PAVFTGDTLF   CGKFFEGTAEQMY+SLC TL +LPK T VYC HEY+VK
Sbjct  120   YVTGKEDEDPAVFTGDTLFIASCGKFFEGTAEQMYQSLCVTLGSLPKPTRVYCGHEYSVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  TIEP N++ ++KL WA+ QR+   PTIPSTIE+ELETNPF+R+DLP+IQ+K+  
Sbjct  180   NLQFALTIEPGNLKTQQKLTWAQNQRQAGQPTIPSTIEEELETNPFMRIDLPEIQEKVGF  239

Query  306   KSPVEALKKLRQLKD  262
             KSPVEAL +LR+LKD
Sbjct  240   KSPVEALGELRKLKD  254



>ref|XP_004240841.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Solanum 
lycopersicum]
Length=258

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/255 (62%), Positives = 204/255 (80%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK++ + C  DD YSY+IIDE+T+EAA VDP +  KVL+ A  N  ++K VLTTHHH  H
Sbjct  1     MKVLHIPCL-DDNYSYMIIDETTKEAAVVDPVEPHKVLRVAQENEVDLKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+K+K+++PG+++YGG++D+V GCT  V++GD ++LGA  +I  L TP HT GHISY
Sbjct  60    AGGNDKIKQLIPGIKIYGGSVDNVRGCTDKVENGDRVSLGADISILSLHTPAHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG   AVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTDKEGEDLAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN ++ EKL WA +QR+  LPTIPSTI++E E+NPF+RVDLP++QDK+  
Sbjct  180   NLQFALTVEPDNAKIAEKLAWAERQRRVGLPTIPSTIQEEFESNPFMRVDLPEVQDKVGC  239

Query  306   KSPVEALKKLRQLKD  262
             KSPVEA++++RQ KD
Sbjct  240   KSPVEAMREIRQRKD  254



>emb|CDP13879.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 204/255 (80%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI+ + C ED+ YSYL+I+E T+EAAAVDPA+  KV +AA  N   +K+VLTTHHH  H
Sbjct  1     MKILHIPCLEDN-YSYLVINEKTKEAAAVDPAEPHKVFRAAQENGVHLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+K+K++VPG++VYGG++D+V GCT+ V++GD I LG   +I CL TPCHT GHISY
Sbjct  60    AGGNDKIKQIVPGIKVYGGSVDNVRGCTNKVENGDRIPLGDEISILCLHTPCHTQGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ K+G  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LP  T V+C HEYT K
Sbjct  120   YVTGKDGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPNPTRVFCGHEYTEK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             N +F  T+EPDN ++++KL WA+QQR+  LPTIPSTI +ELETNPF+RVDLP +Q  +  
Sbjct  180   NFQFAITVEPDNEKIRQKLAWAQQQRRSGLPTIPSTIGEELETNPFMRVDLPDVQRMVGC  239

Query  306   KSPVEALKKLRQLKD  262
             KSPVEA++++RQ KD
Sbjct  240   KSPVEAIREIRQRKD  254



>gb|EYU35184.1| hypothetical protein MIMGU_mgv1a012213mg [Erythranthe guttata]
Length=258

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 157/256 (61%), Positives = 208/256 (81%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             M+I+ + C ED+ YSYLIIDE+T+EAA VDP +  K+L+ A+ N   +K+VLTTHHH  H
Sbjct  1     MQILHIPCLEDN-YSYLIIDEATKEAAVVDPVEPHKILRVAEENGVHLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+KMK+++P + ++GG++D+V+GCT+ V++GD  +LGA  +I  L TPCHT GHISY
Sbjct  60    AGGNDKMKQLLPDIEIFGGSVDNVQGCTNKVENGDRFSLGADISILSLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V++KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTAKEGDVPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCTTLGSLPKPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F ST+EP+N R+ +KL WA+Q+R+  LPTIPSTIE+E ETNPF+RVDL ++Q+K+  
Sbjct  180   NLQFASTVEPENERISQKLLWAQQKRRTGLPTIPSTIEEEFETNPFMRVDLTEVQEKVGC  239

Query  306   KSPVEALKKLRQLKDK  259
             KSPVEA++++R  KD 
Sbjct  240   KSPVEAMREIRLRKDN  255



>ref|XP_010278945.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Nelumbo 
nucifera]
Length=258

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 203/255 (80%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI+PV C ED+ YSY+IIDE+++EAA VDP + EK+L+ A  N  ++K+VLTTHHH  H
Sbjct  1     MKILPVLCLEDN-YSYIIIDETSKEAAVVDPVEPEKILRVAAENGVDLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN ++K++VPG++VYGG +D+V+GCT  +Q GD + LG    I  L TPCHT GHISY
Sbjct  60    AGGNNEIKKLVPGIKVYGGLVDNVKGCTDKLQHGDKLKLGRDIDILSLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +++ KE   PAVFTGDTLF  GCGKFFEGTAEQMY+SLC  L +LPK T VYC HEYTVK
Sbjct  120   YLTGKEEEDPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCVILGSLPKPTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  TIEPDN R+ +KL WA+ QR+ NLPTIPSTIEDELE NPF+RVDLP++Q+K+  
Sbjct  180   NLQFALTIEPDNARITQKLSWAQHQRQGNLPTIPSTIEDELEINPFMRVDLPQLQEKVGC  239

Query  306   KSPVEALKKLRQLKD  262
              SPVEAL+++R+ KD
Sbjct  240   LSPVEALREVRRRKD  254



>ref|XP_006595529.1| PREDICTED: uncharacterized protein LOC100527131 isoform X1 [Glycine 
max]
Length=258

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/256 (63%), Positives = 207/256 (81%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             M+I  + C +D+ YSYLI+DEST+EAAAVDP + EKVL+ A ++   +K VLTTHHH  H
Sbjct  1     MRIHHIACLQDN-YSYLIVDESTKEAAAVDPVEPEKVLEVASSHGLTLKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+K+K++VPG++VYGG++++V+GCT  V++GD ++LGA  TI  L TPCHT GHISY
Sbjct  60    AGGNDKIKQLVPGIKVYGGSIENVKGCTDKVENGDKVSLGAEITILALHTPCHTQGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KE  QPAVFTGDTLF   CGKFFEGTAEQMY+SL  TLA+LPK T VYC HEY+V 
Sbjct  120   YVTGKEDEQPAVFTGDTLFIASCGKFFEGTAEQMYQSLNVTLASLPKSTRVYCGHEYSVN  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN+R+++KL WAR QR+    TIPSTIEDELETNPF+RVDLP+IQ+++  
Sbjct  180   NLQFALTLEPDNLRIQQKLTWARNQRQAGQATIPSTIEDELETNPFMRVDLPEIQERVGC  239

Query  306   KSPVEALKKLRQLKDK  259
             KSPVEAL ++R+ KD 
Sbjct  240   KSPVEALGEIRKQKDN  255



>ref|XP_006486126.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like 
[Citrus sinensis]
Length=258

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 157/256 (61%), Positives = 205/256 (80%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  + C ED+ Y+YL+IDE+T+EAA VDP + EK+++AA  +   +  VLTTHHH  H
Sbjct  1     MKIFHIPCLEDN-YAYLVIDETTKEAAVVDPVEPEKIIEAAKQHGVNLTTVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKMKEMVPG++VYGG+LD+V+GCTH V++GD  ++GA+  +  L TPCHT GHISY
Sbjct  60    AGGNEKMKEMVPGIKVYGGSLDNVKGCTHQVENGDKFSIGAHVNVLSLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEG+AEQMY+SLC TL +LP+ T VYC HEYTVK
Sbjct  120   YVTGKEGEDPAVFTGDTLFVAGCGKFFEGSAEQMYQSLCVTLGSLPQPTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL F  T+EP NV++++KL WA+ Q++  LPTIPSTIE+ELETNPF+RVDLP++Q+ +  
Sbjct  180   NLLFALTVEPSNVKLQQKLAWAQNQQQAGLPTIPSTIEEELETNPFMRVDLPELQELVGF  239

Query  306   KSPVEALKKLRQLKDK  259
               P+EAL+++R+ KD 
Sbjct  240   NDPIEALREIRKRKDN  255



>ref|XP_007218221.1| hypothetical protein PRUPE_ppa007897mg [Prunus persica]
 gb|EMJ19420.1| hypothetical protein PRUPE_ppa007897mg [Prunus persica]
Length=352

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/260 (63%), Positives = 212/260 (82%), Gaps = 1/260 (0%)
 Frame = -3

Query  1041  QKLTPMKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTH  862
             ++ T MKI  V C ED+ Y+YLIIDEST+EAAAVDP + EKVL+AA  +  +IK+VLTTH
Sbjct  90    RQTTEMKIHHVACLEDN-YAYLIIDESTKEAAAVDPVEPEKVLKAAQEHGVDIKLVLTTH  148

Query  861   HHHYHAGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTN  682
             HH  HAGGNEK+K++VPG+++YGG++D+V+GCT  V +GD I+LGA   I  L TPCHT 
Sbjct  149   HHWDHAGGNEKIKQLVPGIKIYGGSIDNVKGCTDKVDNGDKISLGADVHILSLHTPCHTK  208

Query  681   GHISYFVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAH  502
             GHISY+V++KEG  P VFTGDTLF  GCGKFFEGTAEQM++SLC TL +LPK T VYC H
Sbjct  209   GHISYYVTNKEGDDPTVFTGDTLFIAGCGKFFEGTAEQMHQSLCVTLGSLPKPTRVYCGH  268

Query  501   EYTVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQ  322
             EYTVKNL+F  T+EP N ++K+KL WA++QR+  LPT+PSTIE+E+ETNPF+R DLP++Q
Sbjct  269   EYTVKNLQFALTVEPGNEKIKQKLSWAQKQRETGLPTVPSTIEEEMETNPFMRADLPELQ  328

Query  321   DKLESKSPVEALKKLRQLKD  262
             +++  K+ VEAL+++RQ KD
Sbjct  329   ERVGCKTAVEALREIRQRKD  348



>ref|XP_006435967.1| hypothetical protein CICLE_v10032268mg [Citrus clementina]
 gb|ESR49207.1| hypothetical protein CICLE_v10032268mg [Citrus clementina]
Length=295

 Score =   349 bits (896),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 157/255 (62%), Positives = 205/255 (80%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  + C ED+ Y+YL+IDE+T+EAA VDP + EK+++AA  +   +  VLTTHHH  H
Sbjct  38    MKIFHIPCLEDN-YAYLVIDETTKEAAVVDPVEPEKIIEAAKQHGVNLTTVLTTHHHWDH  96

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKMKEMVPG++VYGG+LD+V+GCTH V++GD  ++GA+  +  L TPCHT GHISY
Sbjct  97    AGGNEKMKEMVPGIKVYGGSLDNVKGCTHQVENGDKFSIGAHVNVLSLHTPCHTKGHISY  156

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEG+AEQMY+SLC TL +LP+ T VYC HEYTVK
Sbjct  157   YVTGKEGEDPAVFTGDTLFVAGCGKFFEGSAEQMYQSLCVTLGSLPQPTQVYCGHEYTVK  216

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL F  T+EP NV++++KL WA+ Q++  LPTIPSTIE+ELETNPF+RVDLP++Q+ +  
Sbjct  217   NLLFALTVEPSNVKLQQKLAWAQNQQQAGLPTIPSTIEEELETNPFMRVDLPELQELVGF  276

Query  306   KSPVEALKKLRQLKD  262
               P+EAL+++R+ KD
Sbjct  277   NDPIEALREIRKRKD  291



>ref|XP_010911346.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Elaeis 
guineensis]
Length=259

 Score =   347 bits (890),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 207/255 (81%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  + C ED+ Y+YLI+DEST+EAAAVDP + +K++++A    AE+K+VLTTHHH  H
Sbjct  1     MKIYHIPCLEDN-YAYLIVDESTKEAAAVDPVEPKKIIESAKEIGAELKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNE++K +VPG++V+GG +D+V+GCT+ V++GD   LGA   I  L TPCHT GHISY
Sbjct  60    AGGNEEIKRLVPGIKVFGGTIDNVKGCTNEVENGDKFTLGADINILSLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKE   PAVFTGDTLF  GCGKFFEGTA+QMY+SLC TL +LPK T VYC HEYTV 
Sbjct  120   YVTSKEEEDPAVFTGDTLFIAGCGKFFEGTADQMYQSLCVTLGSLPKPTRVYCGHEYTVS  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL F  T+EP+N ++K+KL WA+ QR+ NLPTIPSTI +ELETNPF+RVDLP+IQ K+  
Sbjct  180   NLRFALTVEPENEKMKQKLSWAQLQRQANLPTIPSTIGEELETNPFMRVDLPEIQAKVGC  239

Query  306   KSPVEALKKLRQLKD  262
             +SPVEA+K++R+LKD
Sbjct  240   RSPVEAIKEIRRLKD  254



>ref|XP_004146429.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like 
[Cucumis sativus]
 gb|KGN50754.1| hypothetical protein Csa_5G223120 [Cucumis sativus]
Length=258

 Score =   347 bits (889),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 204/255 (80%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  + C ED+ YSYLIIDEST+EAA VDP + EK++  A+ +   +K+VLTTHHH  H
Sbjct  1     MKIHYIPCLEDN-YSYLIIDESTKEAAVVDPVEPEKIVNIANEHGVHLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             +GGNEK+K++VPG++VYGG++D V+GCT  V++GD I LGA   I  L TPCHT GHISY
Sbjct  60    SGGNEKIKQLVPGIKVYGGSIDKVKGCTDAVENGDKIPLGADVVILSLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +VS KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC  L +LPK T VYC HEYTVK
Sbjct  120   YVSGKEGEDPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCIKLGSLPKQTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN ++K KL WA+ QR+    T+PSTIE+E+ETNPF+RVDLP++Q+K+ +
Sbjct  180   NLQFALTVEPDNEKIKGKLLWAQGQRQAGQATVPSTIEEEMETNPFMRVDLPQLQEKVGN  239

Query  306   KSPVEALKKLRQLKD  262
              SPVEA++++R+LKD
Sbjct  240   HSPVEAIREIRRLKD  254



>ref|XP_006650035.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like 
isoform X1 [Oryza brachyantha]
Length=258

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 202/255 (79%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI+PV C ED+ Y+YLI+DESTR AAAVDP + EKVL AA    A I  VLTTHHH  H
Sbjct  1     MKIIPVACLEDN-YAYLIVDESTRSAAAVDPVEPEKVLAAAAEVGARIDFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKM + VPGV+VYGG+LD+V+GCT  V++G  ++LG    I CL TPCHT GHISY
Sbjct  60    AGGNEKMAQSVPGVKVYGGSLDNVKGCTDQVENGIKLSLGKDIEILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKE   PAVFTGDTLF  GCG+FFEGTAEQMY+SLC TL +LPK T VYC HEYT K
Sbjct  120   YVTSKEEEDPAVFTGDTLFIAGCGRFFEGTAEQMYQSLCVTLGSLPKPTRVYCGHEYTAK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EP+N +VK+KLEWA++QR+ N PT+PSTI +E E N F+RVDLP+IQ K  +
Sbjct  180   NLKFILTVEPENEKVKQKLEWAQKQREANQPTVPSTIGEEFEINTFMRVDLPEIQAKFGA  239

Query  306   KSPVEALKKLRQLKD  262
             KSPV+A++++R+ KD
Sbjct  240   KSPVDAMREVRKTKD  254



>gb|KHN40009.1| Hydroxyacylglutathione hydrolase cytoplasmic [Glycine soja]
Length=256

 Score =   343 bits (880),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/256 (63%), Positives = 206/256 (80%), Gaps = 3/256 (1%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             M+I  + C +D+ YSYLI+DEST+EAAAVD A  EKVL+ A ++   +K VLTTHHH  H
Sbjct  1     MRIHHIACLQDN-YSYLIVDESTKEAAAVDSA--EKVLEVASSHGLTLKFVLTTHHHWDH  57

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+K+K++VPG++VYGG++++V+GCT  V++GD ++LGA  TI  L TPCHT GHISY
Sbjct  58    AGGNDKIKQLVPGIKVYGGSIENVKGCTDKVENGDKVSLGAEITILALHTPCHTQGHISY  117

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KE  QPAVFTGDTLF   CGKFFEGTAEQMY+SL  TLA+LPK T VYC HEY+V 
Sbjct  118   YVTGKEDEQPAVFTGDTLFIASCGKFFEGTAEQMYQSLNVTLASLPKSTRVYCGHEYSVN  177

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN+R+++KL WAR QR+    TIPSTIEDELETNPF+RVDLP+IQ+++  
Sbjct  178   NLQFALTLEPDNLRIQQKLTWARNQRQAGQATIPSTIEDELETNPFMRVDLPEIQERVGC  237

Query  306   KSPVEALKKLRQLKDK  259
             KSPVEAL ++R+ KD 
Sbjct  238   KSPVEALGEIRKQKDN  253



>ref|XP_004307749.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=259

 Score =   343 bits (879),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 195/235 (83%), Gaps = 1/235 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C ED+ Y+YLIIDEST+EAA VDP + EKVL+AA  + A++KIVLTTHHH  H
Sbjct  1     MKIHHVACLEDN-YAYLIIDESTKEAAVVDPVEPEKVLKAAQEHGAQVKIVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+KE+VPG++VYGG++D+V+GCT  V +GD I LGA T I  L TPCHT GHISY
Sbjct  60    AGGNEKIKELVPGIKVYGGSVDNVKGCTDKVDNGDKITLGADTQILSLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKEG +PAVFTGDTLF  GCGKFFEGTAEQM++SLC TLA+LPK T VYC HEYTVK
Sbjct  120   YVTSKEGEEPAVFTGDTLFVAGCGKFFEGTAEQMHQSLCVTLASLPKPTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQ  322
             NL+F  T+EP N ++K+KL WA+QQR+  LPT+PSTIE E+ETNPF+R D+P++Q
Sbjct  180   NLQFAQTVEPHNAKIKQKLSWAQQQREAGLPTVPSTIESEMETNPFVRADMPELQ  234



>dbj|BAJ87343.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=258

 Score =   343 bits (879),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 202/255 (79%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI+PV C ED+ Y+YLI+DEST+ AAAVDP + EKVL AA    A I  VLTTHHH  H
Sbjct  1     MKIIPVACLEDN-YAYLIVDESTKAAAAVDPVEPEKVLAAASEVGAYIDCVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKM+ +VPG++VYGG++D+V+GCT  V++G  +++G    I CL TPCHT GHISY
Sbjct  60    AGGNEKMRLLVPGIKVYGGSMDNVKGCTDQVENGTKLSIGKEIEILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SK+   PAVFTGDTLF  GCG+FFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTSKKEEDPAVFTGDTLFIAGCGRFFEGTAEQMYQSLCVTLGSLPKSTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             +L+F  T+EP+N ++K+KLEWA++QR+ N PT+PSTI DE E N F+RVDLP+IQ K  +
Sbjct  180   SLQFMLTVEPENEKMKQKLEWAQKQREANQPTVPSTIGDEFEINTFMRVDLPEIQAKFGA  239

Query  306   KSPVEALKKLRQLKD  262
             KS VEAL+ +R +KD
Sbjct  240   KSAVEALRTVRNIKD  254



>gb|EPS73265.1| hypothetical protein M569_01492 [Genlisea aurea]
Length=257

 Score =   343 bits (879),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 203/255 (80%), Gaps = 2/255 (1%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             M+IV + C  D+ YSY+I+D+ TREAA VDP +  K+L  A+   A++K++LTTHHH  H
Sbjct  1     MEIVHIPCLSDN-YSYMIVDKRTREAAVVDPVEPGKILPVAEEIGADLKLILTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN++MK+++PG++VYGGALD V+GCT  VQ+GD I LGA   I CL TPCHT GHISY
Sbjct  60    AGGNDEMKKLLPGIKVYGGALDTVKGCTDEVQNGDEIKLGADINILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KE   PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL  LPK T VYC HEYTVK
Sbjct  120   YVTDKED-DPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGTLPKRTRVYCGHEYTVK  178

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  TIEP+N ++ EKL WA  Q+K NLPT+PST+E+ELETNPF+RV LP+IQ+++E 
Sbjct  179   NLQFALTIEPNNGKLVEKLAWAEHQQKSNLPTVPSTVEEELETNPFMRVSLPEIQERVER  238

Query  306   KSPVEALKKLRQLKD  262
             +SPVEAL ++R+ KD
Sbjct  239   RSPVEALGEIRKRKD  253



>ref|XP_004984491.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like 
isoform X2 [Setaria italica]
Length=258

 Score =   342 bits (878),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 203/255 (80%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI+PV C ED+ Y+YLI+DEST++AAAVDP + EKVL+AA    A +  VLTTHHH  H
Sbjct  1     MKIIPVPCLEDN-YAYLIVDESTKKAAAVDPVEPEKVLKAASEVGAYVDCVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKM+  VPG++VYGG+LD+V+GCT  V++G  ++LG    I CL TPCHT GHISY
Sbjct  60    AGGNEKMRLQVPGIKVYGGSLDNVKGCTDQVENGTKLSLGNDIEILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             + +SKEG  P VFTGDTLF  GCG+FFEGTAEQMY+SL  TL +LPK T VYC HEYTVK
Sbjct  120   YATSKEGEDPVVFTGDTLFIAGCGRFFEGTAEQMYQSLIVTLGSLPKSTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             +L+F  T+EP+N ++K+KLEWA +QR+ N PT+PSTI DE E N F+RVDLP+IQ K  +
Sbjct  180   SLKFMLTLEPENEKMKQKLEWAEKQREANQPTVPSTIGDEFEINTFMRVDLPEIQAKFGA  239

Query  306   KSPVEALKKLRQLKD  262
             KSPVEAL+++R++KD
Sbjct  240   KSPVEALREVRKIKD  254



>ref|XP_002465318.1| hypothetical protein SORBIDRAFT_01g036340 [Sorghum bicolor]
 gb|EER92316.1| hypothetical protein SORBIDRAFT_01g036340 [Sorghum bicolor]
Length=258

 Score =   342 bits (878),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 202/255 (79%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI+PV C ED+ Y+YLI+DEST++AAAVDP + EKV++AA    A +  VLTTHHH  H
Sbjct  1     MKIIPVPCLEDN-YAYLIVDESTKKAAAVDPVEPEKVIKAAGEVGAYVDCVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKM+  VPG++++GG+LD+V+GCT  V++G  ++LG    I CL TPCHT GHISY
Sbjct  60    AGGNEKMRLQVPGIKIFGGSLDNVKGCTDQVENGTKLSLGKDIEILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SL  TL +LPK T VYC HEYTVK
Sbjct  120   YVTSKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLIVTLGSLPKSTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EP+N + K+KLEWA +QR+ N PT+PSTI DE E N F+RVDLP+IQ K  +
Sbjct  180   NLKFILTVEPENEKTKQKLEWAEKQRQANQPTVPSTIGDEFEINTFMRVDLPEIQAKFGA  239

Query  306   KSPVEALKKLRQLKD  262
              SPVEAL+++R+ KD
Sbjct  240   NSPVEALREVRKTKD  254



>gb|KHG16215.1| Hydroxyacylglutathione hydrolase cytoplasmic -like protein [Gossypium 
arboreum]
Length=249

 Score =   342 bits (876),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 200/256 (78%), Gaps = 10/256 (4%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C ED+ YSYL+IDEST+EAA VDP D EKV   A+ +   +K          H
Sbjct  1     MKIFEVPCLEDN-YSYLVIDESTKEAAVVDPVDAEKVFDVANQHGVVLKD---------H  50

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+K+K++VPG++VYGG+LD+V GCTH +Q+GDT++LG++  I  L TPCHT GHISY
Sbjct  51    AGGNDKIKQLVPGIKVYGGSLDNVRGCTHQLQNGDTLSLGSHLNILALHTPCHTKGHISY  110

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +++ K+G  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  111   YITGKDGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTRVYCGHEYTVK  170

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F ST+EP N R+++KL WA  QRK  LPTIPSTIE+E+ETNPF+RVDLP++Q  +  
Sbjct  171   NLQFASTVEPKNARIQQKLAWANGQRKAGLPTIPSTIEEEMETNPFMRVDLPELQGSIGC  230

Query  306   KSPVEALKKLRQLKDK  259
             +SPVEAL+++RQ+KD 
Sbjct  231   QSPVEALREIRQMKDN  246



>gb|ABK23771.1| unknown [Picea sitchensis]
Length=258

 Score =   342 bits (877),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 199/256 (78%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKIVPV C ED+ Y+YLIIDE T EAA VDP + + +LQAA+ + A IK VLTTHHH  H
Sbjct  1     MKIVPVPCLEDN-YAYLIIDEDTGEAAVVDPVEPQNILQAAEVHGANIKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNE++K++VPG+ VYGGA D V+GCT  ++ GD ++LG   TI  L TPCHT GHISY
Sbjct  60    AGGNEELKKLVPGIEVYGGAKDHVKGCTVALEHGDELSLGRTVTIKALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             F++S  G  PAVFTGDTLF  GCGKFFEG+AEQMY+SLCK LA+LP+ T V+C HEYTVK
Sbjct  120   FLTSTSGDDPAVFTGDTLFIAGCGKFFEGSAEQMYQSLCKILASLPRSTQVFCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL F  T+EP+N R+K+KL WA QQR+ N PT+PSTI+DELE+NPF+RVD  ++++ +  
Sbjct  180   NLRFAMTVEPENERIKQKLNWAEQQRRENKPTVPSTIQDELESNPFMRVDRLELKELVGH  239

Query  306   KSPVEALKKLRQLKDK  259
              SPV  L ++RQ+KD 
Sbjct  240   NSPVHVLGEIRQMKDN  255



>ref|XP_004984490.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like 
isoform X1 [Setaria italica]
Length=268

 Score =   342 bits (877),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 203/255 (80%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI+PV C ED+ Y+YLI+DEST++AAAVDP + EKVL+AA    A +  VLTTHHH  H
Sbjct  1     MKIIPVPCLEDN-YAYLIVDESTKKAAAVDPVEPEKVLKAASEVGAYVDCVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKM+  VPG++VYGG+LD+V+GCT  V++G  ++LG    I CL TPCHT GHISY
Sbjct  60    AGGNEKMRLQVPGIKVYGGSLDNVKGCTDQVENGTKLSLGNDIEILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             + +SKEG  P VFTGDTLF  GCG+FFEGTAEQMY+SL  TL +LPK T VYC HEYTVK
Sbjct  120   YATSKEGEDPVVFTGDTLFIAGCGRFFEGTAEQMYQSLIVTLGSLPKSTQVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             +L+F  T+EP+N ++K+KLEWA +QR+ N PT+PSTI DE E N F+RVDLP+IQ K  +
Sbjct  180   SLKFMLTLEPENEKMKQKLEWAEKQREANQPTVPSTIGDEFEINTFMRVDLPEIQAKFGA  239

Query  306   KSPVEALKKLRQLKD  262
             KSPVEAL+++R++KD
Sbjct  240   KSPVEALREVRKIKD  254



>gb|AFK34093.1| unknown [Medicago truncatula]
Length=248

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 198/249 (80%), Gaps = 1/249 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C ED+ YSYLI+DEST+EAAAVDP + EKVL+A+++    IK VLTTHHH  H
Sbjct  1     MKIYHVPCLEDN-YSYLIVDESTKEAAAVDPVEPEKVLEASNSLGLTIKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
              GGNEK+KE+VPG++VYGG++D+V+GCT+ +++GD + LGA   I  L TPCHT GHISY
Sbjct  60    TGGNEKIKELVPGIKVYGGSIDNVKGCTNALENGDKVHLGADINILALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KE   PAVFTGDTLF  GCGKFFEGTAEQMY+SL  TL +LPK T VYC HEY+VK
Sbjct  120   YVTGKEDEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLSVTLGSLPKPTRVYCGHEYSVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN+R+ EKL WA+ QR+   PTIPSTI DELE+NPF+RVDLP IQ+K+  
Sbjct  180   NLQFALTVEPDNLRILEKLTWAQNQRQTGQPTIPSTIGDELESNPFMRVDLPAIQEKMGF  239

Query  306   KSPVEALKK  280
              SPVEAL+ 
Sbjct  240   NSPVEALEN  248



>ref|NP_001132380.1| uncharacterized protein LOC100193826 [Zea mays]
 gb|ACF81198.1| unknown [Zea mays]
 tpg|DAA45200.1| TPA: hydroxyacylglutathione hydrolase isoform 1 [Zea mays]
 tpg|DAA45201.1| TPA: hydroxyacylglutathione hydrolase isoform 2 [Zea mays]
Length=258

 Score =   341 bits (874),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 200/255 (78%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI+PV C  DD Y+YLI+DEST++AAAVDP + EKVL+AA    A +  VLTTHHH  H
Sbjct  1     MKIIPVPCL-DDNYAYLIVDESTKKAAAVDPVEPEKVLKAAGEVGAYVDCVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKM+  VPG++V+GG+LD+V+GCT  V++G  ++LG    I CL TPCHT GHISY
Sbjct  60    AGGNEKMRLQVPGIKVFGGSLDNVKGCTDQVENGMKLSLGKDIEILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKEG  PAVFTGDTLF  GCGKFFEG+AEQMY+SL  TL +LPK T VYC HEYTVK
Sbjct  120   YVTSKEGEDPAVFTGDTLFIAGCGKFFEGSAEQMYQSLIVTLGSLPKSTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EP+N + K+KLEWA +QR+ N PT+PSTI DE E N F+RVDLP+IQ K   
Sbjct  180   NLKFMLTLEPENEKTKQKLEWAEKQREANQPTVPSTIGDEFEINTFMRVDLPEIQAKFSV  239

Query  306   KSPVEALKKLRQLKD  262
              SPVEA++++R+ KD
Sbjct  240   NSPVEAMREVRKTKD  254



>ref|XP_008657238.1| PREDICTED: uncharacterized protein LOC100193826 isoform X1 [Zea 
mays]
Length=268

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 200/255 (78%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI+PV C  DD Y+YLI+DEST++AAAVDP + EKVL+AA    A +  VLTTHHH  H
Sbjct  1     MKIIPVPCL-DDNYAYLIVDESTKKAAAVDPVEPEKVLKAAGEVGAYVDCVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKM+  VPG++V+GG+LD+V+GCT  V++G  ++LG    I CL TPCHT GHISY
Sbjct  60    AGGNEKMRLQVPGIKVFGGSLDNVKGCTDQVENGMKLSLGKDIEILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKEG  PAVFTGDTLF  GCGKFFEG+AEQMY+SL  TL +LPK T VYC HEYTVK
Sbjct  120   YVTSKEGEDPAVFTGDTLFIAGCGKFFEGSAEQMYQSLIVTLGSLPKSTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EP+N + K+KLEWA +QR+ N PT+PSTI DE E N F+RVDLP+IQ K   
Sbjct  180   NLKFMLTLEPENEKTKQKLEWAEKQREANQPTVPSTIGDEFEINTFMRVDLPEIQAKFSV  239

Query  306   KSPVEALKKLRQLKD  262
              SPVEA++++R+ KD
Sbjct  240   NSPVEAMREVRKTKD  254



>ref|NP_001235365.1| uncharacterized protein LOC100527131 [Glycine max]
 gb|ACU16178.1| unknown [Glycine max]
Length=248

 Score =   339 bits (869),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 202/249 (81%), Gaps = 1/249 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             M+I  + C +D+ YSYLI+DEST+EAAAVDP + E+VL+ A ++   +K VLTTHHH  H
Sbjct  1     MRIHHIACLQDN-YSYLIVDESTKEAAAVDPVEPERVLEVASSHGLTLKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+K+K++VPG++VYGG++++V+GCT  V++GD ++LGA  TI  L TPCHT GHISY
Sbjct  60    AGGNDKIKQLVPGIKVYGGSIENVKGCTDKVENGDKVSLGAEITILALHTPCHTQGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KE  QPAVFTGDTLF   CGKFFEGTAEQMY+SL  TLA+LPK T VYC HEY+V 
Sbjct  120   YVTGKEDEQPAVFTGDTLFIASCGKFFEGTAEQMYQSLNVTLASLPKSTRVYCGHEYSVN  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EPDN+R+++KL WAR QR+    TIPSTIEDELETN F+RVDLP+IQ+++  
Sbjct  180   NLQFALTLEPDNLRIQQKLTWARNQRQAGQATIPSTIEDELETNLFMRVDLPEIQERVGC  239

Query  306   KSPVEALKK  280
             KSPVEAL++
Sbjct  240   KSPVEALER  248



>gb|ACG31465.1| hydroxyacylglutathione hydrolase [Zea mays]
Length=258

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 199/255 (78%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI+PV C  DD Y+YLI+DEST++AAAVDP + EKVL+AA    A +  VLTTHHH  H
Sbjct  1     MKIIPVPCL-DDNYAYLIVDESTKKAAAVDPVEPEKVLKAAGEVGAYVDCVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKM+  VPG++V+GG+LD+V+GCT  V++G  ++LG    I CL TPCHT GHISY
Sbjct  60    AGGNEKMRLQVPGIKVFGGSLDNVKGCTDQVENGMKLSLGKDIEILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKEG  PAVFTGDTLF  GCGKFFEG+AEQMY+SL  TL +LPK T VYC HEYTVK
Sbjct  120   YVTSKEGEDPAVFTGDTLFIAGCGKFFEGSAEQMYQSLIVTLGSLPKSTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EP+N + K+KLEWA +QR+ N PT+PSTI DE E N F+RVDLP+IQ K   
Sbjct  180   NLKFMLTLEPENEKTKQKLEWAEKQREANQPTVPSTIGDEFEINTFMRVDLPEIQAKFSV  239

Query  306   KSPVEALKKLRQLKD  262
              SPVEA+ ++R+ KD
Sbjct  240   NSPVEAMIEVRKTKD  254



>ref|XP_010031061.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Eucalyptus 
grandis]
Length=258

 Score =   337 bits (864),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/256 (61%), Positives = 206/256 (80%), Gaps = 1/256 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  + C ED+ ++YLI+DEST EAAAVDPA+ EKV++AA  +  ++K+VLTTHHH  H
Sbjct  1     MKIHHIPCLEDN-FAYLIVDESTGEAAAVDPAEPEKVVKAAREHGVDLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+K+++P ++VYGG++D+V+ CT+ V++GD ++LG  T I CL TP HT GHISY
Sbjct  60    AGGNEKIKQLIPEIKVYGGSIDNVKACTNKVENGDKVSLGKETNILCLHTPGHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ K    PAVFTGDTLF  GCGK FEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTGKGDEDPAVFTGDTLFIAGCGKIFEGTAEQMYQSLCVTLGSLPKPTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL F  T+E +N ++K+KL WA+QQ++  LPTIPSTIE+E+ETNPF+RVDLP++Q+ +  
Sbjct  180   NLLFALTVEQENAKIKQKLSWAQQQQEKGLPTIPSTIEEEMETNPFMRVDLPELQEIVGC  239

Query  306   KSPVEALKKLRQLKDK  259
             KSPVE L+++RQ KDK
Sbjct  240   KSPVECLREIRQRKDK  255



>ref|XP_010464772.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like 
isoform X1 [Camelina sativa]
Length=311

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/239 (65%), Positives = 194/239 (81%), Gaps = 0/239 (0%)
 Frame = -3

Query  975  IIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMVPGVRVY  796
            IIDEST +AA VDP D EKV+ +A+ +  +IK VLTTHHH  HAGGNEK+K++VPG++VY
Sbjct  70   IIDESTGDAAVVDPVDPEKVIASAEEHQVKIKFVLTTHHHWDHAGGNEKIKQLVPGIKVY  129

Query  795  GGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQPAVFTGDT  616
            GG+LD V+GCT  V +GD ++LG    I  L TPCHT GHISY+V+ K G  PAVFTGDT
Sbjct  130  GGSLDKVKGCTDAVDNGDKLSLGQDVNICALHTPCHTKGHISYYVTGKVGETPAVFTGDT  189

Query  615  LFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEPDNVRVKE  436
            LF  GCGKFFEGTAEQM++SLC TLAALPK T VYC HEYTVKNLEF  T+EP+N ++++
Sbjct  190  LFVAGCGKFFEGTAEQMHQSLCVTLAALPKPTQVYCGHEYTVKNLEFALTVEPNNEKIQQ  249

Query  435  KLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKLRQLKDK  259
            KL WARQQR+ NLPTIPST+E+ELETNPF+RVD P+IQ+KL  KSP++ L+++R  KD+
Sbjct  250  KLSWARQQRQANLPTIPSTLEEELETNPFMRVDKPEIQEKLGCKSPIDTLREIRNKKDQ  308



>ref|XP_008782702.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Phoenix 
dactylifera]
Length=258

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/255 (61%), Positives = 204/255 (80%), Gaps = 1/255 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  + C ED+ Y+YLI+DEST+EAAAVDP + +K+++ A    A++K+VLTTHHH  H
Sbjct  1     MKIYHIPCLEDN-YAYLIVDESTKEAAAVDPVEPKKIIKCAKEIGADLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             +GGNE++K++VP ++V+GG +D+V+GCT+ V++GD   LGA   I  L TPCHT GHISY
Sbjct  60    SGGNEEIKKLVPEIKVFGGTIDNVKGCTNKVENGDKFTLGADINILSLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KE   PAVFTGDTLF  GCG+FFEGTA+QMY+SLC TLA+LPK T VYC HEYTV 
Sbjct  120   YVTGKEEEDPAVFTGDTLFIAGCGRFFEGTADQMYQSLCVTLASLPKPTRVYCGHEYTVN  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL F  T+EP+N ++K+KL WA+ QR+ NLPTIPSTI +ELETNPF+RVD+ +IQ K+  
Sbjct  180   NLRFALTVEPENEKIKQKLSWAQHQRQANLPTIPSTIGEELETNPFMRVDVAEIQAKVGC  239

Query  306   KSPVEALKKLRQLKD  262
              SPVEA+K++R+LKD
Sbjct  240   HSPVEAIKEIRRLKD  254



>ref|XP_010228673.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic isoform 
X4 [Brachypodium distachyon]
Length=240

 Score =   333 bits (855),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/236 (66%), Positives = 191/236 (81%), Gaps = 1/236 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKIVPV C ED+ YSYLI+DEST+ AAAVDP + EKVL AA    A +  +LTTHHH  H
Sbjct  1     MKIVPVACLEDN-YSYLIVDESTKAAAAVDPVEPEKVLAAASEVGAYVDCILTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKM+ +VPG++VYGG++D+V+GCT+ V++G  ++LG  T I CL TPCHT GHISY
Sbjct  60    AGGNEKMRLLVPGIKVYGGSMDNVKGCTNQVENGTKLSLGKDTEILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKE   PAVFTGDTLF  GCG+FFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTSKEEEDPAVFTGDTLFIAGCGRFFEGTAEQMYQSLCVTLGSLPKSTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQD  319
             NL+F  T+EP+N +VK+KLEWA++QR+ N PT+PSTI DE E N F+RVDLP++QD
Sbjct  180   NLQFVLTVEPENEKVKQKLEWAQKQRQANQPTVPSTIRDEFEINTFMRVDLPEVQD  235



>ref|XP_010228671.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic isoform 
X2 [Brachypodium distachyon]
Length=260

 Score =   334 bits (857),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 201/267 (75%), Gaps = 8/267 (3%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKIVPV C ED+ YSYLI+DEST+ AAAVDP + EKVL AA    A +  +LTTHHH  H
Sbjct  1     MKIVPVACLEDN-YSYLIVDESTKAAAAVDPVEPEKVLAAASEVGAYVDCILTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKM+ +VPG++VYGG++D+V+GCT+ V++G  ++LG  T I CL TPCHT GHISY
Sbjct  60    AGGNEKMRLLVPGIKVYGGSMDNVKGCTNQVENGTKLSLGKDTEILCLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SKE   PA       F  GCG+FFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTSKEEEDPA-------FIAGCGRFFEGTAEQMYQSLCVTLGSLPKSTRVYCGHEYTVK  172

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  T+EP+N +VK+KLEWA++QR+ N PT+PSTI DE E N F+RVDLP++Q K  +
Sbjct  173   NLQFVLTVEPENEKVKQKLEWAQKQRQANQPTVPSTIRDEFEINTFMRVDLPEVQAKFGA  232

Query  306   KSPVEALKKLRQLKDKNLS*IYDERWK  226
             KSPVEAL+ +R  KD     IY  R K
Sbjct  233   KSPVEALRTVRNTKDTWKGGIYSCRAK  259



>ref|XP_008234181.1| PREDICTED: LOW QUALITY PROTEIN: hydroxyacylglutathione hydrolase 
cytoplasmic-like, partial [Prunus mume]
Length=243

 Score =   333 bits (854),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 197/238 (83%), Gaps = 0/238 (0%)
 Frame = -3

Query  975  IIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMVPGVRVY  796
            IID+ST+EAAAVDP + EKVL+AA  +  +IK+VLTTHHH   AGGNEK+K++VPG++VY
Sbjct  2    IIDKSTKEAAAVDPVEPEKVLKAAQEHGVDIKLVLTTHHHWDRAGGNEKIKQLVPGIKVY  61

Query  795  GGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQPAVFTGDT  616
            GG++D+V+GCT  V +GD I+LGA   I  L TPCHT GHISY+V++KEG  PAVFTGDT
Sbjct  62   GGSIDNVKGCTDKVDNGDKISLGADVHILSLHTPCHTKGHISYYVTNKEGDDPAVFTGDT  121

Query  615  LFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEPDNVRVKE  436
            LF  GCGKFFEGTAEQM++SLC TL +L K T VYC HEYTVKNL+F  T+EPDN ++K+
Sbjct  122  LFIAGCGKFFEGTAEQMHQSLCVTLGSLXKPTRVYCGHEYTVKNLQFALTVEPDNEKIKQ  181

Query  435  KLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKLRQLKD  262
            KL WA++QR+  LPT+PSTIE+E+ETNPF+R DLP++Q+++  K+ VEAL+++RQ KD
Sbjct  182  KLSWAQKQRETGLPTVPSTIEEEMETNPFMRADLPELQERIGRKTAVEALREIRQRKD  239



>ref|XP_009416328.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Musa 
acuminata subsp. malaccensis]
Length=257

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/255 (62%), Positives = 202/255 (79%), Gaps = 2/255 (1%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKIV V+C ED+ Y+Y+I++E + EAAAVDP + +KV   A    A++K+VLTTHHH  H
Sbjct  1     MKIVHVECLEDN-YAYIIVNEVSGEAAAVDPVEPDKVCWTAKQIGADLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEKMK++VPG++V+GG+ D V+GCT  +++GD + LG    I  L TPCHT GHISY
Sbjct  60    AGGNEKMKQLVPGIKVFGGSKDSVKGCTDNLENGDKLPLGPDMEILALHTPCHTMGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+SK G  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL++LPK T VYC HEYTVK
Sbjct  120   YVTSK-GEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLSSLPKPTRVYCGHEYTVK  178

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F ST+EPDN ++ +KL WA+ QRK   PTIPSTI++EL+TNPF+RVDLP+IQ ++  
Sbjct  179   NLQFASTVEPDNEKISQKLLWAQNQRKEGQPTIPSTIDEELQTNPFMRVDLPEIQARVGC  238

Query  306   KSPVEALKKLRQLKD  262
              +PVE L+K+R +KD
Sbjct  239   GTPVETLRKIRTMKD  253



>ref|XP_009600781.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic [Nicotiana 
tomentosiformis]
Length=247

 Score =   330 bits (845),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 150/238 (63%), Positives = 188/238 (79%), Gaps = 1/238 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK++ + C  DD YSY+IIDE+T+EAA VDP +  KVL+ A  N  ++K VLTTHHH  H
Sbjct  1     MKVLHIPCL-DDNYSYMIIDETTKEAAVVDPVEPHKVLRVAQENEVDLKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+KMK++VPG+++YGG++D+V GCT  V++GD I+LGA  +I  L TP HT GHISY
Sbjct  60    AGGNDKMKQLVPGIKIYGGSVDNVRGCTDKVENGDKISLGADISILSLHTPSHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK T VYC HEYTVK
Sbjct  120   YVTGKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTRVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKL  313
             NL+F  T+EPDN ++ +KL WA  QR+  LPTIPSTI++ELETNPF+R DLP++Q  L
Sbjct  180   NLQFALTVEPDNAKIAQKLAWAEHQRRVGLPTIPSTIQEELETNPFMRADLPEVQVTL  237



>gb|AAC49867.1| glyoxalase II cytoplasmic isozyme [Arabidopsis thaliana]
Length=256

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/256 (62%), Positives = 200/256 (78%), Gaps = 3/256 (1%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  V C +D+ Y+YLIIDEST +AA VDP D EKV+ +A+ + A+IK VLTTHHH  H
Sbjct  1     MKIFHVPCLQDN-YTYLIIDESTGDAAVVDPVDPEKVIASAEKHQAKIKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+K++VP ++VYGG+LD V+     +   D +    Y  I  L TPCHT GHISY
Sbjct  60    AGGNEKIKQLVPDIKVYGGSLDKVKVALMRLI-CDKLTWSGYN-ILALHTPCHTKGHISY  117

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TLAALPK T VYC HEYTVK
Sbjct  118   YVTGKEGENPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCVTLAALPKPTQVYCGHEYTVK  177

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NLEF  T+EP+N ++++KL WARQQR+ +LPTIPST+E+ELETNPF+RVD P+IQ+KL  
Sbjct  178   NLEFALTVEPNNGKIQQKLAWARQQRQADLPTIPSTLEEELETNPFMRVDKPEIQEKLGC  237

Query  306   KSPVEALKKLRQLKDK  259
             KSP++ ++++R  KD+
Sbjct  238   KSPIDTMREVRNKKDQ  253



>ref|NP_001275099.1| uncharacterized protein LOC102584437 [Solanum tuberosum]
 gb|AFW90562.1| hydroxyacylglutathione hydrolase [Solanum tuberosum]
Length=257

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 146/237 (62%), Positives = 189/237 (80%), Gaps = 1/237 (0%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK++ +  + DD YSY+IIDE+T+EAA VDP +  KVL+ A  N  ++K VLTTHHH  H
Sbjct  1     MKVLHIP-YLDDNYSYMIIDETTKEAAVVDPVEPHKVLRVAQENEVDLKFVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN+K+K++VPG+++YGG++D+V GCT  V++GD ++LG   +I  L TP HT GHISY
Sbjct  60    AGGNDKIKQLVPGIKIYGGSVDNVRGCTDKVENGDRVSLGVDISILSLHTPAHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC TL +LPK TLVYC HEYTVK
Sbjct  120   YVTDKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTLVYCGHEYTVK  179

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDK  316
             NL+F  T+EPDN ++ +KL WA +QR+  LPTIPSTI++E E+NPF+RVDLP++Q K
Sbjct  180   NLQFALTVEPDNAKIAQKLAWAERQRRVGLPTIPSTIQEEFESNPFMRVDLPEVQIK  236



>ref|XP_001769411.1| predicted protein [Physcomitrella patens]
 gb|EDQ65780.1| predicted protein [Physcomitrella patens]
Length=260

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 184/256 (72%), Gaps = 2/256 (1%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK+VPV C ED+ Y+YL+ DE T +AA VDP   ++VLQAA  N A++K+VLTTHHH  H
Sbjct  1     MKVVPVPCLEDN-YAYLVFDEETGDAAVVDPVWPDQVLQAAQINGAKVKMVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN  MK+++  V +YGG  D VEGC+H VQ GD  ++     + CL TPCHT GHISY
Sbjct  60    AGGNNGMKKLLKDVPIYGGVKDKVEGCSHPVQHGDEFSISPTVRVKCLETPCHTKGHISY  119

Query  666   FVSSK-EGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTV  490
             F++S     + AVFTGDTLF GGCG+FFEGT +QMY+SLCKTLA+LP  T VYC HEYT 
Sbjct  120   FITSTLPNDKSAVFTGDTLFIGGCGRFFEGTPDQMYQSLCKTLASLPLETQVYCGHEYTQ  179

Query  489   KNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLE  310
             KNLEF  T+EP N  +  K+EW  +QRK  L T+PSTI DELE NPF+RVD   +Q    
Sbjct  180   KNLEFALTLEPKNEALLRKMEWVLRQRKQKLATVPSTIGDELEFNPFMRVDQKSLQLATG  239

Query  309   SKSPVEALKKLRQLKD  262
              +SP+E + ++R++KD
Sbjct  240   RESPLEVMAEVRRMKD  255



>ref|XP_002974130.1| hypothetical protein SELMODRAFT_149526 [Selaginella moellendorffii]
 gb|EFJ25085.1| hypothetical protein SELMODRAFT_149526 [Selaginella moellendorffii]
Length=257

 Score =   288 bits (736),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 181/256 (71%), Gaps = 2/256 (1%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             M+++PV C  DD Y+YLIID ++++AAAVDP   E VL AA  + A++ +VLTTH H  H
Sbjct  1     MEVIPVPCL-DDNYAYLIIDGASKQAAAVDPVKPESVLSAAKKHGAQVTMVLTTHKHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN ++K++VPG++V+GGA D+VEGCT  ++ G  + L     I  L TPCHT GHISY
Sbjct  60    AGGNNEIKKLVPGIKVFGGAKDNVEGCTDPLEHGAELELSKDVKIKALHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             FV+ K  G PAVFTGDTLF  GCGKFFEG A+ MY SL + LA LP  T V+C HEYT K
Sbjct  120   FVTHK-SGDPAVFTGDTLFVAGCGKFFEGKAQDMYHSLSEVLAELPPATRVFCGHEYTAK  178

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F  +++P N  +K+K+ W  +QR+ + PT+PSTI +EL+TNPF+RV++ + Q  +  
Sbjct  179   NLKFAMSVDPHNDALKQKVAWTEEQRRNDKPTVPSTIREELQTNPFMRVNVKEFQVHMGE  238

Query  306   KSPVEALKKLRQLKDK  259
               PVE L  LR  KD+
Sbjct  239   SDPVELLASLRAAKDQ  254



>ref|XP_008328136.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Cynoglossus semilaevis]
Length=310

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 168/246 (68%), Gaps = 3/246 (1%)
 Frame = -3

Query  996  DDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEM  817
             D Y YL+ID  TREAA VDP +  KV++A   ++ ++  VLTTHHH  HAGGNEKM ++
Sbjct  60   SDNYMYLLIDADTREAAIVDPVEPIKVVEAVRKHSVKLTTVLTTHHHWDHAGGNEKMLKL  119

Query  816  VPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP  637
            +PG++VYGG  D V+G T  V    +  LG+   I CL TPCHT GHI Y+V+ +   +P
Sbjct  120  MPGLKVYGGD-DRVDGITKKVSHSHSFKLGSLN-IKCLFTPCHTTGHICYYVTKENSTEP  177

Query  636  -AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIE  460
             AVFTGDTLF  GCGKFFEGTAEQMY++L + L  LP  T VYC HEYTV NL+F   +E
Sbjct  178  PAVFTGDTLFVAGCGKFFEGTAEQMYKALIEILGRLPPETRVYCGHEYTVSNLKFARHVE  237

Query  459  PDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKK  280
            PDN  +++KL WA+++     PT+PST+ DE   NPF+RV    +QD ++  +P+E ++ 
Sbjct  238  PDNEIIQKKLAWAKEKCSLEEPTVPSTLADEFTFNPFMRVKEKSVQDHVKQTNPIETMRS  297

Query  279  LRQLKD  262
            LR+ KD
Sbjct  298  LRKEKD  303



>ref|XP_008328137.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Cynoglossus semilaevis]
Length=309

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 168/246 (68%), Gaps = 3/246 (1%)
 Frame = -3

Query  996  DDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEM  817
             D Y YL+ID  TREAA VDP +  KV++A   ++ ++  VLTTHHH  HAGGNEKM ++
Sbjct  59   SDNYMYLLIDADTREAAIVDPVEPIKVVEAVRKHSVKLTTVLTTHHHWDHAGGNEKMLKL  118

Query  816  VPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP  637
            +PG++VYGG  D V+G T  V    +  LG+   I CL TPCHT GHI Y+V+ +   +P
Sbjct  119  MPGLKVYGGD-DRVDGITKKVSHSHSFKLGSLN-IKCLFTPCHTTGHICYYVTKENSTEP  176

Query  636  -AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIE  460
             AVFTGDTLF  GCGKFFEGTAEQMY++L + L  LP  T VYC HEYTV NL+F   +E
Sbjct  177  PAVFTGDTLFVAGCGKFFEGTAEQMYKALIEILGRLPPETRVYCGHEYTVSNLKFARHVE  236

Query  459  PDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKK  280
            PDN  +++KL WA+++     PT+PST+ DE   NPF+RV    +QD ++  +P+E ++ 
Sbjct  237  PDNEIIQKKLAWAKEKCSLEEPTVPSTLADEFTFNPFMRVKEKSVQDHVKQTNPIETMRS  296

Query  279  LRQLKD  262
            LR+ KD
Sbjct  297  LRKEKD  302



>ref|XP_008415030.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Poecilia reticulata]
Length=260

 Score =   260 bits (664),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 168/245 (69%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE ++EAA VDP +  KV++A   +  ++  VLTTHHH  HAGGNEKM +++
Sbjct  11   DNYMYLLIDEESKEAAIVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMVKLM  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D V+  T  V   +T  LG+ + + CL TPCHT GHI Y+V+ +   +P 
Sbjct  71   PGLKVYGGD-DRVDAITKKVSHSNTFKLGSLS-VKCLFTPCHTTGHICYYVTKESSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTAEQMY++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTAEQMYKALIEILGRLPPETRVYCGHEYTVSNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  +++KLEWA+++     PTIPST+ DE   NPF+RV    +QD ++   P+E ++ L
Sbjct  189  LNEVIQKKLEWAKEKCSDGEPTIPSTLADEFTFNPFMRVKEKSVQDHVKQTDPIETMRSL  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>tpg|DAA45199.1| TPA: hypothetical protein ZEAMMB73_732063 [Zea mays]
Length=193

 Score =   257 bits (657),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  828  MKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKE  649
            M+  VPG++V+GG+LD+V+GCT  V++G  ++LG    I CL TPCHT GHISY+V+SKE
Sbjct  1    MRLQVPGIKVFGGSLDNVKGCTDQVENGMKLSLGKDIEILCLHTPCHTKGHISYYVTSKE  60

Query  648  GGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGS  469
            G  PAVFTGDTLF  GCGKFFEG+AEQMY+SL  TL +LPK T VYC HEYTVKNL+F  
Sbjct  61   GEDPAVFTGDTLFIAGCGKFFEGSAEQMYQSLIVTLGSLPKSTRVYCGHEYTVKNLKFML  120

Query  468  TIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEA  289
            T+EP+N + K+KLEWA +QR+ N PT+PSTI DE E N F+RVDLP+IQ K    SPVEA
Sbjct  121  TLEPENEKTKQKLEWAEKQREANQPTVPSTIGDEFEINTFMRVDLPEIQAKFSVNSPVEA  180

Query  288  LKKLRQLKD  262
            ++++R+ KD
Sbjct  181  MREVRKTKD  189



>gb|EFN67738.1| Hydroxyacylglutathione hydrolase [Camponotus floridanus]
Length=302

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/256 (49%), Positives = 172/256 (67%), Gaps = 4/256 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK+  +   +D+ Y YLIIDE+T+EAA VDP D E V  A   N  ++  VLTTHHH  H
Sbjct  48    MKVQILPALQDN-YMYLIIDEATQEAAVVDPVDPETVAAAVQQNNVKLTKVLTTHHHWDH  106

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN K+ +    + +YGG  D +E   H +   DT  +G  + + CL TPCHT GHI Y
Sbjct  107   AGGNAKLLKSFNDLTIYGGD-DRIEAINHKITHNDTFNIGNLS-VKCLATPCHTRGHICY  164

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ +E   P+VFTGDTLFAGGCG+FFEGTA+QMY++L + L +LP+ T VYC HEYT  
Sbjct  165   YVTGEEH-PPSVFTGDTLFAGGCGRFFEGTADQMYKALIEILGSLPEETKVYCGHEYTAN  223

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+FG  +EP+N  +++KL+W+ +QR  NLPT+PSTI+DE  TNPF+RV  P +    + 
Sbjct  224   NLKFGLHVEPENKAIQQKLDWSHEQRANNLPTVPSTIKDEKLTNPFMRVHEPTVMKHAQQ  283

Query  306   KSPVEALKKLRQLKDK  259
               P++ +  LR+ KD 
Sbjct  284   NDPIQTMSYLRREKDN  299



>ref|XP_008415029.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Poecilia reticulata]
Length=309

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 168/246 (68%), Gaps = 3/246 (1%)
 Frame = -3

Query  996  DDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEM  817
             D Y YL+IDE ++EAA VDP +  KV++A   +  ++  VLTTHHH  HAGGNEKM ++
Sbjct  59   SDNYMYLLIDEESKEAAIVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMVKL  118

Query  816  VPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP  637
            +PG++VYGG  D V+  T  V   +T  LG+ + + CL TPCHT GHI Y+V+ +   +P
Sbjct  119  MPGLKVYGGD-DRVDAITKKVSHSNTFKLGSLS-VKCLFTPCHTTGHICYYVTKESSSEP  176

Query  636  -AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIE  460
             AVFTGDTLF  GCGKFFEGTAEQMY++L + L  LP  T VYC HEYTV NL+F   +E
Sbjct  177  PAVFTGDTLFVAGCGKFFEGTAEQMYKALIEILGRLPPETRVYCGHEYTVSNLKFARHVE  236

Query  459  PDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKK  280
            P N  +++KLEWA+++     PTIPST+ DE   NPF+RV    +QD ++   P+E ++ 
Sbjct  237  PLNEVIQKKLEWAKEKCSDGEPTIPSTLADEFTFNPFMRVKEKSVQDHVKQTDPIETMRS  296

Query  279  LRQLKD  262
            LR+ KD
Sbjct  297  LRKEKD  302



>ref|XP_007557435.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X2 [Poecilia formosa]
 ref|XP_007557440.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X2 [Poecilia formosa]
Length=260

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 167/245 (68%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE ++EAA VDP +  KV++A   +  ++  VLTTHHH  HAGGNEKM +++
Sbjct  11   DNYMYLLIDEESKEAAIVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMVKLM  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D V+  T  V   +T  LG+ + + CL TPCHT GHI Y+V+ +   +P 
Sbjct  71   PGLKVYGGD-DRVDAITKKVSHSNTFKLGSLS-VKCLFTPCHTTGHICYYVTKESSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTAEQMY++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTAEQMYKALIEILGRLPPETRVYCGHEYTVSNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  +++KL WA+++     PTIPST+ DE   NPF+RV    +QD ++   P+E ++ L
Sbjct  189  QNEVIQKKLAWAKEKCSDGEPTIPSTLADEFTFNPFMRVKEKSVQDHVKQTDPIETMRSL  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_007557434.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X1 [Poecilia formosa]
 ref|XP_007557439.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X1 [Poecilia formosa]
Length=309

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 167/246 (68%), Gaps = 3/246 (1%)
 Frame = -3

Query  996  DDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEM  817
             D Y YL+IDE ++EAA VDP +  KV++A   +  ++  VLTTHHH  HAGGNEKM ++
Sbjct  59   SDNYMYLLIDEESKEAAIVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMVKL  118

Query  816  VPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP  637
            +PG++VYGG  D V+  T  V   +T  LG+ + + CL TPCHT GHI Y+V+ +   +P
Sbjct  119  MPGLKVYGGD-DRVDAITKKVSHSNTFKLGSLS-VKCLFTPCHTTGHICYYVTKESSSEP  176

Query  636  -AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIE  460
             AVFTGDTLF  GCGKFFEGTAEQMY++L + L  LP  T VYC HEYTV NL+F   +E
Sbjct  177  PAVFTGDTLFVAGCGKFFEGTAEQMYKALIEILGRLPPETRVYCGHEYTVSNLKFARHVE  236

Query  459  PDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKK  280
            P N  +++KL WA+++     PTIPST+ DE   NPF+RV    +QD ++   P+E ++ 
Sbjct  237  PQNEVIQKKLAWAKEKCSDGEPTIPSTLADEFTFNPFMRVKEKSVQDHVKQTDPIETMRS  296

Query  279  LRQLKD  262
            LR+ KD
Sbjct  297  LRKEKD  302



>ref|XP_005808795.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
[Xiphophorus maculatus]
Length=309

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 167/246 (68%), Gaps = 3/246 (1%)
 Frame = -3

Query  996  DDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEM  817
             D Y YL+IDE ++EAA VDP +  KV++A   +  ++  VLTTHHH  HAGGNEKM ++
Sbjct  59   SDNYMYLLIDEESKEAAIVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMVKL  118

Query  816  VPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP  637
            +PG++VYGG  D V+  T  V   +T  LG+   + CL TPCHT GHI Y+V+ +   +P
Sbjct  119  MPGLKVYGGD-DRVDAITKKVSHSNTFKLGSLI-VKCLFTPCHTTGHICYYVTKESSSEP  176

Query  636  -AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIE  460
             AVFTGDTLF  GCGKFFEGTAEQMY++L + L  LP  T VYC HEYTV NL+F   +E
Sbjct  177  PAVFTGDTLFVAGCGKFFEGTAEQMYKALIEILGRLPPETRVYCGHEYTVSNLKFARHVE  236

Query  459  PDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKK  280
            P N  +++KL WA+++     PTIPST+ DE   NPF+RV    +QD ++  +P+E ++ 
Sbjct  237  PHNEVIQKKLAWAKEKCSDGEPTIPSTLADEFTFNPFMRVKEKSVQDHVKQTNPIETMRS  296

Query  279  LRQLKD  262
            LR+ KD
Sbjct  297  LRKEKD  302



>ref|XP_008286134.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Stegastes 
partitus]
 ref|XP_008286135.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Stegastes 
partitus]
Length=309

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 164/245 (67%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID  +REAA VDP +  KV++A   +  ++  VLTTHHH  HA GNEKM +++
Sbjct  60   DNYMYLLIDTESREAAIVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHASGNEKMVKIM  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D V+  T  V   +T  LG+   + CL TPCHT GHI Y+V+ +   +P 
Sbjct  120  PGLKVYGGD-DRVDAITKKVSHSNTFKLGSLN-VKCLFTPCHTTGHICYYVTKENSTEPP  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTAEQMY++L   L  LP  T VYC HEYTV NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFFEGTAEQMYKALIDILGRLPPETRVYCGHEYTVSNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            DN  +K+KL WA+++     PTIPST+ DE   NPF+RV    +QD ++   P+E ++ L
Sbjct  238  DNEVIKKKLAWAKEKCSIGEPTIPSTLADEFTFNPFMRVKEKSVQDHVKQTDPIETMRSL  297

Query  276  RQLKD  262
            R+ KD
Sbjct  298  RKEKD  302



>ref|XP_005461151.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X2 [Oreochromis niloticus]
 ref|XP_005461152.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X3 [Oreochromis niloticus]
Length=260

 Score =   257 bits (657),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 167/245 (68%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID  +REAA VDP +  KV++A   +  ++  VLTTHHH  HAGGNEKM +++
Sbjct  11   DNYMYLLIDVDSREAAIVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMLKLM  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D V+  T  V   +T  +G+   + CL TPCHT GHI Y+V+ +   +P 
Sbjct  71   PGLKVYGGD-DRVDAITKKVSHSNTFKVGSLN-VKCLSTPCHTTGHICYYVTKENSTEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTAEQM+++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTAEQMHKALIEILGRLPPETHVYCGHEYTVNNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            DN  ++EKL WA+++     PTIPST+ DE   NPF+RV  P +Q+ ++   P+E ++ L
Sbjct  189  DNEVIQEKLAWAKEKCNNGEPTIPSTLADEFTYNPFMRVKEPSVQEYVKQTDPIETMRSL  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>gb|EFX88128.1| hypothetical protein DAPPUDRAFT_96363 [Daphnia pulex]
Length=259

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 171/256 (67%), Gaps = 4/256 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK+  +   +D+ Y YL++DES+ EAA VDP +  KV++  +    ++  VLTTHHH  H
Sbjct  1     MKVHIIPALQDN-YMYLLVDESSNEAAIVDPVNPSKVVEIVNQENVKLTTVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNE++ ++VPG+ VYGG  + +      V  GD + +G    I CL TPCHT+GHI Y
Sbjct  60    AGGNEELVKLVPGLAVYGGD-NRIGALNKKVSHGDKLQVGNLE-IQCLFTPCHTSGHICY  117

Query  666   FV-SSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTV  490
             ++ SS   GQ AVFTGDTLF GGCG+FFEGTA+QMY +L   L ALP  T VYC HEY++
Sbjct  118   YLPSSSVNGQSAVFTGDTLFQGGCGRFFEGTADQMYHALINVLGALPDDTRVYCGHEYSL  177

Query  489   KNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLE  310
             +NL FG  +EP+N  V +++ WAR+QR+ + PTIPS + +E + NPF+RV  P +Q   +
Sbjct  178   QNLAFGLYVEPNNEFVSKRISWAREQREKSQPTIPSLLSEEKQFNPFMRVHEPSVQSHAK  237

Query  309   SKSPVEALKKLRQLKD  262
                P+E +K LR  KD
Sbjct  238   QTDPIETMKSLRTEKD  253



>ref|XP_011063845.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Acromyrmex echinatior]
Length=254

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 169/256 (66%), Gaps = 5/256 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  +   +D+ Y YLIIDE T+EAA VDP D E V  A   N  ++  VLTTHHH  H
Sbjct  1     MKIQILPALQDN-YMYLIIDEETQEAAIVDPVDPEAVTAAVQQNDVKLTKVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN K+ +    + +YGG  D +E     +   DT  +G  + + CL TPCHT GHI Y
Sbjct  60    AGGNAKLSKSFADLVIYGGD-DRIEAINRKIMHNDTFNIGNLS-VKCLATPCHTRGHICY  117

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ +  GQ +VFTGDTLFAGGCGKFFEGTA+QMY++L + L +LP+ T VYC HEYTV 
Sbjct  118   YVTGE--GQHSVFTGDTLFAGGCGKFFEGTADQMYKALIEILGSLPEETKVYCGHEYTVN  175

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+FG  +EP+NV +++KL+    QR  NLPT+PSTI+DE  TNPF+RV  P +   +  
Sbjct  176   NLKFGLHVEPENVAIQQKLDQVHIQRANNLPTVPSTIKDEKLTNPFMRVHEPSVMKHVRQ  235

Query  306   KSPVEALKKLRQLKDK  259
               P++ +  LR+ KD 
Sbjct  236   NDPIQTMSHLRREKDN  251



>ref|XP_003456418.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X1 [Oreochromis niloticus]
Length=309

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 167/246 (68%), Gaps = 3/246 (1%)
 Frame = -3

Query  996  DDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEM  817
             D Y YL+ID  +REAA VDP +  KV++A   +  ++  VLTTHHH  HAGGNEKM ++
Sbjct  59   SDNYMYLLIDVDSREAAIVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMLKL  118

Query  816  VPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP  637
            +PG++VYGG  D V+  T  V   +T  +G+   + CL TPCHT GHI Y+V+ +   +P
Sbjct  119  MPGLKVYGGD-DRVDAITKKVSHSNTFKVGSLN-VKCLSTPCHTTGHICYYVTKENSTEP  176

Query  636  -AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIE  460
             AVFTGDTLF  GCGKFFEGTAEQM+++L + L  LP  T VYC HEYTV NL+F   +E
Sbjct  177  PAVFTGDTLFVAGCGKFFEGTAEQMHKALIEILGRLPPETHVYCGHEYTVNNLKFARHVE  236

Query  459  PDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKK  280
            PDN  ++EKL WA+++     PTIPST+ DE   NPF+RV  P +Q+ ++   P+E ++ 
Sbjct  237  PDNEVIQEKLAWAKEKCNNGEPTIPSTLADEFTYNPFMRVKEPSVQEYVKQTDPIETMRS  296

Query  279  LRQLKD  262
            LR+ KD
Sbjct  297  LRKEKD  302



>ref|XP_783848.2| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
[Strongylocentrotus purpuratus]
Length=258

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/255 (50%), Positives = 163/255 (64%), Gaps = 3/255 (1%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  +   ED+ Y YL+ DE+T+EAA VDP D EKVL+A       +  VLTTHHH  H
Sbjct  1     MKITLLSALEDN-YMYLLTDEATKEAAIVDPVDPEKVLKAVQEEGVNLTTVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+ ++  G+ V GG  D +      V  GD   +G    + CL TPCHT GHI Y
Sbjct  60    AGGNEKLVKLTSGLTVCGGD-DRIGALNKKVGHGDEFKVGNLQ-VRCLFTPCHTTGHICY  117

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             FV       P VFTGDTLF  GCG+FFEGT +QMY +L + L+ LP  T V+C HEY+V 
Sbjct  118   FVQGDPSEAPVVFTGDTLFLSGCGRFFEGTPDQMYAALIEKLSKLPDNTNVFCGHEYSVS  177

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             +L F  ++EPDNV +++KLEWA+ QR   LPTIPST+ +E   NPF+RV    IQD + S
Sbjct  178   SLSFALSVEPDNVSIQKKLEWAKDQRAKKLPTIPSTLAEEKAYNPFMRVGAKSIQDHVGS  237

Query  306   KSPVEALKKLRQLKD  262
               P+E + +LR+ KD
Sbjct  238   TEPIEVMGRLRKEKD  252



>ref|XP_010872543.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Esox lucius]
Length=313

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 161/245 (66%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP +  KVL+A   +A  +  VLTTHHH  HAGGNEKM  +V
Sbjct  64   DNYMYLLIDEETKEAAIVDPVEPVKVLEAVRKHAVRLTTVLTTHHHWDHAGGNEKMVRLV  123

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG+ VYGG  D V+  T  V+  +T  +G+   + CL TPCHT GHI Y V+     +P 
Sbjct  124  PGLTVYGGD-DRVDALTKKVKHSNTFKVGSLN-VKCLFTPCHTTGHICYLVTKDNSNEPP  181

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEG+AEQMY +L   L  LP  T VYC HEYTV NL+F   +EP
Sbjct  182  AVFTGDTLFVAGCGKFFEGSAEQMYRALIDVLGRLPPETRVYCGHEYTVNNLKFARHVEP  241

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            DN  +K+KL WA+++     PTIPST+ +E + NPF+RV    +Q+      P+E ++ +
Sbjct  242  DNEVIKKKLAWAKEKVSNGEPTIPSTLAEEFKFNPFMRVKEKSVQEHAGQNDPIETMRSI  301

Query  276  RQLKD  262
            R+ KD
Sbjct  302  RKEKD  306



>ref|XP_011063844.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Acromyrmex echinatior]
 gb|EGI59609.1| Hydroxyacylglutathione hydrolase, mitochondrial [Acromyrmex echinatior]
Length=299

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 169/256 (66%), Gaps = 5/256 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  +   +D+ Y YLIIDE T+EAA VDP D E V  A   N  ++  VLTTHHH  H
Sbjct  46    MKIQILPALQDN-YMYLIIDEETQEAAIVDPVDPEAVTAAVQQNDVKLTKVLTTHHHWDH  104

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN K+ +    + +YGG  D +E     +   DT  +G  + + CL TPCHT GHI Y
Sbjct  105   AGGNAKLSKSFADLVIYGGD-DRIEAINRKIMHNDTFNIGNLS-VKCLATPCHTRGHICY  162

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ +  GQ +VFTGDTLFAGGCGKFFEGTA+QMY++L + L +LP+ T VYC HEYTV 
Sbjct  163   YVTGE--GQHSVFTGDTLFAGGCGKFFEGTADQMYKALIEILGSLPEETKVYCGHEYTVN  220

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+FG  +EP+NV +++KL+    QR  NLPT+PSTI+DE  TNPF+RV  P +   +  
Sbjct  221   NLKFGLHVEPENVAIQQKLDQVHIQRANNLPTVPSTIKDEKLTNPFMRVHEPSVMKHVRQ  280

Query  306   KSPVEALKKLRQLKDK  259
               P++ +  LR+ KD 
Sbjct  281   NDPIQTMSHLRREKDN  296



>ref|XP_003702211.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
[Megachile rotundata]
Length=301

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 165/245 (67%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE+++EAA VDP D + V+ A   N   +  VLTTHHH  HAGGN K+ +  
Sbjct  57   DNYMYLIIDEASQEAAIVDPVDPDSVVSAVQQNNVNLTKVLTTHHHWDHAGGNAKLCKKF  116

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQPA  634
              ++VYGG  D +E  T  V+  DT  +G    + CL TPCHT+GHI Y+V+  +   P+
Sbjct  117  NNLQVYGGD-DRIEALTCKVKHDDTFNIGRLQ-VKCLATPCHTSGHICYYVTGDQD-PPS  173

Query  633  VFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEPD  454
            VFTGDTLFAGGCG+FFEGTAEQMY++L   L +LP  T VYC HEYT  NL+FG  +EP+
Sbjct  174  VFTGDTLFAGGCGRFFEGTAEQMYKALITVLGSLPDETKVYCGHEYTGNNLKFGKFVEPE  233

Query  453  NVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKLR  274
            N  +++K+EW R QR+ N PT+PSTI++E  TNPF+RV    + D  E K P++ +  LR
Sbjct  234  NEAIRQKMEWVRIQREKNYPTVPSTIQEEKLTNPFMRVHEQSVMDHTEQKDPIQTMAFLR  293

Query  273  QLKDK  259
            + KD 
Sbjct  294  REKDN  298



>gb|ACQ57952.1| Hydroxyacylglutathione hydrolase [Anoplopoma fimbria]
Length=260

 Score =   255 bits (651),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 164/245 (67%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID  +REAA VDP +  KV++A   +  ++  VLTTHHH  HAGGNEKM +++
Sbjct  11   DNYMYLLIDVDSREAAVVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMVKLM  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG+RVYGG  D V+  T  V     I +G+   + CL TPCHT GH  Y+V+  +  +P 
Sbjct  71   PGLRVYGGD-DRVDAITKKVSHSHNIKVGSLN-VKCLFTPCHTTGHTCYYVTKDKSTEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTAEQM+++L   L  LP  T VYC HEYTV NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTAEQMHKALIDILGILPPETRVYCGHEYTVSNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            DN  ++EKL WA+++     PT+PST+ DE   NPF+RV    +QD ++  +P+E ++ L
Sbjct  189  DNEVIQEKLAWAKEKCSDGEPTVPSTLADEFTFNPFMRVKEKSVQDHVKQTTPIETMRSL  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>gb|EZA56493.1| Hydroxyacylglutathione hydrolase, mitochondrial [Cerapachys biroi]
Length=302

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/256 (49%), Positives = 171/256 (67%), Gaps = 4/256 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK+  +   +D+ Y YLIIDE+T+EAA VDP D + V  A   +  ++  VLTTHHH  H
Sbjct  48    MKVQILPALQDN-YMYLIIDETTQEAAIVDPVDPDAVTTAVKQHNVKLTKVLTTHHHWDH  106

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN K+ +   G+ VYGG  D +E   H +   D + +G  + + CL TPCHT GHI Y
Sbjct  107   AGGNGKLLKSFTGLPVYGGD-DRIEAINHKITHNDVLNIGNLS-VKCLATPCHTRGHICY  164

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+ +E   P+VFTGDTLFAGGCG+FFEGTA+QMY++L + L +LP+ T VYC HEYT  
Sbjct  165   YVTGEEQ-PPSVFTGDTLFAGGCGRFFEGTADQMYKALVEVLGSLPEETNVYCGHEYTAN  223

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+FG  +EP+N  ++EKL+WA  QR  +LPT+PSTI+DE  TNPF+RV    +    + 
Sbjct  224   NLKFGLHVEPENQAIREKLDWAHTQRANSLPTVPSTIKDEKLTNPFMRVHETSVMQHAQQ  283

Query  306   KSPVEALKKLRQLKDK  259
               PV+ +  LR+ KD 
Sbjct  284   NDPVQTMSYLRREKDN  299



>gb|EFZ09440.1| hypothetical protein SINV_15790 [Solenopsis invicta]
Length=242

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 160/241 (66%), Gaps = 4/241 (2%)
 Frame = -3

Query  975  IIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMVPGVRVY  796
            IIDE+T+EAA VDP D E V  A   N  ++  VLTTHHH  HAGGN K+ +    + +Y
Sbjct  1    IIDEATQEAAIVDPVDPEAVTAAVQQNDVKLTKVLTTHHHWDHAGGNAKLSKSFADIAIY  60

Query  795  GGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQ--PAVFTG  622
            GG  D +E   H +   DT  +G  + I CL TPCHT GHI Y+V+   GG+  PAVFTG
Sbjct  61   GGD-DRIEAINHKIMHSDTFNIGNLS-IKCLATPCHTRGHICYYVTGGGGGEHPPAVFTG  118

Query  621  DTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEPDNVRV  442
            DTLFAGGCGKFFEGTA+QMY++L + L +LP+ T VYC HEYTV NL+F   +EP+N  +
Sbjct  119  DTLFAGGCGKFFEGTADQMYKALVEILGSLPEQTKVYCGHEYTVNNLKFALHVEPENATI  178

Query  441  KEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKLRQLKD  262
            ++KL+    QR  NLPT+PSTI+DE  TNPF+RV  P +    +   P++ +  LR+ KD
Sbjct  179  RQKLDMVHTQRANNLPTVPSTIKDEKLTNPFMRVHEPSVMKHAQQNDPIQTMSYLRREKD  238

Query  261  K  259
             
Sbjct  239  N  239



>ref|XP_005734677.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X2 [Pundamilia nyererei]
 ref|XP_005925487.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X2 [Haplochromis burtoni]
 ref|XP_005925488.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X3 [Haplochromis burtoni]
 ref|XP_005925489.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X4 [Haplochromis burtoni]
Length=260

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 166/245 (68%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID  +REAA VDP +  KV++A   +  ++  VLTTHHH  HAGGNEKM +++
Sbjct  11   DNYMYLLIDVDSREAAVVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMLKLM  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D V+  T  V   +T  +G+   + CL TPCHT GHI Y+V+ +   +P 
Sbjct  71   PGLKVYGGD-DRVDAITKKVSHSNTFKVGSLH-VKCLSTPCHTTGHICYYVTKENSTEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTAEQM+++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTAEQMHKALIEILGRLPPETRVYCGHEYTVNNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  +++KL WA+++     PTIPST+ DE   NPF+RV  P +Q+ ++   P+E ++ L
Sbjct  189  HNEVIQKKLAWAKEKCSNGEPTIPSTLADEFTFNPFMRVKEPSVQEHVKQTDPIETMRSL  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_005707034.1| hydroxyacylglutathione hydrolase [Galdieria sulphuraria]
 gb|EME30514.1| hydroxyacylglutathione hydrolase [Galdieria sulphuraria]
Length=266

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 170/262 (65%), Gaps = 3/262 (1%)
 Frame = -3

Query  1041  QKLTPMKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTH  862
             + L+P+  V       D Y+YL+ID +   AAA+DPA+ EKVL+ A     ++  VLTTH
Sbjct  4     EALSPIARVVTIPVLSDNYAYLLIDTTKNVAAAIDPAEPEKVLEVATKERVKLTHVLTTH  63

Query  861   HHHYHAGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTN  682
              H  HA GN+KM E+V G+ + GG LD+V+G T  V+DG  I +G    I  L TPCHT 
Sbjct  64    KHWDHAAGNKKMAELVFGITIVGGELDEVDGATLSVKDGQIIHVGN-ICIKALHTPCHTK  122

Query  681   GHISYFVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAH  502
             GHI Y+V++ +   P VFTGDTLF  GCGKFFEGTA+ M+ SL + L  LP  T V+C H
Sbjct  123   GHICYYVTTTDSSPPQVFTGDTLFIAGCGKFFEGTAKDMFHSLLQVLRVLPLDTRVWCGH  182

Query  501   EYTVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQ  322
             EYTVKNL+F  T+E +N  ++ KL WA Q+R  + PT+PST+ +E++ NPF+RV   K+Q
Sbjct  183   EYTVKNLQFAKTVETNNSFIQTKLAWAEQRRSLHEPTVPSTLSEEVQYNPFMRVTEKKLQ  242

Query  321   DKLE--SKSPVEALKKLRQLKD  262
             + L      PV+ L  LR+ KD
Sbjct  243   ESLRMLDSDPVDILAYLRKQKD  264



>ref|XP_004071735.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
[Oryzias latipes]
Length=331

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/247 (52%), Positives = 168/247 (68%), Gaps = 5/247 (2%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE ++EAA VDP +  KV++A   +  ++  VLTTHHH  HAGGNEKM +++
Sbjct  60   DNYMYLLIDEDSKEAAIVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMVKLM  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQ--  640
            PG++V GG  D V+  T  V   +T+ LG+ + I CL TPCHT GHI Y+V+ +EG    
Sbjct  120  PGLKVCGGD-DRVDAITKKVSHSNTLKLGSLS-IKCLFTPCHTTGHICYYVT-REGSSEP  176

Query  639  PAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIE  460
            PAVFTGDTLF  GCGKFFEGTAEQMYE+L + L  LP  T VYC HEYTV NL+F   +E
Sbjct  177  PAVFTGDTLFVAGCGKFFEGTAEQMYEALIEILGNLPPETRVYCGHEYTVSNLKFARHVE  236

Query  459  PDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKK  280
            P N  +K+KL WA+ +   + PT+PST+ +E E NPFLR+ +  +Q       PVE L+ 
Sbjct  237  PHNEVIKKKLAWAKARDDDDKPTVPSTLVEEFEYNPFLRLSVEAVQKFTGKTEPVEVLRA  296

Query  279  LRQLKDK  259
            LR+ +DK
Sbjct  297  LRKERDK  303



>ref|XP_003396987.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform 2 [Bombus terrestris]
Length=255

 Score =   252 bits (644),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 164/245 (67%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE+++EAA VDP D + V  A   N   +  VLTTHHH  HAGGN  + +  
Sbjct  11   DNYMYLIIDEASQEAAIVDPVDPDSVACAVQQNNVCLTKVLTTHHHWDHAGGNANLCKKF  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQPA  634
              ++VYGG  D +E  T  V+  DT  +G    + CL TPCHT+GHI Y+++  +   PA
Sbjct  71   NNLQVYGGD-DRIEALTCKVKHNDTFNIGKLQ-VRCLATPCHTSGHICYYITGDQES-PA  127

Query  633  VFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEPD  454
            VFTGDTLFAGGCG+FFEGTAEQMY++L + L +LP  T VYC HEYT  NL+FG  +EP+
Sbjct  128  VFTGDTLFAGGCGRFFEGTAEQMYKALIEILGSLPNETKVYCGHEYTGNNLKFGKHVEPE  187

Query  453  NVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKLR  274
            N  +++K+EW R QR+ N PT+PSTI++E  TNPF+RV    + D  E K P++ +  LR
Sbjct  188  NEAIRQKIEWVRIQREKNNPTVPSTIQEEKFTNPFMRVHEQSVMDHTEQKDPIQTMAFLR  247

Query  273  QLKDK  259
            + KD 
Sbjct  248  REKDN  252



>ref|XP_005734676.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X1 [Pundamilia nyererei]
 ref|XP_005925486.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X1 [Haplochromis burtoni]
Length=309

 Score =   254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 166/246 (67%), Gaps = 3/246 (1%)
 Frame = -3

Query  996  DDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEM  817
             D Y YL+ID  +REAA VDP +  KV++A   +  ++  VLTTHHH  HAGGNEKM ++
Sbjct  59   SDNYMYLLIDVDSREAAVVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMLKL  118

Query  816  VPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP  637
            +PG++VYGG  D V+  T  V   +T  +G+   + CL TPCHT GHI Y+V+ +   +P
Sbjct  119  MPGLKVYGGD-DRVDAITKKVSHSNTFKVGSLH-VKCLSTPCHTTGHICYYVTKENSTEP  176

Query  636  -AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIE  460
             AVFTGDTLF  GCGKFFEGTAEQM+++L + L  LP  T VYC HEYTV NL+F   +E
Sbjct  177  PAVFTGDTLFVAGCGKFFEGTAEQMHKALIEILGRLPPETRVYCGHEYTVNNLKFARHVE  236

Query  459  PDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKK  280
            P N  +++KL WA+++     PTIPST+ DE   NPF+RV  P +Q+ ++   P+E ++ 
Sbjct  237  PHNEVIQKKLAWAKEKCSNGEPTIPSTLADEFTFNPFMRVKEPSVQEHVKQTDPIETMRS  296

Query  279  LRQLKD  262
            LR+ KD
Sbjct  297  LRKEKD  302



>ref|XP_010872544.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X3 [Esox lucius]
Length=265

 Score =   252 bits (644),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 127/250 (51%), Positives = 163/250 (65%), Gaps = 8/250 (3%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP +  KVL+A   +A  +  VLTTHHH  HAGGNEKM  +V
Sbjct  11   DNYMYLLIDEETKEAAIVDPVEPVKVLEAVRKHAVRLTTVLTTHHHWDHAGGNEKMVRLV  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG+ VYGG  D V+  T  V+  +T  +G+   + CL TPCHT GHI Y V+     +P 
Sbjct  71   PGLTVYGGD-DRVDALTKKVKHSNTFKVGSLN-VKCLFTPCHTTGHICYLVTKDNSNEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEG+AEQMY +L   L  LP  T VYC HEYTV NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGSAEQMYRALIDVLGRLPPETRVYCGHEYTVNNLKFARHVEP  188

Query  456  DNVRVKEKLEWAR----QQRKFN-LPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVE  292
            DN  +K+KL WA+    Q++  N  PTIPST+ +E + NPF+RV    +Q+      P+E
Sbjct  189  DNEVIKKKLAWAKLLFSQEKVSNGEPTIPSTLAEEFKFNPFMRVKEKSVQEHAGQNDPIE  248

Query  291  ALKKLRQLKD  262
             ++ +R+ KD
Sbjct  249  TMRSIRKEKD  258



>ref|XP_002130731.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
[Ciona intestinalis]
Length=284

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 173/261 (66%), Gaps = 7/261 (3%)
 Frame = -3

Query  1038  KLTPMKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHH  859
             +L  MK+  +   ED+ Y YL++DE T EAA VDP + +KVL+A +    ++  +LTTHH
Sbjct  23    QLNKMKVNLLPALEDN-YMYLLVDEKTNEAAIVDPVEPDKVLKAVEKEGVKLTTILTTHH  81

Query  858   HHYHAGGNEKMKEMV--PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHT  685
             H  HAGGN+++   V    ++VYGG  D ++G T    +G    +G+   I CL TPCHT
Sbjct  82    HWDHAGGNKELISKVGASNLKVYGGD-DRIDGITTKAVEGLEFNVGSLE-IRCLFTPCHT  139

Query  684   NGHISYFVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCA  505
              GHI YFV  K    PAVFTGDTLF  GCG+FFEGTAEQMY SL K L+ LP  T VYC 
Sbjct  140   TGHICYFV--KNPNTPAVFTGDTLFVSGCGRFFEGTAEQMYSSLVKKLSILPPATQVYCG  197

Query  504   HEYTVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKI  325
             HEYTV +L+F   ++P+N  V EKL W+ +QR+ N PTIPSTI +E+  NPF+RV+  ++
Sbjct  198   HEYTVSSLKFAQFVQPNNQHVLEKLNWSIKQRENNQPTIPSTIAEEMLYNPFMRVENEEL  257

Query  324   QDKLESKSPVEALKKLRQLKD  262
             Q + ++ +PVE +K LR  KD
Sbjct  258   QKRCKTSTPVETMKFLRNEKD  278



>ref|XP_003396986.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform 1 [Bombus terrestris]
 ref|XP_003488483.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
[Bombus impatiens]
Length=301

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 164/245 (67%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE+++EAA VDP D + V  A   N   +  VLTTHHH  HAGGN  + +  
Sbjct  57   DNYMYLIIDEASQEAAIVDPVDPDSVACAVQQNNVCLTKVLTTHHHWDHAGGNANLCKKF  116

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQPA  634
              ++VYGG  D +E  T  V+  DT  +G    + CL TPCHT+GHI Y+++  +   PA
Sbjct  117  NNLQVYGGD-DRIEALTCKVKHNDTFNIGKLQ-VRCLATPCHTSGHICYYITGDQES-PA  173

Query  633  VFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEPD  454
            VFTGDTLFAGGCG+FFEGTAEQMY++L + L +LP  T VYC HEYT  NL+FG  +EP+
Sbjct  174  VFTGDTLFAGGCGRFFEGTAEQMYKALIEILGSLPNETKVYCGHEYTGNNLKFGKHVEPE  233

Query  453  NVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKLR  274
            N  +++K+EW R QR+ N PT+PSTI++E  TNPF+RV    + D  E K P++ +  LR
Sbjct  234  NEAIRQKIEWVRIQREKNNPTVPSTIQEEKFTNPFMRVHEQSVMDHTEQKDPIQTMAFLR  293

Query  273  QLKDK  259
            + KD 
Sbjct  294  REKDN  298



>ref|XP_004558408.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X2 [Maylandia zebra]
Length=260

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 165/245 (67%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID  +REAA VDP +  KV++A   +  ++  VLTTHHH  HAGGNEKM +++
Sbjct  11   DNYMYLLIDVDSREAAVVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMLKLM  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D V+  T  V   +   +G+   + CL TPCHT GHI Y+V+ +   +P 
Sbjct  71   PGLKVYGGD-DRVDAITKKVSHSNAFKVGSLH-VKCLSTPCHTTGHICYYVTKENSTEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTAEQM+++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTAEQMHKALIEILGRLPPETRVYCGHEYTVNNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  +++KL WA+++     PTIPST+ DE   NPF+RV  P +Q+ ++   P+E ++ L
Sbjct  189  HNEVIQKKLAWAKEKCSNGEPTIPSTLADEFTFNPFMRVKEPSVQEHVKQTDPIETMRSL  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_010872542.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Esox lucius]
Length=318

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/250 (51%), Positives = 163/250 (65%), Gaps = 8/250 (3%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP +  KVL+A   +A  +  VLTTHHH  HAGGNEKM  +V
Sbjct  64   DNYMYLLIDEETKEAAIVDPVEPVKVLEAVRKHAVRLTTVLTTHHHWDHAGGNEKMVRLV  123

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG+ VYGG  D V+  T  V+  +T  +G+   + CL TPCHT GHI Y V+     +P 
Sbjct  124  PGLTVYGGD-DRVDALTKKVKHSNTFKVGSLN-VKCLFTPCHTTGHICYLVTKDNSNEPP  181

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEG+AEQMY +L   L  LP  T VYC HEYTV NL+F   +EP
Sbjct  182  AVFTGDTLFVAGCGKFFEGSAEQMYRALIDVLGRLPPETRVYCGHEYTVNNLKFARHVEP  241

Query  456  DNVRVKEKLEWAR----QQRKFN-LPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVE  292
            DN  +K+KL WA+    Q++  N  PTIPST+ +E + NPF+RV    +Q+      P+E
Sbjct  242  DNEVIKKKLAWAKLLFSQEKVSNGEPTIPSTLAEEFKFNPFMRVKEKSVQEHAGQNDPIE  301

Query  291  ALKKLRQLKD  262
             ++ +R+ KD
Sbjct  302  TMRSIRKEKD  311



>gb|ELT90617.1| hypothetical protein CAPTEDRAFT_151639 [Capitella teleta]
Length=258

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 173/257 (67%), Gaps = 4/257 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             M++  V   ED+ Y YL++DE+T   AAVDP + EK++ A     A++K +LTTHHH  H
Sbjct  1     MRVRLVPALEDN-YMYLLVDEATGICAAVDPVEPEKIVAAVKEERADLKAILTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             A GNE + ++VPG+ VYGG  D +    H V+ GD   +G+ + + CL TPCHT+GHI +
Sbjct  60    ANGNEALTKLVPGLTVYGGD-DRIGALNHKVKHGDEFKIGSLS-VRCLFTPCHTSGHICF  117

Query  666   FVSSKEGGQ-PAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTV  490
              V++ +    PAVFTGDTLF GGCG+FFEGTA+QM+ +L +TL+ L   T VYC HEYTV
Sbjct  118   LVNNTQTDDAPAVFTGDTLFVGGCGRFFEGTAQQMHTALNETLSKLHPTTKVYCGHEYTV  177

Query  489   KNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLE  310
              NL+F  ++EP+N  V  KL+WA  QRK + PTIPSTI +E++ NPF+RV    IQD + 
Sbjct  178   SNLKFALSVEPENPAVVSKLQWAEAQRKNHQPTIPSTIGEEMQFNPFMRVSEKLIQDHVG  237

Query  309   SKSPVEALKKLRQLKDK  259
             +   +E +  +R+ KD 
Sbjct  238   ASDVIEVMAAIRKEKDN  254



>ref|XP_008210304.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Nasonia vitripennis]
Length=255

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/245 (52%), Positives = 164/245 (67%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   ++VL A   N  ++  +LTTHHH  HAGGN+ +   V
Sbjct  11   DNYMYLIIDEDTQEAAIVDPVSPDQVLAAVKENNCKLTKILTTHHHWDHAGGNKCLSCSV  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQPA  634
            P V+VYGG  D ++  T  V  G  I LG    I CL TPCHT GHI Y+V+ K+  +PA
Sbjct  71   PDVQVYGGD-DRIDALTCKVGHGSVINLGNLK-IECLHTPCHTRGHICYYVT-KDCAEPA  127

Query  633  VFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEPD  454
            VFTGDTLF+GGCG+FFEGTAEQM ++L + LA LP  T VYC HEYT+ NL++G  +EP+
Sbjct  128  VFTGDTLFSGGCGRFFEGTAEQMNKALNEILAKLPDQTKVYCGHEYTINNLKYGRQVEPN  187

Query  453  NVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKLR  274
            N  + EKLEWA  +RK NLPT+PSTI +E   NPF+RV  P ++   +   P++ +  LR
Sbjct  188  NQALVEKLEWACCRRKNNLPTVPSTIGEEKLFNPFMRVCEPTVKAHTQKCDPIDVMASLR  247

Query  273  QLKDK  259
              KD 
Sbjct  248  SEKDN  252



>ref|XP_004558407.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X1 [Maylandia zebra]
Length=309

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 165/246 (67%), Gaps = 3/246 (1%)
 Frame = -3

Query  996  DDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEM  817
             D Y YL+ID  +REAA VDP +  KV++A   +  ++  VLTTHHH  HAGGNEKM ++
Sbjct  59   SDNYMYLLIDVDSREAAVVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMLKL  118

Query  816  VPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP  637
            +PG++VYGG  D V+  T  V   +   +G+   + CL TPCHT GHI Y+V+ +   +P
Sbjct  119  MPGLKVYGGD-DRVDAITKKVSHSNAFKVGSLH-VKCLSTPCHTTGHICYYVTKENSTEP  176

Query  636  -AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIE  460
             AVFTGDTLF  GCGKFFEGTAEQM+++L + L  LP  T VYC HEYTV NL+F   +E
Sbjct  177  PAVFTGDTLFVAGCGKFFEGTAEQMHKALIEILGRLPPETRVYCGHEYTVNNLKFARHVE  236

Query  459  PDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKK  280
            P N  +++KL WA+++     PTIPST+ DE   NPF+RV  P +Q+ ++   P+E ++ 
Sbjct  237  PHNEVIQKKLAWAKEKCSNGEPTIPSTLADEFTFNPFMRVKEPSVQEHVKQTDPIETMRS  296

Query  279  LRQLKD  262
            LR+ KD
Sbjct  297  LRKEKD  302



>ref|XP_008579768.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Galeopterus variegatus]
 ref|XP_008579775.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Galeopterus variegatus]
Length=260

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE TREAA VDP   +KVL+    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDEDTREAAIVDPVQPQKVLETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFV+   G +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLTTLQVGSLN-VKCLSTPCHTSGHICYFVTKPGGSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  + +YC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDSKIYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            DN  V+EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ L
Sbjct  189  DNAAVQEKLAWAKEKYSIGEPTVPSTMAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAL  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>ref|XP_001602195.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Nasonia vitripennis]
Length=302

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 164/244 (67%), Gaps = 3/244 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   ++VL A   N  ++  +LTTHHH  HAGGN+ +   V
Sbjct  58   DNYMYLIIDEDTQEAAIVDPVSPDQVLAAVKENNCKLTKILTTHHHWDHAGGNKCLSCSV  117

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQPA  634
            P V+VYGG  D ++  T  V  G  I LG    I CL TPCHT GHI Y+V+ K+  +PA
Sbjct  118  PDVQVYGGD-DRIDALTCKVGHGSVINLGNLK-IECLHTPCHTRGHICYYVT-KDCAEPA  174

Query  633  VFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEPD  454
            VFTGDTLF+GGCG+FFEGTAEQM ++L + LA LP  T VYC HEYT+ NL++G  +EP+
Sbjct  175  VFTGDTLFSGGCGRFFEGTAEQMNKALNEILAKLPDQTKVYCGHEYTINNLKYGRQVEPN  234

Query  453  NVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKLR  274
            N  + EKLEWA  +RK NLPT+PSTI +E   NPF+RV  P ++   +   P++ +  LR
Sbjct  235  NQALVEKLEWACCRRKNNLPTVPSTIGEEKLFNPFMRVCEPTVKAHTQKCDPIDVMASLR  294

Query  273  QLKD  262
              KD
Sbjct  295  SEKD  298



>ref|NP_001188161.1| hydroxyacylglutathione hydrolase-like protein [Ictalurus punctatus]
 gb|ADO28926.1| hydroxyacylglutathione hydrolase-like protein [Ictalurus punctatus]
Length=280

 Score =   251 bits (640),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/258 (49%), Positives = 168/258 (65%), Gaps = 8/258 (3%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             M++  +   ED+ Y YL+IDE ++EA AVDPA   ++L+  +     +  VLTTHHH  H
Sbjct  1     MRVKVISILEDN-YMYLVIDEQSKEAIAVDPAVPHRLLEIVNREGVRLTAVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             A GN+ + + +P +RVYGG  D + G TH V +G  +       + CL TPCHT+GH+ Y
Sbjct  60    ARGNDALLKDLPDLRVYGGD-DRITGLTHKVTNGQELKFNT-INVRCLFTPCHTSGHMCY  117

Query  666   FVSSKEGG---QPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEY  496
             F+   E G    PAVFTGDTLF GGCGKFFEGTAEQMY +L K L  LP+ T V+C HEY
Sbjct  118   FLW--EDGCPDSPAVFTGDTLFVGGCGKFFEGTAEQMYHNLTKVLGTLPQDTKVFCGHEY  175

Query  495   TVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDK  316
             T+KNL+F   +EP+N RVKEKL WAR + + + PT+PST+ +E E NPFLR+    +Q  
Sbjct  176   TIKNLKFAMLVEPENERVKEKLSWARARDEDDKPTVPSTLLEEFEYNPFLRLSEEDVQKF  235

Query  315   LESKSPVEALKKLRQLKD  262
                  P+E L+ LR+ KD
Sbjct  236   TGKSDPIEVLRVLRKEKD  253



>ref|XP_004522027.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X2 [Ceratitis capitata]
Length=303

 Score =   251 bits (642),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 129/284 (45%), Positives = 181/284 (64%), Gaps = 8/284 (3%)
 Frame = -3

Query  1107  LRVTKTA*LLSLELNQ-EKAIPYQKLTPMKIVPVQCFEDDRYSYLIIDESTREAAAVDPA  931
              RV K   LL + +N+   ++   KL  M I  +   +D+ + YLIID +T+EAA VDP 
Sbjct  22    FRVQK---LLKVGINRMHSSVEDLKLNSMHIKVLPALQDN-FMYLIIDNTTKEAAIVDPV  77

Query  930   DTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV-PGVRVYGGALDDVEGCTHGV  754
             D E VL+A  A   ++  VLTTHHH  HAGGNEK+ ++    + VYGG  D +   T+ V
Sbjct  78    DPESVLEAVRAENVQLTKVLTTHHHWDHAGGNEKLVKLFGKPLTVYGGD-DRIGALTNKV  136

Query  753   QDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQPAVFTGDTLFAGGCGKFFEGTA  574
             +  D+I +G    ++CL TPCHT GHI YFV S  G    VFTGDTLF GGCG+FFEGT 
Sbjct  137   KQDDSITIGNLK-VSCLFTPCHTTGHICYFVESPNGDDRVVFTGDTLFQGGCGRFFEGTP  195

Query  573   EQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNLP  394
             +QMY +LC+ L++LP+ T V+C HEYT++N+ +   +EP N R+ +++EWA+ +R    P
Sbjct  196   DQMYSALCEKLSSLPEDTKVFCGHEYTLQNMAYARHVEPMNDRIMKRIEWAKLRRATKSP  255

Query  393   TIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKLRQLKD  262
             T+PSTI +E   NPF+RV  P +Q     K P++ +  LR+ KD
Sbjct  256   TVPSTIGEEKSWNPFMRVHEPNVQKHAGEKDPIKTMGSLRKEKD  299



>ref|XP_008551511.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Microplitis 
demolitor]
Length=301

 Score =   251 bits (642),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/255 (50%), Positives = 165/255 (65%), Gaps = 5/255 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             +KI+P     DD + YLIIDE T+EAA VDP +   V  A + +  ++  +LTTHHH  H
Sbjct  50    IKILPAL---DDNFMYLIIDEKTKEAAIVDPVNPTLVSSAVEEHKVKLNKILTTHHHWDH  106

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN +M +  P ++V+GG  D V+  T+ V   + I +G    I CL TPCHT+GHI Y
Sbjct  107   AGGNVEMCKKFPNIKVFGGD-DRVDELTNKVSHDELINIGNLK-IKCLSTPCHTSGHICY  164

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             ++S  +   PAVFTGDTLF GGCG+FFEGT EQMY +L K L +LP  T VYC HEYT K
Sbjct  165   YLSGIDNDSPAVFTGDTLFIGGCGRFFEGTPEQMYTALIKILGSLPDETKVYCGHEYTCK  224

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL FG  +EP N  +K++LEWA  QRK   PT+PSTI DE + NPF+RV    ++D   +
Sbjct  225   NLLFGMKVEPSNEDIKKQLEWANNQRKERKPTVPSTIGDEKKFNPFMRVHESSVKDFTGT  284

Query  306   KSPVEALKKLRQLKD  262
                +  + KLRQ KD
Sbjct  285   NDHISTMAKLRQEKD  299



>ref|XP_005081650.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Mesocricetus auratus]
Length=261

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 164/246 (67%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++A   +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  12   DNYMYLVIDEDTKEAAIVDPVQPQKVIEAVKKHRVKLTTVLTTHHHWDHAGGNEKLVKLE  71

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  72   PGLKVYGGD-DRIGALTHRVTHLSTLQVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPS  129

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  130  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGQLPPDTKVYCGHEYTINNLKFARHVEP  189

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            DN  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  190  DNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  249

Query  276  RQLKDK  259
            R+ KD+
Sbjct  250  RREKDQ  255



>ref|XP_005697452.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Capra hircus]
 ref|XP_005697453.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Capra hircus]
Length=260

 Score =   249 bits (637),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 165/246 (67%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++A   + A++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLLIDEDTKEAAIVDPVQPQKVVEAVRKHGAKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFV+     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLH-VKCLSTPCHTSGHICYFVTKPNSPEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV A++ +
Sbjct  189  NNTAIQEKLAWAKEKYSVGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETEPVAAMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RKEKDQ  254



>ref|XP_006971708.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Peromyscus maniculatus bairdii]
Length=261

 Score =   249 bits (637),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 162/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ +M 
Sbjct  12   DNYMYLVIDEDTQEAAIVDPVQPQKVIETVKKHRVKLTTVLTTHHHWDHAGGNEKLVKMQ  71

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ T + CL TPCHT+GHI YFVS     +P 
Sbjct  72   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLT-VKCLSTPCHTSGHICYFVSKPGSSEPS  129

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  130  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTINNLKFARHVEP  189

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  190  SNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKSVQQHAGESDPVTTMRAI  249

Query  276  RQLKDK  259
            R+ KD+
Sbjct  250  RREKDQ  255



>ref|NP_001153098.1| hydroxyacylglutathione hydrolase, mitochondrial isoform 2 [Mus 
musculus]
 ref|XP_006523723.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Mus musculus]
 ref|XP_006523724.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Mus musculus]
 dbj|BAE27615.1| unnamed protein product [Mus musculus]
 dbj|BAE29657.1| unnamed protein product [Mus musculus]
 dbj|BAE30223.1| unnamed protein product [Mus musculus]
 dbj|BAE31462.1| unnamed protein product [Mus musculus]
Length=260

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 164/246 (67%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLIIDEDTQEAAIVDPVQPQKVIEAAKKHRVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPS  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  GNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>ref|XP_004522028.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X3 [Ceratitis capitata]
 ref|XP_004522029.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X4 [Ceratitis capitata]
Length=269

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 170/260 (65%), Gaps = 4/260 (2%)
 Frame = -3

Query  1038  KLTPMKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHH  859
             KL  M I  +   +D+ + YLIID +T+EAA VDP D E VL+A  A   ++  VLTTHH
Sbjct  9     KLNSMHIKVLPALQDN-FMYLIIDNTTKEAAIVDPVDPESVLEAVRAENVQLTKVLTTHH  67

Query  858   HHYHAGGNEKMKEMV-PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTN  682
             H  HAGGNEK+ ++    + VYGG  D +   T+ V+  D+I +G    ++CL TPCHT 
Sbjct  68    HWDHAGGNEKLVKLFGKPLTVYGGD-DRIGALTNKVKQDDSITIGNLK-VSCLFTPCHTT  125

Query  681   GHISYFVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAH  502
             GHI YFV S  G    VFTGDTLF GGCG+FFEGT +QMY +LC+ L++LP+ T V+C H
Sbjct  126   GHICYFVESPNGDDRVVFTGDTLFQGGCGRFFEGTPDQMYSALCEKLSSLPEDTKVFCGH  185

Query  501   EYTVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQ  322
             EYT++N+ +   +EP N R+ +++EWA+ +R    PT+PSTI +E   NPF+RV  P +Q
Sbjct  186   EYTLQNMAYARHVEPMNDRIMKRIEWAKLRRATKSPTVPSTIGEEKSWNPFMRVHEPNVQ  245

Query  321   DKLESKSPVEALKKLRQLKD  262
                  K P++ +  LR+ KD
Sbjct  246   KHAGEKDPIKTMGSLRKEKD  265



>ref|XP_004902582.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Heterocephalus glaber]
 ref|XP_004902583.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Heterocephalus glaber]
 ref|XP_004902584.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X3 [Heterocephalus glaber]
 ref|XP_004873741.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Heterocephalus glaber]
 ref|XP_004873742.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X3 [Heterocephalus glaber]
 gb|EHB14224.1| Hydroxyacylglutathione hydrolase, mitochondrial [Heterocephalus 
glaber]
Length=260

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLLIDEDTQEAAIVDPVQPQKVVETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   I CL TPCHT+GHI YFVS   G +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLN-IKCLSTPCHTSGHICYFVSKPGGSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTADEMYKALIQVLGRLPPETRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  NNTAIQEKLAWAKEKYANGEPTVPSTLAEEFTYNPFMRVREKSVQQHAGEVDPVTTMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>gb|AAH04749.1| Hydroxyacyl glutathione hydrolase [Mus musculus]
 gb|AAH19817.1| Hydroxyacyl glutathione hydrolase [Mus musculus]
Length=260

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 164/246 (67%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLIIDEDTQEAAIVDPVQPQKVIEAAKKHHVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPS  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  GNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>ref|NP_956337.1| hydroxyacylglutathione hydrolase, mitochondrial [Danio rerio]
 gb|AAQ97789.1| hydroxyacyl glutathione hydrolase [Danio rerio]
 gb|AAH60913.1| Hydroxyacylglutathione hydrolase [Danio rerio]
 gb|AAH66607.1| Hagh protein [Danio rerio]
Length=260

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 165/245 (67%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP + +KV+ A   +  ++K VLTTHHH  HAGGNEK+ +++
Sbjct  11   DNYMYLLIDEETKEAAIVDPVEPQKVVDAVKKHGVKLKTVLTTHHHWDHAGGNEKLVKLM  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQ-P  637
            PG+ VYGG  D V   T  V   +T  +G+   + CL TPCHT+GHI YFV+ +   + P
Sbjct  71   PGLTVYGGD-DRVGALTQKVTHYNTFKVGSLN-VKCLFTPCHTSGHICYFVTKENSTEAP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTADEMYKALIEVLGRLPPETRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++ KL WA+++     PTIPST+ +E   NPF+RV    + +   +  P+EA++ +
Sbjct  189  NNEVIRTKLAWAKEKYDNGEPTIPSTVAEEFTFNPFMRVREKSVLEHAGTSDPIEAMRSI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_004522026.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X1 [Ceratitis capitata]
Length=339

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 178/276 (64%), Gaps = 5/276 (2%)
 Frame = -3

Query  1083  LLSLELNQ-EKAIPYQKLTPMKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQA  907
             LL + +N+   ++   KL  M I  +   +D+ + YLIID +T+EAA VDP D E VL+A
Sbjct  63    LLKVGINRMHSSVEDLKLNSMHIKVLPALQDN-FMYLIIDNTTKEAAIVDPVDPESVLEA  121

Query  906   ADANAAEIKIVLTTHHHHYHAGGNEKMKEMVPG-VRVYGGALDDVEGCTHGVQDGDTIAL  730
               A   ++  VLTTHHH  HAGGNEK+ ++    + VYGG  D +   T+ V+  D+I +
Sbjct  122   VRAENVQLTKVLTTHHHWDHAGGNEKLVKLFGKPLTVYGGD-DRIGALTNKVKQDDSITI  180

Query  729   GAYTTITCLLTPCHTNGHISYFVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLC  550
             G    ++CL TPCHT GHI YFV S  G    VFTGDTLF GGCG+FFEGT +QMY +LC
Sbjct  181   GNLK-VSCLFTPCHTTGHICYFVESPNGDDRVVFTGDTLFQGGCGRFFEGTPDQMYSALC  239

Query  549   KTLAALPKLTLVYCAHEYTVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIED  370
             + L++LP+ T V+C HEYT++N+ +   +EP N R+ +++EWA+ +R    PT+PSTI +
Sbjct  240   EKLSSLPEDTKVFCGHEYTLQNMAYARHVEPMNDRIMKRIEWAKLRRATKSPTVPSTIGE  299

Query  369   ELETNPFLRVDLPKIQDKLESKSPVEALKKLRQLKD  262
             E   NPF+RV  P +Q     K P++ +  LR+ KD
Sbjct  300   EKSWNPFMRVHEPNVQKHAGEKDPIKTMGSLRKEKD  335



>ref|XP_004596674.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Ochotona 
princeps]
Length=260

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 160/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KVL     +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDEGTKEAAIVDPVQPQKVLDTVKKHGVKLTTVLTTHHHWDHAGGNEKLVQLQ  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   I CL TPCHT+GH+ Y VS   G +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLN-IKCLFTPCHTSGHVCYLVSKPGGAEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY +L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYRALLEVLGRLPPDTRVYCGHEYTVSNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  +++KL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  NNAAIQQKLAWAKERSGSGEPTVPSTIAEEFTYNPFMRVREKSVQQHAGETDPVTTMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>ref|XP_004627942.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Octodon 
degus]
Length=309

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 164/246 (67%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLLIDEETQEAAIVDPVQPQKVVETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   I CL TPCHT+GHI YFV+   G +P 
Sbjct  120  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLN-IKCLFTPCHTSGHICYFVTKPGGSEPP  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFFEGTADEMYKALLQVLGRLPADTRVYCGHEYTINNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q  +    PV  ++ +
Sbjct  238  NNTAIQEKLAWAKEKYANGEPTVPSTLAEEFTYNPFMRVREKTVQQHVGETDPVTTMRAI  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RREKDQ  303



>ref|XP_006763982.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Myotis 
davidii]
Length=260

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 160/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KV++ A  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLIIDDDTKEAAIVDPVQPQKVVETAKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLH-VKCLSTPCHTSGHICYFVSKPGSSEPS  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY +L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTADEMYRALIEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  V+EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  SNTAVQEKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_005163922.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Danio rerio]
 ref|XP_009297606.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Danio rerio]
 sp|Q6P963.2|GLO2_DANRE RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial; 
AltName: Full=Glyoxalase II; Short=Glx II; Flags: Precursor 
[Danio rerio]
Length=303

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 165/245 (67%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP + +KV+ A   +  ++K VLTTHHH  HAGGNEK+ +++
Sbjct  54   DNYMYLLIDEETKEAAIVDPVEPQKVVDAVKKHGVKLKTVLTTHHHWDHAGGNEKLVKLM  113

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQ-P  637
            PG+ VYGG  D V   T  V   +T  +G+   + CL TPCHT+GHI YFV+ +   + P
Sbjct  114  PGLTVYGGD-DRVGALTQKVTHYNTFKVGSLN-VKCLFTPCHTSGHICYFVTKENSTEAP  171

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  172  AVFTGDTLFVAGCGKFFEGTADEMYKALIEVLGRLPPETRVYCGHEYTINNLKFARHVEP  231

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++ KL WA+++     PTIPST+ +E   NPF+RV    + +   +  P+EA++ +
Sbjct  232  NNEVIRTKLAWAKEKYDNGEPTIPSTVAEEFTFNPFMRVREKSVLEHAGTSDPIEAMRSI  291

Query  276  RQLKD  262
            R+ KD
Sbjct  292  RKEKD  296



>gb|ACO10962.1| Hydroxyacylglutathione hydrolase [Caligus rogercresseyi]
Length=269

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 169/261 (65%), Gaps = 8/261 (3%)
 Frame = -3

Query  1035  LTPMKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHH  856
             L+ M I  +  F+D+ Y Y+IIDE +R A  VDPAD + V +        +  +LTTHHH
Sbjct  13    LSGMTIEILPAFKDN-YMYMIIDEKSRTAGIVDPADPDLVAKRVKECNLNLTSILTTHHH  71

Query  855   HYHAGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGH  676
               HAGGN KMKEM P +++YGG  D ++G TH V  GD I + +     C  TPCHT GH
Sbjct  72    WDHAGGNMKMKEMFPDIKIYGGD-DRIDGLTHKVSSGDVIHIDSLQ-FHCHFTPCHTQGH  129

Query  675   ISYFVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEY  496
             I Y  S   G +PAVFTGDTLF GGCG+FFEGTA +M+++L +TL +LP  T VYC HEY
Sbjct  130   ICYHFS---GLEPAVFTGDTLFLGGCGRFFEGTAPEMHKNLMETLGSLPNETKVYCGHEY  186

Query  495   TVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNL--PTIPSTIEDELETNPFLRVDLPKIQ  322
             ++ NL FG+ +EPDN  + +K+ W +++R  +   PT+PSTI +E   NPF+RVD+  +Q
Sbjct  187   SLNNLRFGAHVEPDNKVISDKIAWCKEKRSRDNPEPTVPSTIGEEKSINPFMRVDVESVQ  246

Query  321   DKLESKSPVEALKKLRQLKDK  259
                ++  P+E +K LR  KD 
Sbjct  247   RHTKTSDPIETMKALRDEKDN  267



>ref|XP_005081649.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Mesocricetus auratus]
Length=309

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 164/246 (67%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++A   +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLVIDEDTKEAAIVDPVQPQKVIEAVKKHRVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  120  PGLKVYGGD-DRIGALTHRVTHLSTLQVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPS  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGQLPPDTKVYCGHEYTINNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            DN  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  DNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RREKDQ  303



>ref|XP_005886877.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Bos 
mutus]
Length=260

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++ A  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLLIDEDTKEAAIVDPVQPQKVVETARKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFV+     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLH-VKCLSTPCHTSGHICYFVTKPNSPEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPADTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  V+EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  NNTAVREKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETEPVATMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RKEKDQ  254



>ref|XP_010595725.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Loxodonta africana]
Length=267

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 164/246 (67%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  18   DNYMYLVIDKDTKEAAIVDPVQPQKVMETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  77

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +E  T+ V     + +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  78   PGLKVYGGD-DRIEALTNKVTHLSVLQVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPP  135

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L K L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  136  AVFTGDTLFVAGCGKFYEGTADEMYKALIKVLGQLPPDTKVYCGHEYTINNLKFARYVEP  195

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  +++KL WA+++ +   PT+PSTI +E   NPF+RV    +Q+      PV  ++ +
Sbjct  196  HNTAIQDKLAWAKEKYRIGEPTVPSTIAEEFTYNPFMRVREKSVQEHASETDPVTTMRAI  255

Query  276  RQLKDK  259
            R+ KD+
Sbjct  256  RKEKDQ  261



>ref|XP_006245961.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Rattus norvegicus]
 ref|XP_006245962.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Rattus norvegicus]
Length=261

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 162/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  12   DNYMYLIIDEDTQEAAVVDPVQPQKVIETVKKHRVKLTTVLTTHHHWDHAGGNEKLVKLE  71

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  72   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPS  129

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  130  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFARHVEP  189

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  V+EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  190  GNTAVQEKLAWAKEKNAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  249

Query  276  RQLKDK  259
            R+ KD+
Sbjct  250  RREKDQ  255



>ref|XP_007640382.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X3 [Cricetulus griseus]
 gb|EGW04432.1| Hydroxyacylglutathione hydrolase, mitochondrial [Cricetulus griseus]
Length=260

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++A   +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDEDTKEAAIVDPVQPQKVIEAVKKHHVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLI-VKCLSTPCHTSGHICYFVSKSGSSEPS  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  NNAAIQEKLAWAKEKYAVGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>ref|XP_005866624.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Myotis 
brandtii]
Length=260

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 160/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KV++ A  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLIIDDDTKEAAIVDPVQPQKVVEMAKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLH-VKCLSTPCHTSGHICYFVSKPGSSEPS  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY +L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTADEMYRALIEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  SNTAIQEKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_004652230.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Jaculus 
jaculus]
Length=309

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE TREAA VDP   +KV++A   +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLVIDEDTREAAIVDPVQPQKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  120  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPP  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  SNTAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGESDPVTTMRAI  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RKEKDQ  303



>ref|NP_077246.2| hydroxyacylglutathione hydrolase, mitochondrial isoform 1 precursor 
[Mus musculus]
 gb|EDL22370.1| hydroxyacyl glutathione hydrolase [Mus musculus]
Length=309

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 164/246 (67%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLIIDEDTQEAAIVDPVQPQKVIEAAKKHRVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  120  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPS  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  GNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RREKDQ  303



>ref|XP_006971707.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Peromyscus maniculatus bairdii]
Length=309

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 162/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ +M 
Sbjct  60   DNYMYLVIDEDTQEAAIVDPVQPQKVIETVKKHRVKLTTVLTTHHHWDHAGGNEKLVKMQ  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ T + CL TPCHT+GHI YFVS     +P 
Sbjct  120  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLT-VKCLSTPCHTSGHICYFVSKPGSSEPS  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTINNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  SNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKSVQQHAGESDPVTTMRAI  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RREKDQ  303



>ref|NP_001030351.1| hydroxyacylglutathione hydrolase, mitochondrial [Bos taurus]
 sp|Q3B7M2.3|GLO2_BOVIN RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial; 
AltName: Full=Glyoxalase II; Short=Glx II; Flags: Precursor 
[Bos taurus]
 gb|AAI07546.1| Hydroxyacylglutathione hydrolase [Bos taurus]
 tpg|DAA15563.1| TPA: hydroxyacylglutathione hydrolase, mitochondrial precursor 
[Bos taurus]
Length=308

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++ A  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  59   DNYMYLLIDEDTKEAAIVDPVQPQKVVETARKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  118

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFV+     +P 
Sbjct  119  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLH-VKCLSTPCHTSGHICYFVTKPNSPEPP  176

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  177  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPADTRVYCGHEYTINNLKFARHVEP  236

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            DN  V+EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  237  DNTAVREKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETEPVATMRAI  296

Query  276  RQLKDK  259
            R+ KD+
Sbjct  297  RKEKDQ  302



>sp|Q99KB8.2|GLO2_MOUSE RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial; 
AltName: Full=Glyoxalase II; Short=Glx II; Flags: Precursor 
[Mus musculus]
Length=309

 Score =   249 bits (636),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 164/246 (67%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLIIDEDTQEAAIVDPVQPQKVIEAAKKHHVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  120  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPS  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  GNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RREKDQ  303



>ref|XP_005349197.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Microtus ochrogaster]
Length=261

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  12   DNYMYLIIDEDTKEAAIVDPVQPQKVIETVKKHRVKLTTVLTTHHHWDHAGGNEKLVKLE  71

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  72   PGLKVYGGD-DRIGALTHKVTHLTTLQVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPS  129

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  130  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTINNLKFARHVEP  189

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  V+EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  190  NNAAVQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  249

Query  276  RQLKDK  259
            R+ KD+
Sbjct  250  RREKDQ  255



>gb|ELR62865.1| Hydroxyacylglutathione hydrolase, mitochondrial, partial [Bos 
mutus]
Length=286

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++ A  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  37   DNYMYLLIDEDTKEAAIVDPVQPQKVVETARKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  96

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFV+     +P 
Sbjct  97   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLH-VKCLSTPCHTSGHICYFVTKPNSPEPP  154

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  155  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPADTRVYCGHEYTINNLKFARHVEP  214

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  V+EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  215  NNTAVREKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETEPVATMRAI  274

Query  276  RQLKDK  259
            R+ KD+
Sbjct  275  RKEKDQ  280



>ref|XP_007606645.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X3 [Cricetulus griseus]
Length=260

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++A   +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDEDTKEAAIVDPVQPQKVIEAVKKHHVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLI-VKCLSTPCHTSGHICYFVSKPGSSEPS  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  NNAAIQEKLAWAKEKYAVGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>gb|AIZ09001.1| mitochondrial hydroxyacylglutathione hydrolase precursor [Heterocephalus 
glaber]
Length=309

 Score =   249 bits (635),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLLIDEDTQEAAIVDPVQPQKVVETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   I CL TPCHT+GHI YFVS   G +P 
Sbjct  120  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLN-IKCLSTPCHTSGHICYFVSKPGGSEPP  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFFEGTADEMYKALIQVLGRLPPETRVYCGHEYTINNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  NNTAIQEKLAWAKEKYANGEPTVPSTLAEEFTYNPFMRVREKSVQQHAGEVDPVTTMRAI  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RREKDQ  303



>ref|XP_010618769.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Fukomys 
damarensis]
 ref|XP_010618770.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Fukomys 
damarensis]
Length=260

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++ A     ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLLIDEDTQEAAIVDPVQPQKVVETARKLGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   I CL TPCHT+GHI YFVS   G +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLN-IKCLSTPCHTSGHICYFVSKPGGSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY++L   L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTADEMYKALLLVLGRLPPETRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  SNTAIQEKLAWAKEKYASGEPTVPSTLAEEFTYNPFMRVREKSVQQHAGEVDPVTTMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>ref|XP_008579781.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Galeopterus variegatus]
Length=259

 Score =   247 bits (630),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 163/246 (66%), Gaps = 4/246 (2%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE TREAA VDP   +KVL+    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDEDTREAAIVDPVQPQKVLETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQ-P  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFV+   G + P
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLTTLQVGSL-NVKCLSTPCHTSGHICYFVTKPGGSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  + +YC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDS-IYCGHEYTINNLKFARHVEP  187

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            DN  V+EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ L
Sbjct  188  DNAAVQEKLAWAKEKYSIGEPTVPSTMAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAL  247

Query  276  RQLKDK  259
            R+ KD+
Sbjct  248  RREKDQ  253



>ref|XP_004438245.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
1 [Ceratotherium simum simum]
Length=260

 Score =   247 bits (630),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 161/245 (66%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLIIDDDTKEAAIVDPVQPQKVVETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   I CL TPCHT+GHI YFVS  +   P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLN-IKCLSTPCHTSGHICYFVSKPDSSNPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  NNAAIQEKLAWAKEKYGIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_004873740.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Heterocephalus glaber]
Length=318

 Score =   249 bits (635),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  69   DNYMYLLIDEDTQEAAIVDPVQPQKVVETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  128

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   I CL TPCHT+GHI YFVS   G +P 
Sbjct  129  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLN-IKCLSTPCHTSGHICYFVSKPGGSEPP  186

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  187  AVFTGDTLFVAGCGKFFEGTADEMYKALIQVLGRLPPETRVYCGHEYTINNLKFARHVEP  246

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  247  NNTAIQEKLAWAKEKYANGEPTVPSTLAEEFTYNPFMRVREKSVQQHAGEVDPVTTMRAI  306

Query  276  RQLKDK  259
            R+ KD+
Sbjct  307  RREKDQ  312



>gb|KFM77441.1| Hydroxyacylglutathione hydrolase, mitochondrial, partial [Stegodyphus 
mimosarum]
Length=258

 Score =   247 bits (630),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 122/255 (48%), Positives = 161/255 (63%), Gaps = 3/255 (1%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  +    DD Y YLIIDE T++A  VDP + +KVLQA      E+  VLTTHHH  H
Sbjct  1     MKIKILSAL-DDNYMYLIIDEKTKKAGIVDPVEPKKVLQAVSEEGVELTTVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN ++ ++  G+ VYGG  + + G T  +   D   +G+   +  LLTPCHT GH+ Y
Sbjct  60    AGGNAELIKLKSGLEVYGGDANII-GLTRKLSHDDEFHIGSLV-VKSLLTPCHTRGHVCY  117

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             FV     G PAVFTGDTLF+ GCGKFFEGTAEQMYE+L K L +LP  T VYC HEYT K
Sbjct  118   FVEDSSQGPPAVFTGDTLFSAGCGKFFEGTAEQMYEALIKILGSLPDNTEVYCGHEYTAK  177

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL + + +EP N+ + ++L+WA+ +R    PT+PSTI +E   NPF+RV  P +      
Sbjct  178   NLLYAAHVEPGNIAIHDRLKWAKTKRAAGEPTVPSTIGNEKTFNPFMRVQEPDVLKHTGQ  237

Query  306   KSPVEALKKLRQLKD  262
               P+  ++ LR  K+
Sbjct  238   NDPILVMQALRNEKN  252



>ref|XP_008144612.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Eptesicus 
fuscus]
Length=308

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 160/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KV++ A  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  59   DNYMYLIIDDDTKEAAIVDPVQPQKVVEMAKKHGVKLTTVLTTHHHWDHAGGNEKLVKLQ  118

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH +    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  119  PGLKVYGGD-DRIGALTHKITHLSTLQVGSLN-VKCLSTPCHTSGHICYFVSKPGSSEPS  176

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY +L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  177  AVFTGDTLFVAGCGKFFEGTADEMYRALIEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  236

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  237  SNTAIQEKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  296

Query  276  RQLKD  262
            R+ KD
Sbjct  297  RKEKD  301



>gb|ACO10827.1| Hydroxyacylglutathione hydrolase [Caligus rogercresseyi]
Length=269

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 168/261 (64%), Gaps = 8/261 (3%)
 Frame = -3

Query  1035  LTPMKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHH  856
             L+ M I  +  F+D+ Y Y+IIDE +R A  VDPAD + V +        +  +LTTHHH
Sbjct  13    LSGMTIEILPAFKDN-YMYMIIDEKSRTAGIVDPADPDLVAKRVKECNLNLTSILTTHHH  71

Query  855   HYHAGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGH  676
               HAGGN KMKEM P +++YGG  D ++G TH V  GD I + +     C  TPCHT GH
Sbjct  72    WDHAGGNMKMKEMFPDIKIYGGD-DRIDGLTHKVSSGDVIHIDSLQ-FHCHFTPCHTQGH  129

Query  675   ISYFVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEY  496
             I Y  S   G +PAVFTGDTLF GGCG+FFEGTA +M+++L +TL +LP  T VYC HEY
Sbjct  130   ICYHFS---GLEPAVFTGDTLFLGGCGRFFEGTAPEMHKNLMETLGSLPNETKVYCGHEY  186

Query  495   TVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNL--PTIPSTIEDELETNPFLRVDLPKIQ  322
             ++ NL FG+ +EPDN  + +K+ W + +R  +   PT+PSTI +E   NPF+RVD+  +Q
Sbjct  187   SLNNLRFGAHVEPDNKVISDKIAWCKGKRSGDNPEPTVPSTIGEEKSINPFMRVDVESVQ  246

Query  321   DKLESKSPVEALKKLRQLKDK  259
                ++  P+E +K LR  KD 
Sbjct  247   RHTKTSDPIETMKALRDEKDN  267



>gb|EXX72543.1| hydroxyacylglutathione hydrolase GLO2 [Rhizophagus irregularis 
DAOM 197198w]
Length=280

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 174/269 (65%), Gaps = 9/269 (3%)
 Frame = -3

Query  1065  NQEKAIPYQKLTPMKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAE  886
             N+++ I       MK++P+   +D+ YSYL+IDE T EAA VDPA+ EKVL+        
Sbjct  20    NKKRMIFQTVCNNMKVIPIPVLQDN-YSYLVIDEKTNEAAVVDPAEPEKVLEVVKNQGVN  78

Query  885   IKIVLTTHHHHYHAGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITC  706
             +K ++TTHHH  H+GGN K+ +  P + VYGG  D +      V+D +   +G    +  
Sbjct  79    LKHLITTHHHVDHSGGNTKLVDEKPDLIVYGGD-DRIPSVNKIVKDNEEFKIGQ-IDVKA  136

Query  705   LLTPCHTNGHISYFVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPK  526
             L T CHT+G +S+++  ++    AVFTGDTLF GGCG+FFEGTAEQM+ SL   LA LPK
Sbjct  137   LFTICHTSGSVSFYL--QDENDKAVFTGDTLFIGGCGRFFEGTAEQMHNSLNNILAKLPK  194

Query  525   LTLVYCAHEYTVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFL  346
              T VYC HEYT  NL+F +++EPDN  +K+K++WA +  +    T+PSTI DELE NPF+
Sbjct  195   DTKVYCGHEYTKSNLKFAASVEPDNEFLKQKIQWANENER----TVPSTIGDELEFNPFM  250

Query  345   RVDLPKIQDKLESKSPVEALKKLRQLKDK  259
             RVD   I+     +SPVE +  LR+LK+K
Sbjct  251   RVDKESIKKATSKQSPVEVMAALRELKNK  279



>gb|ELK30111.1| Hydroxyacylglutathione hydrolase, mitochondrial [Myotis davidii]
Length=327

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 160/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KV++ A  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  78   DNYMYLIIDDDTKEAAIVDPVQPQKVVETAKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  137

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  138  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLH-VKCLSTPCHTSGHICYFVSKPGSSEPS  195

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY +L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  196  AVFTGDTLFVAGCGKFFEGTADEMYRALIEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  255

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  V+EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  256  SNTAVQEKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  315

Query  276  RQLKD  262
            R+ KD
Sbjct  316  RKEKD  320



>gb|ESA19588.1| hypothetical protein GLOINDRAFT_344042 [Rhizophagus irregularis 
DAOM 181602]
Length=248

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 169/256 (66%), Gaps = 9/256 (4%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK++P+   +D+ YSYL+IDE T EAA VDPA+ EKVL+        +K ++TTHHH  H
Sbjct  1     MKVIPIPVLQDN-YSYLVIDEKTNEAAVVDPAEPEKVLEVVKNQGVNLKHLITTHHHVDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             +GGN K+ +  P + VYGG  D +      V+D +   +G    +  L T CHT+G +S+
Sbjct  60    SGGNTKLVDEKPDLIVYGGD-DRIPSVNKIVKDNEEFKIGQ-IDVKALFTICHTSGSVSF  117

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             ++  ++    AVFTGDTLF GGCG+FFEGTAEQM+ SL   LA LPK T VYC HEYT  
Sbjct  118   YL--QDENDKAVFTGDTLFIGGCGRFFEGTAEQMHNSLNNILAKLPKDTKVYCGHEYTKS  175

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F +++EPDN  +K+K++WA +  +    T+PSTI DELE NPF+RVD   I+     
Sbjct  176   NLKFAASVEPDNEFLKQKIQWANENER----TVPSTIGDELEFNPFMRVDKESIKKATSK  231

Query  306   KSPVEALKKLRQLKDK  259
             +SPVE +  LR+LK+K
Sbjct  232   QSPVEVMAALRELKNK  247



>ref|XP_004020757.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Ovis 
aries]
Length=308

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  59   DNYMYLLIDEDTKEAAVVDPVQPQKVVETVRKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  118

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFV+     +P 
Sbjct  119  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLH-VKCLSTPCHTSGHICYFVTKPNSAEPP  176

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  177  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  236

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV A++ +
Sbjct  237  NNTAIQEKLAWAKEKYSVGEPTVPSTIAEEFTYNPFMRVREKAVQQHAGETEPVAAMRAI  296

Query  276  RQLKDK  259
            R+ KD+
Sbjct  297  RKEKDQ  302



>dbj|BAE38377.1| unnamed protein product [Mus musculus]
Length=260

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLIIDEDTQEAAIVDPVQPQKVIEAAKKHRVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ + + + + CL TPCHT+GHI YFVS     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVESLS-VKCLSTPCHTSGHICYFVSKPGSSEPS  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  GNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>ref|XP_007655412.1| PREDICTED: LOW QUALITY PROTEIN: hydroxyacylglutathione hydrolase, 
mitochondrial [Ornithorhynchus anatinus]
Length=259

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/256 (49%), Positives = 162/256 (63%), Gaps = 5/256 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK+V +    D+ Y YLIIDE T+EAA VDP   +KVL+    +  ++  VLTTHHH  H
Sbjct  1     MKVVLLPALTDN-YMYLIIDEETKEAAIVDPVQPQKVLETVKKHGVKLTTVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNEK+ +M PG++V+GG  D V   T  V    T+ +G    + CL TPCHT+GHI Y
Sbjct  60    AGGNEKLVKMEPGLKVFGGD-DRVGALTQKVSHLSTLQVGTLH-VKCLFTPCHTSGHICY  117

Query  666   FVSSKEGGQP-AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTV  490
              V   E  +P AVFTGDTLF  GCG FFEGTA++MY++ C  L  LP    VYC HEYT+
Sbjct  118   LVRKPESSEPPAVFTGDTLFVAGCGXFFEGTADEMYKA-CXVLGRLPAPQRVYCGHEYTI  176

Query  489   KNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLE  310
              NL+F   +EPDN  V+EKL WA+++     PTIPST+ +E   NPF+RV    IQ    
Sbjct  177   NNLKFARHVEPDNSAVQEKLAWAKEKYSIGEPTIPSTLAEEFTYNPFMRVREKSIQRHTG  236

Query  309   SKSPVEALKKLRQLKD  262
                PV A++ LR+ KD
Sbjct  237   ETDPVTAMRALRKEKD  252



>ref|XP_006076917.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Bubalus bubalis]
 ref|XP_006076918.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Bubalus bubalis]
Length=260

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 162/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLLIDEDTKEAAIVDPVQPQKVVETVRKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFV+     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLH-VKCLSTPCHTSGHICYFVTKPNSPEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPADTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  NNTAIREKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETEPVATMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RKEKDQ  254



>gb|AAH97301.1| Hagh protein, partial [Rattus norvegicus]
Length=304

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 162/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  55   DNYMYLIIDEDTQEAAVVDPVQPQKVIETVKKHRVKLTTVLTTHHHWDHAGGNEKLVKLE  114

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  115  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPS  172

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  173  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFARHVEP  232

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  V+EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  233  GNTAVQEKLAWAKEKNAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  292

Query  276  RQLKDK  259
            R+ KD+
Sbjct  293  RREKDQ  298



>ref|XP_007100154.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Physeter catodon]
Length=260

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KVL+    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLIIDDDTKEAAIVDPVQPQKVLEMVRKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLN-VKCLSTPCHTSGHICYFVSKPNSPEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
             VFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  VVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTRVYCGHEYTINNLKFACHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q  +    PV  ++ +
Sbjct  189  SNAAIQEKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHVGEMDPVTTMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RKEKDQ  254



>ref|NP_203500.2| hydroxyacylglutathione hydrolase, mitochondrial precursor [Rattus 
norvegicus]
 gb|EDM03882.1| hydroxyacyl glutathione hydrolase [Rattus norvegicus]
Length=309

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 162/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLIIDEDTQEAAVVDPVQPQKVIETVKKHRVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  120  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPS  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  V+EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  GNTAVQEKLAWAKEKNAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RREKDQ  303



>ref|XP_006611214.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X5 [Apis dorsata]
Length=255

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/244 (49%), Positives = 160/244 (66%), Gaps = 3/244 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE+++EAA VDP D + V  A   N   +  VLTTHHH  HAGGN K+ +  
Sbjct  11   DNYMYLIIDETSQEAAIVDPVDPDTVACAVQQNNVSLTKVLTTHHHWDHAGGNIKLCKKF  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQPA  634
              ++VYGG  D +E  T  V+  D   +G    + CL TPCHT GHI ++++  +   PA
Sbjct  71   NNLQVYGGD-DRIEALTCKVKHNDIFNIGKLQ-VQCLSTPCHTTGHICFYITENQDT-PA  127

Query  633  VFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEPD  454
            VFTGDTLF  GCG+FFEGTAEQMY++L + L +LP  T VYC HEYT  NL+F   +EP+
Sbjct  128  VFTGDTLFVAGCGRFFEGTAEQMYKALIEILGSLPNETKVYCGHEYTANNLKFAKHVEPE  187

Query  453  NVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKLR  274
            N  +++K+EW R QR+ N P++PSTI++E  TNPF+RV    + D  E K P++ +  LR
Sbjct  188  NEAIRQKIEWVRIQREKNNPSVPSTIQEEKLTNPFMRVHEQSVMDHTEQKDPIQTMAFLR  247

Query  273  QLKD  262
            + KD
Sbjct  248  REKD  251



>ref|XP_003417826.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Loxodonta africana]
Length=307

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 164/246 (67%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  58   DNYMYLVIDKDTKEAAIVDPVQPQKVMETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  117

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +E  T+ V     + +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  118  PGLKVYGGD-DRIEALTNKVTHLSVLQVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPP  175

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L K L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  176  AVFTGDTLFVAGCGKFYEGTADEMYKALIKVLGQLPPDTKVYCGHEYTINNLKFARYVEP  235

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  +++KL WA+++ +   PT+PSTI +E   NPF+RV    +Q+      PV  ++ +
Sbjct  236  HNTAIQDKLAWAKEKYRIGEPTVPSTIAEEFTYNPFMRVREKSVQEHASETDPVTTMRAI  295

Query  276  RQLKDK  259
            R+ KD+
Sbjct  296  RKEKDQ  301



>ref|XP_003790829.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Otolemur 
garnettii]
Length=309

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 163/245 (67%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV+     +  ++  VLTTHHH  HAGGNEK+ ++V
Sbjct  60   DNYMYLIIDEDTKEAAIVDPVQPQKVVDTVKKHGVKLTTVLTTHHHWDHAGGNEKLIKLV  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQ-P  637
            PG++VYGG  + +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     + P
Sbjct  120  PGLKVYGGD-ERIGALTHKVTHLSTLQVGSLN-VKCLSTPCHTSGHICYFVSKPGVSESP  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTAE+MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFYEGTAEEMYKALLEILGRLPPDTKVYCGHEYTINNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N+ ++EKL WA+++     PT+PST+E+E   NPF+RV    +Q       PV  ++ +
Sbjct  238  NNMAIQEKLAWAKKKYGGGEPTVPSTLEEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  297

Query  276  RQLKD  262
            R+ KD
Sbjct  298  RKEKD  302



>ref|XP_003964596.1| PREDICTED: LOW QUALITY PROTEIN: hydroxyacylglutathione hydrolase, 
mitochondrial-like [Takifugu rubripes]
Length=308

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 161/245 (66%), Gaps = 4/245 (2%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID  +REAA VDP +  KVL+A   +  ++  VLTTHHH  H+ GNEK+  M+
Sbjct  60   DNYMYLLIDADSREAAVVDPVEPVKVLEAVKKHGVKLTTVLTTHHHWDHSSGNEKLLRMM  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQ-P  637
            PG+RVYGG  D V   T  V       LG+  ++ CL TPCHT GH+ Y+V+     + P
Sbjct  120  PGLRVYGGD-DRVNALTKKVTHSHAFKLGSL-SVKCLFTPCHTTGHVCYYVTKDNSDEPP  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTAEQMY++L + L  LP  T VYC HEYTV + +F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFFEGTAEQMYKALVEILGRLPPETRVYCGHEYTV-SXKFARHVEP  236

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            DN  +K+KL WA+++ +   PTIPST+ +E   NPF+RV    +QD ++   PVE ++ L
Sbjct  237  DNDAIKKKLAWAKERYENGEPTIPSTLAEEFTFNPFMRVKEKSVQDHVKQDDPVETMRCL  296

Query  276  RQLKD  262
            R+ KD
Sbjct  297  RKEKD  301



>ref|XP_007528076.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Erinaceus 
europaeus]
Length=308

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  59   DNYMYLIIDEDTKEAAVVDPVQPQKVVETVRKHGVKLTTVLTTHHHWDHAGGNEKLVKLQ  118

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQ-P  637
            PG++VYGG  D +   TH      T+ +G+   + CL TPCHT+GH+ YFVS     + P
Sbjct  119  PGLKVYGGD-DRIGALTHRATHLSTLQVGSLH-VKCLWTPCHTSGHVCYFVSKPNSSESP  176

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++M+++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  177  AVFTGDTLFVAGCGKFYEGTADEMFKALLEVLGRLPPDTRVYCGHEYTVNNLKFARHVEP  236

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PSTI +EL  NPF+RV    +Q       PV  ++ +
Sbjct  237  HNTAIQEKLAWAKEKYSLGEPTVPSTIAEELTYNPFMRVREKTVQQHAGESDPVTTMRAI  296

Query  276  RQLKDK  259
            R+ KD+
Sbjct  297  RKEKDQ  302



>ref|XP_007606644.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Cricetulus griseus]
Length=297

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++A   +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  48   DNYMYLVIDEDTKEAAIVDPVQPQKVIEAVKKHHVKLTTVLTTHHHWDHAGGNEKLVKLE  107

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  108  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLI-VKCLSTPCHTSGHICYFVSKPGSSEPS  165

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  166  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTINNLKFARHVEP  225

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  226  NNAAIQEKLAWAKEKYAVGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  285

Query  276  RQLKDK  259
            R+ KD+
Sbjct  286  RREKDQ  291



>ref|XP_005349196.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Microtus ochrogaster]
Length=309

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLIIDEDTKEAAIVDPVQPQKVIETVKKHRVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  120  PGLKVYGGD-DRIGALTHKVTHLTTLQVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPS  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTINNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  V+EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  NNAAVQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RREKDQ  303



>ref|XP_005391566.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X3 [Chinchilla lanigera]
Length=260

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLLIDEETQEAAIVDPVQPQKVVETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   T+ V    T+ +G+   I CL TPCHT+GHI YFV+   G +P 
Sbjct  71   PGLKVYGGD-DRIGALTNKVSHLSTLQVGSLN-IKCLSTPCHTSGHICYFVTKPGGSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTADEMYKALLQVLGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  NNTAIQEKLAWAKEKYANGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>emb|CDI95494.1| hydroxyacylglutathione hydrolase [Hymenolepis microstoma]
 emb|CDS34423.1| hydroxyacylglutathione hydrolase [Hymenolepis microstoma]
Length=282

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 175/268 (65%), Gaps = 5/268 (2%)
 Frame = -3

Query  1053  AIPYQKLTP--MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIK  880
             ++ Y ++ P  M+++ +    D+ Y YL++DE T + AAVDP + +K+L   + N   + 
Sbjct  16    SLSYPRIRPFAMRVLTIPALSDN-YMYLLVDEKTNQCAAVDPVEPKKLLSKVEKNDLILA  74

Query  879   IVLTTHHHHYHAGGNEKMKEMVPG-VRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCL  703
              VLTTHHH  HAGGN ++  ++   VRVYGG    +E  T+ V  G+TI LG   TITCL
Sbjct  75    CVLTTHHHWDHAGGNNELLNLISTPVRVYGGG-SSIEAVTNQVSHGETINLGKDITITCL  133

Query  702   LTPCHTNGHISYFVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKL  523
              TPCHT  HI Y+ ++ +     VFTGDTLF GGCG+FFEGTAEQMY +L + L  LP  
Sbjct  134   HTPCHTKDHICYYATTSDQSDGCVFTGDTLFLGGCGRFFEGTAEQMYHALIEILGKLPGS  193

Query  522   TLVYCAHEYTVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLR  343
             T VYC HEYTVKN EF  T++ +N  + E+++   + RK    T+P T+ +EL+TNPF+R
Sbjct  194   TKVYCGHEYTVKNFEFAKTVDSENKALLERMDVITKMRKDGKFTVPGTMREELDTNPFMR  253

Query  342   VDLPKIQDKLESKSPVEALKKLRQLKDK  259
             V  P +Q ++++   ++A++ +RQ+KD+
Sbjct  254   VTDPGLQSRVQAIDAIDAMRVVRQMKDR  281



>ref|XP_008504781.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Equus 
przewalskii]
 ref|XP_008504782.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Equus 
przewalskii]
Length=266

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 160/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  17   DNYMYLIIDDDTKEAAIVDPVQPQKVVETVKKHGVKLTTVLTTHHHWDHAGGNEKLIKLE  76

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFV+      P 
Sbjct  77   PGLKVYGGD-DRIGALTHKVAHLSTLQVGSLN-VKCLSTPCHTSGHICYFVTKPNSSDPP  134

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  135  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  194

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  195  NNAAIQEKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  254

Query  276  RQLKD  262
            R+ KD
Sbjct  255  RKEKD  259



>ref|XP_007606643.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Cricetulus griseus]
Length=309

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++A   +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLVIDEDTKEAAIVDPVQPQKVIEAVKKHHVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  120  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLI-VKCLSTPCHTSGHICYFVSKPGSSEPS  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTINNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  NNAAIQEKLAWAKEKYAVGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RREKDQ  303



>ref|XP_006611213.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X4 [Apis dorsata]
Length=302

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/244 (49%), Positives = 160/244 (66%), Gaps = 3/244 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE+++EAA VDP D + V  A   N   +  VLTTHHH  HAGGN K+ +  
Sbjct  58   DNYMYLIIDETSQEAAIVDPVDPDTVACAVQQNNVSLTKVLTTHHHWDHAGGNIKLCKKF  117

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQPA  634
              ++VYGG  D +E  T  V+  D   +G    + CL TPCHT GHI ++++  +   PA
Sbjct  118  NNLQVYGGD-DRIEALTCKVKHNDIFNIGKLQ-VQCLSTPCHTTGHICFYITENQDT-PA  174

Query  633  VFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEPD  454
            VFTGDTLF  GCG+FFEGTAEQMY++L + L +LP  T VYC HEYT  NL+F   +EP+
Sbjct  175  VFTGDTLFVAGCGRFFEGTAEQMYKALIEILGSLPNETKVYCGHEYTANNLKFAKHVEPE  234

Query  453  NVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKLR  274
            N  +++K+EW R QR+ N P++PSTI++E  TNPF+RV    + D  E K P++ +  LR
Sbjct  235  NEAIRQKIEWVRIQREKNNPSVPSTIQEEKLTNPFMRVHEQSVMDHTEQKDPIQTMAFLR  294

Query  273  QLKD  262
            + KD
Sbjct  295  REKD  298



>ref|XP_006568363.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X3 [Apis mellifera]
Length=255

 Score =   244 bits (624),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/244 (49%), Positives = 160/244 (66%), Gaps = 3/244 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE+++EAA VDP D + V  A   N   +  VLTTHHH  HAGGN K+ +  
Sbjct  11   DNYMYLIIDETSQEAAIVDPVDPDTVACAVQQNNVSLTKVLTTHHHWDHAGGNIKLCKKF  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQPA  634
              ++VYGG  + +E  T  V+  D   +G    + CL TPCHT GHI Y+++  +   PA
Sbjct  71   NNLQVYGGD-ERIEALTCKVKHNDIFNIGKLQ-VQCLSTPCHTTGHICYYITENQDV-PA  127

Query  633  VFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEPD  454
            VFTGDTLF  GCG+FFEGTAEQMY++L + L +LP  T VYC HEYT  NL+F   +EP+
Sbjct  128  VFTGDTLFVAGCGRFFEGTAEQMYKALIEILGSLPNETKVYCGHEYTANNLKFAKHVEPE  187

Query  453  NVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKLR  274
            N  +++K+EW R QR+ N P++PSTI++E  TNPF+RV    + D  E K P++ +  LR
Sbjct  188  NEAIRQKIEWVRIQREKNNPSVPSTIQEEKLTNPFMRVHEQSVMDHTEQKDPIQTMAFLR  247

Query  273  QLKD  262
            + KD
Sbjct  248  REKD  251



>gb|AAC39944.1| RSP29 [Rattus norvegicus]
Length=260

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLIIDEDTQEAAVVDPVQPQKVIETVKKHRVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLEVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPS  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T V C HEYTV NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVICGHEYTVNNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  V+EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  GNTAVQEKLAWAKEKNAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>ref|XP_004604249.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Sorex 
araneus]
Length=309

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 159/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE TREAA VDP   +KV++ A     ++  VLTTHHH  HAGGN+K+ ++ 
Sbjct  60   DNYMYLIIDEDTREAAVVDPVQPQKVIETARKQGVKLTTVLTTHHHWDHAGGNDKLVKLA  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  + V   TH      T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  120  PGLKVYGGD-ERVGALTHRATHLSTLQVGSLH-VKCLATPCHTSGHICYFVSKPGTSEPP  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++M ++L + L  LP  T VYC HEYTV NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFFEGTADEMCKALLEVLGRLPPDTRVYCGHEYTVSNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  V+EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  QNTAVREKLAWAKEKYNLGEPTVPSTIAEEFAYNPFMRVREKTVQQHAGESDPVTTMRAI  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RKEKDQ  303



>ref|XP_003693139.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
[Apis florea]
Length=301

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/244 (49%), Positives = 161/244 (66%), Gaps = 4/244 (2%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE+++EAA VDP D + V  A   N   +  VLTTHHH  HAGGN K+ +  
Sbjct  58   DNYMYLIIDETSQEAAIVDPVDPDTVACAVQQNNVTLTKVLTTHHHWDHAGGNTKLCKKF  117

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQPA  634
              ++VYGG  D +E  T  V+  D   +G    + CL TPCHT GHI ++++ ++   PA
Sbjct  118  NNLQVYGGD-DRIEALTCKVKHNDIFNIGKLQ-VQCLSTPCHTTGHICFYITDQDI--PA  173

Query  633  VFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEPD  454
            VFTGDTLF  GCG+FFEGTAEQMY++L + L +LP  T VYC HEYT  NL+F   +EP+
Sbjct  174  VFTGDTLFVAGCGRFFEGTAEQMYKALIEILGSLPNETKVYCGHEYTANNLKFAKHVEPE  233

Query  453  NVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKLR  274
            N  +++K+EW R QR+ N P++PSTI++E  TNPF+RV    + D  E K P++ +  LR
Sbjct  234  NEAIRQKIEWVRIQREKNNPSVPSTIQEEKLTNPFMRVHEQSVMDHTEQKDPIQTMAFLR  293

Query  273  QLKD  262
            + KD
Sbjct  294  REKD  297



>ref|XP_005599127.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Equus 
caballus]
Length=266

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 160/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  17   DNYMYLIIDDDTKEAAIVDPVQPQKVVETVKKHGVKLTTVLTTHHHWDHAGGNEKLIKLE  76

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFV+      P 
Sbjct  77   PGLKVYGGD-DRIGALTHKVAHLSTLQVGSLN-VKCLSTPCHTSGHICYFVTKPNSSDPP  134

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  135  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTRVYCGHEYTINNLKFARHMEP  194

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  195  NNAAIQEKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  254

Query  276  RQLKD  262
            R+ KD
Sbjct  255  RKEKD  259



>ref|XP_006204322.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Vicugna pacos]
Length=260

 Score =   244 bits (624),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 159/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KV++       ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLIIDDDTKEAAIVDPVQPQKVVETVRKYGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHRVTHLSTLQVGSLN-VKCLSTPCHTSGHICYFVSKPNSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  SNAAIQEKLAWAKEKYSAGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_005096292.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X4 [Aplysia californica]
Length=257

 Score =   244 bits (623),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 154/246 (63%), Gaps = 2/246 (1%)
 Frame = -3

Query  996  DDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEM  817
            +D Y YL+IDE T++ A VDP +  KV  A      ++  VLTTHHH  HAGGNEK+ E 
Sbjct  10   EDNYMYLLIDEDTKQCAVVDPVEPAKVQAALKEENVQLTTVLTTHHHWDHAGGNEKLIEA  69

Query  816  VPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP  637
            V G +V  G  + +   T  V  GD + +G+   + CL TPCHT+GHI YFV+   G QP
Sbjct  70   V-GSKVVVGGDERIGALTRKVSHGDELKIGSLN-VKCLYTPCHTSGHICYFVTGPSGSQP  127

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT  QMY +L + LA LP  T VYC HEYTV N +F +T+EP
Sbjct  128  AVFTGDTLFVAGCGKFFEGTPGQMYTALVEILATLPPETKVYCGHEYTVSNFKFAATVEP  187

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  +  +++ A++QR    PTIPSTI DEL  NPF+RV    +Q       PV+ +  L
Sbjct  188  NNSELTARMDLAQKQRNNKEPTIPSTIGDELSFNPFMRVREASVQQHTGQSDPVKVMGAL  247

Query  276  RQLKDK  259
            R  KD 
Sbjct  248  RSAKDN  253



>ref|XP_008068509.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Tarsius 
syrichta]
Length=309

 Score =   246 bits (628),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 159/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV+        ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLVIDEDTKEAAIVDPVQPQKVVDTVRKLGVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS   G +P 
Sbjct  120  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLN-VKCLSTPCHTSGHICYFVSKAGGSEPP  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFFEGTADEMYKALLEVLGRLPPDTKVYCGHEYTINNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA ++     PT+PST+ +E   NPF+RV    +Q       PV  +K +
Sbjct  238  SNAAIQEKLAWAVEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHTGETDPVTTMKAI  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RREKDQ  303



>ref|XP_009090000.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Serinus 
canaria]
 ref|XP_009090001.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Serinus 
canaria]
Length=260

 Score =   244 bits (623),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 157/245 (64%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ TREAA VDP   +KVL A   +  ++  VLTTHHH  HAGGNEK+ +M 
Sbjct  11   DNYMYLLIDQDTREAAIVDPVQPQKVLDAVKKHGVKLTSVLTTHHHWDHAGGNEKLVKME  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG+RVYGG    V   TH V     + +G+ + + CL TPCHT+GHI Y+V+     +P 
Sbjct  71   PGLRVYGGD-SRVGALTHRVSHLTALKVGSLS-VKCLSTPCHTSGHICYYVTKPNSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT E+MY++L + L +L   T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTPEEMYKALIEILGSLDPRTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+ Q     PTIPSTI +E   NPF+RV    +Q+      PV  +  +
Sbjct  189  RNPSIQEKLAWAKAQYDSGEPTIPSTISEEFTYNPFMRVREKSVQEHAGESDPVRVMGAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_006100952.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Myotis 
lucifugus]
Length=307

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 160/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KV++ A  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  58   DNYMYLIIDDDTKEAAIVDPVQPQKVVEMAKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  117

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQPA  634
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P+
Sbjct  118  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLH-VKCLSTPCHTSGHICYFVSKPGSSEPS  175

Query  633  -VFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
             VFTGDTLF  GCGKFFEGTA++MY +L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  176  SVFTGDTLFVAGCGKFFEGTADEMYRALIEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  235

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  236  SNTAIQEKLAWAKEKYSTGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  295

Query  276  RQLKD  262
            R+ KD
Sbjct  296  RKEKD  300



>ref|XP_002402678.1| hydroxyacylglutathione hydrolase, putative [Ixodes scapularis]
 gb|EEC11554.1| hydroxyacylglutathione hydrolase, putative [Ixodes scapularis]
Length=262

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/255 (47%), Positives = 164/255 (64%), Gaps = 8/255 (3%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             M+I  +   +D+ Y YL++D ST+EAA VDP     VL+       ++  VLTTHHH  H
Sbjct  12    MQIKVLNALQDN-YMYLVVDSSTKEAAVVDP-----VLEEVKKLNVKLTTVLTTHHHWDH  65

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             +GGN+K+ E+ PG+ VYGG  D V   T  VQDG+ + +G  T + CL TPCHT+GHI Y
Sbjct  66    SGGNDKLVELSPGLAVYGGD-DRVPKITRHVQDGEQLQVGQLT-VKCLHTPCHTSGHICY  123

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             F  +  G  PAVFTGDT+F  GCGKFFEGTA+QMY++L + LA LP  T V+C HEYT+ 
Sbjct  124   FFPASNGDAPAVFTGDTMFIAGCGKFFEGTADQMYKALVEKLAKLPDATRVFCGHEYTIN  183

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+F + +EP N  + +K+ WA ++R  N PT+PSTI +E   NPF+RV+   +      
Sbjct  184   NLKFAAKVEPGNQAIVDKMAWAEKKRAKNEPTVPSTIAEEKTFNPFMRVNESAVHKHAHL  243

Query  306   KSPVEALKKLRQLKD  262
               P+  +  LR+ KD
Sbjct  244   NDPISTMAYLRKEKD  258



>ref|XP_008926338.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Manacus vitellinus]
Length=282

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 161/245 (66%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP + +KVL A   +   +  VLTTHHH  HA GNE++  + 
Sbjct  11   DNYMYLLIDEETKEAAIVDPVNPQKVLDAVKKHGVRLTTVLTTHHHWDHARGNEELARLC  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEG-GQP  637
            PG+RV+G A   +   T  V  G  +  GA   + CL TPCHT+GH+ YF+   +    P
Sbjct  71   PGLRVFG-ADQRIGALTDTVTHGQELTFGA-IRVRCLFTPCHTSGHMCYFMWEDDSPDAP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            A+F+GDTLF GGCG+FFEGTAEQMY +L + L ALPK T V+C HE TV+NL+F   +EP
Sbjct  129  ALFSGDTLFVGGCGQFFEGTAEQMYTNLTQILGALPKDTKVFCGHECTVRNLKFALKVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  VKEKL WA+Q+   +LPT+PST+++E   NPFLRV    +Q       PVE L++L
Sbjct  189  ENEMVKEKLAWAKQRDDEDLPTVPSTLQEEFLYNPFLRVMEEPVQRFTGQTDPVEVLRRL  248

Query  276  RQLKD  262
            R  +D
Sbjct  249  RTERD  253



>ref|XP_008854439.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Nannospalax galili]
Length=297

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 160/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE TREAA VDP   +KV++       ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  48   DNYMYLVIDEDTREAAIVDPVQPQKVIETVKKQGVKLTTVLTTHHHWDHAGGNEKLVKLE  107

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V     + +G+ T + CL TPCHT+GHI YFVS     +P 
Sbjct  108  PGLKVYGGD-DRIGALTHKVTHLSMLQVGSLT-VKCLSTPCHTSGHICYFVSKPGSSEPS  165

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  166  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTINNLKFARHVEP  225

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  +  +
Sbjct  226  NNAAIQEKLAWAKEKYAIGEPTVPSTLVEEFTYNPFMRVREKTVQQHAGETDPVTTMWAI  285

Query  276  RQLKDK  259
            R+ KD+
Sbjct  286  RREKDQ  291



>ref|XP_006174077.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Camelus ferus]
Length=260

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 159/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV++       ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDDDTKEAAIVDPVQPQKVVETVRKYGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHRVTHLSTLQVGSLN-VKCLSTPCHTSGHICYFVSKPNSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  SNAAIQEKLAWAKEKYSAGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_006568362.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X2 [Apis mellifera]
Length=302

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/244 (49%), Positives = 160/244 (66%), Gaps = 3/244 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE+++EAA VDP D + V  A   N   +  VLTTHHH  HAGGN K+ +  
Sbjct  58   DNYMYLIIDETSQEAAIVDPVDPDTVACAVQQNNVSLTKVLTTHHHWDHAGGNIKLCKKF  117

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQPA  634
              ++VYGG  + +E  T  V+  D   +G    + CL TPCHT GHI Y+++  +   PA
Sbjct  118  NNLQVYGGD-ERIEALTCKVKHNDIFNIGK-LQVQCLSTPCHTTGHICYYITENQDV-PA  174

Query  633  VFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEPD  454
            VFTGDTLF  GCG+FFEGTAEQMY++L + L +LP  T VYC HEYT  NL+F   +EP+
Sbjct  175  VFTGDTLFVAGCGRFFEGTAEQMYKALIEILGSLPNETKVYCGHEYTANNLKFAKHVEPE  234

Query  453  NVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKLR  274
            N  +++K+EW R QR+ N P++PSTI++E  TNPF+RV    + D  E K P++ +  LR
Sbjct  235  NEAIRQKIEWVRIQREKNNPSVPSTIQEEKLTNPFMRVHEQSVMDHTEQKDPIQTMAFLR  294

Query  273  QLKD  262
            + KD
Sbjct  295  REKD  298



>ref|XP_007181750.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Balaenoptera acutorostrata scammoni]
Length=260

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 160/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLIIDDDTKEAAIVDPVQPQKVVEMVRKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLN-VKCLSTPCHTSGHICYFVSKPNSPEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
             VFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T V+C HEYT+ NL+F   +EP
Sbjct  129  VVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTRVFCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  L+ +
Sbjct  189  SNAAIQEKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKAVQQHAGEMDPVTTLRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RKEKDQ  254



>ref|XP_010337341.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Saimiri boliviensis boliviensis]
 ref|XP_010337342.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Saimiri boliviensis boliviensis]
Length=260

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 162/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV++ A  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDDETKEAAIVDPVQPQKVVEEAKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFV+   G QP 
Sbjct  71   PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLN-VKCLSTPCHTSGHICYFVTKPGGSQPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++M ++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPADTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  V+EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  GNAAVQEKLVWAKEKYNIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAV  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>ref|XP_005096291.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X3 [Aplysia californica]
Length=283

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 154/245 (63%), Gaps = 2/245 (1%)
 Frame = -3

Query  996  DDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEM  817
            +D Y YL+IDE T++ A VDP +  KV  A      ++  VLTTHHH  HAGGNEK+ E 
Sbjct  36   EDNYMYLLIDEDTKQCAVVDPVEPAKVQAALKEENVQLTTVLTTHHHWDHAGGNEKLIEA  95

Query  816  VPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP  637
            V G +V  G  + +   T  V  GD + +G+   + CL TPCHT+GHI YFV+   G QP
Sbjct  96   V-GSKVVVGGDERIGALTRKVSHGDELKIGSLN-VKCLYTPCHTSGHICYFVTGPSGSQP  153

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT  QMY +L + LA LP  T VYC HEYTV N +F +T+EP
Sbjct  154  AVFTGDTLFVAGCGKFFEGTPGQMYTALVEILATLPPETKVYCGHEYTVSNFKFAATVEP  213

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  +  +++ A++QR    PTIPSTI DEL  NPF+RV    +Q       PV+ +  L
Sbjct  214  NNSELTARMDLAQKQRNNKEPTIPSTIGDELSFNPFMRVREASVQQHTGQSDPVKVMGAL  273

Query  276  RQLKD  262
            R  KD
Sbjct  274  RSAKD  278



>ref|XP_008488463.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Calypte anna]
Length=282

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 162/246 (66%), Gaps = 5/246 (2%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +K+L+        ++ +LTTHHH  HA GNE++  + 
Sbjct  11   DNYMYLLIDEETKEAAIVDPVQPQKLLEIVRKEEVVLRAILTTHHHWDHARGNEELARLC  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGG--Q  640
            PG+R+YG A + +   TH V     +  GA   + CL TPCHT+GH+ YF+  +EG    
Sbjct  71   PGLRIYG-ADERIGALTHKVTHEQELTFGA-IRVRCLFTPCHTSGHMCYFMW-EEGSPDA  127

Query  639  PAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIE  460
            PA+F+GDTLF GGCGKFFEGTAEQMY +L + L ALPK T V+C HE TV+NL+F   +E
Sbjct  128  PALFSGDTLFVGGCGKFFEGTAEQMYSNLTQVLGALPKETKVFCGHECTVRNLKFALKVE  187

Query  459  PDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKK  280
            P+N  VK+KL WA+Q+   +LPT+PST+++E   NPFLRV    +Q       PVE L+ 
Sbjct  188  PENEMVKKKLAWAKQRDDEDLPTVPSTLQEEFLYNPFLRVTEEALQKFTGQTDPVEVLRT  247

Query  279  LRQLKD  262
            LR  KD
Sbjct  248  LRTQKD  253



>ref|XP_005096289.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X1 [Aplysia californica]
Length=294

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 154/245 (63%), Gaps = 2/245 (1%)
 Frame = -3

Query  996  DDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEM  817
            +D Y YL+IDE T++ A VDP +  KV  A      ++  VLTTHHH  HAGGNEK+ E 
Sbjct  47   EDNYMYLLIDEDTKQCAVVDPVEPAKVQAALKEENVQLTTVLTTHHHWDHAGGNEKLIEA  106

Query  816  VPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP  637
            V G +V  G  + +   T  V  GD + +G+   + CL TPCHT+GHI YFV+   G QP
Sbjct  107  V-GSKVVVGGDERIGALTRKVSHGDELKIGSLN-VKCLYTPCHTSGHICYFVTGPSGSQP  164

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT  QMY +L + LA LP  T VYC HEYTV N +F +T+EP
Sbjct  165  AVFTGDTLFVAGCGKFFEGTPGQMYTALVEILATLPPETKVYCGHEYTVSNFKFAATVEP  224

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  +  +++ A++QR    PTIPSTI DEL  NPF+RV    +Q       PV+ +  L
Sbjct  225  NNSELTARMDLAQKQRNNKEPTIPSTIGDELSFNPFMRVREASVQQHTGQSDPVKVMGAL  284

Query  276  RQLKD  262
            R  KD
Sbjct  285  RSAKD  289



>ref|XP_005391565.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Chinchilla lanigera]
Length=343

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  94   DNYMYLLIDEETQEAAIVDPVQPQKVVETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  153

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   T+ V    T+ +G+   I CL TPCHT+GHI YFV+   G +P 
Sbjct  154  PGLKVYGGD-DRIGALTNKVSHLSTLQVGSLN-IKCLSTPCHTSGHICYFVTKPGGSEPP  211

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  212  AVFTGDTLFVAGCGKFFEGTADEMYKALLQVLGRLPPDTRVYCGHEYTINNLKFARHVEP  271

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  272  NNTAIQEKLAWAKEKYANGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  331

Query  276  RQLKDK  259
            R+ KD+
Sbjct  332  RREKDQ  337



>ref|XP_008631635.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Corvus brachyrhynchos]
 ref|XP_010390600.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Corvus cornix cornix]
Length=260

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 158/245 (64%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KVL A   +  ++  VLTTHHH  HAGGNEK+ +M 
Sbjct  11   DNYMYLLIDQDTKEAAIVDPVQPQKVLDAVKKHGVKLTTVLTTHHHWDHAGGNEKLVKME  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG+RVYGG    V   T  V     + +G+ + + CL TPCHT+GHI Y+V+     +P 
Sbjct  71   PGLRVYGGD-SRVGALTQRVSHLTALKVGSLS-VKCLSTPCHTSGHICYYVTKPNSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT ++MY++L + L +L   T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTPDEMYKALIEILGSLDPKTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+ Q     PTIPSTI +E   NPF+RV    +QD      P+ A+  +
Sbjct  189  NNTSIQEKLAWAKAQYDSGEPTIPSTIAEEFTYNPFMRVREKSVQDHAGETDPIRAMGAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>emb|CDJ39071.1| hydroxyacylglutathione hydrolase, putative [Eimeria tenella]
Length=264

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 169/258 (66%), Gaps = 6/258 (2%)
 Frame = -3

Query  1023  KIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHA  844
             +++PV    D+ Y+YL+ID+ T+ AA VDPA+ EKV+ AA  +   ++  L TH H  H+
Sbjct  5     EVIPVPTLSDN-YAYLLIDKKTKTAACVDPAEPEKVIAAAKEHGVTLQKCLCTHRHADHS  63

Query  843   GGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYF  664
             GGNE++K +VPG+ V G A ++  G T  V DG+T  +G    +  L  PCHT+GH+ Y+
Sbjct  64    GGNEQIKTLVPGIEVIGSAYEETPGRTKAVCDGETFRIGDLL-VKVLHAPCHTSGHVLYY  122

Query  663   VSSK--EGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTV  490
             V S+      P +FTGDTLF  GCG+FFEG A QM+ +L K +  LP  TLVYC HEYTV
Sbjct  123   VESRTDSNATPIIFTGDTLFLAGCGRFFEGDATQMHRALMKIIGELPAETLVYCGHEYTV  182

Query  489   KNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLE  310
              NL+F +++EP+N  V+ KLEWA+QQR    PTIPS+I +E   NPF+RVD P++Q  + 
Sbjct  183   ANLQFAASVEPNNPAVQNKLEWAQQQRNAGKPTIPSSIGEEKTYNPFMRVDKPEVQRAVR  242

Query  309   SKS--PVEALKKLRQLKD  262
             +     V+ +  LR+ K+
Sbjct  243   APEGDEVQTMHILRERKN  260



>ref|XP_005523137.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Pseudopodoces humilis]
 ref|XP_005523138.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X3 [Pseudopodoces humilis]
Length=260

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 157/245 (64%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ TREAA VDP   +KVL A   +  ++  VLTTHHH  HAGGNEK+ +M 
Sbjct  11   DNYMYLLIDQDTREAAIVDPVQPQKVLDAVKKHGVKLTTVLTTHHHWDHAGGNEKLVKME  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG+RVYGG    V   T  V     + +G+ + + CL TPCHT+GHI Y+V+     +P 
Sbjct  71   PGLRVYGGD-GRVGALTQKVSHLTALKVGSLS-VKCLSTPCHTSGHICYYVTKPNSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT E+MY++L + L +L   T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTPEEMYKALIEILGSLDPKTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+ Q     PTIPSTI +E   NPF+RV    +Q+      PV A+  +
Sbjct  189  SNPSIQEKLAWAKAQYDSGEPTIPSTIAEEFTYNPFMRVREKSVQEHAGESDPVRAMGAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_010390601.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Corvus cornix cornix]
Length=282

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 162/245 (66%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KVL A   +  ++  VLTTHHH  HA GNE++ ++ 
Sbjct  11   DNYMYLLIDQDTKEAAIVDPVQPQKVLDAVKKHGVKLTTVLTTHHHWDHARGNEELAQLF  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEG-GQP  637
            PG++V+G A + +   TH V  G  +  GA   + CL TPCHT+GH+ YF+   +    P
Sbjct  71   PGLQVFG-ADERIGALTHKVTHGQELTFGA-IRVRCLFTPCHTSGHMCYFMWEDDSPDAP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            A+F+GDTLF GGCG+FFEGTAEQM+ +L + L  LPK T V+C HE TV+NL+F   +EP
Sbjct  129  ALFSGDTLFVGGCGQFFEGTAEQMHTNLTQILGTLPKDTKVFCGHECTVRNLKFALKVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  VKEKL WARQ+   +LPT+PST+++E   NPFLRV    +Q       PVE L+ L
Sbjct  189  ENEMVKEKLAWARQRDDEDLPTVPSTLQEEFLYNPFLRVTEEPVQRFTGRTDPVEVLRML  248

Query  276  RQLKD  262
            R  +D
Sbjct  249  RSERD  253



>dbj|BAF82844.1| unnamed protein product [Homo sapiens]
Length=260

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV+ AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G++VYGG  D +   TH +    T+ +G+   + CL TPCHT+GHI YFVS   G +P 
Sbjct  71   SGLKVYGGD-DRIGALTHKITHLSTLQVGSLN-VKCLATPCHTSGHICYFVSKPGGSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++M E+L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMCEALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  GNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAV  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>ref|XP_008854438.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Nannospalax galili]
Length=330

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 160/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE TREAA VDP   +KV++       ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  48   DNYMYLVIDEDTREAAIVDPVQPQKVIETVKKQGVKLTTVLTTHHHWDHAGGNEKLVKLE  107

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V     + +G+ T + CL TPCHT+GHI YFVS     +P 
Sbjct  108  PGLKVYGGD-DRIGALTHKVTHLSMLQVGSLT-VKCLSTPCHTSGHICYFVSKPGSSEPS  165

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  166  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTINNLKFARHVEP  225

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  +  +
Sbjct  226  NNAAIQEKLAWAKEKYAIGEPTVPSTLVEEFTYNPFMRVREKTVQQHAGETDPVTTMWAI  285

Query  276  RQLKDK  259
            R+ KD+
Sbjct  286  RREKDQ  291



>ref|XP_005391564.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Chinchilla lanigera]
Length=354

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  105  DNYMYLLIDEETQEAAIVDPVQPQKVVETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  164

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   T+ V    T+ +G+   I CL TPCHT+GHI YFV+   G +P 
Sbjct  165  PGLKVYGGD-DRIGALTNKVSHLSTLQVGSLN-IKCLSTPCHTSGHICYFVTKPGGSEPP  222

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  223  AVFTGDTLFVAGCGKFFEGTADEMYKALLQVLGRLPPDTRVYCGHEYTINNLKFARHVEP  282

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  283  NNTAIQEKLAWAKEKYANGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  342

Query  276  RQLKDK  259
            R+ KD+
Sbjct  343  RREKDQ  348



>ref|XP_005096290.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
isoform X2 [Aplysia californica]
Length=293

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 154/245 (63%), Gaps = 2/245 (1%)
 Frame = -3

Query  996  DDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEM  817
            +D Y YL+IDE T++ A VDP +  KV  A      ++  VLTTHHH  HAGGNEK+ E 
Sbjct  46   EDNYMYLLIDEDTKQCAVVDPVEPAKVQAALKEENVQLTTVLTTHHHWDHAGGNEKLIEA  105

Query  816  VPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP  637
            V G +V  G  + +   T  V  GD + +G+   + CL TPCHT+GHI YFV+   G QP
Sbjct  106  V-GSKVVVGGDERIGALTRKVSHGDELKIGSLN-VKCLYTPCHTSGHICYFVTGPSGSQP  163

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT  QMY +L + LA LP  T VYC HEYTV N +F +T+EP
Sbjct  164  AVFTGDTLFVAGCGKFFEGTPGQMYTALVEILATLPPETKVYCGHEYTVSNFKFAATVEP  223

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  +  +++ A++QR    PTIPSTI DEL  NPF+RV    +Q       PV+ +  L
Sbjct  224  NNSELTARMDLAQKQRNNKEPTIPSTIGDELSFNPFMRVREASVQQHTGQSDPVKVMGAL  283

Query  276  RQLKD  262
            R  KD
Sbjct  284  RSAKD  288



>sp|O35952.2|GLO2_RAT RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial; 
AltName: Full=Glyoxalase II; Short=Glx II; AltName: Full=Round 
spermatid protein RSP29; Flags: Precursor [Rattus norvegicus]
Length=309

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLIIDEDTQEAAVVDPVQPQKVIETVKKHRVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFVS     +P 
Sbjct  120  PGLKVYGGD-DRIGALTHKVTHLSTLEVGSLS-VKCLSTPCHTSGHICYFVSKPGSSEPS  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T V C HEYTV NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVICGHEYTVNNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  V+EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  GNTAVQEKLAWAKEKNAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAI  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RREKDQ  303



>ref|XP_009284756.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Aptenodytes forsteri]
Length=282

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 160/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KVL A   +  ++  VLTTHHH  HA GNE++  + 
Sbjct  11   DNYMYLLIDEETKEAAIVDPVQPQKVLDAVKKHGVKLTTVLTTHHHWDHARGNEELARLC  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFV-SSKEGGQP  637
            PG++VYG A + +   TH V     +  GA   + CL TPCHT+GH+ YF+        P
Sbjct  71   PGLQVYG-ADERIGALTHKVTHDQELTFGA-IRVRCLFTPCHTSGHMCYFMWEDGSPDAP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            A+F+GDTLF GGCGKFFEGTAEQMY +L + L ALPK T V+C HE TV+NL+F   +EP
Sbjct  129  ALFSGDTLFVGGCGKFFEGTAEQMYANLTQILGALPKETKVFCGHECTVRNLKFALKVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  VK+KL WA+Q+   +LPT+PST+++E   NPFLRV    +Q       PVE L+ L
Sbjct  189  ENEMVKKKLAWAKQRDDEDLPTVPSTLQEEFLYNPFLRVMEEPLQKFTGKTDPVEVLRTL  248

Query  276  RQLKD  262
            R  KD
Sbjct  249  RTEKD  253



>gb|KFP72720.1| Hydroxyacylglutathione hydrolase-like, partial [Acanthisitta 
chloris]
Length=260

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 166/256 (65%), Gaps = 4/256 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK+  +   ED+ Y YL+I+ESTR+A AVD A  +++L+        ++ +LTTHHH  H
Sbjct  1     MKVKVISVLEDN-YMYLVIEESTRDAVAVDAAVPKRLLEIIRKEDVVLRAILTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             A GNE++  + PG+RVYG A   +   TH V     +  GA   + CL TPCHT+GH+ Y
Sbjct  60    ARGNEELVRLCPGLRVYG-ADQRIGALTHKVTHEQELTFGA-IRVRCLFTPCHTSGHMCY  117

Query  666   FVSSKEG-GQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTV  490
             F+   +    PA+F+GDTLF GGCG+FFEGTAEQMY +L + L  LPK T V+C HEYTV
Sbjct  118   FMWEDDSPDAPALFSGDTLFVGGCGQFFEGTAEQMYTNLTQVLGTLPKETKVFCGHEYTV  177

Query  489   KNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLE  310
             +NL+F   +EP+N  VKEKL WA+Q+   +LPT+PST+++E   NPFLRV    +Q    
Sbjct  178   RNLKFALKVEPENEMVKEKLAWAKQRDDEDLPTVPSTLQEEFLYNPFLRVMEESVQKFTG  237

Query  309   SKSPVEALKKLRQLKD  262
                PVE L+ LR  +D
Sbjct  238   KTDPVEVLRTLRIERD  253



>gb|KFO58952.1| hypothetical protein N302_11765, partial [Corvus brachyrhynchos]
Length=286

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 158/245 (64%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KVL A   +  ++  VLTTHHH  HAGGNEK+ +M 
Sbjct  37   DNYMYLLIDQDTKEAAIVDPVQPQKVLDAVKKHGVKLTTVLTTHHHWDHAGGNEKLVKME  96

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG+RVYGG    V   T  V     + +G+ + + CL TPCHT+GHI Y+V+     +P 
Sbjct  97   PGLRVYGGD-SRVGALTQRVSHLTALKVGSLS-VKCLSTPCHTSGHICYYVTKPNSSEPP  154

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT ++MY++L + L +L   T VYC HEYT+ NL+F   +EP
Sbjct  155  AVFTGDTLFVAGCGKFFEGTPDEMYKALIEILGSLDPKTRVYCGHEYTINNLKFARHVEP  214

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+ Q     PTIPSTI +E   NPF+RV    +QD      P+ A+  +
Sbjct  215  NNTSIQEKLAWAKAQYDSGEPTIPSTIAEEFTYNPFMRVREKSVQDHAGETDPIRAMGAI  274

Query  276  RQLKD  262
            R+ KD
Sbjct  275  RKEKD  279



>ref|XP_010193210.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Mesitornis unicolor]
Length=260

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 156/245 (64%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KVL A   +  ++  VLTTHHH  HAGGNEK+ +M 
Sbjct  11   DNYMYLLIDEETKEAAIVDPVQPQKVLDAVKKHGVKLTTVLTTHHHWDHAGGNEKLVKME  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G+RVYGG    V   T  V    ++ +G+   + CL TPCHT+GHI Y+V+     +P 
Sbjct  71   SGLRVYGGD-SRVGALTQKVSHLTSLKVGSLN-VKCLCTPCHTSGHICYYVTKPNSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT E+MY +L + L +L   T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTPEEMYRALIEILGSLDPQTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            DNV ++EKL WA+ +     PTIPSTI +E   NPF+RV    +Q       P+ A+  +
Sbjct  189  DNVSIREKLAWAKAKYDSGEPTIPSTIAEEFTYNPFMRVREKTVQQHAGETDPIRAMGAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_004270372.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Orcinus 
orca]
Length=309

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 160/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLIIDDDTKEAAIVDPVQPQKVVEMVRKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQ-P  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     + P
Sbjct  120  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLN-VKCLSTPCHTSGHICYFVSKPNSPERP  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
             VFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  178  VVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  SNAAIQEKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RKEKDQ  303



>ref|XP_001362982.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Monodelphis domestica]
Length=309

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 159/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ +M 
Sbjct  60   DNYMYLIIDEDTKEAAIVDPVQPQKVVETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKME  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G++VYGG  D V   T  V    T+ +G+ T + CL TPCHT+GHI YFVS     +P 
Sbjct  120  RGLKVYGGD-DRVGALTQKVSHLTTLQVGSLT-VKCLSTPCHTSGHICYFVSKPNSSEPP  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFYEGTADEMYKALLEILGRLPPETKVYCGHEYTINNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+ +     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  NNTAIQEKLAWAKTKYGIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  297

Query  276  RQLKD  262
            R+ KD
Sbjct  298  RKEKD  302



>ref|XP_003269190.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Nomascus 
leucogenys]
Length=260

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 160/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV+ AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G++VYGG  D +   TH +    T+ +G+   + CL TPCHT+GHI YFVS   G QP 
Sbjct  71   SGLKVYGGD-DRIGALTHKITHLSTLQVGSLN-VKCLATPCHTSGHICYFVSKPGGSQPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++M ++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPETRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  GNAAIQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAV  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RREKD  253



>emb|CDJ66855.1| hydroxyacylglutathione hydrolase, putative [Eimeria necatrix]
Length=264

 Score =   242 bits (618),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 168/258 (65%), Gaps = 6/258 (2%)
 Frame = -3

Query  1023  KIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHA  844
             +++PV    D+ Y+YL+ID+ T+ AA +DPA+ EKV+ AA  +   ++  L TH H  H+
Sbjct  5     EVIPVPTLSDN-YAYLLIDKKTKTAACIDPAEPEKVIAAAKEHGVTLQKCLCTHRHADHS  63

Query  843   GGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYF  664
             GGNE++K +VPG+ V G A ++  G T  V DG+T  +G    +  L  PCHT+GH+ Y+
Sbjct  64    GGNEQIKTLVPGIEVIGSAYEETPGRTKAVCDGETFRIGDLL-VKVLHAPCHTSGHVLYY  122

Query  663   VSSK--EGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTV  490
             V S+      P +FTGDTLF  GCG+FFEG A QM+ +L K +  LP  TLVYC HEYT+
Sbjct  123   VESRTDSNASPIIFTGDTLFLAGCGRFFEGDATQMHRALMKIIGELPAETLVYCGHEYTL  182

Query  489   KNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLE  310
              NL F +++EP+N  V+ KLEWA+QQR    PTIPS+I +E   NPF+RVD P++Q  + 
Sbjct  183   ANLRFAASVEPNNAAVQNKLEWAQQQRNAGKPTIPSSIGEEKTYNPFMRVDRPEVQRAVR  242

Query  309   SKS--PVEALKKLRQLKD  262
             +     V+ +  LR+ K+
Sbjct  243   APEGDEVQTMHILRERKN  260



>emb|CDI82141.1| hydroxyacylglutathione hydrolase, putative [Eimeria acervulina]
Length=330

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/260 (45%), Positives = 172/260 (66%), Gaps = 7/260 (3%)
 Frame = -3

Query  1023  KIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHA  844
             +++PV    D+ Y+YL+ID  T  AA VDPA+ EKV+ AA      ++  L TH H  H+
Sbjct  68    EVIPVPTLSDN-YAYLLIDRKTNTAACVDPAEPEKVVAAAKERGVTLETCLCTHRHFDHS  126

Query  843   GGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYT--TITCLLTPCHTNGHIS  670
             GGNE++K++VPG+ V G A ++  G T  V DGDT  LG ++   +  L  PCHT GH+ 
Sbjct  127   GGNEQIKKLVPGIEVIGSAYEETPGRTKAVTDGDTFRLGKFSDLQVKVLHAPCHTIGHLL  186

Query  669   YFVSSKE--GGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEY  496
             Y++ S+     +P +FTGDTLF  GCG+FFEG A+QM+ +L KT+ +LP  TLVYC HEY
Sbjct  187   YYLESRTDVNAKPIIFTGDTLFLAGCGRFFEGNAQQMHHALMKTIGSLPAETLVYCGHEY  246

Query  495   TVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDK  316
             T+ NL+F +T+EP+N  ++ KLEWA++Q+    PT+PS+I +E   NPF+RVD P++Q  
Sbjct  247   TIANLKFAATVEPNNFALQNKLEWAQKQQISGKPTVPSSIGEEKAYNPFMRVDRPEVQKA  306

Query  315   LESKS--PVEALKKLRQLKD  262
             + +     ++ +  LR+ K+
Sbjct  307   VGAPEGDEIQTMHILRERKN  326



>ref|XP_003762055.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Sarcophilus 
harrisii]
Length=260

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 158/245 (64%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIIDE T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ +M 
Sbjct  11   DNYMYLIIDEDTKEAAIVDPVQPQKVMETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKME  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G++VYGG  D V   T  V     + +G+ T I CL TPCHT+GHI YFVS     +P 
Sbjct  71   RGLKVYGGD-DRVGALTQKVSHLTMLQVGSLT-IKCLATPCHTSGHICYFVSKPNSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPETKVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +NV ++EKL WA+ +     P +PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  NNVAIQEKLAWAKTKCAVGEPAVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>gb|EFB17173.1| hypothetical protein PANDA_008978 [Ailuropoda melanoleuca]
Length=284

 Score =   243 bits (619),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 159/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KV++       ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  35   DNYMYLIIDDETKEAAIVDPVQPQKVVETVKKRGVKLTTVLTTHHHWDHAGGNEKLVKLE  94

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++V GG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFV+     +P 
Sbjct  95   PGLKVCGGD-DRIGALTHKVTHLSTLQVGSLS-VKCLSTPCHTSGHICYFVTKPGSSEPP  152

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY +L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  153  AVFTGDTLFVAGCGKFYEGTADEMYRALIEILGRLPPDTRVYCGHEYTINNLKFARHVEP  212

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  V+EKL WA+++     PT+PSTI +EL  NPF+RV    +Q       PV  ++ +
Sbjct  213  SNAAVQEKLAWAKEKYSIGEPTVPSTIAEELTYNPFMRVREKTVQQHAGETDPVTTMRAI  272

Query  276  RQLKD  262
            R+ KD
Sbjct  273  RKEKD  277



>ref|XP_004403198.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
2 [Odobenus rosmarus divergens]
 ref|XP_006741986.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Leptonychotes weddellii]
 ref|XP_006741987.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Leptonychotes weddellii]
Length=260

 Score =   241 bits (616),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 160/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLIIDDETKEAAVVDPVQPQKVVETVKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++V GG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  71   PGLKVCGGD-DRIGALTHKVTHLSTLQVGSLN-VKCLSTPCHTSGHICYFVSKPSSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++M+++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMHKALLEILGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  NNAAIQEKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_006637198.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
[Lepisosteus oculatus]
Length=260

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 161/246 (65%), Gaps = 5/246 (2%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE TREAA VDP + +KV+ A   +  ++  VLTTHHH  HAGGNEK+ ++V
Sbjct  11   DNYMYLLIDEETREAAIVDPVEPQKVVDAIKKHRVKLTTVLTTHHHWDHAGGNEKLVKLV  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQ--  640
             G++VYGG  D V   +  V   +T  +G+   + CL TPCHT+GHI YFV+ K+G    
Sbjct  71   SGLKVYGGD-DRVGALSQKVTHYNTFKVGSLN-VKCLFTPCHTSGHICYFVT-KDGSTEP  127

Query  639  PAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIE  460
            PAVFTGDTLF  GCGKFFEGTA++MY++L   L  LP  T VYC HEYT+ NL+F   +E
Sbjct  128  PAVFTGDTLFVAGCGKFFEGTADEMYKALIDVLGKLPPETRVYCGHEYTINNLKFAQHVE  187

Query  459  PDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKK  280
            P N  +++KL WA++      PTIPST+ +E   NPF+RV    +Q+ +    P+  +  
Sbjct  188  PKNEAIRKKLAWAKEVYNKGEPTIPSTMAEEFTYNPFMRVREKAVQEHVGKSDPIPTMAS  247

Query  279  LRQLKD  262
            LR+ KD
Sbjct  248  LRKEKD  253



>ref|XP_010990925.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Camelus 
dromedarius]
Length=309

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 159/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV++       ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLVIDDDTKEAAIVDPVQPQKVVETVRKYGVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  120  PGLKVYGGD-DRIGALTHRVTHLSTLQVGSLN-VKCLSTPCHTSGHICYFVSKPNSSEPP  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  SNAAIQEKLAWAKEKYSAGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  297

Query  276  RQLKD  262
            R+ KD
Sbjct  298  RKEKD  302



>ref|XP_004158977.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like 
[Cucumis sativus]
Length=195

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 140/182 (77%), Gaps = 1/182 (1%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  + C ED+ YSYLIIDEST+EAA VDP + EK++  A+ +   +K+VLTTHHH  H
Sbjct  1     MKIHYIPCLEDN-YSYLIIDESTKEAAVVDPVEPEKIVNIANEHGVHLKLVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             +GGNEK+K++VPG++VYGG++D V+GCT  V++GD I LGA   I  L TPCHT GHISY
Sbjct  60    SGGNEKIKQLVPGIKVYGGSIDKVKGCTDAVENGDKIPLGADVVILSLHTPCHTKGHISY  119

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +VS KEG  PAVFTGDTLF  GCGKFFEGTAEQMY+SLC  L +LPK T VYC HE   K
Sbjct  120   YVSGKEGEDPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCIKLGSLPKQTRVYCGHEDPNK  179

Query  486   NL  481
             ++
Sbjct  180   DI  181



>ref|XP_010948207.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Camelus 
bactrianus]
Length=309

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 159/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV++       ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLVIDDDTKEAAIVDPVQPQKVVETVRKYGVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  120  PGLKVYGGD-DRIGALTHRVTHLSTLQVGSLN-VKCLSTPCHTSGHICYFVSKPSSSEPP  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  178  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  SNAAIQEKLAWAKEKYSAGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  297

Query  276  RQLKD  262
            R+ KD
Sbjct  298  RKEKD  302



>gb|KFQ20623.1| hypothetical protein N332_07325, partial [Mesitornis unicolor]
Length=286

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 156/245 (64%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KVL A   +  ++  VLTTHHH  HAGGNEK+ +M 
Sbjct  37   DNYMYLLIDEETKEAAIVDPVQPQKVLDAVKKHGVKLTTVLTTHHHWDHAGGNEKLVKME  96

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G+RVYGG    V   T  V    ++ +G+   + CL TPCHT+GHI Y+V+     +P 
Sbjct  97   SGLRVYGGD-SRVGALTQKVSHLTSLKVGSLN-VKCLCTPCHTSGHICYYVTKPNSSEPP  154

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT E+MY +L + L +L   T VYC HEYT+ NL+F   +EP
Sbjct  155  AVFTGDTLFVAGCGKFFEGTPEEMYRALIEILGSLDPQTRVYCGHEYTINNLKFARHVEP  214

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            DNV ++EKL WA+ +     PTIPSTI +E   NPF+RV    +Q       P+ A+  +
Sbjct  215  DNVSIREKLAWAKAKYDSGEPTIPSTIAEEFTYNPFMRVREKTVQQHAGETDPIRAMGAI  274

Query  276  RQLKD  262
            R+ KD
Sbjct  275  RKEKD  279



>ref|XP_005590963.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X3 [Macaca fascicularis]
 ref|XP_005590964.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X4 [Macaca fascicularis]
Length=260

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV+ AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLQ  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G++VYGG  D +   TH +    T+ +G+   + CL TPCHT+GHI YFVS   G +P 
Sbjct  71   SGLKVYGGD-DRIGALTHKITHLSTLQVGSLN-VKCLATPCHTSGHICYFVSRPGGSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++M ++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  GNAAIQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHARETDPVTTMRAV  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RKEKDE  254



>ref|XP_009080922.1| PREDICTED: hydroxyacylglutathione hydrolase-like protein [Acanthisitta 
chloris]
Length=282

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 166/256 (65%), Gaps = 4/256 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK+  +   ED+ Y YL+I+ESTR+A AVD A  +++L+        ++ +LTTHHH  H
Sbjct  1     MKVKVISVLEDN-YMYLVIEESTRDAVAVDAAVPKRLLEIIRKEDVVLRAILTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             A GNE++  + PG+RVYG A   +   TH V     +  GA   + CL TPCHT+GH+ Y
Sbjct  60    ARGNEELVRLCPGLRVYG-ADQRIGALTHKVTHEQELTFGA-IRVRCLFTPCHTSGHMCY  117

Query  666   FVSSKEG-GQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTV  490
             F+   +    PA+F+GDTLF GGCG+FFEGTAEQMY +L + L  LPK T V+C HEYTV
Sbjct  118   FMWEDDSPDAPALFSGDTLFVGGCGQFFEGTAEQMYTNLTQVLGTLPKETKVFCGHEYTV  177

Query  489   KNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLE  310
             +NL+F   +EP+N  VKEKL WA+Q+   +LPT+PST+++E   NPFLRV    +Q    
Sbjct  178   RNLKFALKVEPENEMVKEKLAWAKQRDDEDLPTVPSTLQEEFLYNPFLRVMEESVQKFTG  237

Query  309   SKSPVEALKKLRQLKD  262
                PVE L+ LR  +D
Sbjct  238   KTDPVEVLRTLRIERD  253



>ref|XP_005426013.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Geospiza 
fortis]
Length=260

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 155/245 (63%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ TREAA VDP   +KVL A   +   +  VLTTHHH  HAGGNEK+ +M 
Sbjct  11   DNYMYLLIDQDTREAAIVDPVQPQKVLDAVKKHGVRLTTVLTTHHHWDHAGGNEKLVKME  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG+ VYGG    V   TH V     + +G+ + + CL TPCHT+GHI Y+V+     +P 
Sbjct  71   PGLYVYGGD-SRVGALTHRVSHLTALKVGSLS-VKCLSTPCHTSGHICYYVTKPNSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT E+MY++L + L +L   T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTPEEMYKALIEILGSLDPRTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+ Q     PTIPSTI +E   NPF+RV    +Q+      PV  +  +
Sbjct  189  RNPSIQEKLAWAKAQYDSGEPTIPSTIAEEFTYNPFMRVREKSVQEHAGESDPVRVMGAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|NP_001270343.1| hydroxyacylglutathione hydrolase, mitochondrial [Macaca fascicularis]
 sp|Q4R6C1.2|GLO2_MACFA RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial; 
AltName: Full=Glyoxalase II; Short=Glx II; Flags: Precursor 
[Macaca fascicularis]
 dbj|BAE90557.1| unnamed protein product [Macaca fascicularis]
Length=308

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KVL AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  59   DNYMYLVIDDETKEAAIVDPVQPQKVLDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLQ  118

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G++VYGG  D +   TH +    T+ +G+   + CL TPCHT+GHI YFVS   G +P 
Sbjct  119  SGLKVYGGD-DRIGALTHKITHLSTLQVGSLN-VKCLATPCHTSGHICYFVSRPGGSEPP  176

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++M ++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  177  AVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  236

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  237  GNAAIQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHARETDPVTTMRAV  296

Query  276  RQLKDK  259
            R+ KD+
Sbjct  297  RKEKDE  302



>ref|NP_001035517.1| hydroxyacylglutathione hydrolase, mitochondrial isoform 2 [Homo 
sapiens]
 pdb|1QH3|A Chain A, Human Glyoxalase Ii With Cacodylate And Acetate Ions 
Present In The Active Site
 pdb|1QH3|B Chain B, Human Glyoxalase Ii With Cacodylate And Acetate Ions 
Present In The Active Site
 pdb|1QH5|A Chain A, Human Glyoxalase Ii With S-(N-Hydroxy-N-Bromophenylcarbamoyl) 
Glutathione
 pdb|1QH5|B Chain B, Human Glyoxalase Ii With S-(N-Hydroxy-N-Bromophenylcarbamoyl) 
Glutathione
 gb|AAK61294.1|AE006639_8 hydroxyacylglutathione hydrolase [Homo sapiens]
 emb|CAA62483.1| glyoxalase II [Homo sapiens]
 gb|AAH00840.1| Hydroxyacylglutathione hydrolase [Homo sapiens]
 gb|EAW85609.1| hydroxyacylglutathione hydrolase, isoform CRA_a [Homo sapiens]
 gb|ABM82146.1| hydroxyacylglutathione hydrolase [synthetic construct]
 gb|ABM82147.1| hydroxyacylglutathione hydrolase [synthetic construct]
 gb|ABM85329.1| hydroxyacylglutathione hydrolase [synthetic construct]
 gb|ABW03710.1| hydroxyacylglutathione hydrolase [synthetic construct]
 gb|AIC48917.1| HAGH, partial [synthetic construct]
 gb|AIC54526.1| HAGH, partial [synthetic construct]
Length=260

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV+ AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G++VYGG  D +   TH +    T+ +G+   + CL TPCHT+GHI YFVS   G +P 
Sbjct  71   SGLKVYGGD-DRIGALTHKITHLSTLQVGSLN-VKCLATPCHTSGHICYFVSKPGGSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++M ++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  GNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAV  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>ref|XP_002428405.1| Hydroxyacylglutathione hydrolase, putative [Pediculus humanus 
corporis]
 gb|EEB15667.1| Hydroxyacylglutathione hydrolase, putative [Pediculus humanus 
corporis]
Length=303

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 165/256 (64%), Gaps = 6/256 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MKI  +   +D+ Y YLIID  T++A  VDP   + VL+A       +K VLTTHHH  H
Sbjct  49    MKIKVLPALQDN-YMYLIIDVRTKDAGIVDPVAPDTVLKAVSEENVNLKYVLTTHHHWDH  107

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGN  + + +P + V GG  D ++G +  V   DT  +G      CL TPCHT+GHI Y
Sbjct  108   AGGNSALIKKLPNLTVLGGD-DRIQGLSKKVGHNDTFHIGNLHG-ECLFTPCHTSGHICY  165

Query  666   FVSSKEGGQP-AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTV  490
              +  K+ G+P AVFTGDTLF  GCG+FFEG+AEQMY++L + L  LP  TLV+C HEYT+
Sbjct  166   LI--KQDGEPSAVFTGDTLFIAGCGRFFEGSAEQMYKALIEILGQLPDNTLVFCGHEYTL  223

Query  489   KNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLE  310
              NL F   +EP N  ++E++EWA ++RK N PT+PSTI+DE  TNPFLRV+   +Q  + 
Sbjct  224   NNLSFAKMVEPKNSNIQERIEWAEKKRKLNEPTVPSTIKDEKLTNPFLRVNTTSVQSFVG  283

Query  309   SKSPVEALKKLRQLKD  262
               + ++ ++ LR  KD
Sbjct  284   HSNAIDTMRALRAKKD  299



>ref|XP_006024077.1| PREDICTED: hydroxyacylglutathione hydrolase-like protein [Alligator 
sinensis]
Length=282

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 167/256 (65%), Gaps = 4/256 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK+  +   ED+ Y YL+I+EST+EA AVD A  +++L+        +K +LTTHHH  H
Sbjct  1     MKVKVISILEDN-YMYLVIEESTKEAVAVDAAVPKRLLEIIRKEGVALKAILTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             A GNE++ ++ P +RVYG A + +   T+ V   + +  G    + CL TPCHT+GH  Y
Sbjct  60    ARGNEELAKLYPDLRVYG-ADERIGALTNKVAHNEVLKFGD-INVRCLFTPCHTSGHTCY  117

Query  666   FVSSKEG-GQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTV  490
             F+        PA+F+GDTLF GGCG+FFEGTAEQMY++L   LAALPK T V+C HEY V
Sbjct  118   FMWEDNSPDAPALFSGDTLFVGGCGRFFEGTAEQMYKNLMDVLAALPKETKVFCGHEYAV  177

Query  489   KNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLE  310
             +NL+F S +EP+N  VK+KL WA+ +   +LPT+PST+++E + NPFLRV    +Q    
Sbjct  178   RNLKFASKVEPENENVKKKLAWAKLRDDEDLPTVPSTLQEEFQYNPFLRVSEEAVQKFTG  237

Query  309   SKSPVEALKKLRQLKD  262
                PV+ L+ LR  KD
Sbjct  238   KTDPVDVLRALRTEKD  253



>ref|XP_010386141.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Rhinopithecus roxellana]
Length=260

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV+ AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLQ  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G++VYGG  D +   TH +    T+ +G+   + CL TPCHT+GHI YFVS   G +P 
Sbjct  71   SGLKVYGGD-DRIGALTHKITHLSTLQVGSLN-VKCLATPCHTSGHICYFVSKPGGSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++M ++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  GNAAIQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRSV  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RKEKDE  254



>ref|XP_005523136.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Pseudopodoces humilis]
Length=311

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 157/245 (64%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ TREAA VDP   +KVL A   +  ++  VLTTHHH  HAGGNEK+ +M 
Sbjct  62   DNYMYLLIDQDTREAAIVDPVQPQKVLDAVKKHGVKLTTVLTTHHHWDHAGGNEKLVKME  121

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG+RVYGG    V   T  V     + +G+ + + CL TPCHT+GHI Y+V+     +P 
Sbjct  122  PGLRVYGGD-GRVGALTQKVSHLTALKVGSLS-VKCLSTPCHTSGHICYYVTKPNSSEPP  179

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT E+MY++L + L +L   T VYC HEYT+ NL+F   +EP
Sbjct  180  AVFTGDTLFVAGCGKFFEGTPEEMYKALIEILGSLDPKTRVYCGHEYTINNLKFARHVEP  239

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+ Q     PTIPSTI +E   NPF+RV    +Q+      PV A+  +
Sbjct  240  SNPSIQEKLAWAKAQYDSGEPTIPSTIAEEFTYNPFMRVREKSVQEHAGESDPVRAMGAI  299

Query  276  RQLKD  262
            R+ KD
Sbjct  300  RKEKD  304



>ref|XP_006901960.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Elephantulus edwardii]
Length=305

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/269 (44%), Positives = 173/269 (64%), Gaps = 6/269 (2%)
 Frame = -3

Query  1062  QEKAIPYQKLTPMKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEI  883
             ++ A+  Q +  ++++P      D Y YL+IDE ++EAA VDP   +KV++    +  ++
Sbjct  36    RKSAVVQQVIMKVELLPALT---DNYMYLLIDEDSKEAAIVDPVQPQKVMETVKKHGVKL  92

Query  882   KIVLTTHHHHYHAGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCL  703
               VLTTHHH  HAGGN+K+ +M PG++VYGG  D +   T+ V    T+ +G+   + CL
Sbjct  93    TTVLTTHHHWDHAGGNDKLVKMEPGLKVYGGD-DRIGALTNKVAHLSTLQVGSLN-VKCL  150

Query  702   LTPCHTNGHISYFVSSKEGGQP-AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPK  526
              TPCHT+GHI YFVS     +P AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP 
Sbjct  151   STPCHTSGHICYFVSKPGSSEPPAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGQLPP  210

Query  525   LTLVYCAHEYTVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFL  346
              T VYC HEYT+ NL+F   +EP N  ++EKL WA+++     PT+PSTI +E   NPF+
Sbjct  211   ETRVYCGHEYTINNLKFAHHVEPHNPAIQEKLAWAKEKYGIGEPTVPSTIAEEFTFNPFM  270

Query  345   RVDLPKIQDKLESKSPVEALKKLRQLKDK  259
             RV    +Q+      PV  ++ +R+ KD+
Sbjct  271   RVREKSVQEHAGETDPVTTMRAIRKEKDQ  299



>ref|XP_001090793.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
1 [Macaca mulatta]
Length=260

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV+ AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLQ  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G++VYGG  D +   TH +    T+ +G+   + CL TPCHT+GH+ YFVS   G +P 
Sbjct  71   SGLKVYGGD-DRIGALTHKITHLSTLQVGSLN-VKCLATPCHTSGHVCYFVSRPGGSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++M ++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  GNAAIQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHARETDPVTTMRAV  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RKEKDE  254



>ref|XP_005523135.1| PREDICTED: hydroxyacylglutathione hydrolase-like protein [Pseudopodoces 
humilis]
Length=282

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 168/256 (66%), Gaps = 4/256 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK+  +   ED+ Y YL+I+ESTR+A AVD A  +++L+        ++ +LTTHHH  H
Sbjct  1     MKVKVISVLEDN-YMYLVIEESTRDAVAVDAAVPKRLLEIIRKEDVVLRAILTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             A GNE++ ++ PG+RV+G A + +   TH V  G  ++ GA   + CL TPCHT+GH+ Y
Sbjct  60    ARGNEELAQLFPGLRVFG-ADERIGALTHKVTHGQELSFGA-IRVRCLFTPCHTSGHMCY  117

Query  666   FVSSKEG-GQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTV  490
             F+   +    PA+F+GDTLF GGCG+FFEGTAEQM+ +L + L  LPK T V+C HE TV
Sbjct  118   FMWEDDSPDAPALFSGDTLFVGGCGQFFEGTAEQMHTNLTQILGTLPKDTKVFCGHECTV  177

Query  489   KNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLE  310
             +NL+F   +EP+N  VKEKL WARQ+   +LPT+PST+ +E   NPFLRV    +Q    
Sbjct  178   RNLKFALKVEPENEMVKEKLAWARQRDDEDLPTVPSTLHEEFLYNPFLRVTEEPVQRFTG  237

Query  309   SKSPVEALKKLRQLKD  262
                PVE L+ LR  +D
Sbjct  238   RTDPVEVLRTLRSERD  253



>ref|XP_002920271.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like 
[Ailuropoda melanoleuca]
Length=318

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 159/245 (65%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ T+EAA VDP   +KV++       ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  69   DNYMYLIIDDETKEAAIVDPVQPQKVVETVKKRGVKLTTVLTTHHHWDHAGGNEKLVKLE  128

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++V GG  D +   TH V    T+ +G+ + + CL TPCHT+GHI YFV+     +P 
Sbjct  129  PGLKVCGGD-DRIGALTHKVTHLSTLQVGSLS-VKCLSTPCHTSGHICYFVTKPGSSEPP  186

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY +L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  187  AVFTGDTLFVAGCGKFYEGTADEMYRALIEILGRLPPDTRVYCGHEYTINNLKFARHVEP  246

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  V+EKL WA+++     PT+PSTI +EL  NPF+RV    +Q       PV  ++ +
Sbjct  247  SNAAVQEKLAWAKEKYSIGEPTVPSTIAEELTYNPFMRVREKTVQQHAGETDPVTTMRAI  306

Query  276  RQLKD  262
            R+ KD
Sbjct  307  RKEKD  311



>ref|XP_009193952.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Papio anubis]
Length=260

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV+ AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLQ  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G++VYGG  D +   TH +    T+ +G+   + CL TPCHT+GHI YFVS   G +P 
Sbjct  71   SGLKVYGGD-DRIGALTHKITHLSTLQVGSLN-VKCLATPCHTSGHICYFVSKPGGSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++M ++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  GNAAIQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAV  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RKEKDE  254



>ref|XP_010568749.1| PREDICTED: hydroxyacylglutathione hydrolase-like protein isoform 
X2 [Haliaeetus leucocephalus]
Length=282

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/258 (49%), Positives = 168/258 (65%), Gaps = 8/258 (3%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK+  +   ED+ Y YL+I+ESTR+A AVD A  +++L+        ++ VLTTHHH  H
Sbjct  1     MKVKVISVLEDN-YMYLVIEESTRDAVAVDAAVPKRLLEIVRKEDVVLRAVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             A GNE++  + PG+RVYG A + +   TH V     +  GA   + CL TPCHT+GH+ Y
Sbjct  60    ARGNEELARLCPGLRVYG-ADERIGALTHKVTHNQELTFGA-IRVRCLFTPCHTSGHMCY  117

Query  666   FVSSKEGGQP---AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEY  496
             F+   E G P   A+F+GDTLF GGCGKFFEGTAEQMY +L + L ALPK T V+C HE 
Sbjct  118   FMW--EDGSPDAPALFSGDTLFVGGCGKFFEGTAEQMYTNLTQILGALPKETKVFCGHEC  175

Query  495   TVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDK  316
             TV+NL+F   +EP+N  VK+KL WA+Q+   +LPT+PST+++E   NPFLRV    +Q  
Sbjct  176   TVRNLKFALKVEPENEIVKKKLAWAKQRDDEDLPTVPSTLQEEFLYNPFLRVMEEPVQKF  235

Query  315   LESKSPVEALKKLRQLKD  262
                  PVE L+ LR  KD
Sbjct  236   TGKTDPVEVLRTLRTEKD  253



>gb|EHJ68016.1| putative hydroxyacyl glutathione hydrolase [Danaus plexippus]
Length=259

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 160/256 (63%), Gaps = 5/256 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             +KI+P      D Y YLI+D++T+EAA VDP +   VLQA       +  VLTTHHH  H
Sbjct  3     VKILPAL---QDNYMYLIVDKATKEAAVVDPVEPNTVLQAVKEIGVNLTTVLTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             AGGNE + +M PG++V GG  D +   T  V       +G    + CL TPCHT+GHI Y
Sbjct  60    AGGNEDLVKMHPGLKVLGGD-DRIGAMTEKVAHNTEFNIGKLN-VKCLFTPCHTSGHICY  117

Query  666   FVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVK  487
             +V+     + AVFTGDTLF GGCG+FFEGTAEQM+++L + L  LP  T V+C HEY++ 
Sbjct  118   YVTVPNANETAVFTGDTLFLGGCGRFFEGTAEQMHKALIEILGNLPDHTKVFCGHEYSIA  177

Query  486   NLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLES  307
             NL+FG  +EPDN  +K+K+ WA   RK   PT+PSTI +E   NPF+RV++  +      
Sbjct  178   NLKFGEHVEPDNEDLKKKIIWANSVRKEEKPTVPSTISEEKLYNPFMRVNVMSVMKHANR  237

Query  306   KSPVEALKKLRQLKDK  259
               P+E +K +R  KD 
Sbjct  238   TDPIETMKAIRLEKDN  253



>gb|EHH60051.1| Hydroxyacylglutathione hydrolase, mitochondrial, partial [Macaca 
fascicularis]
Length=283

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV+ AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  34   DNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLQ  93

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G++VYGG  D +   TH +    T+ +G+   + CL TPCHT+GHI YFVS   G +P 
Sbjct  94   SGLKVYGGD-DRIGALTHKITHLSTLQVGSLN-VKCLATPCHTSGHICYFVSRPGGSEPP  151

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++M ++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  152  AVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  211

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  212  GNAAIQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHARETDPVTTMRAV  271

Query  276  RQLKDK  259
            R+ KD+
Sbjct  272  RKEKDE  277



>ref|XP_007453627.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Lipotes vexillifer]
Length=309

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 160/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ ++EAA VDP   +KV++    +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLIIDDDSKEAAIVDPVQPQKVVEMVRKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  120  PGLKVYGGD-DRIGALTHKVTHLSTLQVGSLN-VKCLSTPCHTSGHICYFVSKPNSPEPP  177

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
             VFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  178  VVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  237

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  238  SNAAIQEKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAV  297

Query  276  RQLKDK  259
            R+ KD+
Sbjct  298  RKEKDQ  303



>ref|XP_006146444.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Tupaia 
chinensis]
Length=260

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID++T EAAAVDP   +KV++AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLLIDDNTGEAAAVDPVQPQKVVEAARKHGVKLTTVLTTHHHWDHAGGNEKLLKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++V GG    V   TH V    T+ +GA T + CL TPC T+GHI YF S     +P 
Sbjct  71   PGLKVCGGD-SRVAALTHRVTHLSTLQVGALT-VKCLATPCDTSGHICYFASEPGSAEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  V+EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  SNPAVQEKLTWAKEKYGIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGESDPVATMRAI  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RREKDQ  254



>ref|XP_008115012.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Anolis carolinensis]
Length=260

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 154/245 (63%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KVL A   +  ++  VLTTHHH  HAGGNEK+ +M 
Sbjct  11   DNYMYLLIDEETKEAAIVDPVQPQKVLDAVRKHGVKLTTVLTTHHHWDHAGGNEKLVKME  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG+RVYGG    V   T  V    +  +G+   + CL TPCHT+GHI YFV+      P 
Sbjct  71   PGLRVYGGD-SRVGALTQKVSHLMSFQVGSLN-VKCLATPCHTSGHICYFVTKPNSSDPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT E+MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTPEEMYKALIEILGRLPPETKVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +N  ++ KL WA+ +     PTIPSTI +E   NPF+RV    +Q   +   PV  +  +
Sbjct  189  NNSAIQHKLSWAKAKYDSGEPTIPSTIGEEFAYNPFMRVREASVQQHAKEADPVRTMGAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RREKD  253



>ref|XP_005337877.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X2 [Ictidomys tridecemlineatus]
Length=297

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 159/247 (64%), Gaps = 5/247 (2%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ TREAA VDP   +KV++       ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  48   DNYMYLIIDKDTREAAIVDPVQPQKVVETVRKYGVKLTTVLTTHHHWDHAGGNEKLVKLQ  107

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQ--  640
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI Y VS K GG   
Sbjct  108  PGLKVYGGD-DRIGALTHKVTHLFTLQVGSLH-VKCLSTPCHTSGHICYLVS-KPGGPDP  164

Query  639  PAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIE  460
            PAVFTGDTLF  GCGKF+EGTAE+MY +L + L  LP  T VYC HEYT+ NL+F   +E
Sbjct  165  PAVFTGDTLFVAGCGKFYEGTAEEMYRALLEVLGRLPPDTKVYCGHEYTISNLKFARHVE  224

Query  459  PDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKK  280
            P N  V EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ 
Sbjct  225  PSNTAVLEKLAWAKEKYATGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGQTDPVATMRY  284

Query  279  LRQLKDK  259
            +R+ KD+
Sbjct  285  IRREKDQ  291



>ref|XP_010157348.1| PREDICTED: hydroxyacylglutathione hydrolase-like protein [Eurypyga 
helias]
Length=260

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 153/245 (62%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KVL A   +  ++  VLTTHHH  HAGGNEK+ +M 
Sbjct  11   DNYMYLLIDEETKEAAIVDPVQPQKVLDAVKKHGVKLTTVLTTHHHWDHAGGNEKLVKME  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG+RVYGG    V   T  V    ++ +G+   + CL TPCHT+GHI Y+V+     +P 
Sbjct  71   PGLRVYGGD-SRVGALTQKVSHLTSLKVGSLN-VKCLCTPCHTSGHICYYVTKPNSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT E+MY +L + L  L   T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTPEEMYRALIEILGNLDPKTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             NV ++EKL WA+       PTIPSTI +E   NPF+RV    +Q       P+  +  +
Sbjct  189  SNVSIQEKLAWAKAMYDSGEPTIPSTIAEEFTYNPFMRVREKTVQQHARETDPIRTMGAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_010133508.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Buceros 
rhinoceros silvestris]
Length=260

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 156/245 (64%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+IDE T+EAA VDP   +KVL A   +  ++  VLTTHHH  HAGGNEK+ +M 
Sbjct  11   DNYMYLLIDEETKEAAIVDPVQPQKVLDAVKKHGVKLTTVLTTHHHWDHAGGNEKLVKME  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G+RVYGG    V   T  V    ++ +G+   + CL TPCHT+GHI Y+V+     +P 
Sbjct  71   AGLRVYGGD-SRVGALTQKVSHLTSLKVGSLN-VKCLYTPCHTSGHICYYVTKPNSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGTAE+MY +L + L +L   T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTAEEMYRALIEILGSLDPNTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
            +NV ++EKL WA+ +     PTIPSTI +E   NPF+RV    +Q       P+  +  +
Sbjct  189  NNVSIQEKLAWAKAKYDSGEPTIPSTIAEEFTYNPFMRVREKTVQQHAGETDPIRTMGAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_510739.5| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Pan 
troglodytes]
Length=308

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV+ AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  59   DNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  118

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G++VYGG  D +   TH +    T+ +G+   + CL TPCHT+GHI YFVS   G +P 
Sbjct  119  SGLKVYGGD-DRIGALTHKITHLSTLQVGSLN-VKCLATPCHTSGHICYFVSKPRGSEPP  176

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++M ++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  177  AVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  236

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  237  GNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGKTDPVTTMQAV  296

Query  276  RQLKDK  259
            R+ KD+
Sbjct  297  RREKDQ  302



>ref|XP_008943983.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Merops nubicus]
Length=260

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 155/245 (63%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL++DE TREAA VDP   +KVL A   +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLLVDEETREAAIVDPVQPQKVLDAVKKHGVKLTTVLTTHHHWDHAGGNEKLVKLE  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG+RVYGG    V   T  V    ++ +G+   + CL TPCHT+GHI Y+V+     +P 
Sbjct  71   PGLRVYGGD-SRVGALTQKVSHLTSLKVGSLN-VKCLCTPCHTSGHICYYVTKPNSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT E+MY +L + L +L   T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTPEEMYRALIEVLGSLDPQTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             NV V+EKL WA+ +     PTIPSTI +E   NPF+RV    +Q       P+  +  +
Sbjct  189  HNVAVQEKLSWAKAKYDSGEPTIPSTIAEEFTYNPFMRVREKTVQQHAGETDPIRTMGAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_007937707.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Orycteropus afer afer]
Length=308

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 160/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ TREAA VDP   +KV++       ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  59   DNYMYLVIDDDTREAAIVDPVQPQKVVETVKKYGVKLTTVLTTHHHWDHAGGNEKLVKLE  118

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG++VYGG  D +   T+ V    T+ +G+   + CL TPCHT+GHI YFVS     +P 
Sbjct  119  PGLKVYGGD-DRIGALTNKVTHLSTLQVGSLN-VKCLSTPCHTSGHICYFVSKPGSSEPP  176

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++MY++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  177  AVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTINNLKFARHVEP  236

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ +
Sbjct  237  HNTAIQEKLAWAKEKYGIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAI  296

Query  276  RQLKDK  259
            R+ KD+
Sbjct  297  RKEKDQ  302



>ref|XP_005495864.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Zonotrichia 
albicollis]
Length=260

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 155/245 (63%), Gaps = 3/245 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ TREAA VDP   +KVL A   +   +  VLTTHHH  HAGGNEK+ +M 
Sbjct  11   DNYMYLLIDQDTREAAIVDPVQPQKVLDAVKKHGVRLTTVLTTHHHWDHAGGNEKLVKME  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
            PG+ VYGG    V   TH V    ++ +G+ + + CL TPCHT+GHI Y+V+     +P 
Sbjct  71   PGLYVYGGD-SRVGALTHRVSHLTSLKVGSLS-VKCLSTPCHTSGHICYYVTKPNSSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKFFEGT E+MY +L + L +L   T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFFEGTPEEMYRALIEILGSLDPRTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  + EKL WA+ +     PTIPSTI +E   NPF+RV    +Q+ +    PV  +  +
Sbjct  189  RNPNIHEKLAWAKAKYDSGEPTIPSTIAEEFTYNPFMRVREKSVQEHVGDSDPVRVMGAI  248

Query  276  RQLKD  262
            R+ KD
Sbjct  249  RKEKD  253



>ref|XP_007980058.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X3 [Chlorocebus sabaeus]
Length=260

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 161/246 (65%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YL+ID+ T+EAA VDP   +KV+ AA  +  ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  11   DNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLQ  70

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQP-  637
             G++VYGG  D +   TH +    T+ +G+   + CL TPCHT+GH+ YFVS   G +P 
Sbjct  71   SGLKVYGGD-DRIGALTHKITHLSTLQVGSLN-VKCLATPCHTSGHVCYFVSKPGGSEPP  128

Query  636  AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIEP  457
            AVFTGDTLF  GCGKF+EGTA++M ++L + L  LP  T VYC HEYT+ NL+F   +EP
Sbjct  129  AVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP  188

Query  456  DNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKKL  277
             N  ++EKL WA+++     PT+PST+ +E   NPF+RV    +Q       PV  ++ +
Sbjct  189  GNAAIQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAV  248

Query  276  RQLKDK  259
            R+ KD+
Sbjct  249  RKEKDE  254



>ref|XP_972438.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Tribolium 
castaneum]
 gb|EFA08581.1| hypothetical protein TcasGA2_TC006236 [Tribolium castaneum]
Length=302

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/259 (47%), Positives = 171/259 (66%), Gaps = 5/259 (2%)
 Frame = -3

Query  1035  LTPMKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHH  856
             L  MK+V +    D+ Y YLI+DE T++AA VDP   + VL+A +     +  VLTTHHH
Sbjct  44    LDTMKVVILPALSDN-YMYLIVDEKTKQAAIVDPVAPDTVLEAVEKEGVNLTKVLTTHHH  102

Query  855   HYHAGGNEKM-KEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNG  679
               HAGGNE++ K+    ++V+GG  D +   T+ V+ GD  ++G    + CL TPCHT+G
Sbjct  103   WDHAGGNEQLVKKSKNALQVFGGD-DRIGALTNRVKHGDKFSIGD-INVECLSTPCHTSG  160

Query  678   HISYFVSSKEGGQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHE  499
             HI Y+V++  G  PAVFTGDTLF  GCG+FFEGTAEQM+ +L   L  LP  T V+C HE
Sbjct  161   HICYYVNAA-GEPPAVFTGDTLFVAGCGRFFEGTAEQMHTALIDILGNLPDNTQVFCGHE  219

Query  498   YTVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQD  319
             YT +NL+F   +EPDN  + E++EWA  +R  + PT+PSTI +E +TNPF+RV LP +Q 
Sbjct  220   YTEQNLKFAKHVEPDNPDILERIEWAGAKRGRHEPTVPSTIANEKQTNPFMRVGLPSVQK  279

Query  318   KLESKSPVEALKKLRQLKD  262
               +  + +E ++ +R+ KD
Sbjct  280   HAKCNNSIETMRTIRKEKD  298



>ref|XP_006274231.1| PREDICTED: hydroxyacylglutathione hydrolase-like protein [Alligator 
mississippiensis]
Length=282

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 166/256 (65%), Gaps = 4/256 (2%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK+  +   ED+ Y YL+I+EST+EA AVD A  +++L+        +K +LTTHHH  H
Sbjct  1     MKVKVISILEDN-YMYLVIEESTKEAVAVDAAVPKRLLEIIRKEGVALKAILTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             A GNE++ ++ P +RVYG A + +   T+ V   + +  G    + CL TPCHT+GH  Y
Sbjct  60    ARGNEELAKLYPDLRVYG-ADERIGALTNRVAHNEVLKFGD-INVRCLFTPCHTSGHTCY  117

Query  666   FVSSKEG-GQPAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTV  490
             F+        PA+F+GDTLF GGCG+FFEGTAEQMY++L   LAALPK T V+C HEY V
Sbjct  118   FMWEDNSPDAPALFSGDTLFVGGCGRFFEGTAEQMYKNLMDVLAALPKETKVFCGHEYAV  177

Query  489   KNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLE  310
             +NL+F   +EP+N  VK+KL WA+ +   +LPT+PST++DE + NPFLRV    +Q    
Sbjct  178   RNLKFALKVEPENESVKKKLAWAKLRDDEDLPTVPSTLQDEFQYNPFLRVSEEAVQKFTG  237

Query  309   SKSPVEALKKLRQLKD  262
                PV+ L+ LR  KD
Sbjct  238   KTDPVDVLRALRTEKD  253



>ref|XP_005337876.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform 
X1 [Ictidomys tridecemlineatus]
Length=309

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 159/247 (64%), Gaps = 5/247 (2%)
 Frame = -3

Query  993  DRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYHAGGNEKMKEMV  814
            D Y YLIID+ TREAA VDP   +KV++       ++  VLTTHHH  HAGGNEK+ ++ 
Sbjct  60   DNYMYLIIDKDTREAAIVDPVQPQKVVETVRKYGVKLTTVLTTHHHWDHAGGNEKLVKLQ  119

Query  813  PGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISYFVSSKEGGQ--  640
            PG++VYGG  D +   TH V    T+ +G+   + CL TPCHT+GHI Y VS K GG   
Sbjct  120  PGLKVYGGD-DRIGALTHKVTHLFTLQVGSLH-VKCLSTPCHTSGHICYLVS-KPGGPDP  176

Query  639  PAVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEYTVKNLEFGSTIE  460
            PAVFTGDTLF  GCGKF+EGTAE+MY +L + L  LP  T VYC HEYT+ NL+F   +E
Sbjct  177  PAVFTGDTLFVAGCGKFYEGTAEEMYRALLEVLGRLPPDTKVYCGHEYTISNLKFARHVE  236

Query  459  PDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDKLESKSPVEALKK  280
            P N  V EKL WA+++     PT+PSTI +E   NPF+RV    +Q       PV  ++ 
Sbjct  237  PSNTAVLEKLAWAKEKYATGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGQTDPVATMRY  296

Query  279  LRQLKDK  259
            +R+ KD+
Sbjct  297  IRREKDQ  303



>ref|XP_009466116.1| PREDICTED: hydroxyacylglutathione hydrolase-like protein [Nipponia 
nippon]
 gb|KFQ99927.1| Hydroxyacylglutathione hydrolase-like [Nipponia nippon]
Length=282

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/258 (48%), Positives = 168/258 (65%), Gaps = 8/258 (3%)
 Frame = -3

Query  1026  MKIVPVQCFEDDRYSYLIIDESTREAAAVDPADTEKVLQAADANAAEIKIVLTTHHHHYH  847
             MK+  +   ED+ Y YL+I+ESTR+A AVD A  +++L+        ++ +LTTHHH  H
Sbjct  1     MKVKVISVLEDN-YMYLVIEESTRDAVAVDAAVPKRLLEIIRKEDVVLRAILTTHHHWDH  59

Query  846   AGGNEKMKEMVPGVRVYGGALDDVEGCTHGVQDGDTIALGAYTTITCLLTPCHTNGHISY  667
             A GNE++  + PG+RVYG A + +   TH V     +  GA   + CL TPCHT+GH+ Y
Sbjct  60    ARGNEELARLCPGLRVYG-ADERIGALTHKVTHNQELTFGA-IRVRCLFTPCHTSGHMCY  117

Query  666   FVSSKEGGQP---AVFTGDTLFAGGCGKFFEGTAEQMYESLCKTLAALPKLTLVYCAHEY  496
             F+   E G P   A+F+GDTLF GGCGKFFEGTAEQMY +L + L ALPK T V+C HE 
Sbjct  118   FMW--EDGSPDAPALFSGDTLFVGGCGKFFEGTAEQMYTNLTQILGALPKETKVFCGHEC  175

Query  495   TVKNLEFGSTIEPDNVRVKEKLEWARQQRKFNLPTIPSTIEDELETNPFLRVDLPKIQDK  316
             TV+NL+F   +EP+N  VK+KL WA+Q+   +LPT+PST+++E   NPFLRV    +Q  
Sbjct  176   TVRNLKFALKVEPENEIVKKKLAWAKQRDDEDLPTVPSTLQEEFLYNPFLRVTEEPLQKF  235

Query  315   LESKSPVEALKKLRQLKD  262
                  PVE L+ LR  KD
Sbjct  236   TGKTDPVEVLRTLRTEKD  253



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2737025756952