BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85322_g1_i1 len=1861 path=[1:0-1860]

Length=1861
                                                                      Score     E

ref|XP_009801577.1|  PREDICTED: uncharacterized protein LOC104247307    671   0.0      
ref|XP_009612606.1|  PREDICTED: uncharacterized protein LOC104105884    668   0.0      
ref|XP_009605991.1|  PREDICTED: uncharacterized protein LOC104100467    668   0.0      
ref|XP_009591180.1|  PREDICTED: uncharacterized protein LOC104088240    664   0.0      
ref|XP_009779247.1|  PREDICTED: uncharacterized protein LOC104228481    657   0.0      
ref|XP_011100287.1|  PREDICTED: uncharacterized protein LOC105178499    639   0.0      
ref|XP_006352036.1|  PREDICTED: uncharacterized protein LOC102586291    639   0.0      
ref|XP_006447475.1|  hypothetical protein CICLE_v10015096mg             632   0.0      
ref|XP_002515719.1|  transferase, transferring glycosyl groups, p...    629   0.0      Ricinus communis
ref|XP_010313666.1|  PREDICTED: uncharacterized protein LOC101245623    627   0.0      
ref|XP_010323808.1|  PREDICTED: uncharacterized protein LOC101246943    620   0.0      
ref|XP_009353239.1|  PREDICTED: uncharacterized protein LOC103944504    619   0.0      
ref|XP_010321546.1|  PREDICTED: uncharacterized protein LOC101254...    618   0.0      
ref|XP_006360582.1|  PREDICTED: uncharacterized protein LOC102585670    616   0.0      
ref|XP_009341434.1|  PREDICTED: uncharacterized protein LOC103933463    615   0.0      
ref|XP_006360683.1|  PREDICTED: uncharacterized protein LOC102597363    613   0.0      
ref|XP_008230135.1|  PREDICTED: uncharacterized protein LOC103329438    614   0.0      
ref|XP_008365447.1|  PREDICTED: uncharacterized protein LOC103429078    614   0.0      
ref|XP_008379601.1|  PREDICTED: uncharacterized protein LOC103442579    613   0.0      
ref|XP_010267798.1|  PREDICTED: uncharacterized protein LOC104604918    611   0.0      
ref|XP_007217531.1|  hypothetical protein PRUPE_ppa023439mg             610   0.0      
ref|XP_009342273.1|  PREDICTED: uncharacterized protein LOC103934264    607   0.0      
ref|XP_002274436.1|  PREDICTED: uncharacterized protein LOC100241450    603   0.0      Vitis vinifera
ref|XP_008341969.1|  PREDICTED: uncharacterized protein LOC103404789    603   0.0      
ref|XP_011036974.1|  PREDICTED: uncharacterized protein LOC105134321    599   0.0      
ref|XP_010109543.1|  hypothetical protein L484_018278                   590   0.0      
ref|XP_004289154.1|  PREDICTED: uncharacterized protein LOC101295084    589   0.0      
ref|XP_010109544.1|  hypothetical protein L484_018279                   583   0.0      
ref|XP_010240968.1|  PREDICTED: uncharacterized protein LOC104585699    582   0.0      
ref|XP_008455831.1|  PREDICTED: uncharacterized protein LOC103495932    577   0.0      
ref|XP_007043327.1|  YUP8H12.11 protein, putative                       574   0.0      
ref|XP_004151927.1|  PREDICTED: uncharacterized protein LOC101206335    569   0.0      
ref|XP_006592398.1|  PREDICTED: uncharacterized protein LOC100813816    568   0.0      
ref|XP_004156798.1|  PREDICTED: uncharacterized protein LOC101223996    568   0.0      
ref|XP_007132578.1|  hypothetical protein PHAVU_011G106700g             565   0.0      
gb|KHG26048.1|  ERV-F (c)1 provirus ancestral Env polyprotein           562   0.0      
gb|KDP25872.1|  hypothetical protein JCGZ_22902                         560   0.0      
gb|KEH29637.1|  transferring glycosyl group transferase                 560   0.0      
ref|XP_003526316.1|  PREDICTED: uncharacterized protein LOC100784602    557   0.0      
ref|XP_004514044.1|  PREDICTED: uncharacterized protein LOC101511630    549   0.0      
ref|XP_006372976.1|  hypothetical protein POPTR_0017s06690g             543   0.0      
ref|XP_010557014.1|  PREDICTED: uncharacterized protein LOC104826156    536   0.0      
ref|XP_010543017.1|  PREDICTED: uncharacterized protein LOC104816...    536   0.0      
emb|CBI28968.3|  unnamed protein product                                532   0.0      
ref|XP_006594879.1|  PREDICTED: uncharacterized protein LOC100779...    529   5e-179   
ref|XP_004487370.1|  PREDICTED: uncharacterized protein LOC101493...    528   7e-179   
ref|XP_010475212.1|  PREDICTED: uncharacterized protein LOC104754...    527   2e-178   
ref|XP_003541938.2|  PREDICTED: uncharacterized protein LOC100779...    524   4e-177   
gb|KHN36558.1|  hypothetical protein glysoja_001289                     523   6e-177   
ref|XP_010475211.1|  PREDICTED: uncharacterized protein LOC104754...    523   1e-176   
ref|XP_004487371.1|  PREDICTED: uncharacterized protein LOC101493...    522   1e-176   
gb|KHN22853.1|  hypothetical protein glysoja_020783                     515   3e-174   
ref|XP_010051115.1|  PREDICTED: uncharacterized protein LOC104439796    515   5e-174   
ref|XP_010543014.1|  PREDICTED: uncharacterized protein LOC104816045    513   2e-173   
ref|XP_010457610.1|  PREDICTED: uncharacterized protein LOC104739061    514   4e-173   
emb|CDY15540.1|  BnaA08g28240D                                          512   2e-172   
ref|XP_010689646.1|  PREDICTED: uncharacterized protein LOC104903328    511   2e-172   
ref|XP_010240965.1|  PREDICTED: uncharacterized protein LOC104585...    509   3e-171   
gb|KCW89426.1|  hypothetical protein EUGRSUZ_A01725                     506   5e-171   
ref|XP_009111055.1|  PREDICTED: uncharacterized protein LOC103836532    508   5e-171   
gb|AES67287.2|  transferring glycosyl group transferase                 507   8e-171   
ref|XP_006594878.1|  PREDICTED: uncharacterized protein LOC100778878    505   5e-170   
ref|XP_009111053.1|  PREDICTED: uncharacterized protein LOC103836531    503   6e-169   
emb|CDY15541.1|  BnaA08g28250D                                          503   6e-169   
ref|XP_010240967.1|  PREDICTED: uncharacterized protein LOC104585...    503   8e-169   
gb|KFK42866.1|  hypothetical protein AALP_AA1G049200                    503   8e-169   
emb|CDX86577.1|  BnaC08g01260D                                          503   9e-169   
ref|XP_003597036.1|  Fringe-related-like protein                        501   1e-168   
ref|XP_009118598.1|  PREDICTED: uncharacterized protein LOC103843...    501   2e-168   
ref|XP_007149951.1|  hypothetical protein PHAVU_005G113100g             496   1e-166   
emb|CDY59796.1|  BnaAnng16280D                                          496   3e-166   
emb|CDY46851.1|  BnaA10g03350D                                          496   3e-166   
gb|KHN41198.1|  hypothetical protein glysoja_017242                     490   2e-165   
ref|XP_004507234.1|  PREDICTED: uncharacterized protein LOC101512759    484   4e-163   
ref|XP_007149950.1|  hypothetical protein PHAVU_005G113000g             486   9e-163   
emb|CDY46850.1|  BnaA10g03340D                                          485   6e-162   
emb|CAN76207.1|  hypothetical protein VITISV_043112                     515   8e-162   Vitis vinifera
emb|CDY49520.1|  BnaC05g03320D                                          484   2e-161   
ref|XP_006594880.1|  PREDICTED: uncharacterized protein LOC100780472    481   2e-160   
ref|XP_009119171.1|  PREDICTED: uncharacterized protein LOC103844151    480   5e-160   
gb|KHN36557.1|  hypothetical protein glysoja_001288                     476   2e-159   
ref|XP_009342266.1|  PREDICTED: uncharacterized protein LOC103934254    475   3e-158   
ref|XP_008365448.1|  PREDICTED: uncharacterized protein LOC103429079    474   1e-157   
ref|XP_007215288.1|  hypothetical protein PRUPE_ppa004954mg             471   1e-156   
ref|XP_004287918.1|  PREDICTED: uncharacterized protein LOC101308316    469   6e-156   
ref|XP_006304743.1|  hypothetical protein CARUB_v10012119mg             467   2e-155   
ref|NP_172020.1|  uncharacterized protein                               467   3e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008341970.1|  PREDICTED: uncharacterized protein LOC103404790    467   1e-154   
ref|XP_002892278.1|  hypothetical protein ARALYDRAFT_887710             464   4e-154   
ref|XP_004514056.1|  PREDICTED: uncharacterized protein LOC101515637    464   1e-153   
ref|XP_008230136.1|  PREDICTED: uncharacterized protein LOC103329439    462   5e-153   
ref|XP_008455407.1|  PREDICTED: uncharacterized protein LOC103495576    461   8e-153   
ref|XP_010543019.1|  PREDICTED: uncharacterized protein LOC104816...    455   8e-152   
ref|XP_009341431.1|  PREDICTED: uncharacterized protein LOC103933...    457   9e-152   
ref|XP_009353240.1|  PREDICTED: uncharacterized protein LOC103944505    456   7e-151   
ref|XP_004514055.1|  PREDICTED: uncharacterized protein LOC101515312    453   2e-150   
gb|KEH29638.1|  transferring glycosyl group transferase                 454   4e-150   
ref|XP_010906683.1|  PREDICTED: uncharacterized protein LOC105033526    453   1e-149   
ref|XP_004144582.1|  PREDICTED: uncharacterized protein LOC101222721    453   1e-149   
ref|XP_007043328.1|  Uncharacterized protein isoform 1                  451   8e-149   
ref|XP_002274405.2|  PREDICTED: uncharacterized protein LOC100246569    449   1e-148   Vitis vinifera
ref|XP_006418045.1|  hypothetical protein EUTSA_v10009924mg             448   3e-148   
gb|KHG26047.1|  putative ATP-dependent DNA ligase ykoU                  449   6e-148   
ref|XP_007043330.1|  Uncharacterized protein isoform 3                  447   3e-147   
ref|XP_010035613.1|  PREDICTED: uncharacterized protein LOC104424814    446   2e-146   
ref|XP_007149949.1|  hypothetical protein PHAVU_005G112900g             444   3e-146   
gb|AAB71450.1|  Similar to hypothetical protein PID|e327464 (gb|Z...    442   3e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283625.1|  hypothetical protein CARUB_v10004682mg             441   6e-145   
ref|XP_003540854.1|  PREDICTED: uncharacterized protein LOC100813...    441   1e-144   
ref|XP_006372975.1|  hypothetical protein POPTR_0017s06680g             441   2e-144   
gb|KCW47063.1|  hypothetical protein EUGRSUZ_K00865                     440   2e-144   
ref|XP_009630351.1|  PREDICTED: uncharacterized protein LOC104120315    439   2e-144   
ref|XP_010051124.1|  PREDICTED: uncharacterized protein LOC104439805    438   5e-144   
ref|XP_010449958.1|  PREDICTED: uncharacterized protein LOC104732128    439   7e-144   
ref|XP_002868218.1|  hypothetical protein ARALYDRAFT_493365             437   2e-143   
gb|ACN40918.1|  unknown                                                 437   4e-143   Picea sitchensis
ref|XP_010435042.1|  PREDICTED: uncharacterized protein LOC104718913    436   8e-143   
ref|XP_009405000.1|  PREDICTED: uncharacterized protein LOC103988...    436   8e-143   
ref|XP_011036975.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    436   2e-142   
ref|XP_010551745.1|  PREDICTED: uncharacterized protein LOC104822287    433   1e-141   
ref|XP_006850470.1|  hypothetical protein AMTR_s00035p00105030          432   1e-141   
gb|KCW89425.1|  hypothetical protein EUGRSUZ_A01724                     430   2e-141   
ref|XP_006414552.1|  hypothetical protein EUTSA_v10025038mg             428   1e-139   
emb|CDY57235.1|  BnaC01g42120D                                          426   3e-139   
ref|XP_009147484.1|  PREDICTED: uncharacterized protein LOC103871019    425   7e-139   
ref|NP_193259.2|  uncharacterized protein                               425   1e-138   Arabidopsis thaliana [mouse-ear cress]
emb|CDY22931.1|  BnaA01g18690D                                          424   1e-138   
ref|XP_007043332.1|  Uncharacterized protein isoform 5                  419   8e-137   
gb|KDP25871.1|  hypothetical protein JCGZ_22901                         418   1e-135   
ref|XP_008776386.1|  PREDICTED: uncharacterized protein LOC103696507    411   1e-134   
gb|ABR17242.1|  unknown                                                 415   1e-134   Picea sitchensis
ref|XP_010674122.1|  PREDICTED: uncharacterized protein LOC104890362    411   3e-133   
emb|CAB10303.1|  hypothetical protein                                   409   9e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002961368.1|  glycosyltransferase-like protein                   406   4e-130   
emb|CDY10034.1|  BnaC08g44170D                                          395   4e-129   
ref|XP_002973713.1|  glycosyltransferase-like protein                   403   1e-128   
ref|XP_002975764.1|  glycosyltransferase-like protein                   403   1e-128   
ref|XP_007209898.1|  hypothetical protein PRUPE_ppa004142mg             400   2e-128   
ref|XP_006414551.1|  hypothetical protein EUTSA_v10025038mg             397   4e-128   
gb|KHG00530.1|  Beta-1,3-N-acetylglucosaminyltransferase lunatic ...    400   4e-128   
ref|XP_010109542.1|  hypothetical protein L484_018277                   396   9e-128   
ref|XP_009799907.1|  PREDICTED: uncharacterized protein LOC104245902    398   1e-127   
ref|XP_007135113.1|  hypothetical protein PHAVU_010G102100g             397   1e-127   
ref|XP_004243452.1|  PREDICTED: uncharacterized protein LOC101248314    396   2e-127   
ref|XP_009347733.1|  PREDICTED: uncharacterized protein LOC103939376    397   2e-127   
ref|XP_002980904.1|  glycosyltransferase-like protein                   399   2e-127   
ref|XP_006297529.1|  hypothetical protein CARUB_v10013552mg             395   6e-127   
ref|XP_009801576.1|  PREDICTED: uncharacterized protein LOC104247...    395   6e-127   
ref|XP_003548651.1|  PREDICTED: uncharacterized protein LOC100790149    395   1e-126   
emb|CDP12059.1|  unnamed protein product                                393   3e-126   
ref|XP_004252583.1|  PREDICTED: uncharacterized protein LOC101263884    393   6e-126   
ref|XP_009598396.1|  PREDICTED: uncharacterized protein LOC104094224    393   8e-126   
emb|CDY58245.1|  BnaA03g58010D                                          391   8e-126   
ref|XP_003547038.2|  PREDICTED: uncharacterized protein LOC100794154    390   9e-126   
emb|CBI34374.3|  unnamed protein product                                392   9e-126   
ref|XP_008373511.1|  PREDICTED: uncharacterized protein LOC103436813    393   1e-125   
ref|XP_006580556.1|  PREDICTED: uncharacterized protein LOC100818244    392   1e-125   
ref|XP_006360694.1|  PREDICTED: uncharacterized protein LOC102601770    392   2e-125   
ref|XP_009799200.1|  PREDICTED: uncharacterized protein LOC104245307    391   2e-125   
ref|XP_004169123.1|  PREDICTED: uncharacterized LOC101218166            393   3e-125   
ref|XP_009363408.1|  PREDICTED: uncharacterized protein LOC103953398    391   5e-125   
ref|XP_003532915.1|  PREDICTED: uncharacterized protein LOC100795943    390   5e-125   
gb|KHN33433.1|  hypothetical protein glysoja_005475                     392   5e-125   
ref|XP_009769878.1|  PREDICTED: uncharacterized protein LOC104220673    390   6e-125   
ref|XP_003542010.2|  PREDICTED: uncharacterized protein LOC100778156    392   6e-125   
ref|XP_002531833.1|  transferase, transferring glycosyl groups, p...    390   6e-125   Ricinus communis
ref|XP_010529619.1|  PREDICTED: uncharacterized protein LOC104806420    391   6e-125   
ref|XP_004148789.1|  PREDICTED: uncharacterized protein LOC101218166    392   7e-125   
ref|XP_006439493.1|  hypothetical protein CICLE_v10019694mg             391   7e-125   
ref|XP_010276911.1|  PREDICTED: uncharacterized protein LOC104611526    391   9e-125   
ref|XP_004245574.1|  PREDICTED: uncharacterized protein LOC101249113    390   1e-124   
ref|XP_006360583.1|  PREDICTED: uncharacterized protein LOC102586004    389   1e-124   
ref|XP_007040329.1|  Beta-1,3-glucosyltransferase                       391   1e-124   
ref|XP_010651091.1|  PREDICTED: uncharacterized protein LOC104879559    390   1e-124   
ref|XP_007207320.1|  hypothetical protein PRUPE_ppa004846mg             389   1e-124   
ref|XP_002279187.1|  PREDICTED: uncharacterized protein LOC100267372    390   1e-124   Vitis vinifera
ref|XP_008465293.1|  PREDICTED: uncharacterized protein LOC103502944    391   1e-124   
emb|CDP00131.1|  unnamed protein product                                389   1e-124   
ref|XP_008222523.1|  PREDICTED: uncharacterized protein LOC103322...    390   1e-124   
ref|XP_007016624.1|  Uncharacterized protein TCM_041982                 390   1e-124   
gb|KHN30225.1|  hypothetical protein glysoja_010603                     391   1e-124   
ref|XP_009801574.1|  PREDICTED: uncharacterized protein LOC104247...    389   2e-124   
ref|XP_001751279.1|  predicted protein                                  386   2e-124   
ref|XP_004242083.1|  PREDICTED: uncharacterized protein LOC101253909    389   2e-124   
ref|XP_010046420.1|  PREDICTED: uncharacterized protein LOC104435352    389   2e-124   
ref|XP_009619167.1|  PREDICTED: uncharacterized protein LOC104111223    388   3e-124   
ref|XP_009611458.1|  PREDICTED: uncharacterized protein LOC104104945    388   3e-124   
ref|XP_008222530.1|  PREDICTED: uncharacterized protein LOC103322...    389   4e-124   
emb|CDY44101.1|  BnaA01g13090D                                          389   4e-124   
ref|XP_008238941.1|  PREDICTED: uncharacterized protein LOC103337556    389   4e-124   
ref|XP_008437319.1|  PREDICTED: uncharacterized protein LOC103482775    389   5e-124   
ref|XP_009776276.1|  PREDICTED: uncharacterized protein LOC104226084    388   6e-124   
ref|XP_011073166.1|  PREDICTED: uncharacterized protein LOC105158...    389   6e-124   
emb|CDP11822.1|  unnamed protein product                                379   7e-124   
ref|XP_002867706.1|  hypothetical protein ARALYDRAFT_492523             389   7e-124   
ref|XP_010422090.1|  PREDICTED: uncharacterized protein LOC104707437    388   8e-124   
ref|XP_006343942.1|  PREDICTED: uncharacterized protein LOC102586899    388   9e-124   
gb|KDO59856.1|  hypothetical protein CISIN_1g010984mg                   387   1e-123   
ref|XP_006339795.1|  PREDICTED: uncharacterized protein LOC102583570    385   1e-123   
ref|XP_004231192.2|  PREDICTED: uncharacterized protein LOC101264770    387   1e-123   
emb|CDX94192.1|  BnaC07g38260D                                          387   1e-123   
ref|XP_007160097.1|  hypothetical protein PHAVU_002G292100g             387   1e-123   
ref|XP_006447476.1|  hypothetical protein CICLE_v10015015mg             387   1e-123   
ref|XP_006846343.1|  hypothetical protein AMTR_s00012p00258210          387   1e-123   
ref|XP_011073151.1|  PREDICTED: uncharacterized protein LOC105158...    388   1e-123   
gb|KFK28899.1|  hypothetical protein AALP_AA7G062500                    387   2e-123   
ref|XP_004298826.1|  PREDICTED: uncharacterized protein LOC101314371    387   2e-123   
ref|XP_004251447.1|  PREDICTED: uncharacterized protein LOC101264891    386   2e-123   
gb|KEH18823.1|  transferring glycosyl group transferase                 386   2e-123   
ref|XP_006303976.1|  hypothetical protein CARUB_v10008901mg             386   3e-123   
emb|CDY61924.1|  BnaA03g58710D                                          386   3e-123   
gb|KHN26942.1|  hypothetical protein glysoja_031019                     386   4e-123   
ref|XP_010112315.1|  hypothetical protein L484_011181                   386   4e-123   
ref|XP_010447528.1|  PREDICTED: uncharacterized protein LOC104730...    387   4e-123   
gb|KHG15704.1|  Beta-1,3-N-acetylglucosaminyltransferase lunatic ...    385   4e-123   
ref|XP_006287536.1|  hypothetical protein CARUB_v10000749mg             385   5e-123   
ref|XP_011041961.1|  PREDICTED: uncharacterized protein LOC105137785    385   6e-123   
ref|XP_002314204.1|  hypothetical protein POPTR_0009s03140g             385   6e-123   Populus trichocarpa [western balsam poplar]
ref|XP_011080920.1|  PREDICTED: uncharacterized protein LOC105164063    386   6e-123   
ref|XP_009763260.1|  PREDICTED: uncharacterized protein LOC104215204    385   6e-123   
ref|XP_010436096.1|  PREDICTED: uncharacterized protein LOC104719814    386   6e-123   
ref|XP_010455541.1|  PREDICTED: uncharacterized protein LOC104737...    385   7e-123   
ref|NP_567683.1|  uncharacterized protein                               386   8e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006365158.1|  PREDICTED: uncharacterized protein LOC102606181    385   8e-123   
ref|XP_002868593.1|  hypothetical protein ARALYDRAFT_916060             385   9e-123   
ref|XP_006829033.1|  hypothetical protein AMTR_s00001p00252920          385   1e-122   
ref|XP_010441307.1|  PREDICTED: uncharacterized protein LOC104724513    385   1e-122   
ref|XP_010538809.1|  PREDICTED: uncharacterized protein LOC104813025    385   1e-122   
ref|NP_198961.1|  uncharacterized protein                               385   1e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396919.1|  hypothetical protein EUTSA_v10028593mg             384   1e-122   
gb|KCW71570.1|  hypothetical protein EUGRSUZ_E00106                     384   2e-122   
emb|CDP08959.1|  unnamed protein product                                384   2e-122   
ref|XP_004143975.1|  PREDICTED: uncharacterized protein LOC101214810    384   2e-122   
ref|XP_009108177.1|  PREDICTED: uncharacterized protein LOC103833880    384   2e-122   
ref|XP_010435007.1|  PREDICTED: uncharacterized protein LOC104718882    384   2e-122   
ref|XP_010055094.1|  PREDICTED: uncharacterized protein LOC104443417    384   2e-122   
emb|CDP20373.1|  unnamed protein product                                384   2e-122   
ref|XP_003517477.1|  PREDICTED: uncharacterized protein LOC100801444    384   2e-122   
gb|KFK33009.1|  hypothetical protein AALP_AA6G318400                    384   3e-122   
ref|XP_010255246.1|  PREDICTED: uncharacterized protein LOC104595986    384   3e-122   
ref|XP_009595643.1|  PREDICTED: uncharacterized protein LOC104091909    384   3e-122   
ref|XP_009612604.1|  PREDICTED: uncharacterized protein LOC104105...    382   3e-122   
ref|XP_009137051.1|  PREDICTED: uncharacterized protein LOC103861091    384   4e-122   
dbj|BAE71200.1|  hypothetical protein                                   384   4e-122   Trifolium pratense [peavine clover]
ref|XP_006367660.1|  PREDICTED: uncharacterized protein LOC102595998    383   5e-122   
ref|XP_004503683.1|  PREDICTED: uncharacterized protein LOC101490078    383   5e-122   
ref|XP_009140092.1|  PREDICTED: uncharacterized protein LOC103864083    383   5e-122   
ref|XP_006405352.1|  hypothetical protein EUTSA_v10027721mg             383   6e-122   
ref|XP_010457107.1|  PREDICTED: uncharacterized protein LOC104738...    382   7e-122   
ref|XP_009358373.1|  PREDICTED: uncharacterized protein LOC103949004    383   8e-122   
emb|CDY13255.1|  BnaC09g24010D                                          382   9e-122   
gb|KHN35036.1|  hypothetical protein glysoja_004802                     381   1e-121   
ref|XP_010474760.1|  PREDICTED: uncharacterized protein LOC104754...    382   1e-121   
gb|KDP25398.1|  hypothetical protein JCGZ_20554                         382   1e-121   
ref|XP_007150256.1|  hypothetical protein PHAVU_005G138800g             384   1e-121   
ref|XP_002892055.1|  predicted protein                                  382   1e-121   
gb|AAK97671.1|  AT4g23490/F16G20_190                                    382   1e-121   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39739.1|  BnaA04g11140D                                          382   1e-121   
emb|CDY44474.1|  BnaCnng11270D                                          382   2e-121   
ref|XP_010480127.1|  PREDICTED: uncharacterized protein LOC104758...    382   2e-121   
emb|CDY63419.1|  BnaCnng42070D                                          382   2e-121   
ref|XP_007051739.1|  Uncharacterized protein TCM_005286                 381   2e-121   
ref|XP_003538307.2|  PREDICTED: uncharacterized protein LOC100801504    381   2e-121   
gb|KFK33008.1|  hypothetical protein AALP_AA6G318400                    381   3e-121   
ref|XP_007152167.1|  hypothetical protein PHAVU_004G107300g             382   3e-121   
ref|XP_009118599.1|  PREDICTED: uncharacterized protein LOC103843...    378   3e-121   
ref|XP_008349721.1|  PREDICTED: uncharacterized protein LOC103412996    382   3e-121   
gb|KDP44147.1|  hypothetical protein JCGZ_05614                         379   3e-121   
ref|XP_002443826.1|  hypothetical protein SORBIDRAFT_07g002850          381   3e-121   Sorghum bicolor [broomcorn]
ref|XP_002977124.1|  glycosyltransferase-like protein                   381   3e-121   
ref|XP_006283536.1|  hypothetical protein CARUB_v10004586mg             381   4e-121   
gb|KEH21118.1|  transferring glycosyl group transferase                 381   4e-121   
ref|XP_004295964.1|  PREDICTED: uncharacterized protein LOC101307385    380   8e-121   
ref|XP_004487057.1|  PREDICTED: uncharacterized protein LOC101496794    380   1e-120   
ref|XP_008385241.1|  PREDICTED: uncharacterized protein LOC103447819    380   1e-120   
ref|XP_006413551.1|  hypothetical protein EUTSA_v10024902mg             380   2e-120   
ref|XP_011022631.1|  PREDICTED: uncharacterized protein LOC105124342    379   2e-120   
ref|XP_008363471.1|  PREDICTED: uncharacterized protein LOC103427177    379   2e-120   
ref|XP_002304515.1|  fringe-related family protein                      379   3e-120   Populus trichocarpa [western balsam poplar]
ref|XP_006283508.1|  hypothetical protein CARUB_v10004561mg             379   3e-120   
ref|XP_009137355.1|  PREDICTED: uncharacterized protein LOC103861400    379   3e-120   
ref|XP_010433901.1|  PREDICTED: uncharacterized protein LOC104717962    379   3e-120   
ref|XP_010112954.1|  hypothetical protein L484_021475                   377   4e-120   
ref|NP_171663.1|  uncharacterized protein                               377   4e-120   
ref|XP_010685940.1|  PREDICTED: uncharacterized protein LOC104900256    378   4e-120   
ref|XP_009354569.1|  PREDICTED: uncharacterized protein LOC103945695    379   4e-120   
ref|XP_009612599.1|  PREDICTED: uncharacterized protein LOC104105...    377   4e-120   
ref|NP_192874.2|  uncharacterized protein                               377   6e-120   
ref|XP_003606544.1|  Fringe-like protein                                379   6e-120   
gb|AES94027.2|  transferring glycosyl group transferase                 377   7e-120   
ref|XP_009624408.1|  PREDICTED: uncharacterized protein LOC104115469    377   7e-120   
ref|XP_003597290.1|  hypothetical protein MTR_2g095970                  378   9e-120   
emb|CDY15168.1|  BnaC05g00470D                                          377   9e-120   
ref|XP_009118600.1|  PREDICTED: uncharacterized protein LOC103843...    374   9e-120   
ref|XP_004512191.1|  PREDICTED: uncharacterized protein LOC101493384    377   1e-119   
gb|AAF81315.1|AC061957_11  Contains similarity to a hypothetical ...    377   1e-119   
ref|XP_004510755.1|  PREDICTED: uncharacterized protein LOC101498680    376   1e-119   
ref|XP_010089064.1|  hypothetical protein L484_024237                   377   2e-119   
gb|KEH34744.1|  transferring glycosyl group transferase                 375   3e-119   
emb|CDX90042.1|  BnaA10g00400D                                          376   3e-119   
ref|XP_004492173.1|  PREDICTED: uncharacterized protein LOC101494656    375   3e-119   
ref|XP_009119708.1|  PREDICTED: uncharacterized protein LOC103844660    375   5e-119   
ref|XP_010055681.1|  PREDICTED: uncharacterized protein LOC104443836    375   5e-119   
ref|XP_002872578.1|  transferase, transferring glycosyl groups          375   7e-119   
ref|XP_002511900.1|  transferase, transferring glycosyl groups, p...    375   1e-118   
ref|XP_008678290.1|  PREDICTED: beta-1,3-N-acetylglucosaminyltran...    374   1e-118   
ref|XP_002298017.1|  fringe-related family protein                      374   3e-118   
ref|XP_002318171.2|  hypothetical protein POPTR_0012s10960g             370   4e-118   
gb|EPS67635.1|  hypothetical protein M569_07140                         370   5e-118   
ref|XP_011089382.1|  PREDICTED: uncharacterized protein LOC105170350    372   6e-118   
ref|XP_011029332.1|  PREDICTED: uncharacterized protein LOC105129092    372   8e-118   
ref|XP_011042986.1|  PREDICTED: uncharacterized protein LOC105138563    371   9e-118   
ref|XP_010676434.1|  PREDICTED: uncharacterized protein LOC104892257    372   1e-117   
ref|XP_001769539.1|  predicted protein                                  370   2e-117   
ref|XP_008662897.1|  PREDICTED: uncharacterized protein LOC103641326    370   3e-117   
ref|XP_004253290.1|  PREDICTED: uncharacterized protein LOC101251270    371   4e-117   
ref|XP_008233003.1|  PREDICTED: uncharacterized protein LOC103332088    370   5e-117   
gb|KHN09296.1|  Glycoprotein-N-acetylgalactosamine 3-beta-galacto...    369   5e-117   
ref|XP_010475561.1|  PREDICTED: uncharacterized protein LOC104754961    371   7e-117   
ref|XP_006429145.1|  hypothetical protein CICLE_v10011508mg             369   1e-116   
ref|XP_010457994.1|  PREDICTED: uncharacterized protein LOC104739370    370   1e-116   
ref|XP_010522968.1|  PREDICTED: uncharacterized protein LOC104801...    369   1e-116   
emb|CBI16231.3|  unnamed protein product                                366   2e-116   
ref|XP_007163444.1|  hypothetical protein PHAVU_001G235100g             367   3e-116   
ref|XP_010488062.1|  PREDICTED: uncharacterized protein LOC104765960    369   3e-116   
gb|KHG20363.1|  Beta-1,3-N-acetylglucosaminyltransferase lunatic ...    369   4e-116   
ref|XP_006587835.1|  PREDICTED: uncharacterized protein LOC100777888    367   6e-116   
ref|XP_010689645.1|  PREDICTED: uncharacterized protein LOC104903326    366   6e-116   
gb|KCW85654.1|  hypothetical protein EUGRSUZ_B02441                     365   1e-115   
gb|KDO76311.1|  hypothetical protein CISIN_1g037480mg                   367   1e-115   
ref|XP_002992119.1|  glycosyltransferase-like protein                   366   2e-115   
ref|XP_004493031.1|  PREDICTED: uncharacterized protein LOC101513883    365   2e-115   
gb|AFW61274.1|  putative DUF604-domain containing/glycosyltransfe...    366   3e-115   
gb|ABN08498.1|  Protein of unknown function DUF604                      364   7e-115   
ref|XP_009757706.1|  PREDICTED: uncharacterized protein LOC104210495    356   7e-115   
ref|XP_006602605.1|  PREDICTED: uncharacterized protein LOC100813750    363   7e-115   
ref|NP_565869.1|  uncharacterized protein                               365   8e-115   
ref|XP_006447435.1|  hypothetical protein CICLE_v10017992mg             358   1e-114   
gb|EPS71450.1|  hypothetical protein M569_03309                         360   1e-114   
ref|XP_009367865.1|  PREDICTED: uncharacterized protein LOC103957435    372   1e-114   
ref|XP_003624018.1|  hypothetical protein MTR_7g078320                  363   1e-114   
gb|KDP35680.1|  hypothetical protein JCGZ_09118                         363   2e-114   
gb|KFK36662.1|  hypothetical protein AALP_AA4G153700                    374   2e-114   
ref|XP_001772352.1|  predicted protein                                  360   2e-114   
ref|XP_002509844.1|  transferase, transferring glycosyl groups, p...    363   3e-114   
ref|XP_009347931.1|  PREDICTED: uncharacterized protein LOC103939549    362   4e-114   
ref|XP_006601991.1|  PREDICTED: uncharacterized protein LOC100802...    362   4e-114   
gb|KEH22967.1|  transferring glycosyl group transferase                 362   6e-114   
gb|EEC82870.1|  hypothetical protein OsI_27743                          359   7e-114   
ref|XP_011091510.1|  PREDICTED: uncharacterized protein LOC105171936    361   8e-114   
ref|XP_009803528.1|  PREDICTED: uncharacterized protein LOC104248872    361   1e-113   
ref|XP_010259965.1|  PREDICTED: uncharacterized protein LOC104599215    362   1e-113   
ref|XP_002881548.1|  hypothetical protein ARALYDRAFT_902953             362   1e-113   
ref|NP_001053643.1|  Os04g0578800                                       362   1e-113   
ref|XP_008442515.1|  PREDICTED: uncharacterized protein LOC103486366    360   2e-113   
ref|XP_004146561.1|  PREDICTED: uncharacterized protein LOC101219663    361   2e-113   
ref|XP_006410964.1|  hypothetical protein EUTSA_v10017530mg             361   2e-113   
ref|NP_001060955.1|  Os08g0137300                                       360   2e-113   
ref|XP_009346405.1|  PREDICTED: uncharacterized protein LOC103938134    358   3e-113   
ref|XP_007140496.1|  hypothetical protein PHAVU_008G117500g             360   4e-113   
ref|XP_002271331.1|  PREDICTED: uncharacterized protein LOC100242633    360   4e-113   
ref|XP_010253427.1|  PREDICTED: uncharacterized protein LOC104594...    360   5e-113   
gb|EYU45959.1|  hypothetical protein MIMGU_mgv1a005742mg                358   5e-113   
ref|XP_004160981.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    360   5e-113   
ref|XP_010553535.1|  PREDICTED: uncharacterized protein LOC104823596    360   8e-113   
emb|CDY01988.1|  BnaC02g27390D                                          359   9e-113   
emb|CDY65114.1|  BnaC04g53660D                                          359   9e-113   
ref|XP_010253426.1|  PREDICTED: uncharacterized protein LOC104594...    360   9e-113   
ref|XP_001772645.1|  predicted protein                                  357   1e-112   
ref|XP_009128480.1|  PREDICTED: uncharacterized protein LOC103853...    358   1e-112   
ref|XP_008387853.1|  PREDICTED: uncharacterized protein LOC103450296    358   1e-112   
ref|XP_004170734.1|  PREDICTED: uncharacterized LOC101203954            358   2e-112   
ref|XP_010047935.1|  PREDICTED: uncharacterized protein LOC104436758    359   2e-112   
ref|XP_011100288.1|  PREDICTED: uncharacterized protein LOC105178500    357   2e-112   
ref|XP_003611069.1|  hypothetical protein MTR_5g010070                  359   2e-112   
ref|XP_009350453.1|  PREDICTED: uncharacterized protein LOC103941982    358   2e-112   
emb|CAH66741.1|  H0404F02.17                                            358   2e-112   
gb|EAY95263.1|  hypothetical protein OsI_17086                          358   2e-112   
ref|XP_011006392.1|  PREDICTED: uncharacterized protein LOC105112393    358   3e-112   
ref|XP_007139801.1|  hypothetical protein PHAVU_008G059900g             357   3e-112   
ref|XP_009380306.1|  PREDICTED: uncharacterized protein LOC103968722    359   5e-112   
ref|XP_004503165.1|  PREDICTED: uncharacterized protein LOC101513...    357   5e-112   
ref|XP_004503166.1|  PREDICTED: uncharacterized protein LOC101513...    356   5e-112   
gb|KDO59864.1|  hypothetical protein CISIN_1g010984mg                   356   8e-112   
ref|XP_006447478.1|  hypothetical protein CICLE_v10015015mg             356   8e-112   
ref|XP_004137929.1|  PREDICTED: uncharacterized protein LOC101203954    358   1e-111   
ref|XP_008240551.1|  PREDICTED: uncharacterized protein LOC103339050    356   1e-111   
ref|XP_009143455.1|  PREDICTED: uncharacterized protein LOC103867167    356   1e-111   
ref|XP_002309080.2|  hypothetical protein POPTR_0006s09010g             356   2e-111   
emb|CDY54929.1|  BnaAnng13620D                                          355   2e-111   
ref|XP_008369934.1|  PREDICTED: uncharacterized protein LOC103433448    355   2e-111   
ref|XP_009619659.1|  PREDICTED: uncharacterized protein LOC104111623    355   2e-111   
ref|XP_010933989.1|  PREDICTED: uncharacterized protein LOC105054219    357   2e-111   
gb|KHG11274.1|  Beta-1,3-glucosyltransferase                            354   2e-111   
emb|CDY68083.1|  BnaAnng26110D                                          355   3e-111   
ref|XP_010474761.1|  PREDICTED: uncharacterized protein LOC104754...    363   5e-111   
ref|XP_008452042.1|  PREDICTED: uncharacterized protein LOC103493168    354   5e-111   
ref|XP_006851899.1|  hypothetical protein AMTR_s00041p00143300          355   6e-111   
ref|XP_009346419.1|  PREDICTED: uncharacterized protein LOC103938144    354   7e-111   
ref|XP_010457110.1|  PREDICTED: uncharacterized protein LOC104738...    363   7e-111   
ref|XP_002448373.1|  hypothetical protein SORBIDRAFT_06g026210          355   7e-111   
dbj|BAK00434.1|  predicted protein                                      353   1e-110   
ref|XP_002315207.1|  hypothetical protein POPTR_0010s20760g             353   1e-110   
ref|XP_010919100.1|  PREDICTED: uncharacterized protein LOC105043302    354   2e-110   
ref|XP_010480134.1|  PREDICTED: uncharacterized protein LOC104758...    362   2e-110   
ref|XP_006378694.1|  hypothetical protein POPTR_0010s20760g             353   2e-110   
ref|XP_009146730.1|  PREDICTED: uncharacterized protein LOC103870351    353   2e-110   
gb|AFW59118.1|  putative DUF604-domain containing/glycosyltransfe...    353   2e-110   
ref|XP_006846344.1|  hypothetical protein AMTR_s00012p00258400          354   2e-110   
dbj|BAJ97304.1|  predicted protein                                      353   2e-110   
gb|EPS62175.1|  hypothetical protein M569_12617                         348   3e-110   
ref|XP_009384071.1|  PREDICTED: uncharacterized protein LOC103971705    355   3e-110   
ref|XP_010521803.1|  PREDICTED: uncharacterized protein LOC104800...    353   4e-110   
ref|XP_010262898.1|  PREDICTED: uncharacterized protein LOC104601308    352   4e-110   
emb|CDY08529.1|  BnaA05g27650D                                          352   4e-110   
ref|XP_002323517.1|  fringe-related family protein                      352   4e-110   
gb|EEE68012.1|  hypothetical protein OsJ_25974                          354   4e-110   
ref|XP_007026944.1|  Uncharacterized protein TCM_021877                 352   6e-110   
ref|XP_010250871.1|  PREDICTED: uncharacterized protein LOC104592979    353   7e-110   
emb|CDY49522.1|  BnaC05g03340D                                          344   7e-110   
ref|XP_009385929.1|  PREDICTED: uncharacterized protein LOC103973162    353   8e-110   
ref|XP_008670912.1|  PREDICTED: uncharacterized protein LOC103648203    352   9e-110   
ref|XP_007206381.1|  hypothetical protein PRUPE_ppa017976mg             351   9e-110   
gb|EYU40071.1|  hypothetical protein MIMGU_mgv1a020865mg                348   1e-109   
ref|XP_008807232.1|  PREDICTED: uncharacterized protein LOC103719...    351   2e-109   
ref|XP_010456306.1|  PREDICTED: uncharacterized protein LOC104737750    350   2e-109   
ref|XP_001767534.1|  predicted protein                                  348   2e-109   
ref|XP_011002626.1|  PREDICTED: uncharacterized protein LOC105109...    350   2e-109   
ref|XP_008807231.1|  PREDICTED: uncharacterized protein LOC103719...    352   2e-109   
ref|NP_174595.1|  uncharacterized protein                               351   2e-109   
ref|XP_009351426.1|  PREDICTED: uncharacterized protein LOC103942953    350   3e-109   
ref|XP_010509283.1|  PREDICTED: uncharacterized protein LOC104785714    350   3e-109   
ref|XP_008230155.1|  PREDICTED: uncharacterized protein LOC103329460    339   4e-109   
ref|XP_011077633.1|  PREDICTED: uncharacterized protein LOC105161594    349   4e-109   
ref|XP_002970669.1|  glycosyltransferase-like protein                   349   4e-109   
ref|XP_009783166.1|  PREDICTED: uncharacterized protein LOC104231809    349   5e-109   
ref|XP_011002624.1|  PREDICTED: uncharacterized protein LOC105109...    349   6e-109   
ref|XP_002969336.1|  glycosyltransferase-like protein                   348   1e-108   
ref|XP_002270850.1|  PREDICTED: uncharacterized protein LOC100253017    349   1e-108   
gb|KHN22852.1|  hypothetical protein glysoja_020782                     342   1e-108   
ref|XP_004305187.1|  PREDICTED: uncharacterized protein LOC101309470    354   1e-108   
ref|XP_008791700.1|  PREDICTED: uncharacterized protein LOC103708518    346   1e-108   
ref|XP_010478742.1|  PREDICTED: uncharacterized protein LOC104757683    349   2e-108   
ref|XP_010461142.1|  PREDICTED: uncharacterized protein LOC104741913    349   2e-108   
gb|KDP28590.1|  hypothetical protein JCGZ_14361                         347   2e-108   
gb|KCW72675.1|  hypothetical protein EUGRSUZ_E01132                     344   3e-108   
ref|XP_006418434.1|  hypothetical protein EUTSA_v10007848mg             343   3e-108   
emb|CAB51419.1|  putative protein                                       347   3e-108   
gb|KDO76824.1|  hypothetical protein CISIN_1g0090291mg                  348   3e-108   
ref|XP_006435632.1|  hypothetical protein CICLE_v10031336mg             347   3e-108   
ref|XP_006476229.1|  PREDICTED: uncharacterized protein LOC102616...    348   4e-108   
ref|XP_006652683.1|  PREDICTED: uncharacterized protein LOC102710778    348   4e-108   
ref|XP_008371981.1|  PREDICTED: uncharacterized protein LOC103435367    347   4e-108   
ref|XP_003573354.1|  PREDICTED: uncharacterized protein LOC100828911    346   7e-108   
ref|XP_010262600.1|  PREDICTED: uncharacterized protein LOC104601...    346   7e-108   
ref|XP_010505370.1|  PREDICTED: uncharacterized protein LOC104782203    347   8e-108   
ref|XP_002893759.1|  hypothetical protein ARALYDRAFT_890907             347   1e-107   
ref|XP_006295581.1|  hypothetical protein CARUB_v10024689mg             349   1e-107   
ref|XP_006439157.1|  hypothetical protein CICLE_v10019592mg             347   2e-107   
ref|XP_011007127.1|  PREDICTED: uncharacterized protein LOC105112918    345   2e-107   
ref|XP_003537924.1|  PREDICTED: uncharacterized protein LOC100819814    346   2e-107   
ref|XP_002518969.1|  beta-1,3-n-acetylglucosaminyltransferase rad...    346   2e-107   
gb|KFK43099.1|  hypothetical protein AALP_AA1G080100                    346   3e-107   
ref|NP_172263.4|  uncharacterized protein                               346   3e-107   
emb|CDY67284.1|  BnaAnng23960D                                          345   3e-107   
gb|KHN35118.1|  hypothetical protein glysoja_004884                     346   3e-107   
gb|KDO52371.1|  hypothetical protein CISIN_1g044015mg                   343   4e-107   
emb|CDY56847.1|  BnaCnng31240D                                          344   4e-107   
ref|XP_003580375.1|  PREDICTED: uncharacterized protein LOC100837952    344   5e-107   
ref|XP_010934149.1|  PREDICTED: uncharacterized protein LOC105054351    347   6e-107   
emb|CDX93612.1|  BnaA06g04360D                                          341   6e-107   
gb|ABR17622.1|  unknown                                                 343   1e-106   
ref|XP_006307183.1|  hypothetical protein CARUB_v10008775mg             345   1e-106   
ref|XP_009412850.1|  PREDICTED: uncharacterized protein LOC103994241    343   1e-106   
ref|XP_010499864.1|  PREDICTED: uncharacterized protein LOC104777336    344   1e-106   
ref|XP_009762736.1|  PREDICTED: uncharacterized protein LOC104214722    342   1e-106   
ref|XP_004246866.1|  PREDICTED: uncharacterized protein LOC101253314    342   1e-106   
ref|XP_004309561.1|  PREDICTED: uncharacterized protein LOC101311434    343   1e-106   
ref|XP_006407449.1|  hypothetical protein EUTSA_v10020559mg             343   2e-106   
ref|XP_006303625.1|  hypothetical protein CARUB_v10011500mg             344   2e-106   
ref|XP_006417759.1|  hypothetical protein EUTSA_v10007281mg             344   2e-106   
ref|XP_010517049.1|  PREDICTED: uncharacterized protein LOC104792565    343   2e-106   
ref|XP_006341206.1|  PREDICTED: uncharacterized protein LOC102579489    340   2e-106   
ref|XP_008343572.1|  PREDICTED: uncharacterized protein LOC103406357    342   2e-106   
ref|XP_009762592.1|  PREDICTED: uncharacterized protein LOC104214596    343   2e-106   
ref|XP_010919437.1|  PREDICTED: uncharacterized protein LOC105043566    343   2e-106   
ref|XP_007209926.1|  hypothetical protein PRUPE_ppa004520mg             342   3e-106   
ref|XP_004976578.1|  PREDICTED: uncharacterized protein LOC101758860    343   3e-106   
ref|XP_002882730.1|  hypothetical protein ARALYDRAFT_478479             342   3e-106   
ref|XP_006415117.1|  hypothetical protein EUTSA_v10007283mg             343   4e-106   
ref|NP_001152262.1|  transferase, transferring glycosyl groups          342   4e-106   
ref|XP_010058383.1|  PREDICTED: uncharacterized protein LOC104446188    343   4e-106   
ref|XP_007157026.1|  hypothetical protein PHAVU_002G037400g             343   5e-106   
ref|XP_009121140.1|  PREDICTED: uncharacterized protein LOC103845975    341   9e-106   
ref|XP_010542323.1|  PREDICTED: uncharacterized protein LOC104815574    342   1e-105   
ref|XP_009111499.1|  PREDICTED: uncharacterized protein LOC103836932    340   1e-105   
ref|XP_009606983.1|  PREDICTED: uncharacterized protein LOC104101239    340   2e-105   
ref|XP_010522969.1|  PREDICTED: uncharacterized protein LOC104801...    348   2e-105   
ref|XP_009343841.1|  PREDICTED: uncharacterized protein LOC103935754    340   2e-105   
ref|XP_008239290.1|  PREDICTED: uncharacterized protein LOC103337897    340   3e-105   



>ref|XP_009801577.1| PREDICTED: uncharacterized protein LOC104247307 [Nicotiana sylvestris]
Length=478

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/479 (67%), Positives = 381/479 (80%), Gaps = 10/479 (2%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQN-FKNIVLICSSLCVVYLVCTFVLVPSTN---LLHVSVSLQD--VS  389
             M F Q P K + S N  KN+++I S  C++YLVCT  L P+ N     H SVSLQD  +S
Sbjct  1     MQFFQVPNKAQYSPNPLKNLIIISSFGCMIYLVCTIFLAPNNNNNKHFHTSVSLQDDELS  60

Query  390   SPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGT--DSLPP  563
             S T+L+HIVFGIAS+E+SW KRKE+VKLWW P  MRGCVFL++       NGT  +SLPP
Sbjct  61    SQTNLDHIVFGIASNEQSWSKRKEYVKLWWEPHIMRGCVFLEKMP-PFSSNGTSNESLPP  119

Query  564   VCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTL  743
             +CIS DTS FRYT RGG PSAIR+AR VS+ V+LNHS+VRWFVFGDDDT+FFP+NLVKTL
Sbjct  120   ICISEDTSRFRYTHRGGTPSAIRVARVVSKTVALNHSNVRWFVFGDDDTIFFPENLVKTL  179

Query  744   SKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLY  923
             SKYDH LWYYIGT+SE  +QN FFS++MAFGGAGFAISYPLAK  AKVFDSC+ RYPHLY
Sbjct  180   SKYDHDLWYYIGTNSESYMQNKFFSYDMAFGGAGFAISYPLAKVFAKVFDSCIERYPHLY  239

Query  924   GSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNM  1103
             GSD RVHACL+ELGV LT EPGFHQMD  G+VFG+LAAHP+RPLVS+HHME  DPIFPNM
Sbjct  240   GSDGRVHACLAELGVGLTREPGFHQMDFHGNVFGMLAAHPIRPLVSMHHMEAIDPIFPNM  299

Query  1104  TTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQE  1283
             TT KA+EHLYKAAS DPHRILQQTVCYDRWFSWT+SVSWGYAVQ+   ++LL D  R QE
Sbjct  300   TTVKAVEHLYKAASFDPHRILQQTVCYDRWFSWTVSVSWGYAVQVFDRNVLLSDVQRVQE  359

Query  1284  SYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFD  1463
             SY+PW+++     Y FD+R Y  DPCRRQ V+Y+D+V S   +G  ++Y+K T+E C FD
Sbjct  360   SYAPWKRSHLGGLYDFDTRKYEFDPCRRQLVYYLDKVFSG-SNGTETIYKKKTSEECKFD  418

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
               SP  L+EIRV + KL LD ++LLAPRRHCCD+L S++   +EIGIRECKE+EL+YMH
Sbjct  419   MTSPIRLEEIRVVSTKLVLDKQQLLAPRRHCCDLLHSTSGNVMEIGIRECKEDELIYMH  477



>ref|XP_009612606.1| PREDICTED: uncharacterized protein LOC104105884 [Nicotiana tomentosiformis]
Length=476

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/476 (67%), Positives = 379/476 (80%), Gaps = 6/476 (1%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQN-FKNIVLICSSLCVVYLVCTFVLVPSTNL-LHVSVSLQD--VSSP  395
             M F Q P K + S N FKN+++I    C++YLVCT  L P+ N   H SVSLQD  +SS 
Sbjct  1     MQFFQVPNKTQHSTNPFKNLIIISCFGCMIYLVCTIFLAPNNNKHFHTSVSLQDDELSSQ  60

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDR-DEVKHEDNGTDSLPPVCI  572
             T+L+HIVFGIAS+E+S  KRKE+VKLWW P  MRGCVFL++           +SLPP+CI
Sbjct  61    TNLDHIVFGIASNEQSCSKRKEYVKLWWEPHIMRGCVFLEKMPPFSSNRTYNESLPPICI  120

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             S DTS FRYT RGG PSAIR+AR VSE V+LNHS+VRWFVFGDDDT+FFP+NLVKTLSKY
Sbjct  121   SEDTSRFRYTHRGGTPSAIRVARVVSETVALNHSNVRWFVFGDDDTIFFPENLVKTLSKY  180

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DHGLWYYIGT+SE  +QN FFS++MAFGGAGFAISYPLAKALAKVFDSC+ RYPHLYGSD
Sbjct  181   DHGLWYYIGTNSESFMQNKFFSYDMAFGGAGFAISYPLAKALAKVFDSCIARYPHLYGSD  240

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
              RVHACL+ELGVSLT EPGFHQMD  G+VFG+LAAHP+RPLVS+HHME  DPIFPNMTT 
Sbjct  241   GRVHACLAELGVSLTREPGFHQMDFHGNVFGMLAAHPIRPLVSMHHMEAIDPIFPNMTTV  300

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             KA+EHLYKAAS DPHRILQQTVCYD WFSWT+SVSWGYAVQ+   ++LL D    QESY+
Sbjct  301   KAVEHLYKAASFDPHRILQQTVCYDHWFSWTVSVSWGYAVQVFDRNVLLSDVQCVQESYA  360

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKAS  1472
             PW+++     Y FD+R Y  D CRRQ V+++D+VSS   +G  + Y+K T+E C FD  S
Sbjct  361   PWKRSHLGGLYDFDTRKYEFDLCRRQLVYFLDKVSSG-SNGTETTYKKKTSEECKFDMTS  419

Query  1473  PRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             PR L+EIRV + KL LD ++LLAPRRHCCDVL S++   +EIGIRECKE+EL+YMH
Sbjct  420   PRRLEEIRVLSSKLVLDKQQLLAPRRHCCDVLHSTSGNVMEIGIRECKEDELIYMH  475



>ref|XP_009605991.1| PREDICTED: uncharacterized protein LOC104100467 [Nicotiana tomentosiformis]
Length=474

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/471 (66%), Positives = 379/471 (80%), Gaps = 6/471 (1%)
 Frame = +3

Query  240   QAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPS-TNLLHVSVSLQ--DVSSPTSLEH  410
             Q P K+    + KN++L+   +C++Y +   +L P+ TN LH SVS Q  D+SSPT+L+H
Sbjct  5     QVPSKIPSCHSIKNLILVSCFICIIYFLYPIILAPNYTNSLHTSVSSQEHDLSSPTTLQH  64

Query  411   IVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSS  590
             +VFGIAS+E+SW KRKE VKLW++ + M+GCVFL++       N +  LPP+CIS D S 
Sbjct  65    VVFGIASNEKSWSKRKELVKLWYKSNEMKGCVFLEKMP-NSSTNDSLLLPPICISEDISR  123

Query  591   FRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWY  770
             F YT +GGNPSAIR+AR VSE V+LNHS+VRWFVFGDDDT+FFP+NLVKTLSKYDHGLWY
Sbjct  124   FPYTNKGGNPSAIRVARVVSETVALNHSNVRWFVFGDDDTIFFPENLVKTLSKYDHGLWY  183

Query  771   YIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHAC  950
             YIG++SE  +QN FFSFEMAFGGAGF ISYPLAK LAKVFDSC+ RYPHLYGSD R+HAC
Sbjct  184   YIGSNSESFIQNKFFSFEMAFGGAGFVISYPLAKVLAKVFDSCIERYPHLYGSDGRIHAC  243

Query  951   LSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHL  1130
             L+ELGV+LTHEPGFHQMD  G+VFGLLAAH +RPLVSLHHME+ DPIFPNMT  KALEHL
Sbjct  244   LTELGVTLTHEPGFHQMDFHGNVFGLLAAHSIRPLVSLHHMEIIDPIFPNMTRMKALEHL  303

Query  1131  YKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNK  1310
             Y+AAS  P RILQQTVCYDR FSWT+SVSWGYAVQ+   ++ LPDA R QESY PW+KN 
Sbjct  304   YQAASFYPQRILQQTVCYDRRFSWTVSVSWGYAVQVFAHNVFLPDAQRVQESYFPWKKNA  363

Query  1311  KDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTT-ENCTFDKASPRNLD  1487
                 Y +++R +  DPC++Q V+++D VSSS  D I ++Y+K TT ENCTF K SPR L+
Sbjct  364   YGTLYEYNTRKFESDPCKKQIVYFLDNVSSS-MDEIKTIYKKKTTSENCTFGKNSPRKLE  422

Query  1488  EIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             EIRV + KLDLD+ +LLAPRRHCCDVL S++ K +EIGIRECKE+EL+YMH
Sbjct  423   EIRVFSHKLDLDTNQLLAPRRHCCDVLPSTSGKVMEIGIRECKEDELIYMH  473



>ref|XP_009591180.1| PREDICTED: uncharacterized protein LOC104088240 [Nicotiana tomentosiformis]
Length=479

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/465 (66%), Positives = 375/465 (81%), Gaps = 7/465 (2%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVS---SPTSLEHIVFGIASS  434
             S   KNI+LI S +C++YL       P+T LLH SVSLQ+ S   S T+LEHIVFGIAS+
Sbjct  15    SNGVKNIILITSFVCIIYLFFFNFNGPNTKLLHTSVSLQNDSTLLSDTNLEHIVFGIASN  74

Query  435   EESWRKRKEFVKLWWRP-SGMRGCVFLDRDEVKHEDNGT--DSLPPVCISGDTSSFRYTC  605
             E++W  RKE VK+WW+  S MRGCVFL++    + +N T  DSLPP+CISGDTS F+YT 
Sbjct  75    EKAWSTRKELVKMWWKAGSKMRGCVFLEKMPSNYTNNTTENDSLPPICISGDTSRFKYTF  134

Query  606   RGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTS  785
             RGG PSAIR+AR V+E V+LNHS+VRW+VFGDDDTVFFPDNLVKTLSKYDHGLWYYIG++
Sbjct  135   RGGTPSAIRVARVVTETVALNHSNVRWYVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGSN  194

Query  786   SEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELG  965
             SE  + N  FS+EMAFGGAG AISYPLAK L KVFD+C+ RYPHL+GSDAR+++CL+ELG
Sbjct  195   SEHFLMNKAFSYEMAFGGAGIAISYPLAKVLGKVFDACIERYPHLFGSDARIYSCLAELG  254

Query  966   VSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAAS  1145
             V LTHEPGFHQ+D+RG++FG+LAAH +RPLVSLHHME+ D IFPNMT  KALEHLY AA 
Sbjct  255   VGLTHEPGFHQLDVRGNMFGMLAAHTIRPLVSLHHMEMNDAIFPNMTKMKALEHLYDAAK  314

Query  1146  IDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPY  1325
              DPHRILQQTVCYDRWF+WT+SVSWGYAVQ+ G H+ LPDA R QESY PW+K      Y
Sbjct  315   FDPHRILQQTVCYDRWFTWTVSVSWGYAVQVFGYHVFLPDAQRVQESYFPWQKGDLARHY  374

Query  1326  GFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVST  1505
               D+R Y PDPC+RQ V+++D VSS   DGI ++Y+K T ENCT +  SPR L+EIRV++
Sbjct  375   DLDTRPYEPDPCKRQLVYFLDNVSSG-SDGIKTIYKKKTPENCTINMVSPRKLEEIRVTS  433

Query  1506  QKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             QKLDLD K+LL+PRR CCDVL S++   +EIGIRECKE+EL+Y+H
Sbjct  434   QKLDLDKKQLLSPRRQCCDVLPSTSRNVMEIGIRECKEDELIYIH  478



>ref|XP_009779247.1| PREDICTED: uncharacterized protein LOC104228481 [Nicotiana sylvestris]
Length=472

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/469 (64%), Positives = 373/469 (80%), Gaps = 4/469 (1%)
 Frame = +3

Query  240   QAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQ--DVSSPTSLEHI  413
             Q P K+    + KN++L+ S + ++Y +   +L P TN +H S+S Q  D+SSPT+L H+
Sbjct  5     QLPSKIASCHSIKNLILVSSFVSIIYFLYPIILAPKTNFVHTSISSQKYDLSSPTTLHHV  64

Query  414   VFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSF  593
             VFGIAS+E+SW KRKE VKLW++P+ MRGCVFL++       N +  LPP+ IS D S F
Sbjct  65    VFGIASNEKSWSKRKELVKLWYKPNEMRGCVFLEKMP-NSSTNDSLLLPPIYISEDISRF  123

Query  594   RYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYY  773
              YT RGGNPSAIR+AR VSE V+LNHS+VRWFVFGDDDT+FFP+NLVKTLSKYDHGLWYY
Sbjct  124   PYTNRGGNPSAIRVARVVSETVALNHSNVRWFVFGDDDTIFFPENLVKTLSKYDHGLWYY  183

Query  774   IGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACL  953
             IG++SE  +QN FFSFEMAFGGAGFAISYPL   LAKVFDSC+ RYPHLYGSD R+HACL
Sbjct  184   IGSNSESFIQNKFFSFEMAFGGAGFAISYPLGNVLAKVFDSCIERYPHLYGSDGRIHACL  243

Query  954   SELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLY  1133
             +ELGV+LTHEPGFHQMD  G+VFGLLAAH +RPLVSLHHME+ +PIFPNMT  K+LEHLY
Sbjct  244   TELGVTLTHEPGFHQMDFHGNVFGLLAAHSIRPLVSLHHMEIIEPIFPNMTRMKSLEHLY  303

Query  1134  KAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK  1313
             +AAS DP R+LQQ VCYDR FSWT+SVSWGYAVQ+   ++ L DA R QESY PW+KN  
Sbjct  304   QAASFDPQRLLQQAVCYDRRFSWTVSVSWGYAVQVFAHNVFLTDAQRVQESYLPWKKNAY  363

Query  1314  DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEI  1493
                Y +++R +  D C++Q +F++++VSS   D I ++Y+K T++NCTF K SPR ++EI
Sbjct  364   GTLYEYNTRKFESDQCKKQIIFFLNKVSSG-MDEIKTIYKKKTSDNCTFSKNSPREIEEI  422

Query  1494  RVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             RV + KLDLD+ +LLAPRRHCCDVL S++ K +E+ IRECKE+EL+YMH
Sbjct  423   RVFSHKLDLDTNQLLAPRRHCCDVLPSTSGKVMEMEIRECKEDELIYMH  471



>ref|XP_011100287.1| PREDICTED: uncharacterized protein LOC105178499 [Sesamum indicum]
Length=452

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/457 (67%), Positives = 362/457 (79%), Gaps = 10/457 (2%)
 Frame = +3

Query  285   VLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEF  464
             +++   LC+ YL  TF+ VP+  + H+S SLQ +  PTSLEHI+FGIAS++++W  RKE+
Sbjct  1     MIVSCLLCMTYL--TFI-VPNIKVTHISTSLQALYPPTSLEHIIFGIASNDKTWLSRKEY  57

Query  465   VKLWWRPSGMRGCVFLD---RDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRL  635
             V+LWWRP  MRGCVFL+   ++    +     +LPPVC+SGDTS FRYT R G  SAIR+
Sbjct  58    VRLWWRPQEMRGCVFLENAPQNATPVDQADASALPPVCVSGDTSRFRYTYRNGLRSAIRV  117

Query  636   ARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFF  815
             AR VSE V+LNHS+VRWFVFGDDDTVFFP+NLVKTLSKYDHGLWYYIGT+SE  +QN  F
Sbjct  118   ARVVSETVALNHSNVRWFVFGDDDTVFFPENLVKTLSKYDHGLWYYIGTNSESYIQNKLF  177

Query  816   SFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFH  995
             SFEMAFGGAGFAISYPLAK LAKVFDSCL RYPHLYGSD+R+ +CL+ELGVSLTHEPGFH
Sbjct  178   SFEMAFGGAGFAISYPLAKVLAKVFDSCLERYPHLYGSDSRIQSCLAELGVSLTHEPGFH  237

Query  996   QMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQT  1175
             QMD+RG VFGLLA+HP+RPLVSLHH E  D IFP MT  KALEHL+KA SID  R++QQT
Sbjct  238   QMDVRGSVFGLLASHPIRPLVSLHHWEAMDAIFPKMTPIKALEHLFKAISIDSQRVMQQT  297

Query  1176  VCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNK--KDVPYGFDSRGYH  1349
             VCYDRWFSWTISVSWGYAVQI   ++ LPDA+R QE+Y PWRK     D+ Y  D+ GY+
Sbjct  298   VCYDRWFSWTISVSWGYAVQIFQHNVFLPDAIRTQETYVPWRKGGGINDL-YVIDTLGYN  356

Query  1350  PDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSK  1529
             PDPCRR  VF++  V  S R+ I S YR MT++NCTFD ASPR L+EIRV +QK DLD K
Sbjct  357   PDPCRRPPVFFLHNV-LSERNRIRSTYRMMTSDNCTFDMASPRKLEEIRVFSQKQDLDHK  415

Query  1530  ELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             +L APRR CCDVL  S+   LE+ IREC +EEL+YMH
Sbjct  416   QLQAPRRQCCDVLPPSSGTVLEVAIRECGDEELIYMH  452



>ref|XP_006352036.1| PREDICTED: uncharacterized protein LOC102586291 [Solanum tuberosum]
Length=480

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/480 (62%), Positives = 369/480 (77%), Gaps = 10/480 (2%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQ-----DVSS  392
             M F Q   K       KN++LI    C +Y +  F+LVP++N L  S         D+SS
Sbjct  1     MQFFQVNSKTPSWHGIKNLILISCFACTIYFLYPFILVPNSNFLDYSFVSSHDQQFDLSS  60

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSL--PPV  566
             P +L+++VFGIAS+ +SW KRKE+VKLWW+P+ MRGCVFL+++         DS+  PP+
Sbjct  61    PITLQNVVFGIASNSKSWSKRKEYVKLWWKPNEMRGCVFLEKNLPNSTTTTNDSISPPPI  120

Query  567   CISGDTSSFRYTCRGGNPSAIRLARAVSE--AVSLNHSDVRWFVFGDDDTVFFPDNLVKT  740
             CIS D S F YT +GG+ SAIR+AR VSE  A++LNHSDV+WFVFGDDDT+FF +NLVKT
Sbjct  121   CISNDISRFPYTNKGGSLSAIRVARVVSETVALNLNHSDVKWFVFGDDDTIFFQENLVKT  180

Query  741   LSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHL  920
             LSKYD+GLWYYIG++SE  +QN FFSF+MAFGGAGFAISYPLAK LA+VFDSC+ RYPHL
Sbjct  181   LSKYDNGLWYYIGSNSESFIQNKFFSFDMAFGGAGFAISYPLAKILARVFDSCIERYPHL  240

Query  921   YGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPN  1100
             YGSD R+HACL+ELGV+LTHEPGFHQMD  G+ FGLLAAHP+RPLVSLHHME  DPIFPN
Sbjct  241   YGSDGRIHACLTELGVTLTHEPGFHQMDFLGNAFGLLAAHPIRPLVSLHHMEKIDPIFPN  300

Query  1101  MTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQ  1280
             MT  K+LE LY  A+ DP RILQQTVCY+R FSWT+SVSWGY VQ+   ++ LPDA R Q
Sbjct  301   MTRMKSLEQLYHVANFDPQRILQQTVCYNRRFSWTVSVSWGYVVQVFVHNVQLPDAQRVQ  360

Query  1281  ESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTF  1460
             ESY PW+KN     Y F++R +  DPC+RQ V+++D VS    DGI ++Y+K   ENCTF
Sbjct  361   ESYLPWKKNAYGTLYEFNTRKFEVDPCKRQLVYFLDEVSMG-VDGIKTIYKKKAYENCTF  419

Query  1461  DKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              K SPR LDEIRV + KL+LD K+L+APRRHCCD+L S++DK +EIGIRECKE+EL+YMH
Sbjct  420   TKNSPRKLDEIRVFSHKLELDKKQLVAPRRHCCDILPSTSDKVMEIGIRECKEDELIYMH  479



>ref|XP_006447475.1| hypothetical protein CICLE_v10015096mg [Citrus clementina]
 ref|XP_006469727.1| PREDICTED: uncharacterized protein LOC102621833 [Citrus sinensis]
 gb|ESR60715.1| hypothetical protein CICLE_v10015096mg [Citrus clementina]
Length=476

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/477 (64%), Positives = 372/477 (78%), Gaps = 8/477 (2%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQD-VSSPTSL  404
             M   Q+  K +    F N++LI SS+C++YL+ +  L+ ++N  HV  S  D    PT+L
Sbjct  1     MKLLQSMYKTQSVSRFINLILISSSVCIIYLLVSVFLLGTSNPTHVFSSQHDGYIPPTTL  60

Query  405   EHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDR----DEVKHEDNGTDSLPPVCI  572
             EHIVFGIAS++ SW KRK++VKLWW+P  M+GCVFL+     D   + DN + SLPPVCI
Sbjct  61    EHIVFGIASNKNSWPKRKDYVKLWWKPQQMQGCVFLESLPTADAEANSDNSSSSLPPVCI  120

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             S DTS FRYT RGG  SAIR+AR V E V+LNHSDVRW+VFGDDDTVFFP+NLVKTLSKY
Sbjct  121   SEDTSRFRYTYRGGLRSAIRVARVVLETVALNHSDVRWYVFGDDDTVFFPENLVKTLSKY  180

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DHGLWYYIG++SE   QN +FSF MAFGGAGFAIS PLAK LAKVFDSC+ RYPHLYGSD
Sbjct  181   DHGLWYYIGSNSEIFEQNRYFSFGMAFGGAGFAISSPLAKVLAKVFDSCIERYPHLYGSD  240

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
             +RV++CL+ELGV LT EPGFHQ D+RG+VFGLL +HP  PLVS+HH++  DPIFPNMTT 
Sbjct  241   SRVYSCLAELGVGLTREPGFHQYDVRGNVFGLLTSHPTTPLVSIHHLDHMDPIFPNMTTI  300

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             KALE L++AA ID  R+LQQTVCYDRWFSWTISVSWGYAVQ++G H+ LPD L  QE++ 
Sbjct  301   KALERLFEAAKIDTGRLLQQTVCYDRWFSWTISVSWGYAVQVYGKHMHLPDILPVQETFK  360

Query  1293  PWRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKA  1469
              W+K K     Y F++R  HPDPC+R T+FY+D  SS  RDGI + Y+K + +NCT +  
Sbjct  361   QWKKGKVLAAAYNFNTRVIHPDPCQRPTIFYLDSASSG-RDGIRTHYKK-SYQNCTNNMG  418

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             SPR L+EIRV +QKLDL+ K+L+APRRHCCDVL SSA + +EI IRECK+EEL++MH
Sbjct  419   SPRKLEEIRVLSQKLDLNIKQLMAPRRHCCDVLPSSAGQVMEIAIRECKDEELIHMH  475



>ref|XP_002515719.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF46666.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=476

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/462 (64%), Positives = 365/462 (79%), Gaps = 4/462 (1%)
 Frame = +3

Query  261   PSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEE  440
             PS+    ++L  SS C++YL+ +  LV  + + HV  SL+D ++PT+L H+VFGIAS+++
Sbjct  16    PSRFITILILSSSSFCIIYLLISIFLVGISKVAHVGSSLEDFNAPTNLGHVVFGIASNQK  75

Query  441   SWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNP  620
             SW KRKE+VKLWW P  MRGCVFL+       ++ T SLPPVCIS DTS FRYT R G  
Sbjct  76    SWPKRKEYVKLWWNPQQMRGCVFLEDMPQDDANDTTSSLPPVCISEDTSRFRYTFRNGLR  135

Query  621   SAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVV  800
             SAIR+AR VSE V LNHSDVRW+VFGDDDTVFF +NLVKTLSKYDHGLWYYIG++SE++ 
Sbjct  136   SAIRVARVVSETVKLNHSDVRWYVFGDDDTVFFTENLVKTLSKYDHGLWYYIGSNSENLE  195

Query  801   QNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTH  980
             QN +FSFEMAFGGAGFAISYPLAK LAKVFDSC  RYPHLYGSD+R+ +CL+ELGV LT 
Sbjct  196   QNRYFSFEMAFGGAGFAISYPLAKVLAKVFDSCTERYPHLYGSDSRISSCLAELGVGLTR  255

Query  981   EPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHR  1160
             EPGFHQ+D+RG++FGLL +HPL PLVSLHH +  DPIFPNMTT  +LEHL+KA ++D  R
Sbjct  256   EPGFHQVDLRGNMFGLLTSHPLSPLVSLHHFDDLDPIFPNMTTINSLEHLFKAVTVDSQR  315

Query  1161  ILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDV--PYGFD  1334
             +LQ+TVCYDRWFSWTISV+WGYAV+I+G H+ LPD L  Q ++  W K    +   Y F+
Sbjct  316   VLQKTVCYDRWFSWTISVAWGYAVEIYGKHIFLPDTLPVQVTFQKWIKKGSLLAGAYTFN  375

Query  1335  SRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKL  1514
              +  HPDPC+R T+F++D VSSS RDGIT+ Y+K  T NC++DKASPR L+EI+V + KL
Sbjct  376   VKEPHPDPCQRPTIFFLDHVSSS-RDGITTHYKKSYT-NCSYDKASPRKLEEIKVFSHKL  433

Query  1515  DLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             DL  K+L +PRR CCDVL SS  K +EIGIRECKEEEL++MH
Sbjct  434   DLSDKQLWSPRRQCCDVLRSSGSKTMEIGIRECKEEELIHMH  475



>ref|XP_010313666.1| PREDICTED: uncharacterized protein LOC101245623 [Solanum lycopersicum]
Length=479

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/479 (63%), Positives = 375/479 (78%), Gaps = 9/479 (2%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQ--DVSSPTS  401
             M F Q   K       KN++LI    C +Y +  F+LVP++N L  S+  Q   +SSP +
Sbjct  1     MQFFQVNSKTSSCHGIKNLILISCFACTIYFLYPFILVPNSNFLDYSLHDQPFGLSSPIT  60

Query  402   LEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRD--EVKHEDNGTDSLPPVCIS  575
             L+++VFGIASS +SW KRKE+VKLWW+P+ MRGCVFL++D        NG+ SLPP+CIS
Sbjct  61    LQNVVFGIASSSKSWSKRKEYVKLWWKPNEMRGCVFLEKDLPNSTTTTNGSISLPPICIS  120

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSL--NHSD--VRWFVFGDDDTVFFPDNLVKTL  743
              D S F Y+ +GG+PSAIR+AR VSE V+L  NHSD  V+WFVFGDDDT+FF +NLVKTL
Sbjct  121   NDISRFPYSNKGGSPSAIRVARVVSETVALYLNHSDDDVKWFVFGDDDTIFFQENLVKTL  180

Query  744   SKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLY  923
             SKYD+GLWYYIG++SE  +QN FFSF+MAFGGAGFAISYPLAK LA+VFDSC+ RY HLY
Sbjct  181   SKYDNGLWYYIGSNSESFIQNKFFSFDMAFGGAGFAISYPLAKILARVFDSCIERYAHLY  240

Query  924   GSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNM  1103
             GSD R+HACL+ELGV+LTHEPGFHQMD  G+ FGLLAAHP+RPLVSLHHME  DPIFPNM
Sbjct  241   GSDGRIHACLTELGVTLTHEPGFHQMDFLGNAFGLLAAHPIRPLVSLHHMEKIDPIFPNM  300

Query  1104  TTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQE  1283
             T  K+LEHLY AA+ DP RILQQTVCYDR FSWT+SVSWGY VQ+  +++ LPDALR QE
Sbjct  301   TRMKSLEHLYHAANFDPQRILQQTVCYDRRFSWTVSVSWGYVVQVFENNVQLPDALRVQE  360

Query  1284  SYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFD  1463
             SY PW+KN     Y F++R +  D C+RQ V+++D VS    DGI ++Y+K   +NCTF 
Sbjct  361   SYLPWKKNAYSTLYEFNTRKFEVDICKRQLVYFLDEVSLG-VDGIKTIYKKRAYDNCTFT  419

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             K SPR LDEIRV + KL+LD K+L+APRRHCCD+L+S++D+ +EIGIRECKE+EL+YMH
Sbjct  420   KNSPRKLDEIRVFSHKLELDKKKLVAPRRHCCDILTSTSDQVMEIGIRECKEDELIYMH  478



>ref|XP_010323808.1| PREDICTED: uncharacterized protein LOC101246943, partial [Solanum 
lycopersicum]
Length=439

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/440 (66%), Positives = 354/440 (80%), Gaps = 7/440 (2%)
 Frame = +3

Query  336   LVPSTNLLHVSVSLQD--VSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVF  509
             L P+ N  H S+SLQ+   SS T+L+H+VFGIAS+E SW KRKE+VKLWW+P  MRGCVF
Sbjct  1     LAPN-NHFHTSISLQNNLSSSQTNLDHVVFGIASNELSWSKRKEYVKLWWKPKRMRGCVF  59

Query  510   LDR--DEVKHEDNGTD-SLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDV  680
             L++      ++ NG + SLP +CIS +TS+FRYT +GG PSAIR+AR V E V LN+++V
Sbjct  60    LEKMIHFSSNDTNGDEYSLPQICISENTSNFRYTHKGGTPSAIRVARVVLETVRLNYTNV  119

Query  681   RWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISY  860
             RWFVFGDDDT+FF +NLVKTLSKYDH  WYYIGT+SE  +QN FFS+EMAFGGAGFAISY
Sbjct  120   RWFVFGDDDTIFFQENLVKTLSKYDHRFWYYIGTNSESFMQNKFFSYEMAFGGAGFAISY  179

Query  861   PLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAH  1040
             PLAK LAKVFDSC+ RYPHLYGSD R+HACLSELGV LT EPGFHQMD   +VFG+LAAH
Sbjct  180   PLAKVLAKVFDSCIERYPHLYGSDGRIHACLSELGVGLTREPGFHQMDFHKNVFGMLAAH  239

Query  1041  PLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSW  1220
             P+RPLVS+HH+E  DPIFPNMTT KALEHLY AAS DPHRILQQTVCYD WFSWT+S+SW
Sbjct  240   PIRPLVSMHHIEEIDPIFPNMTTVKALEHLYNAASFDPHRILQQTVCYDTWFSWTVSLSW  299

Query  1221  GYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSS  1400
             GYAVQ+   H+LLP+  R QESY+PW+ +     Y FD+R Y PDPC+RQ V+++D+VSS
Sbjct  300   GYAVQVFDKHVLLPNVQRVQESYAPWKSSHLGGLYDFDTRKYEPDPCQRQPVYFLDKVSS  359

Query  1401  SHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSA  1580
             S  +G  S+Y+K T E C FD +SPR L++IRV + KL LD ++LLAPRRHCCDVL S++
Sbjct  360   S-INGTESIYKKKTFEKCKFDMSSPRRLEKIRVLSNKLVLDKQQLLAPRRHCCDVLPSTS  418

Query  1581  DKALEIGIRECKEEELVYMH  1640
                +EI IRECKE+EL++M 
Sbjct  419   SNVMEIAIRECKEDELIHMQ  438



>ref|XP_009353239.1| PREDICTED: uncharacterized protein LOC103944504 [Pyrus x bretschneideri]
Length=477

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/477 (63%), Positives = 370/477 (78%), Gaps = 8/477 (2%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLV-PSTNLLHVSVSLQDVSSP--T  398
             ++F Q+P K +      N+ +I SS+C ++L+ +F LV  S+ L H+S   QD  SP  T
Sbjct  2     LLFPQSPSKTQNPSRLINLFIISSSVCTLFLLVSFFLVFTSSKLAHISSLSQDAYSPPST  61

Query  399   SLEHIVFGIASSEESWR-KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD-SLPPVCI  572
             SLEHIVFGIAS+++SW  KRKE+V+LWW+   MRGCVFLD     H  +  D SLPPVCI
Sbjct  62    SLEHIVFGIASNQKSWSAKRKEYVRLWWKNQSMRGCVFLDSLPSDHHRHANDTSLPPVCI  121

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDT+ FRYT RGG  SAIR+AR VSE V+LNH++VRW+VFGDDDTVFFP+NLVKTLSKY
Sbjct  122   SGDTARFRYTYRGGLKSAIRVARVVSEIVALNHTNVRWYVFGDDDTVFFPENLVKTLSKY  181

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DHGLWYYIGTSSE   QN  F F MA+GGAGFAIS PLAK LAKVFDSCL RYPH+YGSD
Sbjct  182   DHGLWYYIGTSSEVYEQNRVFGFGMAYGGAGFAISAPLAKVLAKVFDSCLERYPHIYGSD  241

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
             +R+ +CL+ELGV LT EPGFHQ DI GD+FGLLA+HP+ PLVSLHH++  +PIFPNMTT 
Sbjct  242   SRIFSCLAELGVGLTREPGFHQNDIHGDMFGLLASHPVTPLVSLHHIDHVNPIFPNMTTL  301

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
              AL+HL+KAA++D  R+LQ+TVCYDRWFSWTI VSWGYAVQ++G+H+LLPDAL  QE++S
Sbjct  302   NALQHLFKAANVDSQRMLQKTVCYDRWFSWTIMVSWGYAVQVYGNHILLPDALPVQETFS  361

Query  1293  PWRKNKKDV-PYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKA  1469
              W+K       Y F++R +H DPCRR  VF++D V S     I S Y+K + ENCT+D A
Sbjct  362   RWKKGSVLTGAYLFNTREHHKDPCRRPVVFFLDNVPSG-AGRIKSTYKK-SYENCTYDIA  419

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             SPR L+E++V + KLD D K+L APRR CCDVL SS +K +EI IRECKEEEL++MH
Sbjct  420   SPRRLEEVKVYSHKLDFDMKQLQAPRRQCCDVLPSSGNKVMEIEIRECKEEELIHMH  476



>ref|XP_010321546.1| PREDICTED: uncharacterized protein LOC101254696 isoform X1 [Solanum 
lycopersicum]
Length=482

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/472 (62%), Positives = 367/472 (78%), Gaps = 9/472 (2%)
 Frame = +3

Query  252   KVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQD-------VSSPTSLEH  410
             K + S   KNI++I S + ++YL+C    +P+T  LH SV+LQ+       +SS T LEH
Sbjct  10    KNQCSNGVKNIIMIISFILIIYLMCFNFSIPNTKSLHTSVTLQNDSSLSLSLSSDTGLEH  69

Query  411   IVFGIASSEESWRKRKEFVKLWWRPS-GMRGCVFLDRDEVKHEDNGTDS-LPPVCISGDT  584
             IVFGIAS+E +W  RKE VK+WW+P   MRGCVFL++    +  N  DS LPP+CISGDT
Sbjct  70    IVFGIASNENAWSARKELVKMWWKPGRNMRGCVFLEKMPPNYTKNANDSSLPPICISGDT  129

Query  585   SSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGL  764
             S F+YT RGG PSAIR+AR V+E V+LNHS+VRW+VFGDDDTVFF +NL+KTLSKYDHGL
Sbjct  130   SRFKYTFRGGTPSAIRVARVVTETVALNHSNVRWYVFGDDDTVFFTENLLKTLSKYDHGL  189

Query  765   WYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVH  944
             WYYIG++SE  + N  FS+EMAFGGAG AIS PLAK L KVFD+C+ RYPHL+GSDAR++
Sbjct  190   WYYIGSNSEHFLMNKAFSYEMAFGGAGIAISSPLAKVLGKVFDACIERYPHLFGSDARIY  249

Query  945   ACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALE  1124
             +CL+ELGV LTHEPGFHQ+D+RG++FG+LAAH LRPLVSLHH+E+ DPIFPNMT  K+LE
Sbjct  250   SCLAELGVGLTHEPGFHQLDVRGNMFGVLAAHTLRPLVSLHHLEMNDPIFPNMTKMKSLE  309

Query  1125  HLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK  1304
             HLY AA  DPHRILQQTVCYDRWF+WT+SVSWGYAVQ+   ++ LPDALR QESY PW+ 
Sbjct  310   HLYNAAKYDPHRILQQTVCYDRWFTWTVSVSWGYAVQVFSYNIFLPDALRIQESYFPWQT  369

Query  1305  NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNL  1484
             +     Y FD+R Y PDPC+RQ V+++  VS+     I ++YRK T ENCT    SPR L
Sbjct  370   SDLARHYDFDTRPYEPDPCKRQLVYFLHNVSTGINGQIKTIYRKKTPENCTITMVSPRRL  429

Query  1485  DEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             +EIRV +QKL++D   LL+PRR CCDVL S++   +++ IRECKE+EL+++H
Sbjct  430   EEIRVVSQKLEIDRNRLLSPRRQCCDVLPSTSRNVMDVAIRECKEDELIFIH  481



>ref|XP_006360582.1| PREDICTED: uncharacterized protein LOC102585670, partial [Solanum 
tuberosum]
Length=445

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/446 (65%), Positives = 350/446 (78%), Gaps = 10/446 (2%)
 Frame = +3

Query  327   TFVLVPSTNLLHVSVSLQD----VSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRP-SG  491
             +  L P+ +  H S+SLQ+    +SS T+L+H+VFGIAS+E SW KRKE+VKLWW+P   
Sbjct  1     SIFLAPNKHF-HTSISLQNDENNLSSQTNLDHVVFGIASNELSWAKRKEYVKLWWKPKQK  59

Query  492   MRGCVFLDR-DEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVS  662
             MRGCVFL++       D   D   LP +CIS DTS+FRYT +GG  SAIR+AR V E V 
Sbjct  60    MRGCVFLEKIPHFSSNDTNDDESFLPQICISEDTSNFRYTHKGGTSSAIRVARVVLETVR  119

Query  663   LNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGA  842
             LN+++VRWFVFGDDDT+FFP+NLV TLSKYDHG WYYIGT+SE  +QN FFS+EMAFGGA
Sbjct  120   LNYTNVRWFVFGDDDTIFFPENLVMTLSKYDHGFWYYIGTNSESFMQNKFFSYEMAFGGA  179

Query  843   GFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVF  1022
             GFAISYPLAK LAKVFDSC+ RYPHLYGSD R+HACLSELGV LT EPGFHQMD   +VF
Sbjct  180   GFAISYPLAKVLAKVFDSCIERYPHLYGSDGRIHACLSELGVGLTREPGFHQMDFHKNVF  239

Query  1023  GLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSW  1202
             G+LAAHP+RPLVS+HHME  DPIFPNMTT KALEHLY AAS DPHRILQQTVCYD WFSW
Sbjct  240   GMLAAHPIRPLVSMHHMEEIDPIFPNMTTVKALEHLYNAASFDPHRILQQTVCYDSWFSW  299

Query  1203  TISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFY  1382
             T+SVSWGYAVQ+   H+LLP+  R QESY+PW+ +     Y FD++ Y PDPCRRQ VF+
Sbjct  300   TVSVSWGYAVQVFDKHVLLPNVQRVQESYAPWKSSHLGGLYDFDTKKYEPDPCRRQLVFF  359

Query  1383  MDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCD  1562
             +D+VSS   +G  ++Y+K T E C FD++SPR L +IRV + KL L+ ++LL PRRHCCD
Sbjct  360   LDKVSSG-INGTETIYKKKTFEKCKFDRSSPRRLKKIRVLSNKLVLNKQQLLTPRRHCCD  418

Query  1563  VLSSSADKALEIGIRECKEEELVYMH  1640
             VL S++   +EI IRECKE+EL++M 
Sbjct  419   VLPSTSSNVMEIAIRECKEDELIHMQ  444



>ref|XP_009341434.1| PREDICTED: uncharacterized protein LOC103933463 [Pyrus x bretschneideri]
Length=477

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/477 (63%), Positives = 371/477 (78%), Gaps = 8/477 (2%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSL-QDVSSP--T  398
             ++F Q+P K +      N+ +I SS+C ++L+ +F LV +++ L +  SL QD  SP  T
Sbjct  2     LLFPQSPSKTQNPSRLINLFIISSSVCTLFLLVSFFLVFTSSKLALISSLSQDAYSPPST  61

Query  399   SLEHIVFGIASSEESWR-KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD-SLPPVCI  572
             SLEHIVFGIAS+++SW  KRKE+V+LWW+   MRGCVFLD     H  +  D SLPPVCI
Sbjct  62    SLEHIVFGIASNQKSWSAKRKEYVRLWWKNQSMRGCVFLDSLLPDHHRHANDTSLPPVCI  121

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDT+ FRYT RGG  SAIR+AR VSE V+LNH++VRW+VFGDDDTVFFP+NLVKTLSKY
Sbjct  122   SGDTARFRYTYRGGLKSAIRVARVVSEIVALNHANVRWYVFGDDDTVFFPENLVKTLSKY  181

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DHGLWYYIGTSSE   QN  F F MA+GGAGFAIS PLAK LAKVFDSCL RYPH+YGSD
Sbjct  182   DHGLWYYIGTSSEVYEQNRVFGFGMAYGGAGFAISAPLAKVLAKVFDSCLERYPHIYGSD  241

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
             +R+ +CL+ELGV LT EPGFHQ DI GD+FGLLA+HP+ PLVSLHH++  +PIFPNMTT 
Sbjct  242   SRIFSCLAELGVGLTREPGFHQNDIHGDMFGLLASHPVTPLVSLHHIDHVNPIFPNMTTL  301

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
              AL+HL+KAA++D  R+LQ+TVCYDRWFSWTI VSWGYAVQ++G+H+LLPDAL  QE++S
Sbjct  302   NALQHLFKAANVDSQRMLQKTVCYDRWFSWTIMVSWGYAVQVYGNHILLPDALPVQETFS  361

Query  1293  PWRKNKKDV-PYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKA  1469
              W+K       Y F++R +H DPCRR  VF++D V S     I S Y+K + ENCT+D A
Sbjct  362   QWKKGSVLTGAYLFNTREHHKDPCRRPVVFFLDNVPSG-AGRIKSTYKK-SYENCTYDIA  419

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             SPR L+E++V + KLD D K+L APRR CCDVL SS +K +EI IRECKEEEL++MH
Sbjct  420   SPRRLEEVKVYSHKLDFDMKQLQAPRRQCCDVLPSSGNKVMEIEIRECKEEELIHMH  476



>ref|XP_006360683.1| PREDICTED: uncharacterized protein LOC102597363 [Solanum tuberosum]
Length=451

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/450 (63%), Positives = 355/450 (79%), Gaps = 10/450 (2%)
 Frame = +3

Query  321   VCTFVLVPSTNLLHVSVSLQD--------VSSPTSLEHIVFGIASSEESWRKRKEFVKLW  476
             +C    +P+T  LH SV+LQ+        +SS T+LEHIVFGIAS+E +W  RKE VK+W
Sbjct  1     MCFNFSIPNTKSLHTSVTLQNDSSSSSLSLSSDTNLEHIVFGIASNENAWSARKELVKMW  60

Query  477   WRPS-GMRGCVFLDRDEVKHEDNGTDS-LPPVCISGDTSSFRYTCRGGNPSAIRLARAVS  650
             W+P   MRGCVFL++    + +N  DS LPP+CISGDTS F+YT RGG PSAIR+AR V+
Sbjct  61    WKPGRNMRGCVFLEKMPPNYTNNANDSSLPPICISGDTSRFKYTFRGGTPSAIRVARVVT  120

Query  651   EAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMA  830
             E V+LNHS+VRW+VFGDDDTVFF +NL+KTLSKYDHGLWYYIG++SE  + N  FS+EMA
Sbjct  121   ETVALNHSNVRWYVFGDDDTVFFTENLLKTLSKYDHGLWYYIGSNSEHFLMNKAFSYEMA  180

Query  831   FGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIR  1010
             FGGAG AIS PLAK L KVFD+C+ RYPHL+GSDAR+++CL+ELGV LTHEPGFHQ+D+R
Sbjct  181   FGGAGIAISSPLAKVLGKVFDTCIERYPHLFGSDARIYSCLAELGVGLTHEPGFHQLDVR  240

Query  1011  GDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDR  1190
             G++FG+LAAH LRPLVSLHH+E+ DPIFPNMT  K+LEHLY AA  DPHRILQQTVCYDR
Sbjct  241   GNMFGVLAAHTLRPLVSLHHLEMNDPIFPNMTKMKSLEHLYDAAKYDPHRILQQTVCYDR  300

Query  1191  WFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQ  1370
             WF+WT+SVSWGYAVQ+   ++ LPDALR QESY PW+ +     Y FD+R Y PDPC+RQ
Sbjct  301   WFTWTVSVSWGYAVQVFSYNIFLPDALRIQESYIPWQTSDLARHYDFDTRPYEPDPCKRQ  360

Query  1371  TVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRR  1550
              V+++  VS+     I ++YRK T ENCT    SPR L+EIRV +QKL++D K LL+PRR
Sbjct  361   LVYFLHNVSTGINGQIKTIYRKKTPENCTITMVSPRRLEEIRVVSQKLEIDRKRLLSPRR  420

Query  1551  HCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              CCDVL S++   +++ IRECKE+EL+++H
Sbjct  421   QCCDVLPSTSRNVMDVAIRECKEDELIFIH  450



>ref|XP_008230135.1| PREDICTED: uncharacterized protein LOC103329438 [Prunus mume]
Length=475

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/460 (65%), Positives = 365/460 (79%), Gaps = 9/460 (2%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFVLV-PSTNLLHVSVSLQDV--SSPTSLEHIVFGIASSEESWR  449
             N+V+I SS+  ++L+ +F LV  S+ L H+S   QDV  S PTSLEHIVFGIAS+++SW 
Sbjct  18    NLVIISSSVFTLFLLVSFFLVFTSSKLAHISYLSQDVYSSPPTSLEHIVFGIASNQKSWS  77

Query  450   -KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD-SLPPVCISGDTSSFRYTCRGGNPS  623
              KRKE+V+LWW+ + MRGCVFL+     HE +  D SLPPVCIS DTS FRYT +GG  S
Sbjct  78    AKRKEYVRLWWK-NPMRGCVFLESLPPGHEHHANDTSLPPVCISEDTSRFRYTYKGGLKS  136

Query  624   AIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQ  803
             AIR+AR VSE V+LNHS+VRW+VFGDDDTVFFP+NLVKTLSKYDH LWYYIGT+SE   Q
Sbjct  137   AIRVARVVSETVALNHSNVRWYVFGDDDTVFFPENLVKTLSKYDHRLWYYIGTNSEIYEQ  196

Query  804   NSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHE  983
             N  F F MA+GGAGFAIS PLAKALAKVFDSC+ RYPHLYGSD+R+ +CL+ELG+ LT E
Sbjct  197   NRIFGFGMAYGGAGFAISSPLAKALAKVFDSCIERYPHLYGSDSRISSCLAELGIGLTQE  256

Query  984   PGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRI  1163
             PGFHQ DI GD FGLLAAHPL PLVSLHH++  +P+FPNMTT KAL+HL+KA   D  R+
Sbjct  257   PGFHQNDIHGDTFGLLAAHPLTPLVSLHHLDHINPVFPNMTTIKALQHLFKAVRADSQRV  316

Query  1164  LQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK-DVPYGFDSR  1340
             LQ+TVCYDRWFSWTI VSWGYAVQIHG+H+LLPD L  QE++S W+K       Y F++R
Sbjct  317   LQKTVCYDRWFSWTIVVSWGYAVQIHGNHILLPDVLPVQETFSQWKKGSVLSGTYTFNTR  376

Query  1341  GYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDL  1520
              +H DPCRR  VF++D VSS+  DGI S+Y+K + ENCT D  SPR L+E+RV + KLDL
Sbjct  377   EHHKDPCRRPVVFFLDNVSSA-GDGIKSIYKK-SYENCTSDTGSPRKLEEVRVYSHKLDL  434

Query  1521  DSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             D K+L APRRHCCD+L S+  + ++IGIRECK+EEL+YMH
Sbjct  435   DIKQLQAPRRHCCDILPSTGGQVMDIGIRECKDEELIYMH  474



>ref|XP_008365447.1| PREDICTED: uncharacterized protein LOC103429078 [Malus domestica]
Length=477

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/477 (63%), Positives = 370/477 (78%), Gaps = 8/477 (2%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLV-PSTNLLHVSVSLQDVSSP--T  398
             ++F Q+P K +      N+ +I SS+  ++L+ +F LV  S+ L ++S   QD  SP  T
Sbjct  2     LLFPQSPSKTQNPSRLINLFIISSSVFTLFLLVSFFLVFTSSKLAYISSLSQDAYSPPST  61

Query  399   SLEHIVFGIASSEESWR-KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD-SLPPVCI  572
             SLEHIVFGIAS+++SW  KRKE+V+LWW+   MRGCVFLD     H  +  D SLPPVCI
Sbjct  62    SLEHIVFGIASNQKSWSAKRKEYVRLWWKNQSMRGCVFLDSLPPDHHHHANDTSLPPVCI  121

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDT+ FRYT RGG  SAIR+AR VSE V+LNH++VRW+VFGDDDT+FFP+NLVKTLSKY
Sbjct  122   SGDTARFRYTYRGGLRSAIRVARVVSEIVALNHTNVRWYVFGDDDTIFFPENLVKTLSKY  181

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DHGLWYYIGTSSE   QN  F F MA+GGAGFAIS PLAK LAKVFDSCL RYPHLYGSD
Sbjct  182   DHGLWYYIGTSSEVYEQNRVFGFGMAYGGAGFAISAPLAKVLAKVFDSCLERYPHLYGSD  241

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
             +R+ +CL+ELGV LT EPGFHQ DI GD+FGLLA+HP+ PLVSLHH++  +PIFPNMTT 
Sbjct  242   SRISSCLAELGVGLTREPGFHQNDIHGDMFGLLASHPVTPLVSLHHIDHVNPIFPNMTTL  301

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
              AL+HL+KAA++D  R+LQ+TVCYDRWFSWTI VSWGYAVQ++G+H+LLPDAL  QE++S
Sbjct  302   NALQHLFKAANVDSQRMLQKTVCYDRWFSWTIMVSWGYAVQVYGNHILLPDALXVQETFS  361

Query  1293  PWRKNKKDV-PYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKA  1469
              W+K       Y F++R +H DPCRR  VF++D VSS     I S Y+K + ENC++D A
Sbjct  362   QWKKGSVLTGAYLFNTREHHKDPCRRPVVFFLDDVSSG-AGRIKSTYKK-SYENCSYDMA  419

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             SPR L+E++V + KLD D K+L APRR CCDVL SS +K +EI IRECKEEEL++MH
Sbjct  420   SPRRLEEVKVYSHKLDFDMKQLQAPRRQCCDVLPSSGNKVMEIEIRECKEEELIHMH  476



>ref|XP_008379601.1| PREDICTED: uncharacterized protein LOC103442579 [Malus domestica]
Length=477

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/477 (63%), Positives = 370/477 (78%), Gaps = 8/477 (2%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLV-PSTNLLHVSVSLQDVSSP--T  398
             ++F Q+P K +      N+ +I SS+  ++L+ +F LV  S+ L ++S   QD  SP  T
Sbjct  2     LLFPQSPSKTQNPSRLINLFIISSSVFTLFLLVSFFLVFTSSKLAYISSLSQDAYSPPST  61

Query  399   SLEHIVFGIASSEESWR-KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD-SLPPVCI  572
             SLEHIVFGIAS+++SW  KRKE+V+LWW+   MRGCVFLD     H  +  D SLPPVCI
Sbjct  62    SLEHIVFGIASNQKSWSAKRKEYVRLWWKNQSMRGCVFLDSLPPDHHHHANDTSLPPVCI  121

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDT+ FRYT RGG  SAIR+AR VSE V+LNH++VRW+VFGDDDT+FFP+NLVKTLSKY
Sbjct  122   SGDTARFRYTYRGGLRSAIRVARVVSEIVALNHTNVRWYVFGDDDTIFFPENLVKTLSKY  181

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DHGLWYYIGTSSE   QN  F F MA+GGAGFAIS PLAK LAKVFDSCL RYPHLYGSD
Sbjct  182   DHGLWYYIGTSSEVYEQNRVFGFGMAYGGAGFAISAPLAKVLAKVFDSCLERYPHLYGSD  241

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
             +R+ +CL+ELGV LT EPGFHQ DI GD+FGLLA+HP+ PLVSLHH++  +PIFPNMTT 
Sbjct  242   SRISSCLAELGVGLTREPGFHQNDIHGDMFGLLASHPVTPLVSLHHIDHVNPIFPNMTTL  301

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
              AL+HL+KAA++D  R+LQ+TVCYDRWFSWTI VSWGYAVQ++G+H+LLPDAL  QE++S
Sbjct  302   NALQHLFKAANVDSQRMLQKTVCYDRWFSWTIMVSWGYAVQVYGNHILLPDALPVQETFS  361

Query  1293  PWRKNKKDV-PYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKA  1469
              W+K       Y F++R +H DPCRR  VF++D VSS     I S Y+K + ENC++D A
Sbjct  362   QWKKGSVLTGAYLFNTREHHKDPCRRPVVFFLDDVSSG-AGRIKSTYKK-SYENCSYDMA  419

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             SPR L+E++V + KLD D K+L APRR CCDVL SS +K +EI IRECKEEEL++MH
Sbjct  420   SPRRLEEVKVYSHKLDFDMKQLQAPRRQCCDVLPSSGNKVMEIEIRECKEEELIHMH  476



>ref|XP_010267798.1| PREDICTED: uncharacterized protein LOC104604918 [Nelumbo nucifera]
Length=475

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/475 (63%), Positives = 356/475 (75%), Gaps = 5/475 (1%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLE  407
             M F Q P K   S    N++LI S LC++YL  +  LV  + L HV V    VS PT+L+
Sbjct  1     MSFFQLPSKSPTSYRLINLLLISSCLCIIYLFVSISLVRPSTLSHVWVPSLYVSPPTTLD  60

Query  408   HIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGD  581
             H+VFGIAS+ +SW  RKE+V+LWW+P  MRGCVF+D       D   DS  LPP+CIS D
Sbjct  61    HLVFGIASTAQSWPNRKEYVRLWWKPQSMRGCVFVDSMPPTTVDKHNDSSTLPPICISED  120

Query  582   TSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHG  761
             TS FRYT RGG  SAIR+ARAVSE VSLNH+ VRWFVFGDDDTVFFP+NLVKTLSKYDH 
Sbjct  121   TSHFRYTYRGGLRSAIRVARAVSETVSLNHTGVRWFVFGDDDTVFFPENLVKTLSKYDHN  180

Query  762   LWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARV  941
             LWYYIGT+SE   QNS FSFEMAFGG GFAISYPLA+ LAKVFDSCL RYPHLYGSDAR+
Sbjct  181   LWYYIGTNSESSKQNSLFSFEMAFGGGGFAISYPLARVLAKVFDSCLVRYPHLYGSDARI  240

Query  942   HACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKAL  1121
              +CL+ELGV LTHEPGFHQ+D RGD FGLLAAHPLRPLVSLHH+   DPIFPNM + +AL
Sbjct  241   FSCLAELGVGLTHEPGFHQVDFRGDAFGLLAAHPLRPLVSLHHLNYIDPIFPNMNSKQAL  300

Query  1122  EHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWR  1301
             EHL +A   DP RILQQTVCYDRWFSWTISVSWGYAVQ+    +LLPD L  Q +++ W 
Sbjct  301   EHLLEAVKFDPARILQQTVCYDRWFSWTISVSWGYAVQLFERDILLPDVLPVQHTFTVWN  360

Query  1302  KNKKDV--PYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASP  1475
             K +     PY FD+R    DPCRR T+F+++ +SS+ +  I S YR+  ++ C   K + 
Sbjct  361   KRETITPSPYMFDTRELPEDPCRRPTLFFLESLSSNGQ-VIRSNYRRSISDKCLESKGAS  419

Query  1476  RNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             + L++IRV ++KL LD ++L APRRHCCD+L SS  + LEIGIREC EEE+++MH
Sbjct  420   KKLEKIRVFSKKLKLDIRQLQAPRRHCCDILPSSVGEVLEIGIRECGEEEMIFMH  474



>ref|XP_007217531.1| hypothetical protein PRUPE_ppa023439mg [Prunus persica]
 gb|EMJ18730.1| hypothetical protein PRUPE_ppa023439mg [Prunus persica]
Length=475

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/460 (64%), Positives = 363/460 (79%), Gaps = 9/460 (2%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFVLV-PSTNLLHVSVSLQDV--SSPTSLEHIVFGIASSEESWR  449
             N+V+I SS+  ++L+ +F LV  S+ L H+S   QDV  S PTSLEH+VFGIAS+++SW 
Sbjct  18    NLVIISSSVFTLFLLVSFFLVFTSSKLAHISYLSQDVYSSPPTSLEHVVFGIASNQQSWS  77

Query  450   -KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD-SLPPVCISGDTSSFRYTCRGGNPS  623
              KRKE+V+LWW  + MRGCVFL+     HE +  D SLPPVCIS DT+ FRYT +GG  S
Sbjct  78    AKRKEYVRLWWT-NPMRGCVFLESLPPGHEHHANDTSLPPVCISEDTTRFRYTYKGGMRS  136

Query  624   AIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQ  803
             AIR+AR VSE V+LNHS+VRW+VFGDDDTVFFP+NLVKTLSKYDHGLWYYIGT+SE   Q
Sbjct  137   AIRVARVVSETVALNHSNVRWYVFGDDDTVFFPENLVKTLSKYDHGLWYYIGTNSEIYEQ  196

Query  804   NSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHE  983
             N  F F MA+GGAGFAIS PLAK LAKVFDSC+ RYPHLYGSD+R+ +CL+ELG+ LT E
Sbjct  197   NRIFGFRMAYGGAGFAISSPLAKVLAKVFDSCIERYPHLYGSDSRISSCLAELGIGLTQE  256

Query  984   PGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRI  1163
             PGFHQ DI GD FGLLAAHPL PLVSLHH++  +P+FPNMTT KAL+HL+KA + D  R+
Sbjct  257   PGFHQNDIHGDTFGLLAAHPLTPLVSLHHLDHINPVFPNMTTIKALQHLFKAVNADSQRV  316

Query  1164  LQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK-DVPYGFDSR  1340
             LQ+TVCYDRWFSWTI VSWGYAVQIHG+H+ LPD L  QE++S W+K       Y F++R
Sbjct  317   LQKTVCYDRWFSWTIVVSWGYAVQIHGNHIFLPDVLPVQETFSQWKKGSVLSGTYTFNTR  376

Query  1341  GYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDL  1520
              +  DPCRR  VF++D VSS+  DGI S+Y+K + ENCT D  SPR L+E+RV + KLDL
Sbjct  377   EHPKDPCRRPVVFFLDNVSSA-GDGIKSIYKK-SYENCTSDMGSPRKLEEVRVYSHKLDL  434

Query  1521  DSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             D K+L APRRHCCD+L S+  + ++IGIRECK+EEL+YMH
Sbjct  435   DIKQLQAPRRHCCDILPSTGGQVMDIGIRECKDEELIYMH  474



>ref|XP_009342273.1| PREDICTED: uncharacterized protein LOC103934264 [Pyrus x bretschneideri]
Length=469

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/468 (63%), Positives = 367/468 (78%), Gaps = 9/468 (2%)
 Frame = +3

Query  255   VKPSQNFKNIVLICSSLCVVYLVCTFVLV-PSTNLLHVSVSLQDVSSP--TSLEHIVFGI  425
             ++PS+   N+ ++ SS+C ++L+ +  LV  S+ L  +S   QD  SP  TSLEHIVFGI
Sbjct  4     LRPSR-LINLFIVSSSVCTLFLLGSLFLVFTSSKLGRISSLSQDAYSPPSTSLEHIVFGI  62

Query  426   ASSEESWR-KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD-SLPPVCISGDTSSFRY  599
             AS++++W  KRKE+V+LWWR   MRGCVFLD     H+ +  D SLPPVCISGDT+ FRY
Sbjct  63    ASNQKAWSAKRKEYVRLWWRNQSMRGCVFLDSLPPDHQRHVNDTSLPPVCISGDTARFRY  122

Query  600   TCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIG  779
             T RGG  SAIR+AR VSE V+LNH++VRW+VFGDDDTVFFP+NLVKTLSKYDHGLWYYIG
Sbjct  123   TYRGGLKSAIRVARVVSETVALNHTNVRWYVFGDDDTVFFPENLVKTLSKYDHGLWYYIG  182

Query  780   TSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSE  959
             T+SE   QN  F F MA+GGAGFAIS PLAK LAKVFDSC+ RYPHLYGSD+R+ +CL+E
Sbjct  183   TNSEVYEQNRVFGFGMAYGGAGFAISAPLAKVLAKVFDSCIERYPHLYGSDSRISSCLAE  242

Query  960   LGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKA  1139
             LGV LT E GFHQ DI GD+FGLLA+HP+ PLVSLHH +  +P+FPNMTT  AL+HL+KA
Sbjct  243   LGVGLTSEAGFHQNDIHGDMFGLLASHPVTPLVSLHHFDHANPVFPNMTTINALKHLFKA  302

Query  1140  ASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK-D  1316
             A++D  R+LQ+TVCYDRWFSWTI+VSWGYAVQ++G+H+LLPD L  Q+++S W+K     
Sbjct  303   ANVDSQRMLQKTVCYDRWFSWTITVSWGYAVQVYGNHILLPDVLPVQQTFSQWKKGSVLS  362

Query  1317  VPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIR  1496
               Y F++R +H DPCRR  VF++D VSS   DGI S+Y+K + ENC++D ASPR L+E+R
Sbjct  363   GVYTFNTREHHKDPCRRPVVFFLDNVSSG-ADGIKSIYKK-SYENCSYDMASPRKLEEVR  420

Query  1497  VSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             V + KLDLD K+LLAPRR CCDVL S   K +EI IRECKEEEL+ MH
Sbjct  421   VYSHKLDLDIKQLLAPRRQCCDVLPSKGSKLMEIEIRECKEEELIRMH  468



>ref|XP_002274436.1| PREDICTED: uncharacterized protein LOC100241450 [Vitis vinifera]
 ref|XP_010657328.1| PREDICTED: uncharacterized protein LOC100241450 [Vitis vinifera]
Length=468

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/461 (63%), Positives = 354/461 (77%), Gaps = 3/461 (1%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEES  443
             S  F NI LI SS C +YL+    L+ ++ + ++  S Q VS+PTSLEH+VFGIAS+++S
Sbjct  9     SSCFINIFLISSSFCTIYLLVLLYLIHASEVANIPDSSQGVSAPTSLEHLVFGIASNQDS  68

Query  444   WRKRKEFVKLWWRPSGMRGCVFLDRDEVKHED-NGTDSLPPVCISGDTSSFRYTCRGGNP  620
             W ++K +VK WW+P  MRGCVF+D         N + SLPPVCIS DTS FRYT R G P
Sbjct  69    WLEKKNYVKHWWKPQQMRGCVFVDSMPGNESSYNDSSSLPPVCISEDTSQFRYTYRHGLP  128

Query  621   SAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVV  800
             SAIR+AR V E V+LNHS VRWFVFGDDDT+FFP+NLVKTLSKYDH LWYYIGT+SE   
Sbjct  129   SAIRVARVVPETVALNHSGVRWFVFGDDDTIFFPENLVKTLSKYDHELWYYIGTNSEIYE  188

Query  801   QNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTH  980
             QN  FSF+MAFGGAGFAISYPLAK LAKVFDSCL RYPHLYGSD+RV+ CL+ELGV LT 
Sbjct  189   QNRLFSFDMAFGGAGFAISYPLAKVLAKVFDSCLERYPHLYGSDSRVYTCLAELGVGLTR  248

Query  981   EPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHR  1160
             EPGFHQ+D+RG+ FGLLAAHPL PLVS HH++  DPIFPNMT  +A+EHL++A  +D  R
Sbjct  249   EPGFHQVDVRGETFGLLAAHPLAPLVSFHHLDHVDPIFPNMTANQAIEHLFEAVKVDSER  308

Query  1161  ILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK-DVPYGFDS  1337
             +LQQTVCYDRWFSWTISVSWGYAVQ+  +H  LPD LRA++++  W+K       Y F++
Sbjct  309   VLQQTVCYDRWFSWTISVSWGYAVQVFENHQFLPDVLRARKTFRQWKKGSVLSESYTFNT  368

Query  1338  RGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLD  1517
             R  H DPCRR T+F+MD VSS  RDGI S YR+  ++ CT   ASP+ L+EI+V + KLD
Sbjct  369   RELHIDPCRRPTIFFMDSVSSG-RDGIESSYRRDASDGCTLHMASPKRLEEIKVFSHKLD  427

Query  1518  LDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             L  K+L APRRHCCDVL SS    LE+ IRECKEEEL+++H
Sbjct  428   LKIKQLQAPRRHCCDVLPSSQGNVLELAIRECKEEELIHIH  468



>ref|XP_008341969.1| PREDICTED: uncharacterized protein LOC103404789 [Malus domestica]
Length=477

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/477 (62%), Positives = 364/477 (76%), Gaps = 8/477 (2%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLV-PSTNLLHVSVSLQDVSSP--T  398
             + F Q+P K +      N  ++ SSLC ++L+ +  LV  S+ L  +S   QD  SP  T
Sbjct  2     LPFPQSPSKPQSPSRLINFFIVSSSLCTLFLLGSLFLVFTSSKLGRISSLSQDAYSPPST  61

Query  399   SLEHIVFGIASSEESWR-KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD-SLPPVCI  572
             SLEH VFGIAS++++W  KRKE+V+LWW    MRGCVFLD     H+ +  D SLPP CI
Sbjct  62    SLEHXVFGIASNQKAWSAKRKEYVRLWWXNQSMRGCVFLDSLPPDHQRHVHDTSLPPXCI  121

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDT+ FRYT RGG  SAIR+AR VSE V+LNH++VRW+VFGDDDTVFFP+NLVKTLSKY
Sbjct  122   SGDTARFRYTYRGGLKSAIRVARVVSETVALNHTNVRWYVFGDDDTVFFPENLVKTLSKY  181

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DHGLWYYIGT+SE   QN  F F MA+GGAGFAIS PLAK LAKVFDSCL RYPHLYGSD
Sbjct  182   DHGLWYYIGTNSEVYEQNRVFGFGMAYGGAGFAISAPLAKVLAKVFDSCLERYPHLYGSD  241

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
             +R+ +CL+ELGV LT E GFHQ DI GD+FGLLA+HP+ PLVSLHH +  +P+FPNMTT 
Sbjct  242   SRISSCLAELGVGLTSEAGFHQNDIHGDMFGLLASHPVTPLVSLHHFDHANPVFPNMTTI  301

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
              AL+HL+KAA++D  R+LQ+TVCYDRWF WTI+VSWGYAVQ++G+H+LLPD L  Q+++S
Sbjct  302   NALKHLFKAANVDSQRMLQKTVCYDRWFXWTITVSWGYAVQVYGNHILLPDVLPVQQTFS  361

Query  1293  PWRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKA  1469
              W+K       Y F++R +H DPCRR  VF++D VSS   DGI S+Y+K + ENC++D A
Sbjct  362   QWKKGSVLSGVYTFBTREHHKDPCRRPVVFFLDNVSSG-ADGIKSIYKK-SYENCSYDMA  419

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             SPR L+E+RV + KLDLD K+L APRR CCDVL S+  K +EI IRECKEEEL+ MH
Sbjct  420   SPRKLEEVRVYSHKLDLDMKQLQAPRRQCCDVLPSTGSKLMEIEIRECKEEELIRMH  476



>ref|XP_011036974.1| PREDICTED: uncharacterized protein LOC105134321 [Populus euphratica]
Length=471

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/467 (62%), Positives = 356/467 (76%), Gaps = 5/467 (1%)
 Frame = +3

Query  246   PVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGI  425
             P K      F ++V++  S C++ L+ +  LV ++ L+H++ S  +V +PT+L HIVFGI
Sbjct  8     PEKSHLPSRFIHLVMVSFSACIICLLLSLFLVGTSRLVHINSSSGNVRAPTTLNHIVFGI  67

Query  426   ASSEESWRKRKEFVKLWWRPSGMRGCVFLDRD-EVKHEDNGTDSLPPVCISGDTSSFRYT  602
             ASS+ SW  RKE+VKLWW+P  MRGCVFL+   E  +  N + SLPP CIS DTS FRYT
Sbjct  68    ASSKISWPNRKEYVKLWWKPDYMRGCVFLESMVEEANSYNDSGSLPPACISEDTSRFRYT  127

Query  603   CRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGT  782
              R G  SAIR+AR + E V+LNHSDVRWFVFGDDDTVF P+NLVKTLSKYDH LWYYIG+
Sbjct  128   FRNGRRSAIRVARVILETVALNHSDVRWFVFGDDDTVFIPENLVKTLSKYDHELWYYIGS  187

Query  783   SSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSEL  962
             +SE   QN  F FEMAFGG GFAISYPLAK LAKVFD+C+ RYPHLYGSD+R++ CL+EL
Sbjct  188   NSEIYKQNREFGFEMAFGGGGFAISYPLAKVLAKVFDACIERYPHLYGSDSRIYYCLAEL  247

Query  963   GVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAA  1142
             GV LTHEPGFHQ+DIRGD FGLL +HPL PLVSLHH++  DPIFPNMTT  ++EH +KA 
Sbjct  248   GVGLTHEPGFHQVDIRGDPFGLLTSHPLAPLVSLHHLDYLDPIFPNMTTMNSIEHFFKAV  307

Query  1143  SIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVP  1322
             + D  R+LQ+TVCYDRWF WTISVSWGYAV+++G+H+ LPD L  Q+++  W++      
Sbjct  308   NFDSQRVLQKTVCYDRWFGWTISVSWGYAVEVYGNHVFLPDVLPVQQTFRQWKRGDGLAG  367

Query  1323  -YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRV  1499
              Y F++R  HPD CRR T+F++D VSS  RDGITS+Y+K +  NC+ D ASPR L+EI+V
Sbjct  368   VYTFNTREPHPDLCRRPTIFFLDHVSSG-RDGITSLYKK-SFVNCSNDMASPRKLEEIKV  425

Query  1500  STQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              +QKLDL  K+L APRR CCDVL  S  K +EI IRECKEEE VYMH
Sbjct  426   YSQKLDLSDKQLRAPRRQCCDVLPPSG-KVMEIAIRECKEEERVYMH  471



>ref|XP_010109543.1| hypothetical protein L484_018278 [Morus notabilis]
 gb|EXC23147.1| hypothetical protein L484_018278 [Morus notabilis]
Length=476

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/477 (63%), Positives = 369/477 (77%), Gaps = 8/477 (2%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVS-LQD-VSSPTS  401
             M F Q+  K        NI+++ SS+C++YL+ +  LV  T LL  S S  QD V +PTS
Sbjct  1     MKFFQSHSKPNCYSRLTNILIVSSSVCILYLLISLFLV-RTKLLEASYSSTQDHVYAPTS  59

Query  402   LEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD--SLPPVCIS  575
             LEHIVFGIAS++ +W   K+ VK+WW+P+ MRGCVFL++       N T+  SLPPVCIS
Sbjct  60    LEHIVFGIASNKNAWPNSKDRVKMWWKPAQMRGCVFLEQGLPAEHQNLTNDTSLPPVCIS  119

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              DTS FRYT +GG+ SAIR+AR VSE V+LNHSDVRWFVFGDDDTVFFP+NLVKTLSKYD
Sbjct  120   EDTSRFRYTYKGGSRSAIRVARVVSETVALNHSDVRWFVFGDDDTVFFPENLVKTLSKYD  179

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             HGLWYYIGT+SE   QN +F F MAFGGAGFAISYPLAK LAK+ DSC+ RYPHLYGSDA
Sbjct  180   HGLWYYIGTNSEIYEQNRYFGFGMAFGGAGFAISYPLAKVLAKLLDSCIERYPHLYGSDA  239

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+++CL+ELGV LT EPGFHQMDIRGDVFGLLA+HP+ PLVSLHH++  +PIFPNMTT+K
Sbjct  240   RIYSCLTELGVGLTLEPGFHQMDIRGDVFGLLASHPVTPLVSLHHLDHINPIFPNMTTSK  299

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             +L+HLYKAAS+D  R+LQQT+CYDRWFSWTI VSWGYAVQI+G+H+  PD L   E++  
Sbjct  300   SLQHLYKAASVDSQRLLQQTICYDRWFSWTIVVSWGYAVQIYGNHVFAPDILPVPETFRR  359

Query  1296  WRKNKKDVP--YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKA  1469
             W+     +   Y F ++  H DPCRR T+F++D VSSS  +G+ + YRK+   NC+ D A
Sbjct  360   WKTRGPFLAGVYTFATKELHADPCRRPTIFFLDSVSSSGNNGVKTTYRKLFV-NCSHDAA  418

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             SPR L+E+RV + KLDLD K+L APRRHCC VL SS+ K +EI IRECK+EEL+ MH
Sbjct  419   SPRKLEEVRVFSHKLDLDIKQLQAPRRHCCQVLPSSSSKVMEIAIRECKDEELIRMH  475



>ref|XP_004289154.1| PREDICTED: uncharacterized protein LOC101295084 [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/475 (62%), Positives = 370/475 (78%), Gaps = 6/475 (1%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQD-VSSPTSL  404
             M   Q+P K + S    N+ +I SS+C ++L  +F LV +++ L  S S     ++ TSL
Sbjct  1     MQLIQSPTKAQVSSRLINLYIISSSVCTLFLFISFFLVFTSSKLPYSSSHDAYAATSTSL  60

Query  405   EHIVFGIASSEESWR-KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD-SLPPVCISG  578
             EH+VFGIAS+++SW  +RKE+V+LWW+   MRGCVFL+     H+++  D SLPPVCISG
Sbjct  61    EHVVFGIASNQKSWTTQRKEYVRLWWKGHSMRGCVFLESLPRDHQNHTNDTSLPPVCISG  120

Query  579   DTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDH  758
             DTS FRYT R G  SAIR+AR VSE V+LNHS+VRW+VFGDDDTVFFP+NLVKTLSKYDH
Sbjct  121   DTSGFRYTYRNGLRSAIRVARVVSETVALNHSNVRWYVFGDDDTVFFPENLVKTLSKYDH  180

Query  759   GLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDAR  938
              LWYYIG +SE   QN  F F MAFGGAGFAISYPLAKALAKVFD+C+ RYPHLYGSD+R
Sbjct  181   ELWYYIGANSEIYEQNRVFGFGMAFGGAGFAISYPLAKALAKVFDTCIERYPHLYGSDSR  240

Query  939   VHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKA  1118
             + +CL+ELGV LTHEPGFHQ D+RGD FG+LA+HPL PLVSLHH++  DPIFPNMTT +A
Sbjct  241   ISSCLAELGVGLTHEPGFHQNDLRGDTFGVLASHPLSPLVSLHHLQHTDPIFPNMTTMQA  300

Query  1119  LEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPW  1298
             L+HL KA ++D  RILQ+TVCYDRWFSWT+SVSWGYAVQI+G+H+LLPD L  QE++  W
Sbjct  301   LQHLLKAVNVDSQRILQKTVCYDRWFSWTVSVSWGYAVQIYGNHMLLPDVLPVQETFKQW  360

Query  1299  RKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASP  1475
             +K       Y F++   HPDPCRR  VF++DRV SS  DGI S+Y+K +  NC++D ASP
Sbjct  361   KKGPVLSGVYTFNTIEQHPDPCRRPVVFFLDRV-SSREDGIMSIYKK-SYANCSYDMASP  418

Query  1476  RNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             R L+E+RV + KLDL+ K+L APRRHCCD+L S+  K ++I IRECK+EEL++MH
Sbjct  419   RKLEEVRVLSHKLDLNIKQLQAPRRHCCDILPSTGGKVMDIAIRECKDEELIHMH  473



>ref|XP_010109544.1| hypothetical protein L484_018279 [Morus notabilis]
 gb|EXC23148.1| hypothetical protein L484_018279 [Morus notabilis]
Length=476

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/475 (61%), Positives = 362/475 (76%), Gaps = 9/475 (2%)
 Frame = +3

Query  234   FSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQD-VSSPTSLEH  410
              SQ+  KV    +    +LI SS      +   +L+  + LL    S Q+ +  PTSLEH
Sbjct  4     LSQSQSKVSNYYSRLTSLLIISSCVCTLYLLIALLLARSKLLETYSSTQEHMYEPTSLEH  63

Query  411   IVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRD-EVKHEDNGTD-SLPPVCISGDT  584
             IVFGIAS+++SW KRK++VK+WW+P+ MRGCVFL++    +H++   D SLPPVCIS DT
Sbjct  64    IVFGIASTKDSWLKRKDYVKMWWKPAQMRGCVFLEQGLPNEHQNLSKDTSLPPVCISEDT  123

Query  585   SSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGL  764
             S FRYT RGG  S IR+AR VSE V+LNHSDVRWFVFGDDDTVFFP+NLVKTLSKYDHGL
Sbjct  124   SWFRYTYRGGFRSLIRVARVVSETVALNHSDVRWFVFGDDDTVFFPENLVKTLSKYDHGL  183

Query  765   WYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVH  944
             WYYIGT+SE    N +F F MAF GAGFAI+YPLA+ LAKV DSCL RYPHLYGSD+R++
Sbjct  184   WYYIGTNSELYEANRYFGFGMAFQGAGFAITYPLARVLAKVLDSCLERYPHLYGSDSRIY  243

Query  945   ACLSELGVSLTHEPGFHQ--MDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKA  1118
             +CL+ELGV LT EPGFHQ  +DIRGDVFGLLA+HP+RPLVSLHH++  DPIFPNMT +KA
Sbjct  244   SCLAELGVGLTLEPGFHQACLDIRGDVFGLLASHPVRPLVSLHHLDHTDPIFPNMTASKA  303

Query  1119  LEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPW  1298
             L+H +KAA++DP R+LQQT+CYDRWFSWTI VSWGYAVQI+G+H+ LPD L   E++  W
Sbjct  304   LQHFFKAANVDPQRLLQQTICYDRWFSWTIVVSWGYAVQIYGNHVFLPDVLHVPETFKGW  363

Query  1299  RKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASP  1475
             R +      Y   ++  HPD CRR TVF++D V+S+  +GI + Y+K +  NC++D  SP
Sbjct  364   RNSGNLSGLYTLTTKELHPDRCRRPTVFFLDNVASAGWNGIKTTYQK-SYVNCSYDSDSP  422

Query  1476  RNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             R LDEIRV + KL+LD K+  APRR CCDVL+SS+ K ++I IRECKEEEL+ +H
Sbjct  423   RKLDEIRVFSHKLELDIKQ--APRRQCCDVLTSSSSKVMDIAIRECKEEELIRIH  475



>ref|XP_010240968.1| PREDICTED: uncharacterized protein LOC104585699 [Nelumbo nucifera]
Length=475

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/476 (57%), Positives = 352/476 (74%), Gaps = 7/476 (1%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLE  407
             M F Q P +   S    N++LI S   ++YL  +  +V  +++      L D+S PT+L+
Sbjct  1     MSFFQLPSRHPTSYRLINLLLISSCFSIIYLFVSISIVRPSSVERAP--LFDLSPPTTLD  58

Query  408   HIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHED-NGTD--SLPPVCISG  578
             H+VFGI+SS +SW  RKE+V+LWW+P  MRGCVF++R     +  N TD  +LPP+CIS 
Sbjct  59    HVVFGISSSAQSWPMRKEYVRLWWKPERMRGCVFVERMPTGADKYNRTDHTTLPPICISQ  118

Query  579   DTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDH  758
             DTS FRYT   G  SAIR+AR+VSE V+LN + VRWFVFGDDDT+FFP+NLV+TLSKYDH
Sbjct  119   DTSRFRYTHGSGLKSAIRVARSVSETVALNQTGVRWFVFGDDDTLFFPENLVQTLSKYDH  178

Query  759   GLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDAR  938
              LWYYIGT SE   QNS FSF+MA+ G GFA+SYPLAK LAKV DSCL RYPHLYG DAR
Sbjct  179   NLWYYIGTYSESAKQNSVFSFQMAYWGGGFALSYPLAKVLAKVLDSCLERYPHLYGDDAR  238

Query  939   VHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKA  1118
             + +CL+ELGV LT+EPGFHQ+D++GD FGLLAAHPL+PLVSLH +E  +P+FP M   +A
Sbjct  239   IFSCLTELGVGLTYEPGFHQVDLKGDAFGLLAAHPLKPLVSLHRLEDIEPVFPKMARKQA  298

Query  1119  LEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPW  1298
             LEHL +A  +DP RILQQT+CYDRWF WT+SVSWGYAVQ+  +H+LLPD L  Q ++ PW
Sbjct  299   LEHLLEAVKLDPGRILQQTICYDRWFQWTVSVSWGYAVQVFEAHILLPDVLPVQRTFEPW  358

Query  1299  RKNKKDVP--YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKAS  1472
              K    +P  + FD+R    DPCRR  +F+++ VSS HR+ I S YR   +E C   K +
Sbjct  359   NKRDTSLPPLHMFDTRELPEDPCRRPIIFFLESVSSDHRERIKSTYRSTISEKCLESKDT  418

Query  1473  PRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              + L +I V ++KL+LD ++L APRRHCCD+L+SSA + LEIGIREC+EEE+++MH
Sbjct  419   SKKLKQIIVFSKKLNLDIRQLRAPRRHCCDILTSSASEVLEIGIRECREEEMIFMH  474



>ref|XP_008455831.1| PREDICTED: uncharacterized protein LOC103495932 [Cucumis melo]
Length=467

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/473 (59%), Positives = 352/473 (74%), Gaps = 8/473 (2%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLE  407
             M    + +K   S       LI SSL V Y + +  L    +  H S S    S   SL 
Sbjct  1     MAILHSSIKPHSSSKLTTFFLISSSLGVGYFLSSLFLF---HTFHPS-STHIPSPDLSLN  56

Query  408   HIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTS  587
              IVFGIAS+++SW KRK++ K+WW+P+ MRGCVF+D D  ++ D  + SLP VC+S DTS
Sbjct  57    QIVFGIASNKDSWPKRKDYAKIWWKPNLMRGCVFVD-DIPQNHDASSSSLPAVCVSADTS  115

Query  588   SFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLW  767
              FRYT RGG  SAIR+AR V E V+  HSDVRW+VFGDDDT FFP+NLV+TLSKYD GLW
Sbjct  116   RFRYTYRGGPRSAIRVARVVLETVAAGHSDVRWYVFGDDDTFFFPENLVRTLSKYDDGLW  175

Query  768   YYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHA  947
             YYIG++SE   QN  F FEM FGGAGFAIS PLAK L  VFDSCL RYPHLYGSD+RVH+
Sbjct  176   YYIGSNSETYFQNRKFGFEMGFGGAGFAISQPLAKTLRNVFDSCLERYPHLYGSDSRVHS  235

Query  948   CLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEH  1127
             CL+ELGV LTHE GFHQ+D+RGD+FGLLA+HPL PLV+LHH++  +PIFPN TT ++L+H
Sbjct  236   CLTELGVKLTHEQGFHQVDLRGDIFGLLASHPLTPLVTLHHLDHINPIFPNKTTQESLQH  295

Query  1128  LYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKN  1307
             LYKA  IDP+R++QQ+VCYDRWFSWTISVSWGYAVQI+  H+ L DA+  Q+++SPW+K+
Sbjct  296   LYKAVEIDPYRVVQQSVCYDRWFSWTISVSWGYAVQIYDHHVFLTDAINVQQTFSPWQKD  355

Query  1308  KKDVP--YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRN  1481
              K  P  + F++R  H DPCRR TVFY+D+VSS     I + Y+K    NC+F  ASPR 
Sbjct  356   SKVEPGFFTFNTREIHDDPCRRPTVFYLDQVSSDWTGLIKTTYKK-DFLNCSFGSASPRR  414

Query  1482  LDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              DE+RV ++KL++D+K+L APRR CCDVL S+A + LEI IR+CKEEE+++MH
Sbjct  415   HDEVRVFSRKLNMDAKQLQAPRRQCCDVLPSTAAEVLEIAIRDCKEEEMIHMH  467



>ref|XP_007043327.1| YUP8H12.11 protein, putative [Theobroma cacao]
 gb|EOX99158.1| YUP8H12.11 protein, putative [Theobroma cacao]
Length=473

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/468 (62%), Positives = 355/468 (76%), Gaps = 9/468 (2%)
 Frame = +3

Query  252   KVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLL-HVSVSLQDVSSPTSLEHIVFGIA  428
             K + S +  N +LI SS+C+ +++ +  LV +      V  S QDV +PT++EHIVFGIA
Sbjct  9     KTQSSSHLLNFILISSSVCLTFIIASVFLVHNAKPPPRVYSSPQDVHAPTAMEHIVFGIA  68

Query  429   SSEESWRKRKEFVKLWWRPSGMRGCVFLDR---DEVKHEDNGTDSLPPVCISGDTSSFRY  599
             S+++SW KRKE+ KLWW+P  MRGCVFL+    +    +DN T  LPP+CIS DTS FRY
Sbjct  69    SNQKSWPKRKEYAKLWWKPRQMRGCVFLESMPPNATSRDDNST--LPPICISEDTSRFRY  126

Query  600   TCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIG  779
             T RGG  SAIR+AR + E V+LNHS+VRW+VFGDDDTVFFP+NL KTLSKYDH LWYY+G
Sbjct  127   TYRGGLRSAIRVARVILETVALNHSNVRWYVFGDDDTVFFPENLAKTLSKYDHRLWYYVG  186

Query  780   TSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSE  959
               SE   QN  F F MAFGGAGFAISYPLAK LAKV DSC+ RYPHLYGSD+RV++CL+E
Sbjct  187   AGSEIYEQNRVFGFGMAFGGAGFAISYPLAKVLAKVLDSCIDRYPHLYGSDSRVYSCLTE  246

Query  960   LGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKA  1139
             LGV LT EPGFHQ D+RG+  GLLAAHPL PLVS HH++  DPIFPNMT  KA+EHL +A
Sbjct  247   LGVGLTREPGFHQFDVRGNALGLLAAHPLTPLVSFHHIDHMDPIFPNMTRIKAMEHLLQA  306

Query  1140  ASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDV  1319
             A++D  RILQ+TVCYDRWFSWTISVSWGYAVQ++G H+ LPD L  QE++  W+K     
Sbjct  307   ANVDSQRILQRTVCYDRWFSWTISVSWGYAVQVYGKHMYLPDVLPVQETFRQWKKGTGLA  366

Query  1320  P-YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIR  1496
               Y F++R  HPDPC R T F++D VSSS + GI SVYR+ + ENCT D  SPR L+EIR
Sbjct  367   GVYTFNTREVHPDPCHRPTTFFLDSVSSS-KAGIKSVYRQ-SYENCTIDMGSPRKLEEIR  424

Query  1497  VSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             VST+KLDL+  ++ APRRHCCDVL S++ K L+I IREC  +E +YMH
Sbjct  425   VSTKKLDLNYNQMQAPRRHCCDVLPSTSGKLLDIAIRECSYDEQIYMH  472



>ref|XP_004151927.1| PREDICTED: uncharacterized protein LOC101206335 [Cucumis sativus]
 gb|KGN63277.1| hypothetical protein Csa_2G423570 [Cucumis sativus]
Length=469

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/476 (58%), Positives = 353/476 (74%), Gaps = 12/476 (3%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPS--TNLLHVSVSLQDVSSPTS  401
             M    + +K + S       LI SS CV Y + +  L  +   +L H+       SS  S
Sbjct  1     MAILHSSIKPQSSSKLITFFLISSSFCVGYFLSSVFLFHTFQPSLTHIP------SSDLS  54

Query  402   LEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHE-DNGTDSLPPVCISG  578
             L  IVFGIAS+++SW KRK+++K+WW+P+ MRGCVF+D     H+  + + SLP VC+S 
Sbjct  55    LHQIVFGIASNKDSWPKRKDYIKIWWKPNLMRGCVFVDDIPQNHDASSSSSSLPAVCVSA  114

Query  579   DTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDH  758
             DTS FRYT RGG  SAIR+AR V E V+  HS+VRW+VFGDDDT FFP+NLVKTLSKYD 
Sbjct  115   DTSRFRYTYRGGFRSAIRVARVVLETVAAGHSNVRWYVFGDDDTFFFPENLVKTLSKYDD  174

Query  759   GLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDAR  938
             GLWYYIG++SE  VQN  F FEM FGGAGFAIS PLA+ L  VFDSCL RYPHLYGSD+R
Sbjct  175   GLWYYIGSNSETYVQNRNFGFEMGFGGAGFAISQPLAQTLRNVFDSCLQRYPHLYGSDSR  234

Query  939   VHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKA  1118
             VH+CL+ELGV LTHE GFHQ+D++GD+FGLLA+HPL P+V+LHH++  +PIFPN T  ++
Sbjct  235   VHSCLTELGVKLTHEQGFHQVDLKGDIFGLLASHPLTPIVTLHHLDRINPIFPNKTIKES  294

Query  1119  LEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPW  1298
             L+HLYKA  IDP+R++QQ+VCYDRWFSWTISVSWGYAVQI+  H+ L DA+  Q++++PW
Sbjct  295   LQHLYKAVEIDPYRVVQQSVCYDRWFSWTISVSWGYAVQIYDHHVFLTDAINVQQTFTPW  354

Query  1299  RKNKKDVP--YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKAS  1472
              K  K  P  + F++R  H DPCRR TVFY+D+VSS     I + Y+K    NC+F  AS
Sbjct  355   LKGSKVEPGSFTFNTREIHEDPCRRPTVFYLDQVSSDWSGLIKTTYKK-DFLNCSFGSAS  413

Query  1473  PRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             PR  DE+RV ++KL++D+K+L APRR CCDVL S+A + LE+ IR+CKEEE+++MH
Sbjct  414   PRRHDEVRVFSRKLNMDAKQLQAPRRQCCDVLPSTAGEVLEMAIRDCKEEEMIHMH  469



>ref|XP_006592398.1| PREDICTED: uncharacterized protein LOC100813816 [Glycine max]
Length=474

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/471 (61%), Positives = 361/471 (77%), Gaps = 12/471 (3%)
 Frame = +3

Query  258   KPS--QNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIAS  431
             KP+  Q+  N++L+ SS C +YL+ + +L+  + L+HV+ S QDVS+PT+++H+VFGIAS
Sbjct  6     KPTKGQSLVNLILVSSSFCALYLIVSVLLLGPSKLVHVNRSSQDVSTPTTIDHLVFGIAS  65

Query  432   SEESWRKRKEFVKLWWRPS----GMRGCVFLDR--DEVKHEDNGTDSLPPVCISGDTSSF  593
             S  SW KRKE+VKLWW  +     M+GCVFLD   DE    +    SLPP+C+S DTS F
Sbjct  66    STSSWGKRKEYVKLWWNNTNTKKAMKGCVFLDSLSDEDNARNANDTSLPPLCVSQDTSRF  125

Query  594   RYTCRGGNPSAIRLARAVSEAVSL-NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWY  770
             R+T +GG  SAIR+AR V+E V+L N SDVRW+VFGDDDTVFFP+N+ KTLSKYDH LWY
Sbjct  126   RFTHKGGLRSAIRVARVVAETVALYNDSDVRWYVFGDDDTVFFPENVQKTLSKYDHELWY  185

Query  771   YIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHAC  950
             YIG  SE   QN  F F MAFGGAGFAIS  LAK LAKVFDSC+ RYPHLYGSD RV++C
Sbjct  186   YIGAHSEVYEQNRVFGFGMAFGGAGFAISSSLAKVLAKVFDSCIERYPHLYGSDGRVYSC  245

Query  951   LSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHL  1130
             L+ELGV LTHEPGFHQ+D++G+ FGLLA+HPL PL+SLHH +  DPIFPNMTT +AL HL
Sbjct  246   LAELGVGLTHEPGFHQVDLKGNTFGLLASHPLTPLLSLHHPDYTDPIFPNMTTKQALNHL  305

Query  1131  YKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK-N  1307
              +A ++D  R+LQQ +CYD+WFSWT+SVSWGYAVQ+  +H+LLPD L+ QE++  WRK N
Sbjct  306   LEAVNVDSQRMLQQAICYDKWFSWTVSVSWGYAVQVFPNHMLLPDVLKVQETFKQWRKGN  365

Query  1308  KKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLD  1487
                  Y F++R  HPDPC+R TVF++D VSS  +DGI S Y+K + +NC+ D  SP+ L+
Sbjct  366   MLAKSYTFNTRELHPDPCKRSTVFFLDNVSSG-KDGIISSYKK-SFQNCSIDDVSPKKLE  423

Query  1488  EIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              I+V T +LDLD K+L APRRHCCDVL S+A   +EI IREC++EELVYMH
Sbjct  424   VIKVVTNRLDLDIKQLHAPRRHCCDVLHSTARDKMEIAIRECEDEELVYMH  474



>ref|XP_004156798.1| PREDICTED: uncharacterized protein LOC101223996 [Cucumis sativus]
Length=469

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/474 (58%), Positives = 350/474 (74%), Gaps = 8/474 (2%)
 Frame = +3

Query  228   MVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLE  407
             M    + +K + S       LI SS CV Y + +  L  +        S    SS  SL 
Sbjct  1     MAILHSSIKPQSSSKLITFFLISSSFCVGYFLSSVFLFHTFQ----PSSTHIPSSDLSLH  56

Query  408   HIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHE-DNGTDSLPPVCISGDT  584
              IVFGIAS+++SW KRK+++K+WW+P+ MRGCVF+D     H+  + + SLP VC+S DT
Sbjct  57    QIVFGIASNKDSWPKRKDYIKIWWKPNLMRGCVFVDDIPQNHDASSSSSSLPAVCVSADT  116

Query  585   SSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGL  764
             S FRYT RGG  SAIR+AR V E V+  HS+VRW+VFGDDDT FFP+NLVKTLSKYD GL
Sbjct  117   SRFRYTYRGGFRSAIRVARVVLETVAAGHSNVRWYVFGDDDTFFFPENLVKTLSKYDDGL  176

Query  765   WYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVH  944
             WYYIG++SE  VQN  F FEM FGGAGFAIS PLA+ L  VFDSCL RYPHLYGSD+RVH
Sbjct  177   WYYIGSNSETYVQNRNFGFEMGFGGAGFAISQPLAQTLRNVFDSCLQRYPHLYGSDSRVH  236

Query  945   ACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALE  1124
             +CL+ELGV LTHE GFHQ+D++GD+FGLLA+HPL P+V+LHH++  +PIFPN T  ++L+
Sbjct  237   SCLTELGVKLTHEQGFHQVDLKGDIFGLLASHPLTPIVTLHHLDRINPIFPNKTIKESLQ  296

Query  1125  HLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK  1304
             HLYKA  IDP+R++QQ+VCYDRWFSWTISVSWGYAVQI+  H+ L DA+  Q++++PW K
Sbjct  297   HLYKAVEIDPYRVVQQSVCYDRWFSWTISVSWGYAVQIYDHHVFLTDAINVQQTFTPWLK  356

Query  1305  NKKDVP--YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPR  1478
               K  P  + F++R  H DPCRR TVFY+D+VSS     I + Y+K    NC+F  ASPR
Sbjct  357   GSKVEPGSFTFNTREIHEDPCRRPTVFYLDQVSSDWSGLIKTTYKK-DFLNCSFGSASPR  415

Query  1479  NLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
               DE+RV ++KL++D+K+L APRR CCDVL S+A + LE+ IR+CKEEE+++MH
Sbjct  416   RHDEVRVFSRKLNMDAKQLQAPRRQCCDVLPSTAGEVLEMAIRDCKEEEMIHMH  469



>ref|XP_007132578.1| hypothetical protein PHAVU_011G106700g [Phaseolus vulgaris]
 gb|ESW04572.1| hypothetical protein PHAVU_011G106700g [Phaseolus vulgaris]
Length=474

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/473 (60%), Positives = 363/473 (77%), Gaps = 14/473 (3%)
 Frame = +3

Query  252   KVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIAS  431
             K   +Q+  N +++ SS C +YL+ + +L+ ++ ++HV+ + QDVS PT+L+H+VFGIAS
Sbjct  6     KPTKAQSLVNFIIVSSSFCALYLIVSVLLLGTSKVVHVNKTSQDVSIPTTLDHLVFGIAS  65

Query  432   SEESWRKRKEFVKLWWRP------SGMRGCVFLDR--DEVKHEDNGTDSLPPVCISGDTS  587
             S+ SW KRKE+VKLWW          M+GCVF+D   DE KH  N T SLPP+C+S +TS
Sbjct  66    SKSSWGKRKEYVKLWWNNINSTTGKAMKGCVFMDSLPDE-KHVSNDT-SLPPLCVSQNTS  123

Query  588   SFRYTCRGGNPSAIRLARAVSEAVSLNH-SDVRWFVFGDDDTVFFPDNLVKTLSKYDHGL  764
              FR+T RGG  SAIR+AR V+E V++N+ SDVRWFVFGDDDTVFFP+N+VKTLSKYDH L
Sbjct  124   RFRFTHRGGLRSAIRVARVVAETVAMNNDSDVRWFVFGDDDTVFFPENVVKTLSKYDHEL  183

Query  765   WYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVH  944
             WYYIG  SE   QN  F F MAFGGAGFAIS  LAK LAKVFDSC+ RYPHLYGSD RV+
Sbjct  184   WYYIGAHSEVYEQNRVFGFGMAFGGAGFAISSSLAKVLAKVFDSCIQRYPHLYGSDGRVY  243

Query  945   ACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALE  1124
             +CL+ELGV LTHE GFHQ+D++G+ FGLLAAHPL PL+SLHH +  DPIFPNMTT KAL+
Sbjct  244   SCLAELGVGLTHESGFHQVDLKGNTFGLLAAHPLTPLLSLHHPDYTDPIFPNMTTIKALK  303

Query  1125  HLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK  1304
             HL++A ++D  R+LQQ +CYD+WFSWT+SVSWGYAVQ+  +H+LLPD L+ QE++  W+K
Sbjct  304   HLFEAVNVDSQRMLQQVICYDKWFSWTVSVSWGYAVQVFPNHMLLPDVLKVQETFKQWKK  363

Query  1305  NKKDVP-YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRN  1481
                    Y F++R  H DPC+R TVF++D VSS  +DG  S Y+K + +NC+ D  SP  
Sbjct  364   GSMLAKTYTFNTRELHNDPCKRSTVFFLDSVSSG-KDGTLSSYKK-SFQNCSNDAVSPMK  421

Query  1482  LDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             L+ I+V T+KLDLD K+LLAPRRHCCDVL S++   +EI IRECK+EELVYM+
Sbjct  422   LEVIKVVTEKLDLDIKQLLAPRRHCCDVLPSTSQDKMEIAIRECKDEELVYMN  474



>gb|KHG26048.1| ERV-F (c)1 provirus ancestral Env polyprotein [Gossypium arboreum]
Length=476

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/468 (60%), Positives = 353/468 (75%), Gaps = 6/468 (1%)
 Frame = +3

Query  252   KVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNL--LHVSVSLQDVSSPTSLEHIVFGI  425
             K + S +  N +LI SS+CV YLV + +L+  +    L    S QDV++PT++EHIVFGI
Sbjct  9     KTQSSSHLMNFILISSSVCVTYLVVSVLLLNGSKPPSLRAYSSYQDVNTPTTVEHIVFGI  68

Query  426   ASSEESWRKRKEFVKLWWRPSGMRGCVFLDR--DEVKHEDNGTDSLPPVCISGDTSSFRY  599
             AS+++SW KRKE+VKLWW+P  MRGC+FL+         D    +LPP+CIS DTS FRY
Sbjct  69    ASNQKSWTKRKEYVKLWWKPRRMRGCLFLESMPSNATLMDVDDVTLPPICISEDTSRFRY  128

Query  600   TCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIG  779
             T RGG  SAIR+AR VSE V+LNH +VRW+VFGDDDTVFFP+NL KTLSKYDH LWYYIG
Sbjct  129   TYRGGLRSAIRVARVVSETVALNHPNVRWYVFGDDDTVFFPENLAKTLSKYDHQLWYYIG  188

Query  780   TSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSE  959
               SE   QN  F F MAFGGAGFAISYPLAK LAKVFDSC+ RYPHLYGSD+RV++CL+E
Sbjct  189   ADSEIYEQNRIFGFGMAFGGAGFAISYPLAKVLAKVFDSCIERYPHLYGSDSRVYSCLTE  248

Query  960   LGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKA  1139
             LGV LT EPGFHQ D+RG+ FGLLAAHPL PLVSLHH++  DPIFP+MTT+KA++HL+ A
Sbjct  249   LGVGLTREPGFHQFDVRGNAFGLLAAHPLTPLVSLHHIDNIDPIFPSMTTSKAMQHLFHA  308

Query  1140  ASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK-NKKD  1316
             A++DP RILQQTVCYDRW SWT SVSWGYA+Q +   + LPD L   E++  W++ N   
Sbjct  309   ANVDPQRILQQTVCYDRWSSWTFSVSWGYAIQAYSKPVSLPDVLPVPETFRQWKRGNVLA  368

Query  1317  VPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIR  1496
               Y F+++ +HP PC+R T+FY++ VSS+    I +VY K + E+CT      R L+EIR
Sbjct  369   GVYTFNTKKFHPHPCQRPTIFYLNSVSSTKHGIIETVYNK-SHEDCTLFMDPTRKLEEIR  427

Query  1497  VSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             V T+KLDL+ K++ APRRHCCDVL S + K L++ IREC E+EL+YMH
Sbjct  428   VFTKKLDLNHKQMQAPRRHCCDVLPSKSGKVLDVAIRECGEDELIYMH  475



>gb|KDP25872.1| hypothetical protein JCGZ_22902 [Jatropha curcas]
Length=472

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/473 (59%), Positives = 356/473 (75%), Gaps = 9/473 (2%)
 Frame = +3

Query  240   QAPVKVKPSQN-FKNIVLICSSLCVVYLVCTFVLVPSTNLLHVS-VSLQDVSSPTSLEHI  413
             Q  +K  PS++ F N++LI SS+C++YL+ +  LV +    ++S  SL D  +PT+++H+
Sbjct  2     QTFLKASPSKSHFSNLILISSSICIIYLLVSLFLVLTPKFTYISSYSLNDSYAPTTIQHV  61

Query  414   VFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS-LPPVCISGDTSS  590
             VFGIASS+ SW KR+E+VKLWW+   MRGCVFL+ + +   ++  DS LPPVCISGD S 
Sbjct  62    VFGIASSKNSWPKRQEYVKLWWKEEEMRGCVFLE-ERISDRNSTIDSRLPPVCISGDISR  120

Query  591   FRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWY  770
             FRYT R G  SAIR+AR VSE V LNHSDVRWFVFGDDDTVF P+NLVK L KYDH LWY
Sbjct  121   FRYTFRNGLRSAIRVARVVSETVLLNHSDVRWFVFGDDDTVFVPENLVKVLGKYDHELWY  180

Query  771   YIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHAC  950
             YIG++SE   QN  F FEMAFGG GFAISYPLAK LAKVFDSC+ RY HLYGSD+R+ +C
Sbjct  181   YIGSNSEIYEQNRIFGFEMAFGGGGFAISYPLAKVLAKVFDSCIQRYSHLYGSDSRISSC  240

Query  951   LSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHL  1130
             L+ELGV LT EPGFHQ+D+RGD FGLL +HPL  LVSLHH +  DPIFPN T   +L+HL
Sbjct  241   LAELGVGLTREPGFHQIDVRGDPFGLLTSHPLSLLVSLHHFDHLDPIFPNKTKINSLQHL  300

Query  1131  YKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNK  1310
             +KA ++D  R+LQ+TVCYD WF WTI++SWGYA++++G+H+ LPD L  Q ++  W  N+
Sbjct  301   FKAVTVDSQRVLQKTVCYDGWFFWTIALSWGYAIEVYGNHISLPDILPVQTTFKQW-TNQ  359

Query  1311  KDV---PYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRN  1481
             K+V    Y F+ R  HPDPC+R  +F++D VSS+ +DG+ + + K +  NC++   SPR 
Sbjct  360   KNVLAGTYTFNVREPHPDPCQRPVIFFLDHVSSA-KDGVITSHYKKSYVNCSYGTTSPRK  418

Query  1482  LDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             LDEI+V + KLDL  K+L APRR CCDVL  SADK +EI +REC EEEL++MH
Sbjct  419   LDEIKVFSHKLDLSGKQLQAPRRQCCDVLPPSADKVMEIAVRECDEEELIHMH  471



>gb|KEH29637.1| transferring glycosyl group transferase [Medicago truncatula]
Length=476

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/470 (60%), Positives = 357/470 (76%), Gaps = 14/470 (3%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVVYLVCTFVLVPSTN------LLHVSVSLQDV---SSPTSLEHIV  416
             +Q+  N +L+ SS C  Y++ + +++ ++N      L H S S +DV    + T+L+ IV
Sbjct  10    AQSLINFILVTSSFCGFYVLVSVLILGTSNSKLLLHLQHSSESSRDVFIKKTNTTLDDIV  69

Query  417   FGIASSEESWRKRKEFVKLWWRPS-GMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSF  593
             FGIASS+ SW KRKE+VKLWW+ +  M+GCVFLD   +   ++   SLPP+C+S DTS F
Sbjct  70    FGIASSKSSWTKRKEYVKLWWKNNNAMKGCVFLD--SLPQNEDDPSSLPPLCVSEDTSRF  127

Query  594   RYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYY  773
             +YTC+GG  SAIR+AR V+E V+LNHS+V+W+VFGDDDTVFFP+NLVKTLSKYDH LWYY
Sbjct  128   QYTCKGGLRSAIRVARVVAETVALNHSNVKWYVFGDDDTVFFPENLVKTLSKYDHELWYY  187

Query  774   IGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACL  953
             IG  SE   QN  F F MAFGGAGFAIS  LAK LAKVFDSCL RYPHLYGSD RV++CL
Sbjct  188   IGAHSEIYEQNRLFGFGMAFGGAGFAISSSLAKVLAKVFDSCLERYPHLYGSDGRVYSCL  247

Query  954   SELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLY  1133
             +ELGV LTHEPGFHQ+D+ G+ FGLLAAHP+ PL+SLHH +  DPIFPNMTTT+AL+HL+
Sbjct  248   AELGVGLTHEPGFHQVDLTGNTFGLLAAHPVTPLLSLHHPDYTDPIFPNMTTTQALKHLF  307

Query  1134  KAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK-NK  1310
             +A ++D  R+LQQT+CYDRWFSWTISVSWGYAVQ+  +H+ LPD + A+E++  W+K N 
Sbjct  308   EAVNVDSQRMLQQTICYDRWFSWTISVSWGYAVQVFPNHMFLPDVVNARETFKQWKKGNM  367

Query  1311  KDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDE  1490
                 Y F+++  HPDPC+R T+FY D  SS  +DGI + Y K + +NC+ D  SP+ L+ 
Sbjct  368   LAKAYTFNTKPVHPDPCKRSTIFYFDSASSG-KDGIINSYYKRSFQNCSKDLVSPKKLEV  426

Query  1491  IRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             I+V T KLDLD K+L APRRHCCDVL SSA   LEI +RECK+EEL+Y H
Sbjct  427   IKVVTHKLDLDIKQLQAPRRHCCDVLPSSASDQLEISVRECKDEELIYKH  476



>ref|XP_003526316.1| PREDICTED: uncharacterized protein LOC100784602 [Glycine max]
Length=481

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/480 (61%), Positives = 365/480 (76%), Gaps = 23/480 (5%)
 Frame = +3

Query  258   KPS--QNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVS-VSLQDVSS-PTSLEHIVFGI  425
             KPS  Q+  N +L+ SS C +YL+ + +L+  + L+HV+  S QDVS+ PT+L+H+VFGI
Sbjct  6     KPSKGQSLINSILVSSSFCALYLIVSVLLLGPSKLVHVNRSSSQDVSTTPTTLDHLVFGI  65

Query  426   ASSEESWRKRKEFVKLWWRP--------SGMRGCVFLDRDEVKHEDNGTD----SLPPVC  569
             ASS+ SW KRK++VKLWW            M+GCVFLD   +  EDNG +    SLPP+C
Sbjct  66    ASSKISWFKRKDYVKLWWNNNNNNNNTNKTMKGCVFLD--SLSDEDNGRNENDTSLPPLC  123

Query  570   ISGDTSSFRYTCRGGNPSAIRLARAVSEAVSL-NHSDVRWFVFGDDDTVFFPDNLVKTLS  746
             +S DTS FR+T +GG  SAIR+AR V E V+L N S+VRW+VFGDDDTVFFP+N+VK LS
Sbjct  124   VSQDTSRFRFTHKGGLRSAIRVARVVGETVALYNDSEVRWYVFGDDDTVFFPENVVKMLS  183

Query  747   KYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYG  926
             KYDH LWYYIG  SE   QN  F F MAFGGAGFAIS  LAK LAKVFDSC+ RYPHLYG
Sbjct  184   KYDHELWYYIGAHSEVYEQNRVFGFGMAFGGAGFAISSSLAKVLAKVFDSCIERYPHLYG  243

Query  927   SDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMT  1106
             SD RV++CL+ELGV LTHEPGFHQ+D++G+ FG+LAAHPL PL+SLHH +  DPIFPNMT
Sbjct  244   SDGRVYSCLAELGVGLTHEPGFHQVDLKGNTFGILAAHPLTPLLSLHHPDYTDPIFPNMT  303

Query  1107  TTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQES  1286
             T +AL+HL++AA++D  R+LQQ +CYDRWFSWT+SVSWGYAVQ+  +H+LLPD L+ QE+
Sbjct  304   TKQALKHLFEAANVDSQRMLQQAICYDRWFSWTVSVSWGYAVQVFPNHMLLPDVLKVQET  363

Query  1287  YSPWRK-NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTF-  1460
             +  WRK N     Y F++R  HPDPC+R TVF++D VSS  +DGI S Y+K + +NC+  
Sbjct  364   FKQWRKGNMLAKSYTFNTRELHPDPCKRSTVFFLDNVSSG-KDGIISSYKK-SFQNCSID  421

Query  1461  DKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             D  SP+ L+ I+V T KLDLD K+L APRRHCCDVL S+A   +EI IRECK+EELVYMH
Sbjct  422   DDVSPKKLEVIKVVTNKLDLDIKQLRAPRRHCCDVLPSTARDQMEIAIRECKDEELVYMH  481



>ref|XP_004514044.1| PREDICTED: uncharacterized protein LOC101511630 [Cicer arietinum]
Length=473

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/472 (59%), Positives = 355/472 (75%), Gaps = 13/472 (3%)
 Frame = +3

Query  252   KVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTN---LLHV----SVSLQDVSSPTSLEH  410
             K   +Q F N +L+ SS C  Y++ + +++ S+N   L H+    S  +  +S+ T+L+H
Sbjct  6     KHTKAQFFINFILVTSSFCGFYVIISLLILGSSNSKLLQHLHHSSSQDVSTISTNTTLDH  65

Query  411   IVFGIASSEESWRKRKEFVKLWWRPS-GMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTS  587
             IVFGIASS+ SW KRK++VKLWW+ +  M+GCVF+D   + +ED+ + SLPP+C+S DTS
Sbjct  66    IVFGIASSKSSWTKRKDYVKLWWKTNNAMKGCVFMD--SISNEDDPS-SLPPLCLSRDTS  122

Query  588   SFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLW  767
              FRYT +GG  SAIR+AR V E V+LNHS+VRW+VFGDDDT+F P+NLVKTLSKYDH LW
Sbjct  123   RFRYTFKGGLRSAIRVARVVVETVALNHSNVRWYVFGDDDTIFLPENLVKTLSKYDHELW  182

Query  768   YYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHA  947
             YYIG  SE   QN  F F MAFGGAGFAIS  LA  LAKVFDSCL RY HLYGSD RV++
Sbjct  183   YYIGAHSEIYEQNRLFGFGMAFGGAGFAISSSLANVLAKVFDSCLERYHHLYGSDGRVYS  242

Query  948   CLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEH  1127
             CL+ELGV LTHEPGFHQ+D+ G+ FGLLAAHP+ PL+SLHH +  DPIFPNMTTT+AL+H
Sbjct  243   CLAELGVGLTHEPGFHQVDLNGNTFGLLAAHPVTPLLSLHHPDYTDPIFPNMTTTQALQH  302

Query  1128  LYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK-  1304
             L+KA ++D  R+LQQT+CYD+WFSWTISVSWGYAVQ+  SH+ LPD +  QE++  W++ 
Sbjct  303   LFKAVNVDSQRMLQQTICYDKWFSWTISVSWGYAVQVFPSHMFLPDVVNVQETFKQWKQG  362

Query  1305  NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNL  1484
             N     Y F++R  H DPC+R T+FY+D VS    DG+ + Y K + +NC+ +  SP  L
Sbjct  363   NVWAKTYTFNTRPLHHDPCKRSTIFYLDNVSFG-EDGMITSYYKKSFQNCSNELGSPNKL  421

Query  1485  DEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             + I+V T KLDLD K+L APRRHCCDVL SSA   LEI +RECK+EEL++MH
Sbjct  422   EVIKVVTNKLDLDIKQLQAPRRHCCDVLPSSASDQLEISVRECKDEELIFMH  473



>ref|XP_006372976.1| hypothetical protein POPTR_0017s06690g [Populus trichocarpa]
 gb|ERP50773.1| hypothetical protein POPTR_0017s06690g [Populus trichocarpa]
Length=455

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/433 (60%), Positives = 329/433 (76%), Gaps = 4/433 (1%)
 Frame = +3

Query  246   PVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGI  425
             P K      F ++V++  S C++ L+ +  LV ++ L H++ S  +V +PT+L HIVFGI
Sbjct  6     PEKPHFPSRFIHLVMVSFSACIICLLVSLFLVGTSRLAHINSSSGNVRAPTTLNHIVFGI  65

Query  426   ASSEESWRKRKEFVKLWWRPSGMRGCVFLDRD-EVKHEDNGTDSLPPVCISGDTSSFRYT  602
             ASS+ SW  RKE+VKLWW+P  MRGCVFL+   E  +  N + SLPP CIS DTS FRYT
Sbjct  66    ASSKISWPNRKEYVKLWWKPDHMRGCVFLESMVEEANSYNDSGSLPPACISEDTSRFRYT  125

Query  603   CRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGT  782
              R G  SAIR+AR V E V+LNHSDVRWFVFGDDDTVF P+NLVKTLSKYDH LWYYIG+
Sbjct  126   YRNGPRSAIRVARVVFETVALNHSDVRWFVFGDDDTVFLPENLVKTLSKYDHELWYYIGS  185

Query  783   SSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSEL  962
             +SE   QN  F FEMAFGG GFAISYPLAK LAKVFD+C+ RYPHLYGSD+R+++CL+EL
Sbjct  186   NSEIYGQNREFGFEMAFGGGGFAISYPLAKVLAKVFDACIERYPHLYGSDSRIYSCLAEL  245

Query  963   GVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAA  1142
             GV LTHEPGFHQ+DIRGD FGLL +HPL PLVSLHH++  DPIFPN TT  ++EH +KA 
Sbjct  246   GVGLTHEPGFHQVDIRGDPFGLLTSHPLAPLVSLHHLDHLDPIFPNTTTMNSIEHFFKAV  305

Query  1143  SIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVP  1322
             +ID  R+LQ+TVCYDRWF WTISVSWGYAV+++G+H+ LPD L  Q+++  W++      
Sbjct  306   NIDSQRVLQKTVCYDRWFGWTISVSWGYAVEVYGNHVFLPDVLPVQQTFRQWKRGDGLAG  365

Query  1323  -YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRV  1499
              Y F++R  HPD CRR T+F++D VSS  RD ITS+Y+K +  NC+ D ASPR L+E++V
Sbjct  366   VYTFNTREPHPDLCRRPTIFFLDHVSSG-RDRITSLYKK-SFANCSNDMASPRKLEEMKV  423

Query  1500  STQKLDLDSKELL  1538
              +QKLDL  K++ 
Sbjct  424   YSQKLDLSEKQVF  436



>ref|XP_010557014.1| PREDICTED: uncharacterized protein LOC104826156 [Tarenaya hassleriana]
Length=476

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/465 (58%), Positives = 332/465 (71%), Gaps = 19/465 (4%)
 Frame = +3

Query  276   KNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRKR  455
             +  +LI  S  V Y++ +   + S   L       D  +PT ++HIVFGI SS+ SW  R
Sbjct  20    RTFLLISISAVVFYVLVSVSCLWSRETLKA----YDFDTPTKIDHIVFGIGSSKNSWPNR  75

Query  456   KEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNPSAI  629
             + + KLWW P  MRGCVF+D      +DN +DS  LPPV +S DTS FRYT RGG+ SAI
Sbjct  76    RAYSKLWWDPHKMRGCVFVD---APLQDNHSDSHLLPPVFVSEDTSRFRYTWRGGDRSAI  132

Query  630   RLARAVSEAVSL--NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQ  803
             R+AR V E V L    SDVRW+VFGDDDT+FFPDNL KTLSKYDH  WYYIG++SE   Q
Sbjct  133   RIARTVLETVRLFNGSSDVRWYVFGDDDTIFFPDNLEKTLSKYDHTSWYYIGSNSEIYEQ  192

Query  804   NSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHE  983
             +S F F+MAFGG GFA+S  LA   AKVFDSC+ RYPHLYG D+R+++CLSELGV LTHE
Sbjct  193   DSVFGFDMAFGGGGFALSSSLANVFAKVFDSCIERYPHLYGGDSRIYSCLSELGVGLTHE  252

Query  984   PGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRI  1163
             PGFHQ D+RG   GLL +HP++P+VSLHHM+  DPIFPN TT  A+ HL++AA+IDP RI
Sbjct  253   PGFHQFDVRGSALGLLISHPMKPIVSLHHMDHMDPIFPNSTTVAAVSHLFRAAAIDPARI  312

Query  1164  LQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVP--YGFDS  1337
              Q +VCYDRWFSWTISVSWGYAVQIHG H+ LPD L AQE++ PW+ N+  +   Y F++
Sbjct  313   FQLSVCYDRWFSWTISVSWGYAVQIHGRHMHLPDVLPAQETFRPWKPNQNVMSRQYTFNT  372

Query  1338  RGYHPDPCRRQTVFYMDRVSSSHRDGIT---SVYRKMTTENCTFDK-ASPRNLDEIRVST  1505
             R    DPC+R   FYM+ VS + R G T   SVYR+   ENCT D  +SPR + EIRV +
Sbjct  373   REIRSDPCQRPVTFYMEDVSFT-RHGTTSIRSVYRQ-AYENCTHDPVSSPRKIHEIRVFS  430

Query  1506  QKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              K + D ++L APRR CCD+L S+  K +EIGIRECKE+EL+YMH
Sbjct  431   NKFEPDVRQLRAPRRQCCDILPSTGGKIMEIGIRECKEDELIYMH  475



>ref|XP_010543017.1| PREDICTED: uncharacterized protein LOC104816048 isoform X1 [Tarenaya 
hassleriana]
Length=487

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/451 (57%), Positives = 325/451 (72%), Gaps = 13/451 (3%)
 Frame = +3

Query  312   VYLVCTFVLVPSTNLLHVS-VSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPS  488
             ++ V  ++LVP + L  +      D  +PT L+HIVFGI SS+ +W  R+++ KLWW P 
Sbjct  41    IFAVVIYILVPFSRLRSLERFYAYDFHTPTQLDHIVFGIGSSKSTWPSRRDYAKLWWDPH  100

Query  489   GMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVS  662
              MRGCVF+   E     N TDS  LPP+C+S DTS F+YT RGG+  AIR+AR V E V 
Sbjct  101   KMRGCVFV---EAPLRKNATDSHLLPPLCVSEDTSRFKYTWRGGHRYAIRIARTVLETVR  157

Query  663   L--NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFG  836
             L  + SD+RW+VFGDDDT+F P+NL KTLSKYDH LWYYIG++SE   QNSFF F MAFG
Sbjct  158   LFNSSSDIRWYVFGDDDTIFIPNNLAKTLSKYDHTLWYYIGSNSEIYGQNSFFGFNMAFG  217

Query  837   GAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGD  1016
             G GF +S  LA  +AKV DSC+ RYPHLY SD R+++CL+ELGV L+HEPGFHQ+D+RG+
Sbjct  218   GGGFVLSSSLANVVAKVLDSCIERYPHLYNSDGRIYSCLAELGVGLSHEPGFHQLDVRGN  277

Query  1017  VFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWF  1196
               GLL +HP+RPLVSLHHM   DPIFPN TT  A+ HL+ A ++D  RILQ +VCYDR F
Sbjct  278   ALGLLMSHPIRPLVSLHHMAHMDPIFPNSTTVAAIRHLFSAVAVDSARILQLSVCYDRRF  337

Query  1197  SWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVP--YGFDSRGYHPDPCRRQ  1370
             SWTISVSWGYAVQIHG ++LLPD L AQE++ PW+ N+      Y F++R  HPDPC+R 
Sbjct  338   SWTISVSWGYAVQIHGQYMLLPDVLSAQETFKPWKPNQDASSRLYNFNTREIHPDPCQRP  397

Query  1371  TVFYMDRVSSSHRDGITSVYRKMTTENCTFD-KASPRNLDEIRVSTQKLDLDSKELLAPR  1547
               +YM+ VS +    I SVY+K T ENCT++  +SPR  DEIRV ++K D + ++L APR
Sbjct  398   ATYYMENVSFTQYGSIQSVYKK-TYENCTYEPNSSPRKFDEIRVFSEKSDPNIRQLKAPR  456

Query  1548  RHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             R CCD+L     K +EIGIREC E EL+YMH
Sbjct  457   RQCCDILHGDG-KVMEIGIRECNENELIYMH  486



>emb|CBI28968.3| unnamed protein product [Vitis vinifera]
Length=437

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 293/368 (80%), Gaps = 2/368 (1%)
 Frame = +3

Query  540   NGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFF  719
             N + SLPPVCIS DTS FRYT R G PSAIR+AR V E V+LNHS VRWFVFGDDDT+FF
Sbjct  71    NDSSSLPPVCISEDTSQFRYTYRHGLPSAIRVARVVPETVALNHSGVRWFVFGDDDTIFF  130

Query  720   PDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSC  899
             P+NLVKTLSKYDH LWYYIGT+SE   QN  FSF+MAFGGAGFAISYPLAK LAKVFDSC
Sbjct  131   PENLVKTLSKYDHELWYYIGTNSEIYEQNRLFSFDMAFGGAGFAISYPLAKVLAKVFDSC  190

Query  900   LHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEV  1079
             L RYPHLYGSD+RV+ CL+ELGV LT EPGFHQ+D+RG+ FGLLAAHPL PLVS HH++ 
Sbjct  191   LERYPHLYGSDSRVYTCLAELGVGLTREPGFHQVDVRGETFGLLAAHPLAPLVSFHHLDH  250

Query  1080  YDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLL  1259
              DPIFPNMT  +A+EHL++A  +D  R+LQQTVCYDRWFSWTISVSWGYAVQ+  +H  L
Sbjct  251   VDPIFPNMTANQAIEHLFEAVKVDSERVLQQTVCYDRWFSWTISVSWGYAVQVFENHQFL  310

Query  1260  PDALRAQESYSPWRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRK  1436
             PD LRA++++  W+K       Y F++R  H DPCRR T+F+MD VSS  RDGI S YR+
Sbjct  311   PDVLRARKTFRQWKKGSVLSESYTFNTRELHIDPCRRPTIFFMDSVSSG-RDGIESSYRR  369

Query  1437  MTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECK  1616
               ++ CT   ASP+ L+EI+V + KLDL  K+L APRRHCCDVL SS    LE+ IRECK
Sbjct  370   DASDGCTLHMASPKRLEEIKVFSHKLDLKIKQLQAPRRHCCDVLPSSQGNVLELAIRECK  429

Query  1617  EEELVYMH  1640
             EEEL+++H
Sbjct  430   EEELIHIH  437



>ref|XP_006594879.1| PREDICTED: uncharacterized protein LOC100779943 isoform X2 [Glycine 
max]
Length=487

 Score =   529 bits (1362),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 276/497 (56%), Positives = 362/497 (73%), Gaps = 20/497 (4%)
 Frame = +3

Query  177   LIADSKLFISTEITRGKMVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNL  356
             +I +++L ++  +    +     P+K KP   F   +L+ SS C + L  + +L+ +  +
Sbjct  2     IICNAQLHLAPSLIMKSI---HKPIKTKPLMKF---ILVSSSFCAISLCVSVLLLATPKI  55

Query  357   LHVSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWR---PSGMRGCVFLDRDEV  527
             + V  S Q VS PT+++H+VFGIASS  SW KRKE+ K+WW       MRGCVF+D   +
Sbjct  56    VEVGSSPQYVSDPTTVDHLVFGIASSGISWPKRKEYSKIWWNWKLNKTMRGCVFVD--TL  113

Query  528   KHEDNGTD----SLPPVCISGDTSSFRYTCR-GGNPSAIRLARAVSEAVSLNHSDVRWFV  692
              HE+N  +    S PP+C+S DTS F YT + GG  SAIR+AR V E V+LNHS VRW+V
Sbjct  114   PHEENANNNNDGSRPPLCVSEDTSQFLYTYKPGGLRSAIRVARVVKETVALNHSGVRWYV  173

Query  693   FGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAK  872
             FGDDDT+FFP NLVKTLSKYDH LWYY+G+ SE    +  F F MAFGG GFAIS  LA+
Sbjct  174   FGDDDTIFFPQNLVKTLSKYDHRLWYYVGSYSEIYEGSQVFGFGMAFGGGGFAISSSLAQ  233

Query  873   ALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRP  1052
              LAKVFDSC+ RY HLYGSDARV++C++ELGV LTHEPGFHQ+D+RGD+FGLLAAHPL P
Sbjct  234   VLAKVFDSCIQRYSHLYGSDARVYSCITELGVGLTHEPGFHQVDLRGDIFGLLAAHPLTP  293

Query  1053  LVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAV  1232
             LVSLHH +  DPIFPNMTTTK+L+HL++A ++D  RILQQTVCY+R FSWTISVSWGY V
Sbjct  294   LVSLHHPDHTDPIFPNMTTTKSLQHLFEAVNVDSERILQQTVCYERRFSWTISVSWGYGV  353

Query  1233  QIHGSHLLLPDALRAQESYSPWRK-NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHR  1409
             Q+  +++LLPD LR ++++  W++ N     Y F++R  HPD C+R T+FY+D+VSS  +
Sbjct  354   QVFQNNMLLPDVLRVEKTFKQWKEGNVLAGIYTFNTRELHPDQCKRPTIFYLDKVSSG-K  412

Query  1410  DGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKA  1589
             DGI S YRK  ++NC++ K   + L+ I+V T KL LD+K+L  PRRHCCDVL S+A  +
Sbjct  413   DGIISSYRKY-SQNCSY-KEPMKKLEVIKVFTNKLYLDNKQLQIPRRHCCDVLPSNAGDS  470

Query  1590  LEIGIRECKEEELVYMH  1640
             +EI IRECK EE++YMH
Sbjct  471   MEIAIRECKYEEMIYMH  487



>ref|XP_004487370.1| PREDICTED: uncharacterized protein LOC101493127 isoform X1 [Cicer 
arietinum]
Length=475

 Score =   528 bits (1359),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 261/472 (55%), Positives = 344/472 (73%), Gaps = 16/472 (3%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVV--YLVCTFVLVPSTNLLHVSVS-----LQDVSSPTSLEHIVFG  422
             +Q    + LI SSLC +  +L  T +L  ++N+L +++      L   SSPT+++H++FG
Sbjct  7     NQPLTKLFLISSSLCAISLFLFLTILLFTTSNILILNIGNSSPQLSTESSPTTIDHLIFG  66

Query  423   IASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD----SLPPVCISGDTSS  590
             IASS  SW KRK++ KLWW    M+GCVF+D   V+  D   +    SLPP+C+S DTS+
Sbjct  67    IASSGISWPKRKKYSKLWWNNKNMKGCVFVDTLPVEENDIKINIDDVSLPPLCVSEDTSN  126

Query  591   FRYTCR-GGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLW  767
             F YT + GG  SAIR+AR V E V LNHS+VRW+VFGDDDT+FFP+NLVKTLSKYDH  W
Sbjct  127   FHYTYKPGGLRSAIRVARVVKETVELNHSNVRWYVFGDDDTIFFPENLVKTLSKYDHRNW  186

Query  768   YYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHA  947
             YY+G  SE+   +  F F MAFGG+GFA+S  LA  LAKVFDSC+ RY HLYGSDARV +
Sbjct  187   YYVGAYSENYEASHVFGFGMAFGGSGFALSASLANVLAKVFDSCIRRYSHLYGSDARVFS  246

Query  948   CLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEH  1127
             C++ELGV LT+EPGFHQ+D+RG++FGLLAAHPL PL+SLHH ++ D IFPNMT + +L+H
Sbjct  247   CITELGVGLTYEPGFHQVDLRGNIFGLLAAHPLSPLLSLHHPDITDAIFPNMTNSNSLQH  306

Query  1128  LYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKN  1307
             L++AA++D  RILQQTVCY+R FS TIS+SWGYAVQ+  +++LLPD LR QE++  W++N
Sbjct  307   LFEAANVDSQRILQQTVCYERRFSQTISISWGYAVQLFQNNVLLPDVLRVQETFKTWKEN  366

Query  1308  KKDVP-YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNL  1484
                   Y F +   H DPC+R  +FY+D VSS  +DGI +   K +  NC++D +  +NL
Sbjct  367   TVMAGIYTFSTTKLHHDPCKRPNIFYLDNVSSD-KDGIITSNYKKSFRNCSYDTS--KNL  423

Query  1485  DEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             + I+V T KLD DSK+L APRR CCDVL S++   +EI IRECK EEL+YMH
Sbjct  424   EVIKVVTNKLDFDSKQLQAPRRQCCDVLPSNSGHLMEIAIRECKYEELIYMH  475



>ref|XP_010475212.1| PREDICTED: uncharacterized protein LOC104754671 isoform X2 [Camelina 
sativa]
Length=486

 Score =   527 bits (1358),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 260/466 (56%), Positives = 329/466 (71%), Gaps = 18/466 (4%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFVLVPSTNLLHV---SVSLQDVSSPTSLEHIVFGIASSEESWR  449
             N +L+ + +C+VYL+ +   + S   +H    S       S T + HIVFG+ SS  SW 
Sbjct  26    NCILLSAFICLVYLLISASRLQSKTSIHAYFSSSDQDQSKSLTKINHIVFGLGSSTNSWP  85

Query  450   KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNPS  623
              R+++VKLWW    MRGCVF+D+  +   +N TDS  LPP+CIS DTS FRYT RGG+ +
Sbjct  86    ARRDYVKLWWDAQKMRGCVFVDQ-PLSSSENHTDSDLLPPICISQDTSRFRYTWRGGDRN  144

Query  624   AIRLARAVSEAVSL---NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSED  794
             AIR+AR V E V L   +  ++RW+VFGDDDT+F P+NL +TLSKYDH  WYYIG++SE 
Sbjct  145   AIRIARCVLETVRLFNASSEEIRWYVFGDDDTIFIPENLARTLSKYDHTSWYYIGSNSET  204

Query  795   VVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSL  974
              +QNS F  +MAFGG GFA+S  LA  LA+ FDSC+ RYPHLYG D+RVH C+ ELGV L
Sbjct  205   YIQNSIFGHDMAFGGGGFALSSSLANVLARNFDSCIERYPHLYGGDSRVHVCVLELGVQL  264

Query  975   THEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDP  1154
             + EPGFHQ D+RG+  G+L +H  RPLVSLHHM   DPIFPN TT  A+ HL+ A   DP
Sbjct  265   SREPGFHQFDVRGNALGILTSHSTRPLVSLHHMAHIDPIFPNSTTFSAVRHLFSAVEFDP  324

Query  1155  HRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFD  1334
              RI Q +VCYDRW+SWTISVSWGY VQI   HLLLPDALR QE++ PW ++     Y F+
Sbjct  325   LRIFQLSVCYDRWYSWTISVSWGYTVQIESRHLLLPDALRTQETFRPWGQSG----YTFN  380

Query  1335  SRGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENCTFDK-ASPRNLDEIRVSTQ  1508
             +R  HPDPC+R   FYM+ VSSS  +G I SVY K   ENCT+D   SPR + EIRV ++
Sbjct  381   TREIHPDPCQRPVTFYMEHVSSSRHNGTIRSVY-KQAYENCTYDPITSPRKIQEIRVFSK  439

Query  1509  KLDLDSKELLAPRRHCCDVL--SSSADKALEIGIRECKEEELVYMH  1640
             +LDLD ++L APRR CCD+L  SS+  K +EIG+RECKE+EL+YMH
Sbjct  440   RLDLDIRQLKAPRRQCCDILPTSSTGGKVMEIGLRECKEDELIYMH  485



>ref|XP_003541938.2| PREDICTED: uncharacterized protein LOC100779943 isoform X1 [Glycine 
max]
Length=485

 Score =   524 bits (1349),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 275/497 (55%), Positives = 362/497 (73%), Gaps = 22/497 (4%)
 Frame = +3

Query  177   LIADSKLFISTEITRGKMVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNL  356
             +I +++L ++  +    +     P+K KP   F   +L+ SS C + L  + +L+ +  +
Sbjct  2     IICNAQLHLAPSLIMKSI---HKPIKTKPLMKF---ILVSSSFCAISLCVSVLLLATPKI  55

Query  357   LHVSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWR---PSGMRGCVFLDRDEV  527
             + V  S Q VS PT+++H+VFGIASS  SW KRKE+ K+WW       MRGCVF+D   +
Sbjct  56    VEVGSSPQYVSDPTTVDHLVFGIASSGISWPKRKEYSKIWWNWKLNKTMRGCVFVD--TL  113

Query  528   KHEDNGTD----SLPPVCISGDTSSFRYTCR-GGNPSAIRLARAVSEAVSLNHSDVRWFV  692
              HE+N  +    S PP+C+S DTS F YT + GG  SAIR+AR V E V+LNHS VRW+V
Sbjct  114   PHEENANNNNDGSRPPLCVSEDTSQFLYTYKPGGLRSAIRVARVVKETVALNHSGVRWYV  173

Query  693   FGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAK  872
             FGDDDT+FFP NLVKTLSKYDH LWYY+G+ SE    +  F F MAFGG GFAIS  LA+
Sbjct  174   FGDDDTIFFPQNLVKTLSKYDHRLWYYVGSYSEIYEGSQVFGFGMAFGGGGFAISSSLAQ  233

Query  873   ALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRP  1052
              LAKVFDSC+ RY HLYGSDARV++C++ELGV LTHEPGFHQ+D+RGD+FGLLAAHPL P
Sbjct  234   VLAKVFDSCIQRYSHLYGSDARVYSCITELGVGLTHEPGFHQVDLRGDIFGLLAAHPLTP  293

Query  1053  LVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAV  1232
             LVSLHH +  DPIFPNMTTTK+L+HL++A ++D  RILQQTVCY+R FSWTISVSWGY V
Sbjct  294   LVSLHHPDHTDPIFPNMTTTKSLQHLFEAVNVDSERILQQTVCYERRFSWTISVSWGYGV  353

Query  1233  QIHGSHLLLPDALRAQESYSPWRK-NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHR  1409
             Q+  +++LLPD LR ++++  W++ N     Y F++R  HPD C+R T+FY+D+VSS  +
Sbjct  354   QVFQNNMLLPDVLRVEKTFKQWKEGNVLAGIYTFNTRELHPDQCKRPTIFYLDKVSSG-K  412

Query  1410  DGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKA  1589
             DGI S YRK  ++NC++ K   + L+ I+V T KL LD+K++  PRRHCCDVL S+A  +
Sbjct  413   DGIISSYRKY-SQNCSY-KEPMKKLEVIKVFTNKLYLDNKQI--PRRHCCDVLPSNAGDS  468

Query  1590  LEIGIRECKEEELVYMH  1640
             +EI IRECK EE++YMH
Sbjct  469   MEIAIRECKYEEMIYMH  485



>gb|KHN36558.1| hypothetical protein glysoja_001289 [Glycine soja]
Length=470

 Score =   523 bits (1346),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 273/474 (58%), Positives = 352/474 (74%), Gaps = 19/474 (4%)
 Frame = +3

Query  246   PVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGI  425
             P+K KP   F   +L+ SS C + L  + +L+ +  ++ V  S Q VS PT+++H+VFGI
Sbjct  7     PIKTKPLMKF---ILVSSSFCAISLCVSVLLLATPKVVEVGSSPQYVSDPTTVDHLVFGI  63

Query  426   ASSEESWRKRKEFVKLWWR---PSGMRGCVFLDRDEVKHEDNGTD----SLPPVCISGDT  584
             ASS  SW KRKE+ K+WW       MRGCVF+D   + HE+N  +    S PP+C+S DT
Sbjct  64    ASSGISWPKRKEYSKIWWNWKLNKTMRGCVFVD--TLPHEENANNNNDGSRPPLCVSEDT  121

Query  585   SSFRYTCR-GGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHG  761
             S F YT + GG  SAIR+AR V E V+LNHS VRW+VFGDDDT+FFP NLVKTLSKYDH 
Sbjct  122   SQFFYTYKPGGLRSAIRVARVVKETVALNHSGVRWYVFGDDDTIFFPQNLVKTLSKYDHR  181

Query  762   LWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARV  941
             LWYY+G+ SE    +  F F MAFGG GFAIS  LA+ LAKVFDSC+ RY HLYGSDARV
Sbjct  182   LWYYVGSYSEIYEGSQVFGFGMAFGGGGFAISSSLAQVLAKVFDSCIQRYSHLYGSDARV  241

Query  942   HACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKAL  1121
             ++C++ELGV LTHEPGFHQ+D+RGD+FGLLAAHPL PLVSLHH +  DPIFPNMTTTK+L
Sbjct  242   YSCITELGVGLTHEPGFHQVDLRGDIFGLLAAHPLTPLVSLHHPDHTDPIFPNMTTTKSL  301

Query  1122  EHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWR  1301
             +HL++A ++D  RILQQTVCY+R FSWTISVSWGY VQ+  +++LLPD LR ++++  W+
Sbjct  302   QHLFEAVNVDSERILQQTVCYERRFSWTISVSWGYGVQVFQNNMLLPDVLRVEKTFKQWK  361

Query  1302  K-NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPR  1478
             + N     Y F++R  HPD C+R T+FY+D+VSS  +DGI S YRK  ++NC++ K   +
Sbjct  362   EGNVLAGIYTFNTRELHPDQCKRPTIFYLDKVSSG-KDGIISSYRKY-SQNCSY-KEPMK  418

Query  1479  NLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              L+ I+V T KL LD+K++  PRRHCCDVL S+A  ++EI IRECK EE++YMH
Sbjct  419   KLEVIKVFTNKLYLDNKQI--PRRHCCDVLPSNAGDSMEIAIRECKYEEMIYMH  470



>ref|XP_010475211.1| PREDICTED: uncharacterized protein LOC104754671 isoform X1 [Camelina 
sativa]
Length=487

 Score =   523 bits (1346),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 260/467 (56%), Positives = 329/467 (70%), Gaps = 19/467 (4%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFVLVPSTNLLHV---SVSLQDVSSPTSLEHIVFGIASSEESWR  449
             N +L+ + +C+VYL+ +   + S   +H    S       S T + HIVFG+ SS  SW 
Sbjct  26    NCILLSAFICLVYLLISASRLQSKTSIHAYFSSSDQDQSKSLTKINHIVFGLGSSTNSWP  85

Query  450   KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNPS  623
              R+++VKLWW    MRGCVF+D+  +   +N TDS  LPP+CIS DTS FRYT RGG+ +
Sbjct  86    ARRDYVKLWWDAQKMRGCVFVDQ-PLSSSENHTDSDLLPPICISQDTSRFRYTWRGGDRN  144

Query  624   AIRLARAVSEAVSL---NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSED  794
             AIR+AR V E V L   +  ++RW+VFGDDDT+F P+NL +TLSKYDH  WYYIG++SE 
Sbjct  145   AIRIARCVLETVRLFNASSEEIRWYVFGDDDTIFIPENLARTLSKYDHTSWYYIGSNSET  204

Query  795   VVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSL  974
              +QNS F  +MAFGG GFA+S  LA  LA+ FDSC+ RYPHLYG D+RVH C+ ELGV L
Sbjct  205   YIQNSIFGHDMAFGGGGFALSSSLANVLARNFDSCIERYPHLYGGDSRVHVCVLELGVQL  264

Query  975   THEPGFH-QMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASID  1151
             + EPGFH Q D+RG+  G+L +H  RPLVSLHHM   DPIFPN TT  A+ HL+ A   D
Sbjct  265   SREPGFHQQFDVRGNALGILTSHSTRPLVSLHHMAHIDPIFPNSTTFSAVRHLFSAVEFD  324

Query  1152  PHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGF  1331
             P RI Q +VCYDRW+SWTISVSWGY VQI   HLLLPDALR QE++ PW ++     Y F
Sbjct  325   PLRIFQLSVCYDRWYSWTISVSWGYTVQIESRHLLLPDALRTQETFRPWGQSG----YTF  380

Query  1332  DSRGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENCTFDK-ASPRNLDEIRVST  1505
             ++R  HPDPC+R   FYM+ VSSS  +G I SVY K   ENCT+D   SPR + EIRV +
Sbjct  381   NTREIHPDPCQRPVTFYMEHVSSSRHNGTIRSVY-KQAYENCTYDPITSPRKIQEIRVFS  439

Query  1506  QKLDLDSKELLAPRRHCCDVL--SSSADKALEIGIRECKEEELVYMH  1640
             ++LDLD ++L APRR CCD+L  SS+  K +EIG+RECKE+EL+YMH
Sbjct  440   KRLDLDIRQLKAPRRQCCDILPTSSTGGKVMEIGLRECKEDELIYMH  486



>ref|XP_004487371.1| PREDICTED: uncharacterized protein LOC101493127 isoform X2 [Cicer 
arietinum]
Length=473

 Score =   522 bits (1344),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 260/472 (55%), Positives = 343/472 (73%), Gaps = 18/472 (4%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVV--YLVCTFVLVPSTNLLHVSVS-----LQDVSSPTSLEHIVFG  422
             +Q    + LI SSLC +  +L  T +L  ++N+L +++      L   SSPT+++H++FG
Sbjct  7     NQPLTKLFLISSSLCAISLFLFLTILLFTTSNILILNIGNSSPQLSTESSPTTIDHLIFG  66

Query  423   IASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD----SLPPVCISGDTSS  590
             IASS  SW KRK++ KLWW    M+GCVF+D   V+  D   +    SLPP+C+S DTS+
Sbjct  67    IASSGISWPKRKKYSKLWWNNKNMKGCVFVDTLPVEENDIKINIDDVSLPPLCVSEDTSN  126

Query  591   FRYTCR-GGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLW  767
             F YT + GG  SAIR+AR V E V LNHS+VRW+VFGDDDT+FFP+NLVKTLSKYDH  W
Sbjct  127   FHYTYKPGGLRSAIRVARVVKETVELNHSNVRWYVFGDDDTIFFPENLVKTLSKYDHRNW  186

Query  768   YYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHA  947
             YY+G  SE+   +  F F MAFGG+GFA+S  LA  LAKVFDSC+ RY HLYGSDARV +
Sbjct  187   YYVGAYSENYEASHVFGFGMAFGGSGFALSASLANVLAKVFDSCIRRYSHLYGSDARVFS  246

Query  948   CLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEH  1127
             C++ELGV LT+EPGFHQ+D+RG++FGLLAAHPL PL+SLHH ++ D IFPNMT + +L+H
Sbjct  247   CITELGVGLTYEPGFHQVDLRGNIFGLLAAHPLSPLLSLHHPDITDAIFPNMTNSNSLQH  306

Query  1128  LYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKN  1307
             L++AA++D  RILQQTVCY+R FS TIS+SWGYAVQ+  +++LLPD LR QE++  W++N
Sbjct  307   LFEAANVDSQRILQQTVCYERRFSQTISISWGYAVQLFQNNVLLPDVLRVQETFKTWKEN  366

Query  1308  KKDVP-YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNL  1484
                   Y F +   H DPC+R  +FY+D VSS  +DGI +   K +  NC++D +  +NL
Sbjct  367   TVMAGIYTFSTTKLHHDPCKRPNIFYLDNVSSD-KDGIITSNYKKSFRNCSYDTS--KNL  423

Query  1485  DEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             + I+V T KLD DSK+  APRR CCDVL S++   +EI IRECK EEL+YMH
Sbjct  424   EVIKVVTNKLDFDSKQ--APRRQCCDVLPSNSGHLMEIAIRECKYEELIYMH  473



>gb|KHN22853.1| hypothetical protein glysoja_020783 [Glycine soja]
Length=454

 Score =   515 bits (1327),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 260/439 (59%), Positives = 333/439 (76%), Gaps = 12/439 (3%)
 Frame = +3

Query  258   KPS--QNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIAS  431
             KP+  Q+  N++L+ SS C +YL+ + +L+  + L+HV+ S QDVS+PT+++H+VFGIAS
Sbjct  6     KPTKGQSLVNLILVSSSFCALYLIVSVLLLGPSKLVHVNRSSQDVSTPTTIDHLVFGIAS  65

Query  432   SEESWRKRKEFVKLWWRPS----GMRGCVFLDR--DEVKHEDNGTDSLPPVCISGDTSSF  593
             S  SW KRKE+VKLWW  +     M+GCVFLD   DE    +    SLPP+C+S DTS F
Sbjct  66    STSSWGKRKEYVKLWWNNTNTKKAMKGCVFLDSLSDEDNARNANDTSLPPLCVSQDTSRF  125

Query  594   RYTCRGGNPSAIRLARAVSEAVSL-NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWY  770
             R+T +GG  SAIR+AR V+E V+L N SDVRW+VFGDDDTVFFP+N+ KTLSKYDH LWY
Sbjct  126   RFTHKGGLRSAIRVARVVAETVALYNDSDVRWYVFGDDDTVFFPENVQKTLSKYDHELWY  185

Query  771   YIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHAC  950
             YIG  SE   QN  F F MAFGGAGFAIS  LAK LAKVFDSC+ RYPHLYGSD RV++C
Sbjct  186   YIGAHSEVYEQNRVFGFGMAFGGAGFAISSSLAKVLAKVFDSCIERYPHLYGSDGRVYSC  245

Query  951   LSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHL  1130
             L+ELGV LTHEPGFHQ+D++G+ FGLLA+HPL PL+SLHH +  DPIFPNMTT +AL HL
Sbjct  246   LAELGVGLTHEPGFHQVDLKGNTFGLLASHPLTPLLSLHHPDYTDPIFPNMTTKQALNHL  305

Query  1131  YKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK-N  1307
              +A ++D  R+LQQ +CYD+WFSWT+SVSWGYAVQ+  +H+LLPD L+ QE++  WRK N
Sbjct  306   LEAVNVDSQRMLQQAICYDKWFSWTVSVSWGYAVQVFPNHMLLPDVLKVQETFKQWRKGN  365

Query  1308  KKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLD  1487
                  Y F++R  HPDPC+R TVF++D VSS  +DGI S Y+K + +NC+ D  SP+ L+
Sbjct  366   MLAKSYTFNTRELHPDPCKRSTVFFLDNVSSG-KDGIISSYKK-SFQNCSIDDVSPKKLE  423

Query  1488  EIRVSTQKLDLDSKELLAP  1544
              I+V T +LDLD K++  P
Sbjct  424   VIKVVTNRLDLDIKQVTMP  442



>ref|XP_010051115.1| PREDICTED: uncharacterized protein LOC104439796 [Eucalyptus grandis]
Length=472

 Score =   515 bits (1327),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 249/469 (53%), Positives = 327/469 (70%), Gaps = 4/469 (1%)
 Frame = +3

Query  240   QAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVF  419
             Q+P K   S    N++ + SS+ ++YL+    ++ ++    +   LQ++S+PT+L HIVF
Sbjct  5     QSPTKTHSSSRLINLLKVLSSILIIYLLVLLFILSTSKYSSLYSPLQELSTPTNLNHIVF  64

Query  420   GIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHED-NGTDSLPPVCISGDTSSFR  596
             GI +S++SW K KE+VKLWW    MRGC FLDR     +  N T SLPP+C+S DTS FR
Sbjct  65    GIFTSQDSWPKSKEYVKLWWNSHTMRGCAFLDRLPPDADSYNDTSSLPPLCVSEDTSGFR  124

Query  597   YTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYI  776
             YT    +   IR+AR V EAV+ NHS+VRW+VF D+ +VF  +NLVKTLSKYDH LW+YI
Sbjct  125   YTHGAQHRFQIRIARMVLEAVARNHSNVRWYVFADESSVFITENLVKTLSKYDHRLWHYI  184

Query  777   GTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLS  956
             G +SE++ QN  F F+MAF GAG AIS PLAK LA+V DSC+ RY HLYG D RV ACL+
Sbjct  185   GANSENLEQNREFGFKMAFLGAGIAISSPLAKVLARVIDSCMDRYAHLYGGDGRVFACLA  244

Query  957   ELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYK  1136
             ELG+ + HEPGFHQ DIRG+  GLL AHP+ PLVS+H ++  DP+FP M T  AL+H +K
Sbjct  245   ELGIGMIHEPGFHQFDIRGNALGLLTAHPVTPLVSIHSLDQIDPLFPGMNTLHALQHFFK  304

Query  1137  AASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK-NKK  1313
             AA+ DP RILQQTVCYDRWFSWTISVSWGYA+Q+  +H+ LPDA++  +++  WR  N  
Sbjct  305   AANADPQRILQQTVCYDRWFSWTISVSWGYAIQVFPNHVYLPDAIKVGQTFRHWRSGNPL  364

Query  1314  DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEI  1493
                Y F++R  H   C R T+F+ +++S S   G T    K    NC +D  SPR + EI
Sbjct  365   TEAYVFNTRELHTVECARPTIFFFEKISKS--KGRTKTTYKRADLNCEYDGGSPRKIKEI  422

Query  1494  RVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             RV   K+DL  K+L APRR CC+VL SS ++ L+I I+ECKEEEL+Y+H
Sbjct  423   RVYAHKMDLTKKQLQAPRRQCCNVLPSSNNEVLDIAIKECKEEELIYLH  471



>ref|XP_010543014.1| PREDICTED: uncharacterized protein LOC104816045 [Tarenaya hassleriana]
Length=458

 Score =   513 bits (1322),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 250/454 (55%), Positives = 320/454 (70%), Gaps = 12/454 (3%)
 Frame = +3

Query  303   LCVVYLVCTFVLVPSTNLLHVS-VSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWW  479
             L  ++LV  ++LVP + L  +         +PT L+HIVFGI SS+ +W  R+++VKLWW
Sbjct  6     LISIFLVVVYILVPFSRLRSLERFYAHGFHTPTRLDHIVFGIGSSKNTWPSRRDYVKLWW  65

Query  480   RPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNPSAIRLARAVSE  653
              P  MRGCVF+   E   ++N TDS  LPPVCIS DTS FRYTCRGG+ S I +AR+V E
Sbjct  66    VPRKMRGCVFV---EAPLQENATDSHLLPPVCISEDTSRFRYTCRGGHRSTIHVARSVLE  122

Query  654   AVSL--NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEM  827
              V L  + SD+RW+VFGDDDT+F P+NL +TLSKYDH LWYYIG++SE   +NSF+ F M
Sbjct  123   IVRLFNSSSDIRWYVFGDDDTIFIPENLARTLSKYDHTLWYYIGSNSEIYGKNSFYGFHM  182

Query  828   AFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDI  1007
             AFGG GF +S  LA  LAKV DSC+ RY HL G D R+++CL+ELGV L+HEPGFHQ+D+
Sbjct  183   AFGGGGFVLSSSLANVLAKVLDSCIERYTHLCGGDGRIYSCLAELGVGLSHEPGFHQLDV  242

Query  1008  RGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYD  1187
             +G+  GLL +HP+RPLVSLHHM   DPIFPN  T  A+ HL   A++D  RILQ +VCYD
Sbjct  243   KGNGLGLLMSHPMRPLVSLHHMAHMDPIFPNSPTVAAVRHLLSVAAVDSARILQLSVCYD  302

Query  1188  RWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVP--YGFDSRGYHPDPC  1361
             R FSWTISVSWGYAVQIHG H+LLPD L  QE++ PW  N+      Y F++R  HPDPC
Sbjct  303   RRFSWTISVSWGYAVQIHGRHMLLPDVLPVQETFEPWNPNQNASSRLYNFNTREIHPDPC  362

Query  1362  RRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDK-ASPRNLDEIRVSTQKLDLDSKELL  1538
              R   +YM+  S +    I S+Y+    ENCT D  +SP   +EI V ++K D + ++L 
Sbjct  363   HRPATYYMENASFTGDGSIRSLYKAKAYENCTSDLISSPWKFEEIIVFSKKYDPNIQQLK  422

Query  1539  APRRHCCDVLSS-SADKALEIGIRECKEEELVYM  1637
             APRR CCD+L S +  K +EIGIRECK++EL+YM
Sbjct  423   APRRQCCDILPSRNGGKIMEIGIRECKDDELIYM  456



>ref|XP_010457610.1| PREDICTED: uncharacterized protein LOC104739061 [Camelina sativa]
Length=487

 Score =   514 bits (1323),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 257/466 (55%), Positives = 323/466 (69%), Gaps = 18/466 (4%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFVLVPSTNLLHV---SVSLQDVSSPTSLEHIVFGIASSEESWR  449
             N +L+ + + +VYL+ +   + S N +H    S       S T + HIVFG+ SS  SW 
Sbjct  27    NCILLFAFIFLVYLLISASRLQSKNSIHAYFSSSDQDQSKSLTKINHIVFGLGSSTNSWP  86

Query  450   KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNPS  623
              R+E+VKLWW    MRGCVF+D   +   +N TDS  LPP+CIS DTS FRYT RGG+ +
Sbjct  87    ARREYVKLWWDAQKMRGCVFVDH-PLSSSENHTDSDLLPPICISQDTSRFRYTWRGGDRN  145

Query  624   AIRLARAVSEAVSL---NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSED  794
             AIR+AR V E V L   +  +VRW+VFGDDDT+F P+NL +TLSKYDH  WYYIG++SE 
Sbjct  146   AIRIARCVLETVRLFNASSEEVRWYVFGDDDTIFIPENLARTLSKYDHTSWYYIGSNSET  205

Query  795   VVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSL  974
               QNS F  +MAFGG GFA+S  LA  LA+ FDSC+ RYPHLYG D+RVH C+ ELGV L
Sbjct  206   YQQNSIFGHDMAFGGGGFALSSSLANVLARNFDSCIERYPHLYGGDSRVHVCVLELGVQL  265

Query  975   THEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDP  1154
             + EPGFHQ D+RG+  G+L +H  RP+VSLHHM   DPIFPN TT  A+ HL+ A  +DP
Sbjct  266   SREPGFHQFDVRGNALGILTSHSTRPMVSLHHMAHIDPIFPNSTTFSAVSHLFSAVELDP  325

Query  1155  HRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFD  1334
              RI Q +VCYDRW+SWTISVSWGY VQI   HLLLP  LR QE++ PW ++     Y F+
Sbjct  326   LRIFQLSVCYDRWYSWTISVSWGYTVQIDSRHLLLPVVLRTQETFRPWGQSG----YTFN  381

Query  1335  SRGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENCTFDK-ASPRNLDEIRVSTQ  1508
             +R  H DPC+R   FYM  VSSS  +G I SVY +   ENCT+D   SPR + EIRV ++
Sbjct  382   TREIHSDPCQRPVTFYMQHVSSSRHNGTIESVYTQ-AYENCTYDPITSPRKIQEIRVYSK  440

Query  1509  KLDLDSKELLAPRRHCCDVL--SSSADKALEIGIRECKEEELVYMH  1640
             +LDLD ++L APRR CCD+L  SS+  K +EIG+RECKE EL+YMH
Sbjct  441   RLDLDIRQLKAPRRQCCDILPTSSTGGKVMEIGLRECKENELIYMH  486



>emb|CDY15540.1| BnaA08g28240D [Brassica napus]
Length=491

 Score =   512 bits (1319),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 263/467 (56%), Positives = 329/467 (70%), Gaps = 16/467 (3%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFVLVPSTNLLHVS-VSLQDVS-SPTSLEHIVFGIASSEESWRK  452
             N VL+     +VYL+ +     S + +    +S QD S SPT ++HIVFGI SS +SW  
Sbjct  27    NCVLLSVFASLVYLLVSLSRFQSKDTIDAYFLSSQDQSQSPTEIDHIVFGIGSSIKSWPA  86

Query  453   RKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNPSA  626
             R+E+V+LWW    MRGCVF+DR  +    N TDS  LPP+C+S DTS FRYT R G+ +A
Sbjct  87    RREYVRLWWDAQRMRGCVFVDR-PLTSLVNDTDSHLLPPICVSEDTSRFRYTWRKGDRNA  145

Query  627   IRLARAVSEAVSLNHS---DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDV  797
             IR+AR V E V + ++   +VRW+VFGDDDT+F  +NL KTLSKYDH  WYYIG SSE  
Sbjct  146   IRIARCVLETVRMFNTSSEEVRWYVFGDDDTIFIHENLAKTLSKYDHTSWYYIGASSEIY  205

Query  798   VQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLT  977
              QNS F  +MAFGG G AIS  LA  LAK+FDSC+ RYPHLYG D+RVHAC+ ELGV L+
Sbjct  206   HQNSLFGHDMAFGGGGIAISSSLANVLAKIFDSCIERYPHLYGGDSRVHACMLELGVGLS  265

Query  978   HEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPH  1157
             HEPGFHQ D+RG+  G+L +H  RPLVSLHHM   DPIFPN TT  A+ HL+ A  +DP 
Sbjct  266   HEPGFHQFDVRGNALGILTSHSTRPLVSLHHMAHIDPIFPNSTTFSAVRHLFSAVELDPL  325

Query  1158  RILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVP--YGF  1331
             RI Q +VCYDRW SWTISVSWGYAVQI   HL L D LR Q+++ PW KN   +   Y F
Sbjct  326   RIFQLSVCYDRWHSWTISVSWGYAVQIETRHLFLRDVLRTQKTFRPW-KNSGGLASVYTF  384

Query  1332  DSRGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENCTFDK-ASPRNLDEIRVST  1505
             ++R  HPDPC+R   F+M+ VSSS  DG I SVY K   +NCT+D  +SPR ++E+RV +
Sbjct  385   NTRDVHPDPCQRPVTFFMEHVSSSPSDGTIKSVY-KQAYQNCTYDPISSPRKIEEVRVFS  443

Query  1506  QKLDLDSKELLAPRRHCCDVL--SSSADKALEIGIRECKEEELVYMH  1640
              +LD D ++L APRR CCD+L  SS+  K L+IGIRECKE+EL+Y+H
Sbjct  444   ARLDPDIRQLKAPRRQCCDILPTSSNGGKVLDIGIRECKEDELIYIH  490



>ref|XP_010689646.1| PREDICTED: uncharacterized protein LOC104903328 [Beta vulgaris 
subsp. vulgaris]
Length=468

 Score =   511 bits (1316),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 261/459 (57%), Positives = 329/459 (72%), Gaps = 8/459 (2%)
 Frame = +3

Query  273   FKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRK  452
             F   +L C  + + +L    +L  +++  +V VS   +S P SLEHIVFG+ASS  SW K
Sbjct  14    FILTILFCICILLYFLTSLSLLWTNSDFRNVFVSSSRLSPPLSLEHIVFGLASSRTSWLK  73

Query  453   RKEFVKLWWRPSGMRGCVFLDRD--EVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSA  626
             +KEFVK+WW+P  M GCVF+D    E+ H  + +  LPPVC+S DTS FRYT + G  SA
Sbjct  74    QKEFVKIWWKPDRMLGCVFVDGLPLELNHTHDSS-LLPPVCVSQDTSRFRYTYKHGYRSA  132

Query  627   IRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQN  806
             IR+AR VSE V+LNHSDVRW+VFGD  T+FFP+NLV TLSKYDH LWYYIG+SSE   QN
Sbjct  133   IRVARIVSETVNLNHSDVRWYVFGDGHTIFFPENLVSTLSKYDHELWYYIGSSSEIYEQN  192

Query  807   SFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEP  986
                SF+MAF GAGFA+S PLAKALAKV DSCL RY HLYGSD R+HACL+ELGV LT E 
Sbjct  193   KVNSFDMAFWGAGFAVSAPLAKALAKVLDSCLERYHHLYGSDGRIHACLAELGVGLTPER  252

Query  987   GFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRIL  1166
             GFHQ+D+RG++FGLLA+HPL PLVSL H++  DPI+PN +   AL HL+K+A+ID  RIL
Sbjct  253   GFHQVDVRGNIFGLLASHPLAPLVSLSHLDEVDPIYPNKSVIDALHHLFKSATIDSGRIL  312

Query  1167  QQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGY  1346
             QQTVCYDRWFSWTISVSWGYA+++   HL L D LR Q+++S W+K      Y F +R  
Sbjct  313   QQTVCYDRWFSWTISVSWGYAIEVFNQHLYLHDVLRVQDTFSQWKKGAAG-NYLFSTRFI  371

Query  1347  HPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFD-KASPRNLDEIRVSTQKLDLD  1523
             HPD CR  T+F++D V    R   TS Y+ +  ENCT+D   SP+ L +I + ++ L + 
Sbjct  372   HPDRCRGSTIFFLDEVHEK-RTIATSKYKIVLPENCTYDPMTSPKKLKDITIFSRYLSI-  429

Query  1524  SKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              K+L APRR CCDVL      +LEI IREC+++EL+ MH
Sbjct  430   -KQLQAPRRQCCDVLPPKVLTSLEILIRECRDDELIMMH  467



>ref|XP_010240965.1| PREDICTED: uncharacterized protein LOC104585698 isoform X1 [Nelumbo 
nucifera]
Length=486

 Score =   509 bits (1310),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 256/474 (54%), Positives = 338/474 (71%), Gaps = 11/474 (2%)
 Frame = +3

Query  240   QAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHV----SVSLQDVSSPTSLE  407
             + P ++  S   K+++LI SSLC++YLV +   +  + LL +           S PTSL 
Sbjct  17    KIPGEILTSSRLKDLLLIFSSLCILYLVVSHYRI--STLLQIRHTQPYPSSSSSPPTSLS  74

Query  408   HIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHED-NGTDSLPPVCISGDT  584
             H+ F IASS +SW  R+ +V+LWW+P  MRG VFLDR        N T+SLPPV IS DT
Sbjct  75    HLAFAIASSSKSWPNRRHYVRLWWKPQLMRGYVFLDRKPPDSATTNTTESLPPVLISEDT  134

Query  585   SSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGL  764
             S F YT +GG  SAIR++R VSE V+ N SDVRWFVFGDDDTVFFP+NL KTLSKYDH  
Sbjct  135   SRFPYTYKGGLRSAIRVSRIVSEIVARNLSDVRWFVFGDDDTVFFPENLAKTLSKYDHNR  194

Query  765   WYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVH  944
             WYY+G+SSE   QNS FSFEMAFGG GFAISYPLA+ LA+V DSCL RY HLYGSD+R+ 
Sbjct  195   WYYVGSSSESFEQNSRFSFEMAFGGGGFAISYPLARVLARVMDSCLMRYSHLYGSDSRIF  254

Query  945   ACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALE  1124
             +CL+ELGV LTHE GFHQ+DIRG++FGLL+AHPL P++SLHH++  DPIFPN +  +ALE
Sbjct  255   SCLAELGVGLTHESGFHQVDIRGNLFGLLSAHPLAPIISLHHLDSVDPIFPNRSQIQALE  314

Query  1125  HLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK  1304
             HL+   ++DP RILQQTVCYD+  S T+SVSWGYAVQ+     LLPD +  Q ++ PWR+
Sbjct  315   HLFNVVNVDPARILQQTVCYDQSNSQTVSVSWGYAVQVFEGIQLLPDLILMQRTFMPWRR  374

Query  1305  --NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPR  1478
               N     + F+ R +  DPC+R ++F++  V  ++ +   S Y K T  +C   K++ +
Sbjct  375   SLNVNLSHFMFNMRVFPKDPCKRPSIFFLGNV-LTNTNVTQSNYSKDTIRSC-LKKSASQ  432

Query  1479  NLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             NL++I+V + KL+LD  +L APRRHCCD+L SS++K ++I IR+C +EE++ MH
Sbjct  433   NLEQIKVFSPKLELDYGQLQAPRRHCCDILPSSSEKVMKIRIRQCLDEEIISMH  486



>gb|KCW89426.1| hypothetical protein EUGRSUZ_A01725 [Eucalyptus grandis]
Length=425

 Score =   506 bits (1302),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 238/423 (56%), Positives = 304/423 (72%), Gaps = 4/423 (1%)
 Frame = +3

Query  378   QDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHED-NGTDS  554
             +++S+PT+L HIVFGI +S++SW K KE+VKLWW    MRGC FLDR     +  N T S
Sbjct  4     EELSTPTNLNHIVFGIFTSQDSWPKSKEYVKLWWNSHTMRGCAFLDRLPPDADSYNDTSS  63

Query  555   LPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLV  734
             LPP+C+S DTS FRYT    +   IR+AR V EAV+ NHS+VRW+VF D+ +VF  +NLV
Sbjct  64    LPPLCVSEDTSGFRYTHGAQHRFQIRIARMVLEAVARNHSNVRWYVFADESSVFITENLV  123

Query  735   KTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYP  914
             KTLSKYDH LW+YIG +SE++ QN  F F+MAF GAG AIS PLAK LA+V DSC+ RY 
Sbjct  124   KTLSKYDHRLWHYIGANSENLEQNREFGFKMAFLGAGIAISSPLAKVLARVIDSCMDRYA  183

Query  915   HLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIF  1094
             HLYG D RV ACL+ELG+ + HEPGFHQ DIRG+  GLL AHP+ PLVS+H ++  DP+F
Sbjct  184   HLYGGDGRVFACLAELGIGMIHEPGFHQFDIRGNALGLLTAHPVTPLVSIHSLDQIDPLF  243

Query  1095  PNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALR  1274
             P M T  AL+H +KAA+ DP RILQQTVCYDRWFSWTISVSWGYA+Q+  +H+ LPDA++
Sbjct  244   PGMNTLHALQHFFKAANADPQRILQQTVCYDRWFSWTISVSWGYAIQVFPNHVYLPDAIK  303

Query  1275  AQESYSPWRK-NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTEN  1451
               +++  WR  N     Y F++R  H   C R T+F+ +++S S   G T    K    N
Sbjct  304   VGQTFRHWRSGNPLTEAYVFNTRELHTVECARPTIFFFEKISKS--KGRTKTTYKRADLN  361

Query  1452  CTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
             C +D  SPR + EIRV   K+DL  K+L APRR CC+VL SS ++ L+I I+ECKEEEL+
Sbjct  362   CEYDGGSPRKIKEIRVYAHKMDLTKKQLQAPRRQCCNVLPSSNNEVLDIAIKECKEEELI  421

Query  1632  YMH  1640
             Y+H
Sbjct  422   YLH  424



>ref|XP_009111055.1| PREDICTED: uncharacterized protein LOC103836532 [Brassica rapa]
Length=491

 Score =   508 bits (1309),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 260/466 (56%), Positives = 325/466 (70%), Gaps = 14/466 (3%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFVLVPSTNLLHVS-VSLQDVS-SPTSLEHIVFGIASSEESWRK  452
             N VL+      VYL+ +     S + +    +S QD S SPT ++HIVFGI SS +SW  
Sbjct  27    NCVLLSVFASFVYLLVSLSRFQSKDTIDAYFLSSQDQSQSPTEIDHIVFGIGSSIKSWPA  86

Query  453   RKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNPSA  626
             R+E+VKLWW    MRGCVF+DR  +    N TDS  LPP+C+S DTS FRYT R G+ +A
Sbjct  87    RREYVKLWWDAQRMRGCVFVDR-PLTSLVNDTDSHLLPPICVSEDTSRFRYTWRKGDKNA  145

Query  627   IRLARAVSEAVSLNHS---DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDV  797
             IR+AR V E V + ++   +VRW+VFGDDDT+F  +NL KTLSKYDH  WYYIG SSE  
Sbjct  146   IRIARCVLETVRMFNTSSEEVRWYVFGDDDTIFIHENLAKTLSKYDHTSWYYIGASSEIY  205

Query  798   VQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLT  977
              QNS F  +MAFGG G AIS  L+  LAK FDSC+ RYPHLYG D+RVHAC+ ELGV L+
Sbjct  206   HQNSLFGHDMAFGGGGIAISSSLSNVLAKNFDSCIERYPHLYGGDSRVHACMLELGVGLS  265

Query  978   HEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPH  1157
             HEPGFHQ D+RG+  G+L +H  RPLVSLHHM   DPIFPN TT  A+ HL+ A  +DP 
Sbjct  266   HEPGFHQFDVRGNALGILTSHSTRPLVSLHHMAHIDPIFPNSTTFSAVRHLFSAVELDPL  325

Query  1158  RILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVP-YGFD  1334
             RI Q +VCYDRW SWTISVSWGYAVQI   HL L D LR Q+++ PW+ +      Y F+
Sbjct  326   RIFQLSVCYDRWHSWTISVSWGYAVQIETRHLFLRDVLRTQKTFRPWKNSGGLASVYTFN  385

Query  1335  SRGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENCTFDK-ASPRNLDEIRVSTQ  1508
             +R  HPDPC+R   F+M+ VSSS  DG I SVY K   +NCT+D  +SPR ++E+RV + 
Sbjct  386   TRDVHPDPCQRPVTFFMEHVSSSPSDGTIKSVY-KQAYQNCTYDPISSPRKIEEVRVFST  444

Query  1509  KLDLDSKELLAPRRHCCDVL--SSSADKALEIGIRECKEEELVYMH  1640
             +LD D ++L APRR CCD+L  SS+    L+IGIRECKE+EL+Y+H
Sbjct  445   RLDPDIRQLKAPRRQCCDILPTSSNGGNVLDIGIRECKEDELIYIH  490



>gb|AES67287.2| transferring glycosyl group transferase [Medicago truncatula]
Length=473

 Score =   507 bits (1306),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 262/470 (56%), Positives = 340/470 (72%), Gaps = 14/470 (3%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVV--YLVCTFVLVPSTNLLHVSVS---LQDVSS-PTSLEHIVFGI  425
             +++   ++   SS C +  ++  + +   ++ ++ +++    LQ   S PT++ H+VFGI
Sbjct  7     TKSLTKLIPFSSSFCAISLFIFISILFFTTSKIVTINIGSSLLQPTESDPTNVNHLVFGI  66

Query  426   ASSEESWRKRKEFVKLWWRPSGMRGCVFLDR---DEVKHEDNGTDSLPPVCISGDTSSFR  596
             ASS +SW  RK++ KLWW    M+GCVF+D    +E  +  N  DS+P +C+S DTS F 
Sbjct  67    ASSGKSWPNRKKYAKLWWN-KNMKGCVFVDNLPPEENDNNLNSDDSVPQICVSEDTSKFN  125

Query  597   YTCR-GGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYY  773
             YT R GG  SAIR+AR V E   LNHSDVRW+VFGDDDT+FFP+NLVKTLSKYDH LWYY
Sbjct  126   YTYRPGGLRSAIRVARVVKETAELNHSDVRWYVFGDDDTIFFPENLVKTLSKYDHRLWYY  185

Query  774   IGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACL  953
             +G  SE+   +  F F MAFGG GFA+S  LA  LAKVFDSC+ RY HLYGSDARV +C+
Sbjct  186   VGAYSENYEGSQTFGFGMAFGGGGFALSASLANVLAKVFDSCIERYSHLYGSDARVFSCI  245

Query  954   SELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLY  1133
             +ELGV LT+EPGFHQ+D+RG+VFGLLAAHPL PL+SLHH ++ D IFPNMT +K+L+HL+
Sbjct  246   AELGVGLTYEPGFHQVDLRGNVFGLLAAHPLSPLLSLHHPDITDAIFPNMTNSKSLQHLF  305

Query  1134  KAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWR-KNK  1310
             +AA +D  R+LQQTVCYDR FS TISVSWGYAVQ+  S++LLPD LR QE++ PW+ K+ 
Sbjct  306   EAAYVDSQRMLQQTVCYDRRFSRTISVSWGYAVQVFQSNVLLPDVLRVQETFKPWKEKHV  365

Query  1311  KDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDE  1490
                 Y F  R  H DPC+R  +FY+D VSS  +DGI S Y K +  NC+ DK S +NL+ 
Sbjct  366   MAGIYTFSKRELHHDPCKRPKIFYLDNVSSG-KDGIISNYTK-SFYNCSNDKTSSKNLEV  423

Query  1491  IRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             I+V T  LDLDSK+L  PRR CCDVL S++ + +EI IRECK EEL+YMH
Sbjct  424   IKVVTNNLDLDSKQLQTPRRQCCDVLDSNSGQLMEIAIRECKYEELIYMH  473



>ref|XP_006594878.1| PREDICTED: uncharacterized protein LOC100778878 [Glycine max]
 gb|KHN36559.1| hypothetical protein glysoja_001290 [Glycine soja]
Length=476

 Score =   505 bits (1301),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 267/480 (56%), Positives = 341/480 (71%), Gaps = 18/480 (4%)
 Frame = +3

Query  240   QAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLV--PST--NLLHVSVSLQDVSSPTSLE  407
             Q+  K+  +Q   N+VL+ SS C +Y++ + VL+  PS   NL   S ++ +  + T+L+
Sbjct  2     QSLHKIATTQTLINLVLVSSSFCAIYILVSVVLLGTPSKLENLHSSSHNVYESKTTTTLD  61

Query  408   HIVFGIASSEESWRKRKEFVKLWW---RPSGMRGCVFLDR-DEVKHEDNGTDSLPPVCIS  575
             H+VFGIASS  SW KRKE+VKLWW   R + MRGCVF+D   + K  +N   +LPP+C+S
Sbjct  62    HLVFGIASSRSSWPKRKEYVKLWWNTIRNTTMRGCVFVDTLPQDKDNNNNASTLPPLCVS  121

Query  576   GDTSSFRYTCRG---GNPSAIRLARAVSEAVS-LNHSDVRWFVFGDDDTVFFPDNLVKTL  743
              DTS FRYT  G   G  SAIR+AR V E V+ +NHS +RW+VFGDDDT+FFP N+VKTL
Sbjct  122   QDTSRFRYTYSGWGGGMRSAIRVARVVKETVARMNHSHIRWYVFGDDDTLFFPQNVVKTL  181

Query  744   SKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLY  923
              KYDH LWYY+G +SE   Q  FF F M FGGAGFAIS  LA  L KVFDSC+ RYP LY
Sbjct  182   CKYDHRLWYYVGANSESYKQTWFFGFGMGFGGAGFAISSSLATVLVKVFDSCIERYPELY  241

Query  924   GSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNM  1103
             GSDARV+AC++ELGV LTHEPGFHQ+D+RG+ FGLLAAHPL PL+SLHH++  DPIFPNM
Sbjct  242   GSDARVYACITELGVGLTHEPGFHQVDLRGNAFGLLAAHPLTPLLSLHHLDNIDPIFPNM  301

Query  1104  TTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQE  1283
             T  KAL+HLY+AA +D  R+LQQTVCYD+  SWTISVSWGYA Q+  +HL LPD +R Q+
Sbjct  302   TIIKALQHLYEAAKVDSQRLLQQTVCYDKRLSWTISVSWGYAAQVFHNHLSLPDVVRVQK  361

Query  1284  SYSPW-RKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTF  1460
             ++  W R       + FD++  H DPCRR T+FY++ +S      I S YRK + +NC+ 
Sbjct  362   TFKHWTRGTALADQFTFDTKELHTDPCRRPTIFYLENLSRGEDGIIISNYRK-SIQNCSS  420

Query  1461  DKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             + A     + IRV++ KL+L  K+LLA RRHCCDVL SS    +EI IRECKE+EL+ M 
Sbjct  421   NVAP----EVIRVASSKLELGIKQLLAQRRHCCDVLPSSVSDQMEIAIRECKEDELISMQ  476



>ref|XP_009111053.1| PREDICTED: uncharacterized protein LOC103836531 [Brassica rapa]
Length=491

 Score =   503 bits (1295),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 257/465 (55%), Positives = 322/465 (69%), Gaps = 22/465 (5%)
 Frame = +3

Query  306   CVVYLVCTFVLV----------PSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRKR  455
             C+++ V TF++             T   +V  S     SPT+++HIVFGIASS ++W  R
Sbjct  28    CILFSVFTFLVYLLLSLSLFQSKETINAYVFSSKDQPQSPTAIDHIVFGIASSIKTWPAR  87

Query  456   KEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNPSAI  629
             +E+VKLWW    MRGCVF+DR  +    N T+S  LPP+C+S DTS FRYT R G+ SAI
Sbjct  88    REYVKLWWDAQRMRGCVFVDR-PLPSFVNHTNSPLLPPICVSEDTSRFRYTWRNGDRSAI  146

Query  630   RLARAVSEAVSLNHS---DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVV  800
             R+AR V E+V + ++   +VRW+VFGDDDT+F P+NLV+TLSKYDH  WYYIG SSE   
Sbjct  147   RIARCVIESVKMFNTSSEEVRWYVFGDDDTIFIPENLVRTLSKYDHTSWYYIGASSEIYY  206

Query  801   QNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTH  980
             QNS F  +MAFGG G AIS  LA  LAKVFDSC+ RYPHLYG D+RVHAC+ ELGV L+H
Sbjct  207   QNSLFGHDMAFGGGGIAISSSLANVLAKVFDSCIERYPHLYGGDSRVHACMLELGVGLSH  266

Query  981   EPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHR  1160
             EPGFHQ D+RG+  G+L +H  RPLVSLHHM   DPIFPN TT  A+ HL+ A  +DP R
Sbjct  267   EPGFHQFDVRGNALGILTSHSTRPLVSLHHMAHIDPIFPNSTTFSAVSHLFSAVELDPLR  326

Query  1161  ILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPW-RKNKKDVPYGFDS  1337
             I Q +VCYD W SWTISVSWGYAVQI   HL L D LR Q+++  W         Y F++
Sbjct  327   IFQVSVCYDCWHSWTISVSWGYAVQIESRHLFLGDVLRTQKTFRTWINYGGLARVYTFNT  386

Query  1338  RGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENCTFDK-ASPRNLDEIRVSTQK  1511
             R  HPDPC+R   F+M+ VSSS  DG I SVY K   +NCT+D  +SPR ++E+RV + +
Sbjct  387   RDVHPDPCQRPVTFFMEHVSSSPGDGTIKSVY-KQAYQNCTYDPISSPRKIEEVRVFSTR  445

Query  1512  LDLDSKELLAPRRHCCDVL--SSSADKALEIGIRECKEEELVYMH  1640
             LD D ++L APRR CCD+L  SS+  K LEI IRECKE+E +Y+H
Sbjct  446   LDPDIRQLKAPRRQCCDILPTSSNGGKVLEIRIRECKEDEFIYIH  490



>emb|CDY15541.1| BnaA08g28250D [Brassica napus]
Length=489

 Score =   503 bits (1295),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 256/465 (55%), Positives = 321/465 (69%), Gaps = 22/465 (5%)
 Frame = +3

Query  306   CVVYLVCTFVLV----------PSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRKR  455
             C+++ V TF++             T   +V  S     SPT+++HIVFGIASS ++W  R
Sbjct  26    CILFSVFTFLVYLLLSLSLFQSKETINAYVFSSKDQPQSPTAIDHIVFGIASSIKTWPAR  85

Query  456   KEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNPSAI  629
             +E+VKLWW    MRGCVF+DR  +    N T+S  LPP+C+S DTS FRYT   G+ SAI
Sbjct  86    REYVKLWWDAQRMRGCVFVDR-PLPSFVNHTNSPLLPPICVSEDTSRFRYTWTNGDRSAI  144

Query  630   RLARAVSEAVSLNHS---DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVV  800
             R+AR V E V + ++   +VRW+VFGDDDT+F P+NLV+TLSKY H  WYYIG SSE   
Sbjct  145   RIARCVIETVRMFNTFSEEVRWYVFGDDDTIFIPENLVRTLSKYSHTSWYYIGASSEIYY  204

Query  801   QNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTH  980
             QNS F  +MAFGG G AIS  LA  LAKVFDSC+ RYPHLYG D+RVHAC+ ELGV L+H
Sbjct  205   QNSLFGHDMAFGGGGIAISSSLANVLAKVFDSCIERYPHLYGGDSRVHACMLELGVGLSH  264

Query  981   EPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHR  1160
             EPGFHQ D+RG+  G+L +H  RPLVSLHHM   DPIFPN TT  A+ HL+ A  +DP R
Sbjct  265   EPGFHQFDVRGNALGILTSHSTRPLVSLHHMTHIDPIFPNSTTFSAVSHLFSAVELDPLR  324

Query  1161  ILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPW-RKNKKDVPYGFDS  1337
             I Q +VCYDRW SWTISVSWGYAVQI   HL L D LR Q+++  W         Y F++
Sbjct  325   IFQVSVCYDRWHSWTISVSWGYAVQIESRHLFLGDVLRTQKTFRTWINYGGLARVYTFNT  384

Query  1338  RGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENCTFDK-ASPRNLDEIRVSTQK  1511
             R  HPDPC+R   F+M+ VSSS  DG I SVY K  ++NCT+D  +SPR ++E+RV + +
Sbjct  385   RDVHPDPCQRPATFFMEHVSSSPGDGTIKSVY-KQASQNCTYDPISSPRKIEEVRVFSTR  443

Query  1512  LDLDSKELLAPRRHCCDVL--SSSADKALEIGIRECKEEELVYMH  1640
             LD D ++L APRR CCD+L  SS+  K LEI IRECKE+E +Y+H
Sbjct  444   LDPDIRQLKAPRRQCCDILPTSSNGGKVLEIRIRECKEDEFIYIH  488



>ref|XP_010240967.1| PREDICTED: uncharacterized protein LOC104585698 isoform X2 [Nelumbo 
nucifera]
Length=484

 Score =   503 bits (1294),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 255/474 (54%), Positives = 337/474 (71%), Gaps = 13/474 (3%)
 Frame = +3

Query  240   QAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHV----SVSLQDVSSPTSLE  407
             + P ++  S   K+++LI SSLC++YLV +   +  + LL +           S PTSL 
Sbjct  17    KIPGEILTSSRLKDLLLIFSSLCILYLVVSHYRI--STLLQIRHTQPYPSSSSSPPTSLS  74

Query  408   HIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHED-NGTDSLPPVCISGDT  584
             H+ F IASS +SW  R+ +V+LWW+P  MRG VFLDR        N T+SLPPV IS DT
Sbjct  75    HLAFAIASSSKSWPNRRHYVRLWWKPQLMRGYVFLDRKPPDSATTNTTESLPPVLISEDT  134

Query  585   SSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGL  764
             S F YT +GG  SAIR++R VSE V+ N SDVRWFVFGDDDTVFFP+NL KTLSKYDH  
Sbjct  135   SRFPYTYKGGLRSAIRVSRIVSEIVARNLSDVRWFVFGDDDTVFFPENLAKTLSKYDHNR  194

Query  765   WYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVH  944
             WYY+G+SSE   QNS FSFEMAFGG GFAISYPLA+ LA+V DSCL RY HLYGSD+R+ 
Sbjct  195   WYYVGSSSESFEQNSRFSFEMAFGGGGFAISYPLARVLARVMDSCLMRYSHLYGSDSRIF  254

Query  945   ACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALE  1124
             +CL+ELGV LTHE GFHQ+DIRG++FGLL+AHPL P++SLHH++  DPIFPN +  +ALE
Sbjct  255   SCLAELGVGLTHESGFHQVDIRGNLFGLLSAHPLAPIISLHHLDSVDPIFPNRSQIQALE  314

Query  1125  HLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK  1304
             HL+   ++DP RILQQTVCYD+  S T+SVSWGYAVQ+     LLPD +  Q ++ PWR+
Sbjct  315   HLFNVVNVDPARILQQTVCYDQSNSQTVSVSWGYAVQVFEGIQLLPDLILMQRTFMPWRR  374

Query  1305  --NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPR  1478
               N     + F+ R +  DPC+R ++F++  V  ++ +   S Y K T  +C   K++ +
Sbjct  375   SLNVNLSHFMFNMRVFPKDPCKRPSIFFLGNV-LTNTNVTQSNYSKDTIRSC-LKKSASQ  432

Query  1479  NLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             NL++I+V + KL+LD  +  APRRHCCD+L SS++K ++I IR+C +EE++ MH
Sbjct  433   NLEQIKVFSPKLELDYGQ--APRRHCCDILPSSSEKVMKIRIRQCLDEEIISMH  484



>gb|KFK42866.1| hypothetical protein AALP_AA1G049200 [Arabis alpina]
Length=504

 Score =   503 bits (1296),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 252/468 (54%), Positives = 329/468 (70%), Gaps = 15/468 (3%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFVLVPSTNLLHV----SVSLQDVSSPTSLEHIVFGIASSEESW  446
             N +L+   + ++YL+ +   + S + ++     S   Q  +S T ++HIVFGI SS  SW
Sbjct  37    NCILLSVFIFLIYLLVSIARLQSKDTIYADHLSSSQDQSQTSLTKIDHIVFGIGSSTRSW  96

Query  447   RKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNP  620
               R+E+VKLWW    MRGCVF+++     + N   S  LPPVC+S DTS FRYT RGG+ 
Sbjct  97    PSRREYVKLWWDAKRMRGCVFVEQPLSSSDQNYRHSYLLPPVCVSEDTSRFRYTWRGGDR  156

Query  621   SAIRLARAVSEAVSLNHS---DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSE  791
             +AIR+AR V EAV + ++   +VRW+VFGDDDT+F P+NL +TLSKYDH  WYYIG++SE
Sbjct  157   NAIRIARCVLEAVKMFNTSSKEVRWYVFGDDDTIFIPENLARTLSKYDHTSWYYIGSNSE  216

Query  792   DVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVS  971
                QNS F  +MAFGG G+ +S  LA  LA+ FDSC+ RYPHL+G D+RV+AC+ ELGV 
Sbjct  217   IYHQNSMFGHDMAFGGGGYVLSSSLANVLARNFDSCIERYPHLHGGDSRVYACVLELGVG  276

Query  972   LTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASID  1151
             L+HEPGFHQ D+RG+  G+L +H  RPLVSLHHM   DPIFPN TT  A+ HL+ A  +D
Sbjct  277   LSHEPGFHQFDVRGNALGILTSHSTRPLVSLHHMAHIDPIFPNSTTFSAVRHLFSAVEVD  336

Query  1152  PHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVP-YG  1328
             P RI Q +VCYDRW+SWTISVSWGY VQI G H+ L D L AQE++ PWRK+      Y 
Sbjct  337   PLRIFQLSVCYDRWYSWTISVSWGYTVQIEGRHMYLRDVLPAQETFRPWRKSGGLASVYT  396

Query  1329  FDSRGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENCTFDK-ASPRNLDEIRVS  1502
             F++R  H DPC+R   F+M+ VSSS  +G I SVY K   ENCTFD  +SPR ++EIRV 
Sbjct  397   FNTREIHRDPCQRPVTFFMEHVSSSRGNGTIKSVY-KQAYENCTFDPISSPRKIEEIRVF  455

Query  1503  TQKLDLDSKELLAPRRHCCDVL--SSSADKALEIGIRECKEEELVYMH  1640
             +++LD D ++L APRR CCD+L  SS+    +EIGIRECKE+EL+Y+H
Sbjct  456   SRRLDPDIRQLKAPRRQCCDILPTSSTGGNIMEIGIRECKEDELIYIH  503



>emb|CDX86577.1| BnaC08g01260D [Brassica napus]
Length=491

 Score =   503 bits (1294),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 255/466 (55%), Positives = 324/466 (70%), Gaps = 14/466 (3%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFVLVPSTNLLHVS-VSLQDVS-SPTSLEHIVFGIASSEESWRK  452
             N +L+     +VYL+ +     S + +    +S QD S SPT + HIVFG+ SS +SW  
Sbjct  27    NCILLSVFASLVYLLVSLSRFQSKDTIDAYFLSSQDQSQSPTEIYHIVFGMGSSIKSWPA  86

Query  453   RKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNPSA  626
             R+E+VKLWW    MRGCVF+DR  +    N TDS  LPP+C+S DTS FRYT R G+ +A
Sbjct  87    RREYVKLWWDAQRMRGCVFVDR-PLTSLVNDTDSHLLPPICVSEDTSRFRYTWRKGDRNA  145

Query  627   IRLARAVSEAVSLNHS---DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDV  797
             IR+AR V E V + ++   +VRW+VFGDDDT+F P+NL KTLSKYDH  WYYIG SSE  
Sbjct  146   IRIARCVLETVRMFNTSSEEVRWYVFGDDDTIFIPENLAKTLSKYDHTSWYYIGASSEIY  205

Query  798   VQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLT  977
              QNS F  +MAFGG G AIS  LA  LA+ FDSC+ RYPHLYG D+RVHAC+ ELGV L+
Sbjct  206   HQNSLFGHDMAFGGGGIAISSSLANVLAENFDSCIERYPHLYGGDSRVHACVLELGVGLS  265

Query  978   HEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPH  1157
             HEPGFHQ D+RG+  G+L +H  RPLVSLHHM   DPIFPN T   A+ HL+ A  +DP 
Sbjct  266   HEPGFHQFDVRGNALGILTSHSTRPLVSLHHMSHIDPIFPNSTILSAVRHLFSAVELDPL  325

Query  1158  RILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVP-YGFD  1334
             RI Q +VCYDRW SWTIS+SWGYAVQI   H+ + D LR Q+++ PW+ +      Y F+
Sbjct  326   RIFQVSVCYDRWHSWTISISWGYAVQIETRHMFMRDVLRTQKTFRPWKNSGGLASVYTFN  385

Query  1335  SRGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENCTFDK-ASPRNLDEIRVSTQ  1508
             +R  HPD C+R   F+M+ VSSS  DG I SVY K   +NCT+D  +SPR ++E+RV + 
Sbjct  386   TRDVHPDLCQRPVTFFMEHVSSSPGDGTIKSVY-KQAYQNCTYDSLSSPRKIEEVRVFST  444

Query  1509  KLDLDSKELLAPRRHCCDVL--SSSADKALEIGIRECKEEELVYMH  1640
             K D D ++L APRR CCD+L  SS+  K LEIGIR+CKE+EL+Y+H
Sbjct  445   KFDPDIRQLKAPRRQCCDILPTSSNGGKVLEIGIRKCKEDELIYIH  490



>ref|XP_003597036.1| Fringe-related-like protein [Medicago truncatula]
 gb|KEH39021.1| transferring glycosyl group transferase [Medicago truncatula]
Length=471

 Score =   501 bits (1291),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 261/470 (56%), Positives = 339/470 (72%), Gaps = 16/470 (3%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVV--YLVCTFVLVPSTNLLHVSVS---LQDVSS-PTSLEHIVFGI  425
             +++   ++   SS C +  ++  + +   ++ ++ +++    LQ   S PT++ H+VFGI
Sbjct  7     TKSLTKLIPFSSSFCAISLFIFISILFFTTSKIVTINIGSSLLQPTESDPTNVNHLVFGI  66

Query  426   ASSEESWRKRKEFVKLWWRPSGMRGCVFLDR---DEVKHEDNGTDSLPPVCISGDTSSFR  596
             ASS +SW  RK++ KLWW    M+GCVF+D    +E  +  N  DS+P +C+S DTS F 
Sbjct  67    ASSGKSWPNRKKYAKLWWN-KNMKGCVFVDNLPPEENDNNLNSDDSVPQICVSEDTSKFN  125

Query  597   YTCR-GGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYY  773
             YT R GG  SAIR+AR V E   LNHSDVRW+VFGDDDT+FFP+NLVKTLSKYDH LWYY
Sbjct  126   YTYRPGGLRSAIRVARVVKETAELNHSDVRWYVFGDDDTIFFPENLVKTLSKYDHRLWYY  185

Query  774   IGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACL  953
             +G  SE+   +  F F MAFGG GFA+S  LA  LAKVFDSC+ RY HLYGSDARV +C+
Sbjct  186   VGAYSENYEGSQTFGFGMAFGGGGFALSASLANVLAKVFDSCIERYSHLYGSDARVFSCI  245

Query  954   SELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLY  1133
             +ELGV LT+EPGFHQ+D+RG+VFGLLAAHPL PL+SLHH ++ D IFPNMT +K+L+HL+
Sbjct  246   AELGVGLTYEPGFHQVDLRGNVFGLLAAHPLSPLLSLHHPDITDAIFPNMTNSKSLQHLF  305

Query  1134  KAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWR-KNK  1310
             +AA +D  R+LQQTVCYDR FS TISVSWGYAVQ+  S++LLPD LR QE++ PW+ K+ 
Sbjct  306   EAAYVDSQRMLQQTVCYDRRFSRTISVSWGYAVQVFQSNVLLPDVLRVQETFKPWKEKHV  365

Query  1311  KDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDE  1490
                 Y F  R  H DPC+R  +FY+D VSS  +DGI S Y K +  NC+ DK S +NL+ 
Sbjct  366   MAGIYTFSKRELHHDPCKRPKIFYLDNVSSG-KDGIISNYTK-SFYNCSNDKTSSKNLEV  423

Query  1491  IRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             I+V T  LDLDSK+   PRR CCDVL S++ + +EI IRECK EEL+YMH
Sbjct  424   IKVVTNNLDLDSKQ--TPRRQCCDVLDSNSGQLMEIAIRECKYEELIYMH  471



>ref|XP_009118598.1| PREDICTED: uncharacterized protein LOC103843612 isoform X1 [Brassica 
rapa]
Length=487

 Score =   501 bits (1291),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 256/472 (54%), Positives = 326/472 (69%), Gaps = 17/472 (4%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVVYLVCTF---VLVPSTNLLHVSVSLQD-VSSPTSLEHIVFGIAS  431
             S    N +++   + +VYL+ +     L     +    ++ QD   S T ++HIVFGI S
Sbjct  19    SARMINCIILSILISLVYLLVSLSAPTLQSKDTIRAYFITAQDQAQSLTEIDHIVFGIGS  78

Query  432   SEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTC  605
             S + W  R+E+VKLWW    MRGCVF+DR  +   +N TDS  LPP+C+S DTS FRYT 
Sbjct  79    STKWWPTRREYVKLWWDARRMRGCVFVDR-PLSSLENHTDSHLLPPICVSEDTSRFRYTW  137

Query  606   RGGNPSAIRLARAVSEAVSLNHS---DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYI  776
             RGG+ +AIR+AR+V E V + ++   +VRW+VFG D+T+F P+NL KTLSKYDH  WYYI
Sbjct  138   RGGDRNAIRIARSVLETVRMFNTSSEEVRWYVFGYDNTMFVPENLAKTLSKYDHTSWYYI  197

Query  777   GTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLS  956
             G +SE   QNS F  +MAFGG GFA+S  LA  LAK FDSC+ RYPHLYG D+R+HAC+ 
Sbjct  198   GANSEIYHQNSKFGHDMAFGGGGFALSSSLANVLAKNFDSCIERYPHLYGGDSRIHACVL  257

Query  957   ELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYK  1136
             ELGV LTHEPGFHQ D++G+  G+LA+H  RPLVSLHH+   DPIFPN TT  A  HL+ 
Sbjct  258   ELGVRLTHEPGFHQFDVKGNALGILASHSTRPLVSLHHVPHIDPIFPNSTTFTAFRHLFS  317

Query  1137  AASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKD  1316
             A  +DP RILQ +VCYDRW+SWTISVSWGY VQI G HL L D L+ QE++ P       
Sbjct  318   AVEVDPLRILQLSVCYDRWYSWTISVSWGYTVQIEGRHLYLRDVLKTQETWKP--SGGLA  375

Query  1317  VPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRD-GITSVYRKMTTENCTFDK-ASPRNLDE  1490
               Y F++R  HPDPC+R   F+M+ VSSS  D  I SVY K   ENCT+D  +SPR L+E
Sbjct  376   SVYTFNTREVHPDPCQRPVTFFMEHVSSSPGDETIKSVY-KQAYENCTYDPISSPRKLEE  434

Query  1491  IRVSTQKLDLDSKELLAPRRHCCDVL--SSSADKALEIGIRECKEEELVYMH  1640
             IRV + +LD D ++L APRR CCD+L  SS+  K +EIGIRECKE+E +Y+H
Sbjct  435   IRVFSTRLDPDIRQLKAPRRQCCDILPTSSTGGKVMEIGIRECKEDEFIYIH  486



>ref|XP_007149951.1| hypothetical protein PHAVU_005G113100g [Phaseolus vulgaris]
 gb|ESW21945.1| hypothetical protein PHAVU_005G113100g [Phaseolus vulgaris]
Length=470

 Score =   496 bits (1277),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 258/468 (55%), Positives = 341/468 (73%), Gaps = 16/468 (3%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQ-DVSS--PTSLEHIVFGIASS  434
             +Q     +L+CSS   + L  + +L+  T ++ +  S Q DVS   PT+ +H+VFGIAS+
Sbjct  10    TQILMKFILVCSSFFAISLCVSVLLLAKTKIVELRYSPQHDVSESDPTTADHLVFGIAST  69

Query  435   EESWRKRKEFVKLWWR--PS-GMRGCVFLDRDEVKHEDNGTD--SLPPVCISGDTSSFRY  599
               SW  RK+++KLWW   P+  MRGCVF+D   + HE+N  +  SLPP+C+S DTS F Y
Sbjct  70    GTSWPSRKQYIKLWWNSIPNITMRGCVFVD--ALPHEENVNNDGSLPPLCVSQDTSQFLY  127

Query  600   TCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIG  779
             T +GG  SAIR+ R V E V+LNHS VRW+VFGDDDT+FFP NLVKTLSKYDH LWYY+G
Sbjct  128   TYKGGLRSAIRVTRVVKETVALNHSGVRWYVFGDDDTIFFPHNLVKTLSKYDHRLWYYVG  187

Query  780   TSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSE  959
             + SE       F F MAFGG GFAIS  LA+ LAKV DSC+ RYPHLYGSD+RV++C++E
Sbjct  188   SYSEIYEGTQVFGFGMAFGGGGFAISSSLAQVLAKVLDSCIQRYPHLYGSDSRVYSCITE  247

Query  960   LGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKA  1139
             LGV LTHEPGFHQ+D+RG++FGLLAAHPL PL+SLHH +  DPIFPNM+T  +L+HL++A
Sbjct  248   LGVGLTHEPGFHQVDLRGNIFGLLAAHPLTPLLSLHHPDHTDPIFPNMSTKTSLQHLFEA  307

Query  1140  ASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWR-KNKKD  1316
               +D  RIL+QTVCY++  SWTISVSWGYAV++  +++LLP+ LR + ++  W   N   
Sbjct  308   VHVDSERILEQTVCYEKQLSWTISVSWGYAVEVFQNNMLLPEVLRVERTFRQWLVGNVLR  367

Query  1317  VPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIR  1496
               Y F++R  HPDPC+R T+FY+D+VSS  +DGI S Y++   +NC+++ AS   L+ I+
Sbjct  368   GIYNFNTREVHPDPCKRGTIFYLDKVSSG-KDGIISSYKR-DFQNCSYE-ASMSKLEVIK  424

Query  1497  VSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             V T KL LD+K+   PRRHCCDVL S+A   +EI IREC  EEL+YM+
Sbjct  425   VVTNKLHLDNKQ--TPRRHCCDVLPSNAGNMMEIAIRECNYEELIYMN  470



>emb|CDY59796.1| BnaAnng16280D [Brassica napus]
Length=488

 Score =   496 bits (1277),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 256/473 (54%), Positives = 325/473 (69%), Gaps = 18/473 (4%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVVYLVCTF---VLVPSTNLLHVSVSLQD-VSSPTSLEHIVFGIAS  431
             S    N +++   + +VYL+ +     L     +    +S QD   S T ++HIVFGI S
Sbjct  19    SARMINCIILSILISLVYLLVSLSVPTLQSKDTIRAYFISAQDQAQSLTEIDHIVFGIGS  78

Query  432   SEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTC  605
             S + W  R+E+VKLWW    MRGCVF+DR  +   +N TDS  LPP+C+S DTS FRYT 
Sbjct  79    STKWWPTRREYVKLWWDARRMRGCVFVDR-PLSSLENHTDSHLLPPICVSEDTSRFRYTW  137

Query  606   RGGNPSAIRLARAVSEAVSLNHSD---VRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYI  776
             RGG+ +AIR+AR+V E V + ++    V+W+VFG D+T+F P+NL KTLSKYDH  WYYI
Sbjct  138   RGGDRNAIRIARSVLETVRMFNTSSEKVKWYVFGYDNTMFVPENLAKTLSKYDHTSWYYI  197

Query  777   GTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLS  956
             G +SE   QNS F  +MAFGG GFA+S  LA  LAK FDSC+ RYPHLYG D+R+HAC+ 
Sbjct  198   GANSEIYHQNSKFGHDMAFGGGGFALSSSLANVLAKNFDSCIERYPHLYGGDSRIHACVL  257

Query  957   ELGVSLTHEPGFH-QMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLY  1133
             ELGV LTHEPGFH Q D++G+  G+LA+H  RPLVSLHH+   DPIFPN TT  A  HL+
Sbjct  258   ELGVGLTHEPGFHQQFDVKGNALGILASHSTRPLVSLHHVPHIDPIFPNSTTFTAFRHLF  317

Query  1134  KAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK  1313
              A  +DP RILQ +VCYDRW+SWTISVSWGY VQI G HL L D L+ QE++ P      
Sbjct  318   SAVEVDPLRILQLSVCYDRWYSWTISVSWGYTVQIEGRHLYLRDVLKTQETWKP--SGGL  375

Query  1314  DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRD-GITSVYRKMTTENCTFDK-ASPRNLD  1487
                Y F++R  HPDPC+R   F+M+ VSSS  D  I SVY K   ENCT+D  +SPR L+
Sbjct  376   ASVYTFNTREVHPDPCQRPVTFFMEHVSSSPGDETIKSVY-KQAYENCTYDPISSPRKLE  434

Query  1488  EIRVSTQKLDLDSKELLAPRRHCCDVL--SSSADKALEIGIRECKEEELVYMH  1640
             EIRV + +LD D ++L APRR CCD+L  SS+  K +EIGIRECKE+E +Y+H
Sbjct  435   EIRVFSTRLDPDIRQLKAPRRQCCDILPTSSTGGKVMEIGIRECKEDEFIYIH  487



>emb|CDY46851.1| BnaA10g03350D [Brassica napus]
Length=492

 Score =   496 bits (1277),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 252/473 (53%), Positives = 324/473 (68%), Gaps = 16/473 (3%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVVYLVCTF---VLVPSTNL-LHVSVSLQDVSSPTSLEHIVFGIAS  431
             S    N +L+   +  VYL+ +    +L P   +  + S S     S T ++HIVFGI S
Sbjct  21    STRMMNCILLSVLISFVYLIVSLSVSMLQPKDTINAYFSSSQDQPQSLTEIDHIVFGIGS  80

Query  432   SEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTC  605
             S  SW  R+++VKLWW    MRGCVF+D   +   +N TDS  LPP+C+S DTS FRYT 
Sbjct  81    SLNSWPARRDYVKLWWDTQRMRGCVFVD-SPLSSLENNTDSHLLPPICVSEDTSRFRYTW  139

Query  606   RGGNPSAIRLARAVSEAVSL-NHS--DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYI  776
              GG+ +AIR+AR V E V + N+S  +VRW+VFGDDDT+F P+NL +TLSKYDH LWYYI
Sbjct  140   AGGDRNAIRIARCVLETVRMFNNSAEEVRWYVFGDDDTIFIPENLARTLSKYDHMLWYYI  199

Query  777   GTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLS  956
             G +SE   QN  F  +MAFGG G A+S  LA  LAK FDSC+ RYPHLYG DAR+HAC+ 
Sbjct  200   GATSEIYHQNWLFGDDMAFGGGGVALSSSLANVLAKNFDSCIERYPHLYGGDARIHACVL  259

Query  957   ELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYK  1136
             ELGV L+HEPGFHQ D+ G+  G+L +H  RPLVSLHHM   DP+FPN TT  A++HL+ 
Sbjct  260   ELGVGLSHEPGFHQFDVNGNALGILTSHSTRPLVSLHHMSHIDPLFPNSTTFSAIQHLFS  319

Query  1137  AASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK-NKK  1313
             A  +DP RI Q +VCYDR +SWTISVSWGY VQI   H+ L D LR QE++ PW+     
Sbjct  320   AVELDPLRIFQLSVCYDRRYSWTISVSWGYTVQIESRHMFLRDVLRTQETFRPWQNFGGL  379

Query  1314  DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENCTFDK-ASPRNLD  1487
                Y F++R ++PDPC+R   F+M+ VSS+  DG I SVY K   ENCT+D  +SPR  +
Sbjct  380   ASVYTFNTREFNPDPCKRPVTFFMEHVSSTPDDGTIKSVY-KQAYENCTYDPISSPRKTE  438

Query  1488  EIRVSTQKLDLDSKELLAPRRHCCDVL--SSSADKALEIGIRECKEEELVYMH  1640
             E+RV + + D D ++L APRR CCD+L  SS+  K +EIGIRECKE+EL+YM+
Sbjct  439   EVRVFSTRFDPDIRKLKAPRRQCCDILPTSSTDGKVMEIGIRECKEDELIYMN  491



>gb|KHN41198.1| hypothetical protein glysoja_017242 [Glycine soja]
Length=386

 Score =   490 bits (1261),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 249/390 (64%), Positives = 306/390 (78%), Gaps = 11/390 (3%)
 Frame = +3

Query  492   MRGCVFLDRDEVKHEDNGTD----SLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAV  659
             M+GCVFLD   +  EDNG +    SLPP+C+S DTS FR+T +GG  SAIR+AR V E V
Sbjct  1     MKGCVFLD--SLSDEDNGRNENDTSLPPLCVSQDTSRFRFTHKGGLRSAIRVARVVGETV  58

Query  660   SL-NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFG  836
             ++ N S+VRW+VFGDDDTVFFP+N+VK LSKYDH LWYYIG  SE   QN  F F MAFG
Sbjct  59    AMYNDSEVRWYVFGDDDTVFFPENVVKMLSKYDHELWYYIGAHSEVYEQNRVFGFGMAFG  118

Query  837   GAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGD  1016
             GAGFAIS  LAK LAKVFDSC+ RYPHLYGSD RV++CL+ELGV LTHEPGFHQ+D++G+
Sbjct  119   GAGFAISSSLAKVLAKVFDSCIERYPHLYGSDGRVYSCLAELGVGLTHEPGFHQVDLKGN  178

Query  1017  VFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWF  1196
              FG+LAAHPL PL+SLHH +  DPIFPNMTT +AL+HL++AA++D  R+LQQ +CYDRWF
Sbjct  179   TFGILAAHPLTPLLSLHHPDYTDPIFPNMTTKQALKHLFEAANVDSQRMLQQAICYDRWF  238

Query  1197  SWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK-NKKDVPYGFDSRGYHPDPCRRQT  1373
             SWT+SVSWGYAVQ+  +H+LLPD L+ QE++  WRK N     Y F++R  HPDPC+R T
Sbjct  239   SWTVSVSWGYAVQVFPNHMLLPDVLKVQETFKQWRKGNMLAKSYTFNTRELHPDPCKRST  298

Query  1374  VFYMDRVSSSHRDGITSVYRKMTTENCTF-DKASPRNLDEIRVSTQKLDLDSKELLAPRR  1550
             VF++D VSS  +DGI S Y+K + +NC+  D  SP+ L+ I+V T KLDLD K+L APRR
Sbjct  299   VFFLDNVSSG-KDGIISSYKK-SFQNCSIDDDVSPKKLEVIKVVTNKLDLDIKQLRAPRR  356

Query  1551  HCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             HCCDVL S+A   +EI IRECK+EELVYMH
Sbjct  357   HCCDVLPSTARDQMEIAIRECKDEELVYMH  386



>ref|XP_004507234.1| PREDICTED: uncharacterized protein LOC101512759 [Cicer arietinum]
Length=381

 Score =   484 bits (1245),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 230/385 (60%), Positives = 290/385 (75%), Gaps = 6/385 (2%)
 Frame = +3

Query  492   MRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNH  671
             M+GCVF+D   + +ED+ + SLPP+C+S DT  F+YTC+GG  SAIR+AR V E V+LNH
Sbjct  1     MKGCVFMD--SISNEDDPS-SLPPLCLSRDTLRFQYTCKGGLRSAIRVARVVVETVALNH  57

Query  672   SDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFA  851
             S+VRW+VFGDDDT+F P+NLVKTLSKYDH LWYYIG  SE   QN  F F MAF GAGFA
Sbjct  58    SNVRWYVFGDDDTIFLPENLVKTLSKYDHELWYYIGAHSEIYEQNRLFGFGMAFDGAGFA  117

Query  852   ISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLL  1031
             IS  LA  LAKVFDSCL RY HLYGSD RV++CL+ELGV L H P FHQ+D+ G++FGLL
Sbjct  118   ISSSLANVLAKVFDSCLERYHHLYGSDGRVYSCLAELGVGLIHVPAFHQVDLTGNIFGLL  177

Query  1032  AAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTIS  1211
             AAHP+ PL+SLHH +  DPIFPNMTTT+AL+HL+KA ++   R+LQQT+CY++WFSWTIS
Sbjct  178   AAHPVTPLLSLHHPDFTDPIFPNMTTTQALQHLFKAVNVGSQRMLQQTICYEKWFSWTIS  237

Query  1212  VSWGYAVQIHGSH-LLLPDALRAQESYSPWRK-NKKDVPYGFDSRGYHPDPCRRQTVFYM  1385
             VSWGYAVQ+  SH + LPD +  QE++  W++ N     Y F++R  H DPC+R T+FY 
Sbjct  238   VSWGYAVQVFPSHNMFLPDVVNVQETFKQWKQGNVWAKTYTFNTRPLHHDPCKRSTIFYS  297

Query  1386  DRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDV  1565
             D +S    DG+   Y   + +NC+ +  S   L+ I+V T KLDLD K+L APRR CCDV
Sbjct  298   DNMSFG-EDGMIKSYYNKSFQNCSKELGSLNKLEVIKVFTNKLDLDIKQLQAPRRQCCDV  356

Query  1566  LSSSADKALEIGIRECKEEELVYMH  1640
             L SSA   LEIG+RECK++EL++MH
Sbjct  357   LPSSASDQLEIGVRECKDKELIFMH  381



>ref|XP_007149950.1| hypothetical protein PHAVU_005G113000g [Phaseolus vulgaris]
 gb|ESW21944.1| hypothetical protein PHAVU_005G113000g [Phaseolus vulgaris]
Length=472

 Score =   486 bits (1252),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 256/474 (54%), Positives = 344/474 (73%), Gaps = 20/474 (4%)
 Frame = +3

Query  249   VKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSV--SLQDVSS--PTSLEHIV  416
             +K KP+      +L+ S  CV+ L  + +L+  T ++  S+     DVS   PT+++H+V
Sbjct  9     IKTKPT--LMKFILVSSLFCVISLCVSVLLLAKTKVIMNSLYSPQHDVSQSDPTTVDHLV  66

Query  417   FGIASSEESWRKRKEFVKLWWR--PS-GMRGCVFLDRDEVKHEDNGTD--SLPPVCISGD  581
             FGIAS+  SW  RK++ KLWW   P+  MRGCVF+D   + HE+N ++  SLPP+C+S +
Sbjct  67    FGIASTGTSWPWRKQYTKLWWNSIPNITMRGCVFVD--ALPHEENVSNDGSLPPLCVSQN  124

Query  582   TSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHG  761
             TS F YT + G PSAIR+AR V E V+LNHS VRW+VFGDDDT+FFP NL+KTLSKYDH 
Sbjct  125   TSQFLYTYKHGLPSAIRVARVVKETVALNHSGVRWYVFGDDDTIFFPQNLLKTLSKYDHR  184

Query  762   LWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARV  941
             LWYY+G++SE       F F MAFGG GFAIS+ LA+ LAKV DSC+ RYPHLYGSD+RV
Sbjct  185   LWYYVGSNSEIYEGTQVFGFGMAFGGGGFAISFSLAQVLAKVLDSCIQRYPHLYGSDSRV  244

Query  942   HACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKAL  1121
             ++C++ELGV LTHEPGFHQ+D+RG++FGLLAAHPL  L+SLHH +  DPIFPNM++  +L
Sbjct  245   YSCITELGVGLTHEPGFHQVDLRGNIFGLLAAHPLTSLLSLHHPDHTDPIFPNMSSITSL  304

Query  1122  EHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWR  1301
             +HL++A  +DP RILQQTVCY++  SWTISVSWGYAV++   ++ LP+ LR   ++  W 
Sbjct  305   QHLFEAVHVDPERILQQTVCYEKQLSWTISVSWGYAVEVFQHNMFLPEVLRVGRTFRQWL  364

Query  1302  K-NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPR  1478
               N     Y F++R  HPDPC+R T+FY+D+VSS  +DGI S Y++   +NC+++ AS  
Sbjct  365   PGNVLRGIYNFNTREVHPDPCKRGTIFYLDKVSSG-KDGIMSSYKR-DFQNCSYE-ASMS  421

Query  1479  NLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              L+ I+V T KL+ D+K+   PRRHCCDVL S+A   +EI IREC  EEL+YM+
Sbjct  422   KLEVIKVVTNKLN-DNKQ--TPRRHCCDVLPSNAGNLMEIAIRECNFEELIYMN  472



>emb|CDY46850.1| BnaA10g03340D [Brassica napus]
Length=491

 Score =   485 bits (1248),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 246/472 (52%), Positives = 318/472 (67%), Gaps = 15/472 (3%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVVYLVCTF---VLVPSTNLLHVSVSLQDV-SSPTSLEHIVFGIAS  431
             S    N +L+      VYL+ +    +L    N+     S QD   S T ++HIVFGI S
Sbjct  21    STRMMNCMLLSVLFSFVYLLASLSISMLQSKDNINSYFSSSQDQPQSLTEIDHIVFGIGS  80

Query  432   SEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTC  605
             S  SW  R+++VKLWW    MRGCVF+D+     E+N TDS  LPP+C+S DTS FRYTC
Sbjct  81    SLNSWPARRDYVKLWWDTQRMRGCVFVDQPLSALENN-TDSHLLPPICVSEDTSRFRYTC  139

Query  606   RGGNPSAIRLARAVSEAVSLNHS---DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYI  776
              GG+  AIR+AR V E V + ++   +VRW+VFGDDDT+F P NL +TLSKYDH  WYYI
Sbjct  140   AGGDRRAIRIARCVLETVRMFNTSAHEVRWYVFGDDDTIFIPKNLARTLSKYDHRSWYYI  199

Query  777   GTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLS  956
             G +SE    N  F  +MAFGG G A+S  LA  LAK+FDSC+ RYP+LYG D+R+HAC+ 
Sbjct  200   GAASEIYESNRVFGNDMAFGGGGIALSSSLANVLAKIFDSCIERYPYLYGGDSRIHACVL  259

Query  957   ELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYK  1136
             ELGV L+HEPGFHQ D+ G+  G+L +H  RPLVSLHHM   DP+FPN TT  A++HL+ 
Sbjct  260   ELGVGLSHEPGFHQFDLNGNALGILTSHSTRPLVSLHHMSHLDPLFPNSTTFSAVQHLFS  319

Query  1137  AASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK-NKK  1313
             A  +DP RILQ +VCYDR +SWTISVSWGY VQI   H+ + D LR Q+++ PW+     
Sbjct  320   AVELDPLRILQLSVCYDRRYSWTISVSWGYTVQIESRHMFVRDVLRTQQTFRPWQNFGGL  379

Query  1314  DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENCTFD-KASPRNLD  1487
                Y F++R ++PDPC+R   F+M+ VSS   DG I SVY K   ENCT+D  +SPR ++
Sbjct  380   ASVYTFNTREFNPDPCKRPVTFFMEYVSSHPGDGTIKSVY-KQAYENCTYDPTSSPRKIE  438

Query  1488  EIRVSTQKLDLDSKELLAPRRHCCDVLSSSAD-KALEIGIRECKEEELVYMH  1640
             EIRV + +LD   + L APRR CCD+L +S + K +EI IRECKE+E +YM 
Sbjct  439   EIRVFSTRLDPHIRHLKAPRRQCCDILHNSTEGKVMEIAIRECKEDEFIYMQ  490



>emb|CAN76207.1| hypothetical protein VITISV_043112 [Vitis vinifera]
Length=1587

 Score =   515 bits (1327),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 259/440 (59%), Positives = 313/440 (71%), Gaps = 42/440 (10%)
 Frame = +3

Query  273   FKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRK  452
             F NI LI SS C +YL+    L+ ++ + ++ VS Q VS+PTSLEH+VFGIAS+++SW +
Sbjct  553   FINIFLISSSFCTIYLLVLLYLIHASEVANIPVSSQGVSAPTSLEHLVFGIASNQDSWLE  612

Query  453   RKEFVKLWWRPSGMRGCVFLDR---DEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPS  623
             +K +VK WW+P  MRGCVF+D    +E  + DN   SLPPVCIS DTS FRYT R G PS
Sbjct  613   KKNYVKHWWKPQQMRGCVFVDSMPGNESSYNDNS--SLPPVCISEDTSRFRYTYRHGLPS  670

Query  624   AIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQ  803
             AIR+A  VSE V+LNHS VRWFVFGDDDT+FFP+NLVKTLSKYDH LWYYIGT+SE   Q
Sbjct  671   AIRVAHVVSETVALNHSGVRWFVFGDDDTIFFPENLVKTLSKYDHELWYYIGTNSEIYEQ  730

Query  804   NSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHE  983
             N  FSF+MAFGGAGFAISYPLAK LAKVFDSCL RYPHLYGSD+RV+ CL+ELGV LT E
Sbjct  731   NRVFSFDMAFGGAGFAISYPLAKVLAKVFDSCLERYPHLYGSDSRVYTCLAELGVGLTRE  790

Query  984   PGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRI  1163
             PGFHQ+D+RGD FGLLAAHPL PLVS HH++  DPIFPNMT  +A+EHL++A  +D  R+
Sbjct  791   PGFHQVDVRGDTFGLLAAHPLAPLVSFHHLDHIDPIFPNMTANQAIEHLFEAVKVDSERV  850

Query  1164  LQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRG  1343
             LQQTVCYDRWFSWTISVSWGYAVQ+  +H  LPD LRA +++  W+K             
Sbjct  851   LQQTVCYDRWFSWTISVSWGYAVQVFENHQFLPDVLRAHKTFRQWKKG------------  898

Query  1344  YHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLD  1523
                                   +GI S YR+ T++NC    ASP+ L+EI+V + KLDL 
Sbjct  899   ----------------------NGIESSYRRDTSDNCNLHMASPKRLEEIKVFSHKLDLK  936

Query  1524  SKE---LLAPRRHCCDVLSS  1574
              K+   L   R H C V  S
Sbjct  937   IKQIDILGEFRNHTCGVCQS  956


 Score =   422 bits (1084),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 214/382 (56%), Positives = 279/382 (73%), Gaps = 8/382 (2%)
 Frame = +3

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             PTS  H++F IASS  S  +R  +++LW   +  R  +FLD            +LPP+ +
Sbjct  44    PTSSHHLLFSIASSAGSLGRRAPYLRLW--SNSARAILFLDSPPPPDPSFA--ALPPIVL  99

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDTS F YT R G PSA+R+AR + EAV  N SD+RWFVFGDDDTVFF DNLV+TLSKY
Sbjct  100   SGDTSRFPYTFRRGLPSAVRVARIIKEAVDRNESDIRWFVFGDDDTVFFVDNLVRTLSKY  159

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  W+YIG+SSE   QN   SF+MAFGG GFA+S+ LA+ALA VFDSCL RYPHL+GSD
Sbjct  160   DHDQWFYIGSSSESYEQNESNSFDMAFGGGGFALSHSLARALAGVFDSCLMRYPHLFGSD  219

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
             AR+ +CL+ELGV LTHEPGFHQ+DIRG++FG+L+AHPL PLVSLHH++  DPIFPNM  T
Sbjct  220   ARIFSCLAELGVGLTHEPGFHQVDIRGNLFGMLSAHPLSPLVSLHHLDSVDPIFPNMNRT  279

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +ALEHL++A +IDP RILQQT+CYDR  S TISV+WG+++Q+   +LLLPD L  Q +++
Sbjct  280   QALEHLFEAVNIDPARILQQTICYDRLSSLTISVAWGFSIQVFKGNLLLPDLLPLQRTFT  339

Query  1293  PWR--KNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDK  1466
             PWR  +N     Y F++R Y  DPC+R  VF++  V S+H DG+ S Y +    NC    
Sbjct  340   PWRRGRNISLSRYMFNTREYPKDPCKRPVVFFLQXVGSNH-DGVWSNYTRHAVGNCG-QT  397

Query  1467  ASPRNLDEIRVSTQKLDLDSKE  1532
              + +NL++IRV +QKL+L+ ++
Sbjct  398   GAIKNLEQIRVLSQKLELNIEQ  419



>emb|CDY49520.1| BnaC05g03320D [Brassica napus]
Length=491

 Score =   484 bits (1245),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 241/467 (52%), Positives = 318/467 (68%), Gaps = 15/467 (3%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFV--LVPSTNLL--HVSVSLQDVSSPTSLEHIVFGIASSEESW  446
             N +L+      VYL+ +    ++ S + +  + S S     S T ++HIVFGI SS  SW
Sbjct  26    NCILLSVLFSFVYLLASLSVSMLQSKDTINSYFSSSQDQPQSLTEIDHIVFGIGSSLNSW  85

Query  447   RKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNP  620
               R+++VKLWW    MRGCVF+D+  +   +N TDS  LPP+C+S DTS FRYTC GG+ 
Sbjct  86    PARRDYVKLWWDTQRMRGCVFVDQ-ALSALENNTDSHLLPPICVSEDTSRFRYTCAGGDR  144

Query  621   SAIRLARAVSEAVSLNHS---DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSE  791
              AIR+AR V E V + ++   +VRW+VFGDDDT+F P+NL +TLSKYDH  WYYIG +SE
Sbjct  145   RAIRIARCVLETVRMFNTSAHEVRWYVFGDDDTIFIPENLARTLSKYDHRSWYYIGAASE  204

Query  792   DVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVS  971
                 N  F  +MAFGG G A+S  LA  LAK FDSC+ RYP+LYG D+R+HAC+ ELGV 
Sbjct  205   IYESNRVFGNDMAFGGGGIALSSSLANVLAKNFDSCIERYPYLYGGDSRIHACVLELGVG  264

Query  972   LTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASID  1151
             L+HEPGFHQ D+ G+  G+L +H  RPLVSLH M   DP+FPN TT   ++HL+ A  +D
Sbjct  265   LSHEPGFHQFDLNGNALGILTSHSTRPLVSLHQMSHLDPLFPNSTTFSTVQHLFSAVELD  324

Query  1152  PHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK-NKKDVPYG  1328
             P RILQ +VCYDR +SWTISVSWGY VQI   H+ + D LR Q+++ PW+        Y 
Sbjct  325   PLRILQLSVCYDRRYSWTISVSWGYTVQIESRHMFVRDVLRTQQTFRPWQNFGGLASVYT  384

Query  1329  FDSRGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENCTFDK-ASPRNLDEIRVS  1502
             F++R ++PDPC+R   F+M+ VSS   DG I SVY K   ENCT+D  +SPR ++EIRV 
Sbjct  385   FNTREFNPDPCKRPVTFFMEYVSSDPGDGTIKSVY-KQAYENCTYDPISSPRKIEEIRVF  443

Query  1503  TQKLDLDSKELLAPRRHCCDVLSSSAD-KALEIGIRECKEEELVYMH  1640
             + +LD D ++L APRR CCD+L +S + K +EI IRECKE+E +YM 
Sbjct  444   STRLDPDIRQLKAPRRQCCDILHNSTEGKVMEIAIRECKEDEFIYMQ  490



>ref|XP_006594880.1| PREDICTED: uncharacterized protein LOC100780472 [Glycine max]
Length=479

 Score =   481 bits (1237),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 259/459 (56%), Positives = 334/459 (73%), Gaps = 21/459 (5%)
 Frame = +3

Query  300   SLCVVYLVC--TFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKL  473
             SLCV  L+   T ++V  ++ L   + + +    T+ +H+VFGIAS+  +W +RK + KL
Sbjct  28    SLCVSMLLLAKTKLVVDMSSSLQSLLRVSESDPTTTADHLVFGIASTGTAWNRRKVYTKL  87

Query  474   WW--RP-SGMRGCVFLDRDEVKHEDNGTD----SLPPVCISGDTSSFRYTCRGGNPSAIR  632
             WW  +P + MRGCVF+D   + HE+N  +    SLPP+C+S DTS F YT + G  SAIR
Sbjct  88    WWNRKPYNTMRGCVFVD--TLPHEENANNNNDGSLPPLCVSEDTSQFPYTYKNGQRSAIR  145

Query  633   LARAVSEAVSL-NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNS  809
             +AR V E V+L NHS VRW+VFGDDDT+FFP NLVKTLSKYDH LWYY+G+SSE      
Sbjct  146   VARVVKETVALLNHSGVRWYVFGDDDTIFFPQNLVKTLSKYDHRLWYYVGSSSEIYDGAQ  205

Query  810   FFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPG  989
              F F MAFGG GFAIS  LA  LAKV DSC+ RYPHLYGSD+RV++C++ELGV LTHEPG
Sbjct  206   VFGFGMAFGGGGFAISSSLAHVLAKVLDSCIQRYPHLYGSDSRVYSCITELGVGLTHEPG  265

Query  990   FHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQ  1169
             FHQ+D+RG++FGLLAAHPL PLVSLHH E  DPIFPNMTTT++L+HL++A ++D  R+LQ
Sbjct  266   FHQVDLRGNIFGLLAAHPLTPLVSLHHPEFTDPIFPNMTTTQSLQHLFEAVNVDSERMLQ  325

Query  1170  QTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNK--KDVPYGFDSRG  1343
             QTVCY+R  SWTISVSWGYAVQ+  +++LLPD LR Q+++  W      K + Y F+ R 
Sbjct  326   QTVCYERSLSWTISVSWGYAVQVFQNNMLLPDVLRVQKTFQQWLWGDVLKGI-YNFNIRE  384

Query  1344  YHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLD  1523
              HPDPC R T+FY+D+V S  +DGI S YRK   +NC++ K   + L+ I+V + KL LD
Sbjct  385   LHPDPCERPTIFYLDKVFSG-KDGIASSYRKH-FQNCSY-KEPMKKLEVIKVVSNKLYLD  441

Query  1524  SKELLAPRRHCCDVL-SSSADKALEIGIRECKEEELVYM  1637
             +K+    RRHCCDVL S++A   +EI IRECK EEL+YM
Sbjct  442   NKQ--TTRRHCCDVLPSNNAGDLMEIAIRECKYEELIYM  478



>ref|XP_009119171.1| PREDICTED: uncharacterized protein LOC103844151 [Brassica rapa]
Length=491

 Score =   480 bits (1236),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 241/471 (51%), Positives = 313/471 (66%), Gaps = 13/471 (3%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVVYLVCTF---VLVPSTNLLHVSVSLQDV-SSPTSLEHIVFGIAS  431
             S    N +L+      VYL+ +    +L    N+     S QD   S T ++HIVFGI S
Sbjct  21    STRMMNCMLLSVLFSFVYLLASLSISMLQSKDNINSYFSSSQDQPQSLTEIDHIVFGIGS  80

Query  432   SEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTC  605
             S  SW  R+++VKLWW    MRGCVF+D+     E+N TDS  L P+C+S DTS FRYTC
Sbjct  81    SLNSWPARRDYVKLWWDTQRMRGCVFVDQPLSALENN-TDSHLLHPICVSEDTSRFRYTC  139

Query  606   RGGNPSAIRLARAVSEAVSLNHS---DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYI  776
              GG+  AIR+AR V E V + ++   +VRW+VFGDDDT+F P NL +TLSKYDH  WYYI
Sbjct  140   AGGDRRAIRIARCVLETVRMFNTSAHEVRWYVFGDDDTIFIPKNLARTLSKYDHRSWYYI  199

Query  777   GTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLS  956
             G +SE    N  F  +MAFGG G A+S  LA  LAK FDSC+ RYP+LYG D+R+HAC+ 
Sbjct  200   GAASEIYESNRVFGNDMAFGGGGIALSSSLANVLAKNFDSCIERYPYLYGGDSRIHACVL  259

Query  957   ELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYK  1136
             ELGV L+HEPGFHQ D+ G+  G+L +H  RPLVSLHHM   DP+FPN TT  A++HL+ 
Sbjct  260   ELGVGLSHEPGFHQFDLNGNALGILTSHSTRPLVSLHHMSHLDPLFPNSTTFSAVQHLFS  319

Query  1137  AASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK-NKK  1313
             A  +DP RILQ +VCYDR +SWTISVSWGY VQI   H+ + D LR Q+++ PW+     
Sbjct  320   AVELDPLRILQLSVCYDRRYSWTISVSWGYTVQIESRHMFVRDVLRTQQTFRPWQNFGGL  379

Query  1314  DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFD-KASPRNLDE  1490
                Y F++R ++PDPC+R   F+M+ VSS   DG      K   ENCT+D  +SPR ++E
Sbjct  380   ASVYTFNTREFNPDPCKRPVTFFMEYVSSHPGDGTMKSVYKQAYENCTYDPTSSPRKIEE  439

Query  1491  IRVSTQKLDLDSKELLAPRRHCCDVLSSSAD-KALEIGIRECKEEELVYMH  1640
             IRV + +LD   ++L APRR CCD+L +S + K +EI IRECKE+E +YM 
Sbjct  440   IRVFSTRLDPHIRQLKAPRRQCCDILHNSTEGKVMEIAIRECKEDEFIYMQ  490



>gb|KHN36557.1| hypothetical protein glysoja_001288 [Glycine soja]
Length=435

 Score =   476 bits (1226),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 251/425 (59%), Positives = 319/425 (75%), Gaps = 19/425 (4%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWW--RP-SGMRGCVFLDRDEVKHEDNGTD----S  554
             T+++H+VFGIAS+  +W +RK + KLWW  +P + MRGCVF+D   + H +N  +    S
Sbjct  18    TTVDHLVFGIASTGTAWNRRKVYTKLWWNRKPYNTMRGCVFVD--TLPHAENANNNNDGS  75

Query  555   LPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSL-NHSDVRWFVFGDDDTVFFPDNL  731
             LPP+C+S DTS F YT + G  SAIR+AR V E V+L NHS VRW+VFGDDDT+FFP NL
Sbjct  76    LPPLCVSEDTSQFPYTYKNGQRSAIRVARVVKETVALLNHSGVRWYVFGDDDTIFFPQNL  135

Query  732   VKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRY  911
             VKTLSKYDH LWYY+G+SSE       F F MAFGG GFAIS  LA  LAKV DSC+ RY
Sbjct  136   VKTLSKYDHRLWYYVGSSSEIYDGAQVFGFGMAFGGGGFAISSSLAHVLAKVLDSCIQRY  195

Query  912   PHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPI  1091
             PHLYGSD+RV++C++ELGV LTHEPGFHQ+D+RG++FGLLAAHPL PLVSLHH E  DPI
Sbjct  196   PHLYGSDSRVYSCITELGVGLTHEPGFHQVDLRGNIFGLLAAHPLTPLVSLHHPEFTDPI  255

Query  1092  FPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDAL  1271
             FPNMTTT++L+HL++A ++D  R+LQQTVCY+R  SWTISVSWGYAVQ+  +++LLPD L
Sbjct  256   FPNMTTTQSLQHLFEAVNVDSERMLQQTVCYERSLSWTISVSWGYAVQVFQNNMLLPDVL  315

Query  1272  RAQESYSPWRKNK--KDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTT  1445
             R Q+++  W      K + Y F+ R  HPDPC R T+FY+D+V S  +DGITS YRK   
Sbjct  316   RVQKTFQQWLWGDVLKGI-YNFNIRELHPDPCERPTIFYLDKVFSG-KDGITSSYRKH-F  372

Query  1446  ENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVL-SSSADKALEIGIRECKEE  1622
             +NC++ K   + L+ I+V + KL LD+K+    RRHCCDVL S++A   +EI IRECK E
Sbjct  373   QNCSY-KEPMKKLEVIKVVSNKLYLDNKQ--TTRRHCCDVLPSNNAGDLMEIAIRECKYE  429

Query  1623  ELVYM  1637
             EL+YM
Sbjct  430   ELIYM  434



>ref|XP_009342266.1| PREDICTED: uncharacterized protein LOC103934254 [Pyrus x bretschneideri]
 ref|XP_009342267.1| PREDICTED: uncharacterized protein LOC103934254 [Pyrus x bretschneideri]
Length=486

 Score =   475 bits (1223),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 244/460 (53%), Positives = 322/460 (70%), Gaps = 16/460 (3%)
 Frame = +3

Query  273   FKNIVLICSSLCVVYLVCTFVL-VPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWR  449
             F  ++LI S    VY +  F L  P T L   +      SSPT+  HIVF I SS  S  
Sbjct  38    FSALLLIRSVFLNVYFLFFFFLHAPPTVLSRYT------SSPTTRRHIVFAIVSSSRSGA  91

Query  450   KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAI  629
             +R+ +++LW  P+  R   FLDR     + +G  S+  V +SGDTS F YT +GG  SAI
Sbjct  92    RREPYLRLWCSPASTRVFAFLDRAPT--DPSGDRSVATVVVSGDTSRFPYTLKGGLRSAI  149

Query  630   RLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNS  809
             RLARAV E V     +VRWFVFGDDDTVFF +NLV+TLSKYDH  W+Y+G++SE   QN+
Sbjct  150   RLARAVKEVVDRGEPNVRWFVFGDDDTVFFVENLVRTLSKYDHDRWFYVGSNSESYQQNA  209

Query  810   FFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPG  989
              +SFEMAFGG GFAIS+ LA ALA+VFDSCL RY HLYGSDARV AC++ELGV LTHEPG
Sbjct  210   KYSFEMAFGGGGFAISHSLATALARVFDSCLMRYGHLYGSDARVFACVAELGVGLTHEPG  269

Query  990   FHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQ  1169
             FHQ+D+RG++FG+L+AHPL PLVSLHH+E  DPIFPNM  T+ALEHL++A ++DP RILQ
Sbjct  270   FHQVDMRGNLFGMLSAHPLSPLVSLHHLEAADPIFPNMNKTQALEHLFEAVNVDPARILQ  329

Query  1170  QTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNK--KDVPYGFDSRG  1343
             QTVCYD   S T+SV+WGYA+Q++  + LL D L  Q+++ PWR++   +   + F+ R 
Sbjct  330   QTVCYDSSHSLTVSVAWGYAIQVYAGNELLSDLLSLQKTFMPWRRSGSIEASQFMFNMRD  389

Query  1344  YHPDPCRRQTVFYMDR-VSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDL  1520
                D C+R TVF+++  VS+SH  G +S Y ++  ENC+   A  +NL++IRV +QKL+L
Sbjct  390   NPRDKCKRPTVFFLESVVSNSH--GSSSNYTRLNVENCSKADAI-KNLEQIRVFSQKLEL  446

Query  1521  DSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             D+ EL A RR CC++L  S D ++ I IR C++ EL+ M+
Sbjct  447   DADELKAQRRQCCEIL-QSFDDSMTINIRRCRDNELISMN  485



>ref|XP_008365448.1| PREDICTED: uncharacterized protein LOC103429079 [Malus domestica]
 ref|XP_008365449.1| PREDICTED: uncharacterized protein LOC103429079 [Malus domestica]
Length=483

 Score =   474 bits (1219),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 241/461 (52%), Positives = 322/461 (70%), Gaps = 21/461 (5%)
 Frame = +3

Query  273   FKNIVLICSSLCVVYLVCTFVLVPSTNLLHV--SVSLQDVSSPTSLEHIVFGIASSEESW  446
             FK ++L  S    +Y +          LLH   +V  +  SSPT+  H+VF IASS  SW
Sbjct  38    FKALLLFLSIFLNLYFL----------LLHAPPAVLSRYTSSPTTRLHLVFAIASSSGSW  87

Query  447   RKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSA  626
              +R+ +++LW  P+  R   FLDR  +  + +G  S+ PV +SGDTS F Y+ +GG  SA
Sbjct  88    SRREPYLRLWCSPASTRAFAFLDRAPI--DSSGEKSVAPVVVSGDTSRFPYSFKGGLRSA  145

Query  627   IRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQN  806
             IR+AR V E V     DVRWFVFGDDDTVFF +NLV+TLSKYDH  W+Y+G++SE   QN
Sbjct  146   IRVARMVKEVVDRGEPDVRWFVFGDDDTVFFVENLVRTLSKYDHDRWFYVGSNSESYQQN  205

Query  807   SFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEP  986
               +SF+MAFGG GFAIS+ LA ALA+VFDSCL RY H YGSDARV +C++ELGV LTHEP
Sbjct  206   VRYSFDMAFGGGGFAISHSLATALARVFDSCLMRYGHWYGSDARVFSCVAELGVGLTHEP  265

Query  987   GFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRIL  1166
             GFHQ+D+RG++FG+L+AHPL PLVSLHH++  DPIFPNM  T+ALEHL++A ++DP RIL
Sbjct  266   GFHQVDMRGNLFGMLSAHPLSPLVSLHHVDATDPIFPNMNNTQALEHLFEAVNLDPARIL  325

Query  1167  QQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK--DVPYGFDSR  1340
             QQTVCYD   S T+SV+WGYA+Q++  + LLPD L  Q+++ PWR++       Y F+ R
Sbjct  326   QQTVCYDMSHSLTVSVAWGYAIQVYDGNELLPDLLSLQKTFMPWRRSGSIDASQYTFNMR  385

Query  1341  GYHPDPCRRQTVFYMDR-VSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLD  1517
              Y  D C+R TVF+++  VS+SH  GI S Y +   ENC+   A  +NL++IRV +QKL+
Sbjct  386   DYPRDKCKRPTVFFLESVVSNSH--GIWSNYSRHNVENCSKANAI-KNLEQIRVFSQKLE  442

Query  1518  LDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              D  E+ A RRHCC++L S  D ++ I IR C++ EL+ M+
Sbjct  443   FDPDEMKAQRRHCCEILPSFND-SMTINIRRCRDNELISMN  482



>ref|XP_007215288.1| hypothetical protein PRUPE_ppa004954mg [Prunus persica]
 gb|EMJ16487.1| hypothetical protein PRUPE_ppa004954mg [Prunus persica]
Length=483

 Score =   471 bits (1213),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 239/459 (52%), Positives = 325/459 (71%), Gaps = 17/459 (4%)
 Frame = +3

Query  273   FKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRK  452
             FK ++LI S    +YL+  F+  P T      V+ +  SSPT+  H+VF IASS  SW +
Sbjct  38    FKTLLLIISIFFNLYLL--FIHAPPT------VTSRYSSSPTTRRHLVFAIASSSLSWAR  89

Query  453   RKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIR  632
             R+ +++LW  P   R   FLDR  +  + +G  S   V +SGDTS F YT RGG  SAIR
Sbjct  90    REPYIRLWCSPISTRAFAFLDRAPL--DSHGYGSGAQVVVSGDTSRFPYTFRGGLRSAIR  147

Query  633   LARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSF  812
             +ARAV E V     DVRWF+FGDDDTVFF +NLVKTLSKYDH  W+Y+G++SE   QN  
Sbjct  148   VARAVKEVVDRGEPDVRWFIFGDDDTVFFVENLVKTLSKYDHDRWFYVGSNSESYQQNVK  207

Query  813   FSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGF  992
             +SFEMAFGG GFAIS+ LA+ LA+VFDSCL RY HLYGSDARV +C++ELGV LTHEPGF
Sbjct  208   YSFEMAFGGGGFAISHSLARVLARVFDSCLMRYGHLYGSDARVFSCVAELGVGLTHEPGF  267

Query  993   HQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQ  1172
             HQ+D+RG++FG+L+AHPL PLVSLHH++  +PIFP+M  T+ALEHL++A ++DP RILQQ
Sbjct  268   HQVDMRGNLFGMLSAHPLSPLVSLHHLDAAEPIFPDMNKTRALEHLFEAVNVDPARILQQ  327

Query  1173  TVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK--DVPYGFDSRGY  1346
             TVCYD   S T+SV+WGYA+Q++  ++LLPD L  Q++++PWR++       Y F+ R Y
Sbjct  328   TVCYDISHSLTVSVAWGYAIQVYDGNVLLPDLLSLQKTFTPWRRSGSFDASQYMFNMRDY  387

Query  1347  HPDPCRRQTVFYMDRV-SSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLD  1523
               D C+R  VF+++ V ++SH  GI S Y + + +NC+   A  +NL++I V + KL+LD
Sbjct  388   PKDKCKRPMVFFLESVIANSH--GIWSTYTRHSVKNCSKPNAI-KNLEQISVFSHKLELD  444

Query  1524  SKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
               E+ APRR CC++L S  D ++ I IR C ++E++ M+
Sbjct  445   VDEMKAPRRPCCNILPSFND-SMTINIRRCGDDEVISMN  482



>ref|XP_004287918.1| PREDICTED: uncharacterized protein LOC101308316 [Fragaria vesca 
subsp. vesca]
Length=487

 Score =   469 bits (1208),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 228/423 (54%), Positives = 305/423 (72%), Gaps = 9/423 (2%)
 Frame = +3

Query  387   SSPTSLEHIVFGIASSEESWRKRKEFVKLWWRP-SGMRGCVFLDRDEVKHEDNGTDSLPP  563
             SSPT+  H++F IASS  SW +RK +++LW  P S  R   FLDR     +D+G     P
Sbjct  68    SSPTTRRHLLFAIASSSRSWPRRKHYLRLWHSPASSTRAFAFLDRAAYPGDDDGA---AP  124

Query  564   VCISGDTSSFRYTCRGGNP--SAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVK  737
             V +SGDTS F YT  GG    SAIR+AR V E V    ++VRW+VFGDDDTVFF DNLV+
Sbjct  125   VIVSGDTSRFPYTVGGGGGLRSAIRVARVVKEIVDRGEAEVRWYVFGDDDTVFFVDNLVQ  184

Query  738   TLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPH  917
             TL+KYDH  W+YIG++SE  +QN  + F+MAFGG GFAIS+ LAK LA+VFDSCL RY  
Sbjct  185   TLAKYDHDRWFYIGSNSESYMQNVKYGFDMAFGGGGFAISHSLAKVLARVFDSCLMRYGD  244

Query  918   LYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFP  1097
             LYGSD+RV +C++ELGV LTHEPGFHQ+D+RG++FG+L+AHPL PLVSLHH++  DPIFP
Sbjct  245   LYGSDSRVFSCVAELGVGLTHEPGFHQVDMRGNLFGMLSAHPLSPLVSLHHLDAADPIFP  304

Query  1098  NMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRA  1277
             NM  T+ALEHL+KA   DP RI+QQTVCYDR  S T+SV+WGYA+Q++  + LLPD L  
Sbjct  305   NMNNTQALEHLFKAVKADPARIVQQTVCYDRTHSLTVSVAWGYAIQVYDGNELLPDLLSL  364

Query  1278  QESYSPWRKNK--KDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTEN  1451
             Q+++ PWR+++  +   Y F  R Y  D C+R ++FY++ V S++  GI S Y +   EN
Sbjct  365   QKTFMPWRRSRSIEASQYMFKMRDYPRDTCKRPSIFYLESVVSNNHGGIWSNYTRHNVEN  424

Query  1452  CTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
             C+ + A  + L  IRV +QKL+LD +E+ APRR CC++L  S + ++ I IR C+++EL+
Sbjct  425   CSKENAI-KKLKHIRVISQKLELDVEEMKAPRRQCCNILEPSFNDSMTIIIRRCRDDELI  483

Query  1632  YMH  1640
              M+
Sbjct  484   SMN  486



>ref|XP_006304743.1| hypothetical protein CARUB_v10012119mg [Capsella rubella]
 gb|EOA37641.1| hypothetical protein CARUB_v10012119mg [Capsella rubella]
Length=461

 Score =   467 bits (1202),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 238/433 (55%), Positives = 295/433 (68%), Gaps = 16/433 (4%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSP-----TSLEHIVFGIASSEES  443
             N +L+ + + +VYL  +   + S NL+H   S            T ++H+VFGI SS  S
Sbjct  27    NCILLFAFIFLVYLFISASRLHSKNLIHACYSSSSDQDQSKSLITKIDHVVFGIGSSTNS  86

Query  444   WRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS---LPPVCISGDTSSFRYTCRGG  614
             W  R+E+VKLWW    MRGCVF+DR  +   +N TDS   LPPVCIS DTS FRYT  GG
Sbjct  87    WPARREYVKLWWDAQKMRGCVFVDR-PLPSSENHTDSSDLLPPVCISQDTSRFRYTWSGG  145

Query  615   NPSAIRLARAVSEAVSL---NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTS  785
             + +AIR+AR V E V+L   +  +VRW+VFGDDDT+F P+NL +TLSKYDH  W+YIG+S
Sbjct  146   DRNAIRIARCVLETVTLFNASSEEVRWYVFGDDDTIFIPENLARTLSKYDHTSWHYIGSS  205

Query  786   SEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELG  965
             SE   QNS F   MAFGG GFA+S  LA  LA+ FDSC+ RYPHLYG D+RVH C+ ELG
Sbjct  206   SEIYEQNSVFGHNMAFGGGGFALSSSLANVLARNFDSCIERYPHLYGGDSRVHVCVLELG  265

Query  966   VSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAAS  1145
             V L+ EPGFHQ D+RG+  G+L +H  RPLVSLHHM   DPIFPN TT  A+ HL+ A  
Sbjct  266   VELSREPGFHQFDVRGNALGILTSHSTRPLVSLHHMAHIDPIFPNSTTFSAVRHLFSAVE  325

Query  1146  IDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVP-  1322
             +DP RI Q +VCYDRW+SWTISVSWGY VQI   HLLL DALR QE++ PW+ +      
Sbjct  326   LDPLRIFQLSVCYDRWYSWTISVSWGYTVQIDSRHLLLTDALRTQETFQPWQNSGGLASV  385

Query  1323  YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENCTFDK-ASPRNLDEIR  1496
             Y F++R  HPDPC+R   FYM  VSSS  +G I SVY K   ENCT+D   SPR + EIR
Sbjct  386   YTFNTREIHPDPCQRPVTFYMQHVSSSPHNGTIISVY-KQAYENCTYDPITSPRKIKEIR  444

Query  1497  VSTQKLDLDSKEL  1535
             V + +LDLD ++L
Sbjct  445   VFSNRLDLDIRQL  457



>ref|NP_172020.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE27817.1| uncharacterized protein AT1G05280 [Arabidopsis thaliana]
Length=461

 Score =   467 bits (1201),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 238/429 (55%), Positives = 298/429 (69%), Gaps = 13/429 (3%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFVLVPSTNLLHV---SVSLQDVSSPTSLEHIVFGIASSEESWR  449
             N +L+   + +VYL+ +   + S N +H    S       SPT +EHIVFGI SS  SWR
Sbjct  26    NCILLFVFILLVYLLISASRLQSKNSIHAYFSSSDQDQSQSPTKIEHIVFGIGSSAISWR  85

Query  450   KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNPS  623
              R+E+VKLWW    MRGCVF++R  +    N TDS  LPPVC+S DTS FRYT RGG+ +
Sbjct  86    ARREYVKLWWDAQKMRGCVFVER-PLPSSQNHTDSYLLPPVCVSQDTSRFRYTWRGGDRN  144

Query  624   AIRLARAVSEAVSLNHS---DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSED  794
             AIR+AR V E V L ++   +VRW+VFGDDDT+F P+NL +TLSKYDH  WYYIG++SE 
Sbjct  145   AIRIARCVLETVRLFNTSSEEVRWYVFGDDDTIFIPENLARTLSKYDHTSWYYIGSTSEI  204

Query  795   VVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSL  974
               QNS F  +MAFGG G+A+S  LA  LA+ FDSC+ RYPHLYG D+RV+AC+ ELGV L
Sbjct  205   YHQNSMFGHDMAFGGGGYALSSSLANVLARNFDSCIERYPHLYGGDSRVYACVLELGVGL  264

Query  975   THEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDP  1154
             + EPGFHQ D+RG+  G+L +H  RPLVSLHHM   DPIFPN TT  A+ HL+ A  +DP
Sbjct  265   SKEPGFHQFDVRGNALGILTSHSTRPLVSLHHMAHIDPIFPNSTTFSAVRHLFSAVQLDP  324

Query  1155  HRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVP-YGF  1331
              RI Q +VCYDRW+SWTISVSWGY VQI G HL L D LRAQE++ PW+K+      Y F
Sbjct  325   LRIFQLSVCYDRWYSWTISVSWGYTVQIDGRHLFLRDVLRAQETFRPWQKSGGLASVYTF  384

Query  1332  DSRGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENCTFDKA-SPRNLDEIRVST  1505
             ++R  H DPC+R   FYM  VSSS  DG I SVY K   ENCT+D   SPR + EIRV +
Sbjct  385   NTREIHRDPCQRPVTFYMQHVSSSSHDGTIKSVY-KQAYENCTYDPVTSPRKIHEIRVFS  443

Query  1506  QKLDLDSKE  1532
             ++LD + ++
Sbjct  444   RRLDPNIRQ  452



>ref|XP_008341970.1| PREDICTED: uncharacterized protein LOC103404790 [Malus domestica]
 ref|XP_008341971.1| PREDICTED: uncharacterized protein LOC103404790 [Malus domestica]
Length=506

 Score =   467 bits (1202),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 233/420 (55%), Positives = 311/420 (74%), Gaps = 9/420 (2%)
 Frame = +3

Query  390   SPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVC  569
             SPT+  H+VF IASS  SW +R+ +++LW  P+  R   FLDR     + +G  S+  V 
Sbjct  92    SPTTRRHLVFAIASSSRSWSRREPYLRLWSSPASTRVFAFLDRAPT--DSSGDRSVATVV  149

Query  570   ISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSK  749
             +SGDTS F YT +GG  SAIR+ARAV E V     DVRWFVFGDDDTVFF +NLV+TLSK
Sbjct  150   VSGDTSRFPYTLKGGLRSAIRVARAVKEVVDRGEPDVRWFVFGDDDTVFFVENLVRTLSK  209

Query  750   YDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGS  929
             YDH  W+Y+G++SE   QN+ +SFEMAFGG GFAIS+ LA ALA+VFDSCL RY HLYGS
Sbjct  210   YDHDRWFYVGSNSESYXQNAKYSFEMAFGGGGFAISHSLATALARVFDSCLMRYGHLYGS  269

Query  930   DARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTT  1109
             DARV AC++ELGV LTHEPGFHQ+D+RG++FG+L+AHPL PLVSLHH+E  DPIFPNM  
Sbjct  270   DARVFACVAELGVGLTHEPGFHQVDMRGNLFGMLSAHPLSPLVSLHHLEAADPIFPNMNK  329

Query  1110  TKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESY  1289
             T+AL HL++A ++DP RILQQTVCYD   S T+SV+WGYA+Q++  + LL D L  Q+++
Sbjct  330   TQALXHLFEAVNVDPARILQQTVCYDSLHSLTVSVAWGYAIQVYAGNELLSDLLSLQKTF  389

Query  1290  SPWRKNK--KDVPYGFDSRGYHPDPCRRQTVFYMDR-VSSSHRDGITSVYRKMTTENCTF  1460
              PWR++   +   + F+ R Y  D C+R TVF+++  VS+SH  G +S Y ++  ENC+ 
Sbjct  390   MPWRRSGSIEASQFMFNMRDYPRDKCKRPTVFFLESVVSNSH--GSSSNYTRLNVENCSK  447

Query  1461  DKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             + A  +NL++IRV +QKL+LD++E+ A RR CC++L SS D ++ I IR C++ EL+ M+
Sbjct  448   ENAI-KNLEQIRVFSQKLELDAEEMKAQRRQCCEIL-SSFDDSMTITIRRCRDNELISMN  505



>ref|XP_002892278.1| hypothetical protein ARALYDRAFT_887710 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68537.1| hypothetical protein ARALYDRAFT_887710 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   464 bits (1194),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 235/430 (55%), Positives = 297/430 (69%), Gaps = 13/430 (3%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFVLVPSTNLLHV--SVSLQDVSS-PTSLEHIVFGIASSEESWR  449
             N +L+   + +VYL+ +   + S + +H   S S QD S  PT +EH+VFGI SS  SW 
Sbjct  27    NCILLFVFIFLVYLLISASRLQSKDSIHAYFSSSDQDQSQIPTKIEHVVFGIGSSTNSWG  86

Query  450   KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCISGDTSSFRYTCRGGNPS  623
              R+E+VKLWW    MRGCVF++R      +N TDS  LPPVC+S DTS FRYT R G+ +
Sbjct  87    ARREYVKLWWDAQKMRGCVFVER-PFPSSENHTDSNLLPPVCVSQDTSRFRYTWRDGDRN  145

Query  624   AIRLARAVSEAVSLNHS---DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSED  794
             AIR+AR V E V L ++   +VRW+VFGDDDT+F P+NL +TLSKYDH  WYYIG++SE 
Sbjct  146   AIRIARCVLETVRLFNTSSKEVRWYVFGDDDTIFIPENLARTLSKYDHTSWYYIGSTSEI  205

Query  795   VVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSL  974
               QNS F   MAFGG GFA+S  LA  LA+ FDSC+ RYPHLYG D+RVH C+ ELGV L
Sbjct  206   YHQNSMFGHNMAFGGGGFALSSSLANVLARNFDSCIERYPHLYGGDSRVHVCVLELGVGL  265

Query  975   THEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDP  1154
             + EPGFHQ D+RG+  G+L +H +RPLVSLHH+   DPIFPN TT  A+ HL+ A  +DP
Sbjct  266   SKEPGFHQFDVRGNALGILTSHSMRPLVSLHHLAHIDPIFPNSTTFSAVRHLFSAVELDP  325

Query  1155  HRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVP-YGF  1331
              RI Q ++CYDRW+SWTISVSWGY VQI   HL LPD LR QE++ PW+ +      Y F
Sbjct  326   LRIFQLSICYDRWYSWTISVSWGYTVQIDSRHLFLPDVLRTQETFRPWQDSGGLASVYMF  385

Query  1332  DSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYRKMTTENCTFDK-ASPRNLDEIRVST  1505
             ++R  HPDPC+R   FYM  VS SSH   I SVY K   ENCT+D   SPR + EIRV +
Sbjct  386   NTREIHPDPCQRPVTFYMQHVSYSSHNGTIKSVY-KQAYENCTYDPITSPRKIKEIRVFS  444

Query  1506  QKLDLDSKEL  1535
             ++LD + K++
Sbjct  445   RRLDPNIKQV  454



>ref|XP_004514056.1| PREDICTED: uncharacterized protein LOC101515637 [Cicer arietinum]
Length=494

 Score =   464 bits (1194),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 224/417 (54%), Positives = 298/417 (71%), Gaps = 10/417 (2%)
 Frame = +3

Query  390   SPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVC  569
             SPT+  H++F +ASS  SW  R+ +V LW+ P   R   FLD        N + + PPV 
Sbjct  87    SPTTRRHVLFAVASSSLSWPHRQSYVNLWYSPKSTRALAFLD----APPSNISTTSPPVV  142

Query  570   ISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSK  749
             ISGD S F YT +GG  SAIR+AR V EAV  N SDVRWFVFGDDDTVFF +N+V+TLSK
Sbjct  143   ISGDASGFPYTLQGGLRSAIRVARVVKEAVDRNESDVRWFVFGDDDTVFFVENVVRTLSK  202

Query  750   YDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGS  929
             YDH  W+YIG++SE   QN+ +SFEMAFGG GFAISY L K LA+V DSCL RY  LYGS
Sbjct  203   YDHDRWFYIGSNSESYEQNTMYSFEMAFGGGGFAISYSLGKVLARVLDSCLRRYGFLYGS  262

Query  930   DARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTT  1109
             DAR+++C++ELGV LTHEPGFHQ+D+RG++FG+LAAHP+ PL+SLHHM+  +P+FP+M  
Sbjct  263   DARIYSCVAELGVMLTHEPGFHQLDMRGNLFGMLAAHPISPLLSLHHMDAAEPLFPDMNR  322

Query  1110  TKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESY  1289
             T++LE L  AA++DP RILQQTVCYDR  S T SVSWG+A+Q++  ++LLPD L  + ++
Sbjct  323   TQSLERLIAAANVDPARILQQTVCYDRSKSLTFSVSWGFAIQVYQGNVLLPDLLAVKRTF  382

Query  1290  SPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKA  1469
              PWRK   +  + FD+R Y  DPC+R  +F++  V S  + GI S Y +   + C+  K 
Sbjct  383   VPWRKVHSN--FMFDTRDYPRDPCKRPLIFFLKSVRSD-KSGIWSNYSRHVEKKCS--KP  437

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             +P  L EI+V ++KLDL  +E+ APRR CC+VL  S ++++ I IR C+ +EL+ M 
Sbjct  438   NPIQLREIKVFSRKLDLSIEEMKAPRRQCCNVLPYS-NESISIHIRRCEIDELISME  493



>ref|XP_008230136.1| PREDICTED: uncharacterized protein LOC103329439 [Prunus mume]
Length=485

 Score =   462 bits (1188),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 236/459 (51%), Positives = 319/459 (69%), Gaps = 15/459 (3%)
 Frame = +3

Query  273   FKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRK  452
             FK ++LI S    +YL+  F+  P T +   S      SSPT+  H+VF IASS  SW +
Sbjct  38    FKTLLLIISIFFNLYLL--FIHAPPTFISRYS------SSPTTRRHLVFAIASSSPSWAR  89

Query  453   RKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIR  632
             R+ +++L   P   R   F   D    + +G  S   V +SGDTS F YT RGG  SAIR
Sbjct  90    REPYIRLSRSPLSPRTRAFAFLDRAPLDSHGYGSGAQVVVSGDTSRFPYTFRGGLRSAIR  149

Query  633   LARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSF  812
             +ARAV E V     DVRWF+FGDDDTVFF +NLVKTLSKYDH  W+Y+G++SE   QN  
Sbjct  150   VARAVKEVVDRGEPDVRWFIFGDDDTVFFVENLVKTLSKYDHDRWFYVGSNSESYQQNVK  209

Query  813   FSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGF  992
             +SFEMAFGG GFAIS+ LA+ LA+VFDSCL RY HLYGSDARV +C++ELGV LTHEPGF
Sbjct  210   YSFEMAFGGGGFAISHSLARVLARVFDSCLMRYGHLYGSDARVFSCVAELGVGLTHEPGF  269

Query  993   HQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQ  1172
             HQ+D+RG++FG+L+AHPL PLVSLHH++  DPIFP+M  T+ALEHL++A ++DP RILQQ
Sbjct  270   HQVDMRGNLFGMLSAHPLSPLVSLHHLDAADPIFPDMNKTQALEHLFEAVNVDPARILQQ  329

Query  1173  TVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK--DVPYGFDSRGY  1346
             TVCYD   S T+SV+WGYA+Q++  ++LLPD L  Q++++PWR++       + F+ R Y
Sbjct  330   TVCYDISHSLTVSVAWGYAIQVYDGNVLLPDLLSLQKTFTPWRRSGSFDASQFMFNMRDY  389

Query  1347  HPDPCRRQTVFYMDRV-SSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLD  1523
                 C+R  VF+++ V ++SH  GI S Y + + ENC+   A  +NL++I V + KL+LD
Sbjct  390   PKGKCKRPVVFFLESVIANSH--GIWSTYTRHSVENCSKANAL-KNLEQISVFSHKLELD  446

Query  1524  SKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
               E+ APRR CC++L S  D ++ I IR C ++E++ M+
Sbjct  447   VDEMKAPRRPCCNILPSFND-SMTINIRRCGDDEVISMN  484



>ref|XP_008455407.1| PREDICTED: uncharacterized protein LOC103495576 [Cucumis melo]
Length=487

 Score =   461 bits (1187),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 238/457 (52%), Positives = 309/457 (68%), Gaps = 11/457 (2%)
 Frame = +3

Query  276   KNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRKR  455
             K I+L+ S+  +VY +       S +LL    +L    SPT+  HIVF IASS   W +R
Sbjct  39    KTILLLLSAAFIVYTLFFNSSFHSPSLLCSRSTL----SPTTRRHIVFAIASSSNFWSRR  94

Query  456   KEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRL  635
             K +V+LW+  +  R   F+DR       +   S+PPV +S DTS F YT RGG  SAIR+
Sbjct  95    KPYVRLWYNRNSTRAFAFVDRIAPDFA-SADPSVPPVIVSNDTSRFPYTFRGGLRSAIRV  153

Query  636   ARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFF  815
             AR V E V  N  DVRW+VFGDDDT+FF DNLVKTL KYDH  WYYIG++SE   QN   
Sbjct  154   ARVVKEIVERNEQDVRWYVFGDDDTLFFVDNLVKTLGKYDHERWYYIGSNSESYGQNLKN  213

Query  816   SFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFH  995
             SF+MAFGG GFAIS+ LA+ LA V DSCL RY HLYGSDAR+ +CL ELGV LTHEPGFH
Sbjct  214   SFDMAFGGGGFAISHSLARVLAGVLDSCLTRYGHLYGSDARIWSCLVELGVGLTHEPGFH  273

Query  996   QMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQT  1175
             Q+D+RG++FGLL+AH L P+++LHH++  DPIFPNM  T+AL HL++A ++DP RI QQ 
Sbjct  274   QVDMRGNLFGLLSAHALSPIITLHHLDAMDPIFPNMNNTQALHHLFEAVNVDPGRIFQQI  333

Query  1176  VCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK--DVPYGFDSRGYH  1349
             VCYDR  S TISVSWG+A+Q+   + LLPD L  Q ++  WR+        Y F+ R Y 
Sbjct  334   VCYDRSHSLTISVSWGFAIQVFEGNRLLPDLLSLQRTFMSWRRAATIDANQYLFNIREYP  393

Query  1350  PDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSK  1529
              DPC+R  +FYM  + +S  + +T+  RKM T+ C    A  +NL +IRV +QKL+LD +
Sbjct  394   KDPCKRN-IFYMQNLRTSKNNALTNYTRKMVTD-CPASGAI-KNLTQIRVFSQKLELDVE  450

Query  1530  ELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             E+ APRR CCD++SSS +  L + IR+C  EEL+ M+
Sbjct  451   EMKAPRRQCCDIISSSKESML-LEIRQCGVEELISMY  486



>ref|XP_010543019.1| PREDICTED: uncharacterized protein LOC104816048 isoform X2 [Tarenaya 
hassleriana]
Length=383

 Score =   455 bits (1170),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 215/358 (60%), Positives = 266/358 (74%), Gaps = 7/358 (2%)
 Frame = +3

Query  582   TSSFRYTCRGGNPSAIRLARAVSEAVSL--NHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             T S  YT RGG+  AIR+AR V E V L  + SD+RW+VFGDDDT+F P+NL KTLSKYD
Sbjct  27    TISNSYTWRGGHRYAIRIARTVLETVRLFNSSSDIRWYVFGDDDTIFIPNNLAKTLSKYD  86

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H LWYYIG++SE   QNSFF F MAFGG GF +S  LA  +AKV DSC+ RYPHLY SD 
Sbjct  87    HTLWYYIGSNSEIYGQNSFFGFNMAFGGGGFVLSSSLANVVAKVLDSCIERYPHLYNSDG  146

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+++CL+ELGV L+HEPGFHQ+D+RG+  GLL +HP+RPLVSLHHM   DPIFPN TT  
Sbjct  147   RIYSCLAELGVGLSHEPGFHQLDVRGNALGLLMSHPIRPLVSLHHMAHMDPIFPNSTTVA  206

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             A+ HL+ A ++D  RILQ +VCYDR FSWTISVSWGYAVQIHG ++LLPD L AQE++ P
Sbjct  207   AIRHLFSAVAVDSARILQLSVCYDRRFSWTISVSWGYAVQIHGQYMLLPDVLSAQETFKP  266

Query  1296  WRKNKKDVP--YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFD-K  1466
             W+ N+      Y F++R  HPDPC+R   +YM+ VS +    I SVY+K T ENCT++  
Sbjct  267   WKPNQDASSRLYNFNTREIHPDPCQRPATYYMENVSFTQYGSIQSVYKK-TYENCTYEPN  325

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             +SPR  DEIRV ++K D + ++L APRR CCD+L     K +EIGIREC E EL+YMH
Sbjct  326   SSPRKFDEIRVFSEKSDPNIRQLKAPRRQCCDILHGDG-KVMEIGIRECNENELIYMH  382



>ref|XP_009341431.1| PREDICTED: uncharacterized protein LOC103933462 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009341432.1| PREDICTED: uncharacterized protein LOC103933462 isoform X1 [Pyrus 
x bretschneideri]
Length=455

 Score =   457 bits (1177),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 241/461 (52%), Positives = 319/461 (69%), Gaps = 21/461 (5%)
 Frame = +3

Query  273   FKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSL--QDVSSPTSLEHIVFGIASSEESW  446
             FK ++L  S    +Y +          LLH   +L  +  SSPT+  H+VF IASS  SW
Sbjct  10    FKALLLFLSVFLNLYFL----------LLHAPSALLSRYTSSPTTRRHLVFAIASSSRSW  59

Query  447   RKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSA  626
              +R+ +++LW  P+  R   FLDR  +  + +G  S+  V +SGDTS F YT +GG  SA
Sbjct  60    SRREPYLRLWCSPASTRAFAFLDRAPI--DSSGDKSVARVVVSGDTSRFPYTFKGGLRSA  117

Query  627   IRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQN  806
             IR+AR V E V     DVRWFVFGDDDTVFF +NLV+TLSKYDH  W+Y+G++SE   QN
Sbjct  118   IRVARMVKEVVDRGEPDVRWFVFGDDDTVFFVENLVRTLSKYDHDRWFYVGSNSESYQQN  177

Query  807   SFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEP  986
               +SF+MAFGG GFAIS+ LA ALA+VFDSCL RY H YGSDARV +C++ELGV LTHEP
Sbjct  178   VKYSFDMAFGGGGFAISHSLATALARVFDSCLMRYGHWYGSDARVFSCVAELGVGLTHEP  237

Query  987   GFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRIL  1166
             GFHQ+D+RG++FG+L+AHPL PLVSLHH++  DPIFPNM  T+ALEHL++A ++DP RIL
Sbjct  238   GFHQVDMRGNLFGMLSAHPLSPLVSLHHVDATDPIFPNMNNTQALEHLFEAVNVDPARIL  297

Query  1167  QQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK--DVPYGFDSR  1340
             QQ VCYD   S T+SV+W YA+Q++  + LLPD L  Q+++ PWR++       Y F+ R
Sbjct  298   QQIVCYDMSHSLTVSVAWVYAIQVYDGNELLPDLLSMQKTFMPWRRSGSIDASQYMFNMR  357

Query  1341  GYHPDPCRRQTVFYMDR-VSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLD  1517
              Y  D C+R TVF+++  VSSSH  GI S Y +   ENC+   A  +NL++IRV +QKL 
Sbjct  358   DYPRDKCKRPTVFFLESIVSSSH--GILSNYSRHNVENCSKANAI-KNLEQIRVFSQKLK  414

Query  1518  LDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             LDS E+ A RR CC++L S  D ++ I IR C++ EL+ M+
Sbjct  415   LDSDEMKAQRRQCCEILPSFND-SMTINIRRCRDNELISMN  454



>ref|XP_009353240.1| PREDICTED: uncharacterized protein LOC103944505 [Pyrus x bretschneideri]
 ref|XP_009353241.1| PREDICTED: uncharacterized protein LOC103944505 [Pyrus x bretschneideri]
Length=455

 Score =   456 bits (1172),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 240/461 (52%), Positives = 318/461 (69%), Gaps = 21/461 (5%)
 Frame = +3

Query  273   FKNIVLICSSLCVVYLVCTFVLVPSTNLLHV--SVSLQDVSSPTSLEHIVFGIASSEESW  446
             FK ++L  S    +Y +          LLH   +V  +  SSPT+  H+VF IASS  SW
Sbjct  10    FKALLLFLSVFLNLYFL----------LLHAPSAVLSRYTSSPTTRRHLVFAIASSSRSW  59

Query  447   RKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSA  626
              +R+ +++LW  P+  R   FLDR  +  + +G  S+  V +SGDTS F YT +GG  SA
Sbjct  60    SRREPYLRLWCSPASTRAFAFLDRAPI--DSSGDKSVARVVVSGDTSRFPYTFKGGLRSA  117

Query  627   IRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQN  806
             IR+AR V E V     DVRWFVFGDDDTVFF +NLV+TLSKYDH  W+Y+G++SE   QN
Sbjct  118   IRVARMVKEVVDRGEPDVRWFVFGDDDTVFFVENLVRTLSKYDHDRWFYVGSNSESYQQN  177

Query  807   SFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEP  986
               +SF+MAFGG GFAIS+ LA ALA+VFDSCL RY H YGSDARV +C++ELGV LTHEP
Sbjct  178   VKYSFDMAFGGGGFAISHSLATALARVFDSCLMRYGHWYGSDARVFSCVAELGVGLTHEP  237

Query  987   GFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRIL  1166
             GFHQ+D+RG++FG+L+AHPL PLVSLHH++  DPIFPNM  T+ALEHL++A ++DP RIL
Sbjct  238   GFHQVDMRGNLFGMLSAHPLSPLVSLHHVDATDPIFPNMNNTQALEHLFEAVNVDPARIL  297

Query  1167  QQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK--DVPYGFDSR  1340
             QQ VCYD   S T+SV+WGYA+Q++  + LLPD L   +++ PWR++       Y F+ R
Sbjct  298   QQIVCYDMSHSLTVSVAWGYAIQVYDGNELLPDLLSVPKTFMPWRRSGSIDTSQYMFNMR  357

Query  1341  GYHPDPCRRQTVFYMDR-VSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLD  1517
              Y  D C+R TVF+++  VSSSH  GI S Y +   ENC+   A  +NL++IRV +QKL 
Sbjct  358   DYPRDKCKRPTVFFLESIVSSSH--GILSNYSRHNVENCSKANAI-KNLEQIRVFSQKLK  414

Query  1518  LDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             LD  E+ A RR CC++L S  D ++ I IR C++ EL+ M+
Sbjct  415   LDLDEMKAQRRQCCEILPSFND-SMTINIRRCRDNELISMN  454



>ref|XP_004514055.1| PREDICTED: uncharacterized protein LOC101515312 [Cicer arietinum]
Length=428

 Score =   453 bits (1166),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 238/424 (56%), Positives = 307/424 (72%), Gaps = 14/424 (3%)
 Frame = +3

Query  309   VVYLVCTFVLVPSTNLLHV----SVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLW  476
             +++L+C      S  L H+    S  +  +S+ T+L+HIVFGIASS+ SW KRK++VKLW
Sbjct  7     ILWLLCHSSNSNSKLLQHLHHSSSQDVSTISTNTTLDHIVFGIASSKSSWTKRKDYVKLW  66

Query  477   WRPS-GMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSE  653
             W+ +  M+GCVF+D   + +ED+ + SLPP+C+S DTS FRYT +GG  SAIR+AR V E
Sbjct  67    WKTNNAMKGCVFMD--SISNEDDPS-SLPPLCLSRDTSRFRYTFKGGLRSAIRVARVVVE  123

Query  654   AVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAF  833
              V+LNHS+VRW+VFGDDDT+F P+NLVKTLSKYDH LWYYIG  SE   QN  F F MAF
Sbjct  124   TVALNHSNVRWYVFGDDDTIFLPENLVKTLSKYDHELWYYIGAHSEIYEQNRLFGFGMAF  183

Query  834   GGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRG  1013
             GGAGFAIS  LA  LAKVFDSCL RY HLYGSD RV++CL+ELGV L H P FHQ+D+ G
Sbjct  184   GGAGFAISSSLANVLAKVFDSCLERYHHLYGSDGRVYSCLAELGVGLIHVPAFHQVDLTG  243

Query  1014  DVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRW  1193
             ++FGLLAAHP+ PL+SLHH +  DPIFPNMTTT+AL+HL+KA ++   R+LQQT+CY++W
Sbjct  244   NIFGLLAAHPVTPLLSLHHPDFTDPIFPNMTTTQALQHLFKAVNVGSQRMLQQTICYEKW  303

Query  1194  FSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK-NKKDVPYGFDSRGYHPDPCRRQ  1370
             FSWTISVSWGYAVQ+  SH+ LPD +  QE++  W++ N     Y F++R  H DPC+R 
Sbjct  304   FSWTISVSWGYAVQVFPSHMFLPDVVNVQETFKQWKQGNVWAKTYTFNTRPLHHDPCKRS  363

Query  1371  TVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSK----ELL  1538
             T+FY D +S    DG+   Y   + +NC+ +  S   L+ I+V T KLDLD K    E  
Sbjct  364   TIFYSDNMSFG-EDGMIKSYYNKSFQNCSNELGSLNKLEVIKVFTNKLDLDIKHDGCEFP  422

Query  1539  APRR  1550
              PR+
Sbjct  423   RPRQ  426



>gb|KEH29638.1| transferring glycosyl group transferase [Medicago truncatula]
Length=479

 Score =   454 bits (1169),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 228/440 (52%), Positives = 305/440 (69%), Gaps = 14/440 (3%)
 Frame = +3

Query  330   FVLV---PSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRG  500
             F+L+   P +N L  S  +  ++S T+  H++F +ASS  SW  R+ +V +W+     R 
Sbjct  50    FLLILWAPYSNTLAPSSVVSRLTS-TTRRHVLFAVASSSLSWPHRQSYVNIWYNKKSTRV  108

Query  501   CVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDV  680
               FLD        N +D  PPV ISGD S F YT +GG  SAIR+AR V EAV  N +DV
Sbjct  109   LAFLD----APPRNSSDESPPVVISGDVSGFPYTLQGGLRSAIRVARVVKEAVDRNETDV  164

Query  681   RWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISY  860
             RWFVFGDDDTVFF +N+VKTLSKYDH  W+Y+G++SE   QN  +SFEMAFGG GFAISY
Sbjct  165   RWFVFGDDDTVFFVENVVKTLSKYDHERWFYVGSNSESYEQNLMYSFEMAFGGGGFAISY  224

Query  861   PLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAH  1040
              L K LA+V DSCL RY  LYGSDAR+++C++ELGV+LTHEPGFHQ+D+RG++FG+LAAH
Sbjct  225   SLGKVLARVLDSCLRRYGFLYGSDARIYSCVAELGVTLTHEPGFHQVDMRGNLFGVLAAH  284

Query  1041  PLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSW  1220
             PL PL SLHH++   P+FP+M  T+AL HL  A ++DP RILQQTVCYDR  S T SVSW
Sbjct  285   PLSPLCSLHHLDAAQPLFPDMNRTQALRHLIAATNVDPTRILQQTVCYDRSNSLTFSVSW  344

Query  1221  GYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSS  1400
             GYA+Q+   ++LLPD L A+++++PWRK   +  + FD+R    DPC+R  VFY+  ++S
Sbjct  345   GYAIQVFQGNVLLPDLLAAKKTFAPWRKIHSN--FMFDTRDNPRDPCKRPFVFYLKSITS  402

Query  1401  SHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSA  1580
               + GI S Y +   + C+  K++P    EI V ++KLDL  +E+ APRR CC+VL S  
Sbjct  403   D-KSGIWSSYSRYVEKKCS--KSNPTLPMEITVFSRKLDLSIEEMKAPRRQCCNVLPSK-  458

Query  1581  DKALEIGIRECKEEELVYMH  1640
             ++ + I IR C+ +EL+ M 
Sbjct  459   NETISIHIRRCETDELISME  478



>ref|XP_010906683.1| PREDICTED: uncharacterized protein LOC105033526 [Elaeis guineensis]
Length=476

 Score =   453 bits (1165),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 223/422 (53%), Positives = 291/422 (69%), Gaps = 13/422 (3%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             TS+ H++FGIASS  SW +R+++++LWWRP+ MRG VFLD           D LPP  +S
Sbjct  60    TSVRHLLFGIASSARSWPRRRDYLRLWWRPALMRGFVFLDSSV---GGGVADDLPPTRVS  116

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVS-----LNHSDVRWFVFGDDDTVFFPDNLVKT  740
              D S F Y+ +GG  SA+R+AR   E V          DVRW V GDDDTVFFP+NL  T
Sbjct  117   ADASRFPYSFKGGLRSAVRVARIAKELVEAVDGRFAPGDVRWIVLGDDDTVFFPENLAGT  176

Query  741   LSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHL  920
             L+KYD   WYY+G  SE + QN   SF MAFGG G AISYPLA+ LAKV DSCL RY HL
Sbjct  177   LAKYDWERWYYVGGRSEGLQQNMAHSFGMAFGGGGLAISYPLARVLAKVLDSCLVRYAHL  236

Query  921   YGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPN  1100
             YGSDAR+ AC++ELGV LT+EPGFHQ+D+RGD+ G+L+AHPL PLVSLHH++  +P+FP+
Sbjct  237   YGSDARIFACITELGVGLTYEPGFHQVDLRGDLLGMLSAHPLAPLVSLHHLDNVEPLFPS  296

Query  1101  MTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQ  1280
             M  T AL+HL++A ++DP RILQQTVCYD     TISVSWGY VQ+   + LLPD L  Q
Sbjct  297   MNRTMALKHLFEAVNVDPARILQQTVCYDSLKMLTISVSWGYTVQVFEGNQLLPDLLSLQ  356

Query  1281  ESYSPWRKNKKDVP--YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENC  1454
             ++++PWR+N+  V   Y F++R +  DPC R  +F+++ VS    D I S Y +  T +C
Sbjct  357   QTFTPWRRNRNIVSGLYIFNTREFPRDPCERPVIFFLESVSFGS-DRINSNYSRHVTNDC  415

Query  1455  TFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVY  1634
                +   +NL +IRVS+QKL+ +  +  APRR CCDVL S  D  L+I IR+CK++EL+ 
Sbjct  416   LQGRRLTKNLQQIRVSSQKLNHEIWQ--APRRQCCDVLPSFTDMVLKIDIRKCKDDELIA  473

Query  1635  MH  1640
             M 
Sbjct  474   MQ  475



>ref|XP_004144582.1| PREDICTED: uncharacterized protein LOC101222721 [Cucumis sativus]
 ref|XP_004159221.1| PREDICTED: uncharacterized protein LOC101223399 [Cucumis sativus]
 gb|KGN43542.1| hypothetical protein Csa_7G044820 [Cucumis sativus]
Length=487

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 227/419 (54%), Positives = 292/419 (70%), Gaps = 9/419 (2%)
 Frame = +3

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD-SLPPVC  569
             PT+  HIVF IASS  SW +RK +V+LW+  +  R   F+DR  +  +    D S+PPV 
Sbjct  74    PTTRRHIVFAIASSSNSWSRRKPYVRLWYDRNSTRAFAFVDR--IAPDFASADPSVPPVI  131

Query  570   ISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSK  749
             +S DTS F YT RGG  SAIR+AR V E V  N  DVRW+VFGDDDT+FF +NLV TL K
Sbjct  132   VSNDTSRFPYTFRGGLRSAIRVARVVKEIVERNEQDVRWYVFGDDDTLFFVENLVNTLGK  191

Query  750   YDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGS  929
             YDH  WYYIG++SE   QN   SF+MAFGG GFAIS+ LA+ LA V DSCL RY HLYGS
Sbjct  192   YDHERWYYIGSNSESYGQNLKNSFDMAFGGGGFAISHSLARVLAGVLDSCLTRYGHLYGS  251

Query  930   DARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTT  1109
             DAR+ +CL ELGV LTHEPGFHQ+D+RG++ GLL+AH L P+VSLHH++  DPIFPNM  
Sbjct  252   DARIWSCLVELGVGLTHEPGFHQVDMRGNLLGLLSAHALSPIVSLHHLDAMDPIFPNMNN  311

Query  1110  TKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESY  1289
             T+AL HL++A ++DP R+ QQ VCYDR  S TISVSWG+A+Q+   + LLPD L  Q ++
Sbjct  312   TQALYHLFEAVNVDPGRVFQQIVCYDRSHSLTISVSWGFAIQVFEGNRLLPDLLSLQRTF  371

Query  1290  SPWRKNKK--DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFD  1463
             + WR+        Y F+ R Y  DPC+R  +FYM  +  S  + +T+  RKM T+ C   
Sbjct  372   TSWRRAATIDANRYLFNMREYPKDPCKRN-IFYMQNLRISKNNALTNYTRKMVTD-CPAS  429

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              A  +NL +IRV +QKL+LD +E+ APRR CCD++SSS +  L + IR+C  EEL+ M+
Sbjct  430   GAI-KNLTQIRVFSQKLELDVEEMKAPRRQCCDIISSSKESML-LEIRQCGVEELIAMY  486



>ref|XP_007043328.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007043329.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007043331.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX99159.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX99160.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX99162.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=484

 Score =   451 bits (1161),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 226/465 (49%), Positives = 319/465 (69%), Gaps = 13/465 (3%)
 Frame = +3

Query  249   VKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIA  428
             + + PS+  K+++LI S    ++LV      P    L ++ ++   SS T   H+ F IA
Sbjct  31    LNLTPSR-IKDLLLIFSLFISIFLVFRHPQAP----LPLATTVPFPSS-TCRHHLFFSIA  84

Query  429   SSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCR  608
              S  S+ +R  +++LW+ P   R   FLD+      D    +LPPV +SGDT SF YT +
Sbjct  85    CSSNSFPRRSSYIRLWYTPRATRAVAFLDQPVSSLVD---PTLPPVMVSGDTKSFPYTFK  141

Query  609   GGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSS  788
             GG  SAIR+AR V EAV  N + +RWFVFGDDDTVF  DNLVK LSKYDH  W+Y+G++S
Sbjct  142   GGLRSAIRVARVVKEAVERNETGIRWFVFGDDDTVFIVDNLVKVLSKYDHEKWFYVGSNS  201

Query  789   EDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGV  968
             E   QN  +SF+MAFGG GFAISY L K LA+V DSCL RY HLYGSDARV +CL+ELGV
Sbjct  202   ESYEQNLKYSFDMAFGGGGFAISYSLGKVLARVLDSCLMRYAHLYGSDARVWSCLAELGV  261

Query  969   SLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASI  1148
              LTHE GFHQ+D+RG++FG+L AHPL PLVSLHH++  +P+FPNM+ T+ALEH +KA ++
Sbjct  262   GLTHERGFHQVDMRGNLFGMLTAHPLSPLVSLHHLDAMEPVFPNMSKTQALEHFFKAVNV  321

Query  1149  DPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK-DVPY  1325
             D  RILQQTVCYDR+ S T+SV+WGYA+Q +  + LLPD L  Q+++SPW++       +
Sbjct  322   DSSRILQQTVCYDRFNSLTVSVAWGYAIQFYEGNQLLPDLLSLQKTFSPWKRGANVGAHF  381

Query  1326  GFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVST  1505
              F++R +  D C+R   F+++ V S  ++ + S+Y + +  NC    A  +NL E++V +
Sbjct  382   MFNTREFPKDSCKRPLGFFLESVGSD-KNVVWSIYTRYSDGNCVRTDAI-KNLKEVKVVS  439

Query  1506  QKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             QKL+LD ++++APRR CC++L  S ++++ I IR+C  +EL+ M+
Sbjct  440   QKLELDMEQIMAPRRQCCEIL-PSYNESMVINIRKCGIDELISMN  483



>ref|XP_002274405.2| PREDICTED: uncharacterized protein LOC100246569 [Vitis vinifera]
Length=455

 Score =   449 bits (1156),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 227/418 (54%), Positives = 301/418 (72%), Gaps = 9/418 (2%)
 Frame = +3

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             PTS  H++F IASS  S  +R  +++LW   +  R  +FLD            +LPP+ +
Sbjct  44    PTSSHHLLFSIASSAGSLGRRAPYLRLW--SNSARAILFLDSPPPPDPSFA--ALPPIVL  99

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDTS F YT R G PSA+R+AR + EAV  N SD+RWFVFGDDDTVFF DNLV+TLSKY
Sbjct  100   SGDTSRFPYTFRRGLPSAVRVARIIKEAVDRNESDIRWFVFGDDDTVFFVDNLVRTLSKY  159

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  W+YIG+SSE   QN   SF+MAFGG GFA+S+ LA+ALA VFDSCL RYPHL+GSD
Sbjct  160   DHDQWFYIGSSSESYEQNESNSFDMAFGGGGFALSHSLARALAGVFDSCLMRYPHLFGSD  219

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
             AR+ +CL+ELGV LTHEPGFHQ+DIRG++FG+L+AHPL PLVSLHH++  DPIFPN   T
Sbjct  220   ARIFSCLAELGVGLTHEPGFHQVDIRGNLFGMLSAHPLSPLVSLHHLDSVDPIFPNRNRT  279

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +ALEHL++A +IDP RILQQT+CYDR  S TISV+WG+++Q+   +LLLPD L  Q +++
Sbjct  280   QALEHLFEAVNIDPARILQQTICYDRLSSLTISVAWGFSIQVFEGNLLLPDLLPLQRTFT  339

Query  1293  PWR--KNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDK  1466
             PWR  +N     Y F++R Y  DPC+R  VF++  V S+H DG+ S Y +    NC    
Sbjct  340   PWRRGRNISLSRYMFNTREYPKDPCKRPVVFFLQSVGSNH-DGVWSNYTRHAVGNCG-QT  397

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              + +NL++IRV +QKL+L+ +++ APRR CC +     +K++ + IR+C  +EL+ MH
Sbjct  398   GAIKNLEQIRVLSQKLELNIEQMKAPRRQCCSIF-PQFNKSMVLSIRQCGVDELISMH  454



>ref|XP_006418045.1| hypothetical protein EUTSA_v10009924mg, partial [Eutrema salsugineum]
 gb|ESQ36398.1| hypothetical protein EUTSA_v10009924mg, partial [Eutrema salsugineum]
Length=454

 Score =   448 bits (1153),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/389 (56%), Positives = 279/389 (72%), Gaps = 10/389 (3%)
 Frame = +3

Query  390   SPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPP  563
             S T ++HIVFGI SS++SW  R+++VKLWW    MRGCVF+D+  +   +N TDS  LPP
Sbjct  68    SLTKIDHIVFGIGSSKKSWLARRDYVKLWWDAQRMRGCVFVDQ-PLSSSENHTDSDLLPP  126

Query  564   VCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSL---NHSDVRWFVFGDDDTVFFPDNLV  734
             VC+S DTS FRYT RGG+ +AIR+AR V E V +   +  +VRW+VFGDDDT+F P+NL 
Sbjct  127   VCVSQDTSRFRYTWRGGDRNAIRIARCVLETVRMFNTSSEEVRWYVFGDDDTIFIPENLA  186

Query  735   KTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYP  914
             +TLSKYDH  WYYIG SSE   QNS F  +MAFGG GFA+S  LA  LAK  DSC+ RYP
Sbjct  187   RTLSKYDHTSWYYIGASSEIYYQNSMFGHDMAFGGGGFALSSSLANILAKNLDSCIERYP  246

Query  915   HLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIF  1094
             HLYG D+R+HAC+ ELGV L++EPGFHQ D+RG+  G+L +H  RPLVSLHH+   +PIF
Sbjct  247   HLYGGDSRIHACVLELGVGLSYEPGFHQFDVRGNALGILMSHSTRPLVSLHHLAHINPIF  306

Query  1095  PNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALR  1274
             PN TT  A+ HL+ A  +DP RI Q +VCYDRW+SWTISVSWGYAVQI G HL L D L 
Sbjct  307   PNSTTFSAVRHLFSAVELDPLRIFQLSVCYDRWYSWTISVSWGYAVQIEGRHLFLRDVLP  366

Query  1275  AQESYSPWRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTE  1448
              Q+++ PW+ +      Y F++R  H DPC+R   F+M+ VSS+  DG I SVY K   E
Sbjct  367   TQKTFRPWQHSGGLSSVYTFNTRDIHHDPCQRPVTFFMEHVSSTKDDGTIQSVY-KQAYE  425

Query  1449  NCTFDK-ASPRNLDEIRVSTQKLDLDSKE  1532
             NCT+D  +SPR + EIRV +++ D D ++
Sbjct  426   NCTYDPISSPRKIQEIRVFSRRFDPDIRQ  454



>gb|KHG26047.1| putative ATP-dependent DNA ligase ykoU [Gossypium arboreum]
Length=482

 Score =   449 bits (1154),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 320/464 (69%), Gaps = 15/464 (3%)
 Frame = +3

Query  249   VKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIA  428
             +K+ PS+  K+++LI S    ++LV     +P    L ++V+     SPT   H++F IA
Sbjct  31    IKLSPSR-IKDLLLIVSLSISLFLVFLHPQIP----LPLAVTAPS-RSPTRRHHLLFSIA  84

Query  429   SSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCR  608
             SS  S+ +R  +++LW+ P   R   FLD+   +   +   +LPP+ +SGDT SF YT +
Sbjct  85    SSAGSFPRRSSYIRLWYTPRDTRAIAFLDQ---RLSSSVGPNLPPIVVSGDTRSFPYTFK  141

Query  609   GGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSS  788
              G  SAIR+AR V EAV LN   +RWFVFGDDDTVF  DNLVK LSKYDH  WYY+G++S
Sbjct  142   SGLRSAIRVARVVKEAVDLNEKGIRWFVFGDDDTVFVVDNLVKVLSKYDHDKWYYVGSNS  201

Query  789   EDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGV  968
             E   QN  +SF+MAFGG GFAISY L K LA+V DSCL RY HLYGSD+R+ +CL ELGV
Sbjct  202   ESYEQNLKYSFDMAFGGGGFAISYSLGKVLARVLDSCLMRYAHLYGSDSRIWSCLVELGV  261

Query  969   SLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASI  1148
              LTHEPGFHQ+D+RG +FG+L AHPL PLVSLHH++  DPIFPNM  T+ALEHL+KA  +
Sbjct  262   GLTHEPGFHQVDVRGSIFGMLTAHPLSPLVSLHHLDAMDPIFPNMDRTRALEHLFKAVKL  321

Query  1149  DPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK-DVPY  1325
             D  RILQQTVCYD + S T+SV+WGYAVQI+  + LLPD L  Q+++SPW++  + +  +
Sbjct  322   DSSRILQQTVCYDHFNSLTVSVAWGYAVQIYEGNQLLPDLLSVQKTFSPWKRGARVEDHF  381

Query  1326  GFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVST  1505
              F++R Y  + C+R  VF++  V +S+++ + S Y + +   C    A  +NL E++V +
Sbjct  382   MFNTREYPRNSCQRPLVFFLKSV-ASNKNVVWSNYTRHSDGKCLRPDAI-KNLKEVKVVS  439

Query  1506  QKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYM  1637
              +LD++  +++APRR CC++ SSS ++++ I I+ C  +EL+ M
Sbjct  440   PELDIE--QMMAPRRQCCEI-SSSYNESMIINIKNCGVDELISM  480



>ref|XP_007043330.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOX99161.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=485

 Score =   447 bits (1150),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 226/466 (48%), Positives = 319/466 (68%), Gaps = 14/466 (3%)
 Frame = +3

Query  249   VKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIA  428
             + + PS+  K+++LI S    ++LV      P    L ++ ++   SS T   H+ F IA
Sbjct  31    LNLTPSR-IKDLLLIFSLFISIFLVFRHPQAP----LPLATTVPFPSS-TCRHHLFFSIA  84

Query  429   SSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCR  608
              S  S+ +R  +++LW+ P   R   FLD+      D    +LPPV +SGDT SF YT +
Sbjct  85    CSSNSFPRRSSYIRLWYTPRATRAVAFLDQPVSSLVD---PTLPPVMVSGDTKSFPYTFK  141

Query  609   GGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSS  788
             GG  SAIR+AR V EAV  N + +RWFVFGDDDTVF  DNLVK LSKYDH  W+Y+G++S
Sbjct  142   GGLRSAIRVARVVKEAVERNETGIRWFVFGDDDTVFIVDNLVKVLSKYDHEKWFYVGSNS  201

Query  789   EDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGV  968
             E   QN  +SF+MAFGG GFAISY L K LA+V DSCL RY HLYGSDARV +CL+ELGV
Sbjct  202   ESYEQNLKYSFDMAFGGGGFAISYSLGKVLARVLDSCLMRYAHLYGSDARVWSCLAELGV  261

Query  969   SLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASI  1148
              LTHE GFHQ+D+RG++FG+L AHPL PLVSLHH++  +P+FPNM+ T+ALEH +KA ++
Sbjct  262   GLTHERGFHQVDMRGNLFGMLTAHPLSPLVSLHHLDAMEPVFPNMSKTQALEHFFKAVNV  321

Query  1149  DPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK-DVPY  1325
             D  RILQQTVCYDR+ S T+SV+WGYA+Q +  + LLPD L  Q+++SPW++       +
Sbjct  322   DSSRILQQTVCYDRFNSLTVSVAWGYAIQFYEGNQLLPDLLSLQKTFSPWKRGANVGAHF  381

Query  1326  GFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVST  1505
              F++R +  D C+R   F+++ V S  ++ + S+Y + +  NC    A  +NL E++V +
Sbjct  382   MFNTREFPKDSCKRPLGFFLESVGSD-KNVVWSIYTRYSDGNCVRTDAI-KNLKEVKVVS  439

Query  1506  QKLDLD-SKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             QKL+LD  ++++APRR CC++L  S ++++ I IR+C  +EL+ M+
Sbjct  440   QKLELDMEQQIMAPRRQCCEIL-PSYNESMVINIRKCGIDELISMN  484



>ref|XP_010035613.1| PREDICTED: uncharacterized protein LOC104424814 [Eucalyptus grandis]
 gb|KCW47062.1| hypothetical protein EUGRSUZ_K00865 [Eucalyptus grandis]
Length=495

 Score =   446 bits (1146),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 242/420 (58%), Positives = 300/420 (71%), Gaps = 8/420 (2%)
 Frame = +3

Query  399   SLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS------LP  560
             +L H+VFGIAS+++S+ +R+ ++  WWRP   RG VF+D         G +       LP
Sbjct  75    ALHHLVFGIASNKDSFPRRRHYIAQWWRPGVTRGFVFVDAPVPLPGGGGNNDTRRNRHLP  134

Query  561   PVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKT  740
             PV +S D S F YT   G  SA+R+AR V E V++N + VRWFVFGDDDTVFFPDNLVKT
Sbjct  135   PVRVSEDASRFPYTNEYGLRSAVRVARVVVETVAMNLTGVRWFVFGDDDTVFFPDNLVKT  194

Query  741   LSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHL  920
             LSKYD GLWYY+G++SE   QN  FSF M FGGAGFAISYPLAK LAK FD C+ RY H 
Sbjct  195   LSKYDDGLWYYVGSNSEVYEQNRVFSFGMGFGGAGFAISYPLAKVLAKGFDGCIERYAHA  254

Query  921   YGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPN  1100
             YGSD+RV+ACL+ELGV LT EPGFHQ D+RGD FG+LAAHP+ PL SLHH++  DPIFPN
Sbjct  255   YGSDSRVYACLTELGVGLTREPGFHQFDVRGDTFGILAAHPVTPLASLHHIDSTDPIFPN  314

Query  1101  MTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQ  1280
             MT  +AL HL++AA  D  R+LQQ+VCY    SWT+SVSWGYAVQ+   HL + +A+R +
Sbjct  315   MTRPQALRHLFRAARTDSQRLLQQSVCYAPSLSWTVSVSWGYAVQVFPRHLPMTEAVRVR  374

Query  1281  ESYSPWRKNKKDV-PYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCT  1457
             E++  W+K       YGF++R    DPC R TVF+M  V+SS +D I S Y+K     C+
Sbjct  375   ETFRQWKKGSVLARSYGFNTREVEADPCERPTVFFMSSVASS-KDWIKSSYKKHNDSGCS  433

Query  1458  FDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYM  1637
              D  SPR L+E+RV + KLDLD K+L APRRHCCDVL SS  KA+EI IREC EEE ++M
Sbjct  434   SDMDSPRMLEEVRVYSHKLDLDIKQLQAPRRHCCDVLPSSVGKAMEIVIRECGEEESIFM  493



>ref|XP_007149949.1| hypothetical protein PHAVU_005G112900g, partial [Phaseolus vulgaris]
 gb|ESW21943.1| hypothetical protein PHAVU_005G112900g, partial [Phaseolus vulgaris]
Length=468

 Score =   444 bits (1142),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 233/446 (52%), Positives = 315/446 (71%), Gaps = 24/446 (5%)
 Frame = +3

Query  240   QAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSP--------  395
              +P+K KP+      +L+ S  CV+ L  + +L+  T      V+L  + SP        
Sbjct  20    HSPIKTKPT--LMKFILVSSLFCVISLCVSVLLLAKTK-----VTLNSLYSPQHDVSRSD  72

Query  396   -TSLEHIVFGIASSEESWRKRKEFVKLWWR--PS-GMRGCVFLDRDEVKHEDNGTDSLPP  563
              T+++H+VFGIASS   W  RK++ KLWW   P+  MRGCVF+D    +   N  DSLPP
Sbjct  73    QTTVDHLVFGIASSGTLWPWRKQYTKLWWNSIPNITMRGCVFVDALPHEENVNNDDSLPP  132

Query  564   VCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTL  743
             +C+S DTS F YT + G+ SAIR+AR V E V+LNHS VRW+VFGDDDT+FFP NL+KTL
Sbjct  133   LCVSQDTSQFPYTYKTGHRSAIRVARVVKETVALNHSGVRWYVFGDDDTIFFPHNLLKTL  192

Query  744   SKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLY  923
             SKYDH LWYY+G+++E    N  F F MAFGG GFAIS  LA+ LAKV DSC+ RYPHL 
Sbjct  193   SKYDHRLWYYVGSNTEMYEGNKVFGFGMAFGGGGFAISSSLAQVLAKVLDSCIQRYPHLL  252

Query  924   GSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNM  1103
              SD+RV++C++ELGV LTHEPGFHQ+D+RG++FGLLAAHPL PL+SLHH +++DPIFPNM
Sbjct  253   ASDSRVYSCITELGVGLTHEPGFHQVDLRGNIFGLLAAHPLTPLLSLHHPDIFDPIFPNM  312

Query  1104  TTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQE  1283
             ++  +++HL++A   D  RILQQTVCY++  SWTISVSWGYAV++   ++ LP+ LR   
Sbjct  313   SSITSMQHLFEAVHADSERILQQTVCYEKQLSWTISVSWGYAVEVFQHNMFLPEVLRVGR  372

Query  1284  SYSPW-RKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTF  1460
             ++  W R N     Y F++R  HPDPC+R T+FY+D+VSS  RDGI S Y++   +NC++
Sbjct  373   TFRQWLRGNFLRGIYNFNTREIHPDPCKRGTIFYLDKVSSG-RDGIISSYKR-DFQNCSY  430

Query  1461  DKASPRNLDEIRVSTQKLDLDSKELL  1538
              KAS   L+ I+V T KL+ D+K+++
Sbjct  431   -KASMSKLEVIKVVTNKLN-DNKQVI  454



>gb|AAB71450.1| Similar to hypothetical protein PID|e327464 (gb|Z97338) [Arabidopsis 
thaliana]
Length=479

 Score =   442 bits (1136),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 232/447 (52%), Positives = 296/447 (66%), Gaps = 31/447 (7%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFVLVPSTNLLHV---SVSLQDVSSPTSLEHIVFGIASSEESWR  449
             N +L+   + +VYL+ +   + S N +H    S       SPT +EHIVFGI SS  SWR
Sbjct  26    NCILLFVFILLVYLLISASRLQSKNSIHAYFSSSDQDQSQSPTKIEHIVFGIGSSAISWR  85

Query  450   KRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS--LPPVCIS----GDTSSFRYTCRG  611
              R+E+VKLWW    MRGCVF++R  +    N TDS  LPP  +      +TS +RYT RG
Sbjct  86    ARREYVKLWWDAQKMRGCVFVER-PLPSSQNHTDSYLLPPGTVKSNRPNETSVYRYTWRG  144

Query  612   GNPSAIRLARAVSEAVSLNHS---DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGT  782
             G+ +AIR+AR V E V L ++   +VRW+VFGDDDT+F P+NL +TLSKYDH  WYYIG+
Sbjct  145   GDRNAIRIARCVLETVRLFNTSSEEVRWYVFGDDDTIFIPENLARTLSKYDHTSWYYIGS  204

Query  783   SSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSEL  962
             +SE   QNS F  +MAFGG G+A+S  LA  LA+ FDSC+ RYPHLYG D+RV+AC+ EL
Sbjct  205   TSEIYHQNSMFGHDMAFGGGGYALSSSLANVLARNFDSCIERYPHLYGGDSRVYACVLEL  264

Query  963   GVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAA  1142
             GV L+ EPGFHQ D+RG+  G+L +H  RPLVSLHHM   DPIFPN TT  A+ HL+ A 
Sbjct  265   GVGLSKEPGFHQFDVRGNALGILTSHSTRPLVSLHHMAHIDPIFPNSTTFSAVRHLFSAV  324

Query  1143  SIDPHRILQQTVCYDRWFSWTISVSWGYAVQIH--------------GSHLLLPDALRAQ  1280
              +DP RI Q +VCYDRW+SWTISVSWGY VQ++              G HL L D LRAQ
Sbjct  325   QLDPLRIFQLSVCYDRWYSWTISVSWGYTVQVNTFLPFFVQDSNNIDGRHLFLRDVLRAQ  384

Query  1281  ESYSPWRKNKKDVP-YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDG-ITSVYRKMTTENC  1454
             E++ PW+K+      Y F++R  H DPC+R   FYM  VSSS  DG I SVY K   ENC
Sbjct  385   ETFRPWQKSGGLASVYTFNTREIHRDPCQRPVTFYMQHVSSSSHDGTIKSVY-KQAYENC  443

Query  1455  TFDKA-SPRNLDEIRVSTQKLDLDSKE  1532
             T+D   SPR + EIRV +++LD + ++
Sbjct  444   TYDPVTSPRKIHEIRVFSRRLDPNIRQ  470



>ref|XP_006283625.1| hypothetical protein CARUB_v10004682mg [Capsella rubella]
 gb|EOA16523.1| hypothetical protein CARUB_v10004682mg [Capsella rubella]
Length=487

 Score =   441 bits (1135),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 223/460 (48%), Positives = 302/460 (66%), Gaps = 9/460 (2%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEES  443
             S   +NI L+     ++Y++ ++       +  ++ SL   S  T   H++F IA+S +S
Sbjct  35    SSRIRNIFLLLVFCFIIYIIFSYGTFRREKISSIARSLTVFS--TRRRHLLFSIAASHDS  92

Query  444   WRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPS  623
             W +R  +V+LW+ P   R  VFLDR   + +     +LPPV +S D S F Y   GG  S
Sbjct  93    WLRRSSYVRLWYTPESTRAVVFLDRGGFESDL----TLPPVVVSKDVSRFPYNFPGGLRS  148

Query  624   AIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQ  803
             AIR+AR V E V     DVRWFVFGDDDTVFF DNLV  LSKYDH  WYY+G++SE   Q
Sbjct  149   AIRVARVVKETVDQGDKDVRWFVFGDDDTVFFVDNLVTVLSKYDHRKWYYVGSNSEFYDQ  208

Query  804   NSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHE  983
             N  +SF+MAFGG GFAIS  LAK LAKV DSCL RY H+YGSD+R+ +CL+ELGV+LTHE
Sbjct  209   NVRYSFDMAFGGGGFAISVSLAKVLAKVLDSCLMRYSHMYGSDSRIFSCLAELGVTLTHE  268

Query  984   PGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRI  1163
             PGFHQ+D+RG++FGLL AHPL PLVSLHH++  DP FP M  T+++  L  A+S+D  RI
Sbjct  269   PGFHQIDVRGNIFGLLCAHPLSPLVSLHHLDAVDPFFPKMNRTESVARLIGASSLDSGRI  328

Query  1164  LQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK-DVPYGFDSR  1340
             LQQ+VCYD   + T+SV WGYA+Q++  + LLPD L  Q+++S WR+       Y F +R
Sbjct  329   LQQSVCYDSLNTVTVSVVWGYAIQVYEGNKLLPDLLTLQKTFSTWRRGSGVQSNYMFSTR  388

Query  1341  GYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDL  1520
              Y  DPC R  VF++D V S   +G  S Y      NC   +A  R L+ I+V + KLD 
Sbjct  389   DYPRDPCGRSLVFFLDSVGSDGSEGTWSNYILHRVGNCHRAEAVKR-LERIKVLSHKLDH  447

Query  1521  DSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             D++++++PRR CCD+ SS  +K++ I IR+C  +EL+ M+
Sbjct  448   DTQQMVSPRRQCCDI-SSPYNKSMVINIRQCMPDELIAMN  486



>ref|XP_003540854.1| PREDICTED: uncharacterized protein LOC100813277 isoform X1 [Glycine 
max]
 ref|XP_006592393.1| PREDICTED: uncharacterized protein LOC100813277 isoform X2 [Glycine 
max]
 ref|XP_006592394.1| PREDICTED: uncharacterized protein LOC100813277 isoform X3 [Glycine 
max]
 ref|XP_006592395.1| PREDICTED: uncharacterized protein LOC100813277 isoform X4 [Glycine 
max]
 ref|XP_006592396.1| PREDICTED: uncharacterized protein LOC100813277 isoform X5 [Glycine 
max]
 ref|XP_006592397.1| PREDICTED: uncharacterized protein LOC100813277 isoform X6 [Glycine 
max]
Length=492

 Score =   441 bits (1133),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 222/418 (53%), Positives = 305/418 (73%), Gaps = 8/418 (2%)
 Frame = +3

Query  390   SPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVC  569
             SPT+  H++F +ASS  SW +R  ++ LW+ P+  R   FLD+    +  +  DS PP+ 
Sbjct  81    SPTTRRHLLFSVASSSTSWPRRLPYINLWYSPATTRALAFLDKTP-PNATSADDSSPPLV  139

Query  570   ISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSK  749
             ISGDTSSF YT RGG  SAIR+ARAV EAV  N +DVRWFVFGDDDTVFF DN+V+ L++
Sbjct  140   ISGDTSSFPYTFRGGLRSAIRVARAVKEAVDRNETDVRWFVFGDDDTVFFVDNVVRALAR  199

Query  750   YDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGS  929
             YDH  W+Y+G++SE   QN  +SFEMAFGG GFAISY LA+ LA+V DSCL RY HLYGS
Sbjct  200   YDHSKWFYVGSNSESYEQNVKYSFEMAFGGGGFAISYSLARVLARVLDSCLRRYGHLYGS  259

Query  930   DARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTT  1109
             D+R+++C++ELGV+LTHEPGFHQ+D+RG++FG+LAAHPL PL+SLHH+E  +P+FP+M  
Sbjct  260   DSRIYSCIAELGVALTHEPGFHQLDMRGNLFGMLAAHPLSPLLSLHHLESVEPLFPDMNR  319

Query  1110  TKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESY  1289
              +ALEHL  AA++DP RILQQTVCYDR  S T SVSWG+A+Q++  + LLPD L  Q ++
Sbjct  320   VQALEHLIAAANVDPARILQQTVCYDRSNSLTFSVSWGFAIQVYQGNELLPDLLSLQRTF  379

Query  1290  SPWRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDK  1466
              PW++  K +  + F++R Y  DPC+R ++F+   V+S  R GI S Y      NC F+ 
Sbjct  380   VPWKRGSKVNANFMFNTRDYPRDPCKRPSIFFFKSVASDKR-GIWSNYSGHVVGNC-FES  437

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
                  L +I V ++KL+L++++++APRR CC+VL +S D  + + IR+C+ +EL+ M 
Sbjct  438   TL---LKQIIVFSKKLELNNEQMIAPRRQCCNVLLTSND-TVSLHIRQCELDELISMQ  491



>ref|XP_006372975.1| hypothetical protein POPTR_0017s06680g [Populus trichocarpa]
 gb|ERP50772.1| hypothetical protein POPTR_0017s06680g [Populus trichocarpa]
Length=506

 Score =   441 bits (1133),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 226/418 (54%), Positives = 293/418 (70%), Gaps = 10/418 (2%)
 Frame = +3

Query  408   HIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS-----LPPVCI  572
             HIVF IASS  S+  R+ +++LW+ P+  R   FLDR+ V    N   S     LPPV I
Sbjct  91    HIVFSIASSSTSFIHRQPYIRLWYNPTTTRAFAFLDREVVDPTGNNNRSVIDPTLPPVII  150

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             S DTSSF YT +GG  SAIR+AR V E V LN  DV WFVFGDDDTVFF +NLV  LSKY
Sbjct  151   SKDTSSFPYTFKGGLKSAIRVARVVKEVVELNEPDVDWFVFGDDDTVFFVENLVTVLSKY  210

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  W+Y+G++SE   QN   SFEM FGG GFAISY LAK LA+V DSCL RY HLYGSD
Sbjct  211   DHNGWFYVGSNSESYSQNVKNSFEMGFGGGGFAISYSLAKVLARVLDSCLVRYAHLYGSD  270

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
             AR+ +CL+ELGV L+HEPGFHQ+D+RGD+FG+L+AHPL PLVSLHH++  +PIFP M+ T
Sbjct  271   ARIFSCLAELGVGLSHEPGFHQVDMRGDLFGMLSAHPLSPLVSLHHLDAVNPIFPKMSKT  330

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +ALEHL+   ++DP RILQQTVCYD  +S T+SV+WGY+VQ+   +  LPD L  Q ++ 
Sbjct  331   QALEHLFNGVNVDPARILQQTVCYDPVYSLTVSVAWGYSVQVFEGNEFLPDLLTPQRTFI  390

Query  1293  PWRK--NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDK  1466
             PWR+  N +   + F+ R Y  DPC+R  VF+M+ V+S  ++GI S Y +    +C    
Sbjct  391   PWRRGGNAEFNRFMFNIREYPKDPCKRPVVFFMESVTSG-KNGIWSNYIRHDVADCNRGY  449

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             A  +NL+ +RV +QKL+ D +++ APRR CCD LS   + ++ I IR+C  +EL+ MH
Sbjct  450   AM-KNLELVRVLSQKLEPDIEQMKAPRRQCCD-LSPLFNGSMVISIRKCGSDELIAMH  505



>gb|KCW47063.1| hypothetical protein EUGRSUZ_K00865 [Eucalyptus grandis]
Length=493

 Score =   440 bits (1132),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 241/420 (57%), Positives = 299/420 (71%), Gaps = 10/420 (2%)
 Frame = +3

Query  399   SLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS------LP  560
             +L H+VFGIAS+++S+ +R+ ++  WWRP   RG VF+D         G +       LP
Sbjct  75    ALHHLVFGIASNKDSFPRRRHYIAQWWRPGVTRGFVFVDAPVPLPGGGGNNDTRRNRHLP  134

Query  561   PVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKT  740
             PV +S D S F YT   G  SA+R+AR V E V++N + VRWFVFGDDDTVFFPDNLVKT
Sbjct  135   PVRVSEDASRFPYTNEYGLRSAVRVARVVVETVAMNLTGVRWFVFGDDDTVFFPDNLVKT  194

Query  741   LSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHL  920
             LSKYD GLWYY+G++SE   QN  FSF M FGGAGFAISYPLAK LAK FD C+ RY H 
Sbjct  195   LSKYDDGLWYYVGSNSEVYEQNRVFSFGMGFGGAGFAISYPLAKVLAKGFDGCIERYAHA  254

Query  921   YGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPN  1100
             YGSD+RV+ACL+ELGV LT EPGFHQ D+RGD FG+LAAHP+ PL SLHH++  DPIFPN
Sbjct  255   YGSDSRVYACLTELGVGLTREPGFHQFDVRGDTFGILAAHPVTPLASLHHIDSTDPIFPN  314

Query  1101  MTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQ  1280
             MT  +AL HL++AA  D  R+LQQ+VCY    SWT+SVSWGYAVQ+   HL + +A+R +
Sbjct  315   MTRPQALRHLFRAARTDSQRLLQQSVCYAPSLSWTVSVSWGYAVQVFPRHLPMTEAVRVR  374

Query  1281  ESYSPWRKNKKDV-PYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCT  1457
             E++  W+K       YGF++R    DPC R TVF+M  V+SS +D I S Y+K     C+
Sbjct  375   ETFRQWKKGSVLARSYGFNTREVEADPCERPTVFFMSSVASS-KDWIKSSYKKHNDSGCS  433

Query  1458  FDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYM  1637
              D  SPR L+E+RV + KLDLD K+  APRRHCCDVL SS  KA+EI IREC EEE ++M
Sbjct  434   SDMDSPRMLEEVRVYSHKLDLDIKQ--APRRHCCDVLPSSVGKAMEIVIRECGEEESIFM  491



>ref|XP_009630351.1| PREDICTED: uncharacterized protein LOC104120315 [Nicotiana tomentosiformis]
Length=467

 Score =   439 bits (1129),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 219/460 (48%), Positives = 306/460 (67%), Gaps = 8/460 (2%)
 Frame = +3

Query  273   FKNIVLICSSLCVV-----YLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSE  437
             FK+I LI +          Y   T +    T+      +  + +SPT++ H+VF IASS 
Sbjct  9     FKDICLILTFFSFFFLSLNYHRSTSIFQKLTSFSSTITAATNKNSPTTVNHLVFSIASSS  68

Query  438   ESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGN  617
             +++ KRKE + LW++P+  +  VFLD     +     D LP + I  +TS F YT R G 
Sbjct  69    KTFSKRKELLPLWYKPNSTKAYVFLDHTPSDNSPKNID-LPQILIYENTSRFPYTHRKGA  127

Query  618   PSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDV  797
               AI +   + + V+ +  +VRW++FGDDDTVFF DNLVKTL KYDH  WYYIG++SE  
Sbjct  128   RYAIGITCMIKQVVARDDPNVRWYIFGDDDTVFFVDNLVKTLEKYDHNEWYYIGSNSESY  187

Query  798   VQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLT  977
              QN++FSF+MAFGG G+AIS PLAKALA V DSCL RYP+LYGSDAR+ +CL+ELGVSLT
Sbjct  188   AQNAYFSFDMAFGGGGYAISRPLAKALAGVLDSCLMRYPNLYGSDARIFSCLAELGVSLT  247

Query  978   HEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPH  1157
             HEPGFHQ D+ G++FGLL++HPL PL+SLHH+E    IFPNMT  +AL+HL+KAA+ DP 
Sbjct  248   HEPGFHQDDLWGNLFGLLSSHPLSPLLSLHHVERMHSIFPNMTKIQALKHLFKAANADPT  307

Query  1158  RILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDS  1337
             RI QQT+CYDR  S ++S++WGYA+Q++  ++ LPD +    ++ PW K+KK   + F +
Sbjct  308   RISQQTICYDRKNSLSVSIAWGYAIQVYEGNIKLPDLITVLRTFEPWDKDKKRPHFMFRT  367

Query  1338  RGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLD  1517
             R    DPC++   F +  V S   +  T+  R    + C  D    +NL+EIRV ++KLD
Sbjct  368   RVESNDPCKKMVAF-LKSVDSYGNNVWTNYTRYRVGKTCAKDGNKIKNLEEIRVFSRKLD  426

Query  1518  LDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYM  1637
              D++++ APRR CCDV S S++K+++I IR C  +E + M
Sbjct  427   ADTRQVRAPRRQCCDV-SLSSNKSMDIQIRPCGIDEFITM  465



>ref|XP_010051124.1| PREDICTED: uncharacterized protein LOC104439805 [Eucalyptus grandis]
 ref|XP_010051130.1| PREDICTED: uncharacterized protein LOC104439805 [Eucalyptus grandis]
 ref|XP_010051137.1| PREDICTED: uncharacterized protein LOC104439805 [Eucalyptus grandis]
 ref|XP_010051142.1| PREDICTED: uncharacterized protein LOC104439805 [Eucalyptus grandis]
Length=473

 Score =   438 bits (1127),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 229/473 (48%), Positives = 310/473 (66%), Gaps = 12/473 (3%)
 Frame = +3

Query  237   SQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSL---QDVSSPTSLE  407
             S A +K       KN++L  S  C+ YL+ +     + +LLH    L      ++PTS  
Sbjct  7     SSAVLKTLSPSRVKNLLLALSLSCIFYLLLS-NHRQAASLLHAPPVLPPQATPATPTSRR  65

Query  408   HIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTS  587
             H++F +ASS  S+ +R+ +++LW+ P+  R   FLDR  + +     D LPP  +S DTS
Sbjct  66    HLLFAVASSSLSFPRRRPYLRLWYSPNSTRALAFLDR--LPYGGPAPD-LPPTLVSEDTS  122

Query  588   SFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLW  767
              F YT  GG  SAIR+AR V E        VRW+VFGDDDTVFF DNLV  LSKYDH  W
Sbjct  123   RFPYTFPGGLRSAIRVARVVKEVADRGEPGVRWYVFGDDDTVFFVDNLVSVLSKYDHTKW  182

Query  768   YYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHA  947
             YY+G++SE   QN  +SF+MAFGG GFAIS  LA ALA+V DSCL RY HLYGSDAR+ +
Sbjct  183   YYVGSNSESYDQNINYSFDMAFGGGGFAISGSLAVALARVLDSCLVRYSHLYGSDARIFS  242

Query  948   CLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEH  1127
             CL+ELGV LTHEPGFHQ+D+RG++FGLL AHPL PLVSLHH++  DPIFPNM  T+ALE 
Sbjct  243   CLAELGVGLTHEPGFHQVDMRGNLFGLLTAHPLSPLVSLHHLDAVDPIFPNMNKTQALEL  302

Query  1128  LYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRK-  1304
             L++A ++DP R+LQQ+VCYDR  S +ISVSWGYAVQ++  + LLPD L  Q +++PWR+ 
Sbjct  303   LFEAVNVDPARVLQQSVCYDRTKSLSISVSWGYAVQVYEGNELLPDLLALQRTFTPWRRS  362

Query  1305  -NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRN  1481
              +     Y F++R +  DPC+R   F++  + S   +G+ S Y      +C    A  +N
Sbjct  363   ISAGSSRYMFNTREFPKDPCKRPVTFFLHSILSDE-NGVRSSYEGQIVGHCIRGNAL-KN  420

Query  1482  LDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             L +I V ++KL+ D +++ A RR CCDVL    + ++ I IR+C + EL+ M 
Sbjct  421   LKKITVFSRKLEHDIEQMKALRRQCCDVL-PIINGSMVIHIRQCGDNELISMQ  472



>ref|XP_010449958.1| PREDICTED: uncharacterized protein LOC104732128 [Camelina sativa]
Length=487

 Score =   439 bits (1128),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 217/416 (52%), Positives = 286/416 (69%), Gaps = 7/416 (2%)
 Frame = +3

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             PT   H++F IA+S +SW +R  +V+LW+ P   R  VFLDR  ++ +     +LPPV +
Sbjct  76    PTRRRHLLFSIAASHDSWLRRSSYVRLWYTPESTRAVVFLDRGGLEPDP----TLPPVVV  131

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             S D S F Y   GG  SAIR+AR V E V     DVRWFVFGDDDTVFF DNLVK LSKY
Sbjct  132   SKDVSRFPYNFPGGLRSAIRVARVVKEIVDRGDKDVRWFVFGDDDTVFFVDNLVKVLSKY  191

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  WYY+G++SE   QN  +SF+MAFGG GFAIS  LAK LAKV DSCL RY H+YGSD
Sbjct  192   DHRKWYYVGSNSEFYDQNVRYSFDMAFGGGGFAISASLAKVLAKVLDSCLMRYSHMYGSD  251

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
             +R+ +CL+ELGV+LTHEPGFHQMD+RGD+FGLL AHPL PLVSLHH++  DP FP M  T
Sbjct  252   SRIFSCLAELGVTLTHEPGFHQMDVRGDIFGLLCAHPLSPLVSLHHLDAVDPFFPKMNRT  311

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +++  L  A+S+D  RILQQ+VCYD   + T+SV WGYA+Q++  + LLP+ L  Q+++S
Sbjct  312   ESVARLIGASSLDTGRILQQSVCYDSLNTVTVSVVWGYAIQVYEGNKLLPELLTLQKTFS  371

Query  1293  PWRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKA  1469
              WR+       Y F +R Y  DPC R  VF++D V S   +G  S Y      +C   +A
Sbjct  372   TWRRGSGVQSNYMFSTRDYPRDPCARPLVFFLDSVGSDGTEGTWSNYYLHRVGHCHRAEA  431

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYM  1637
               R L+ IRV ++KL+L ++++ +PRR CCD+ SSS +K++ I +R+C  +EL+ M
Sbjct  432   VKR-LERIRVLSRKLELGAEQMGSPRRQCCDI-SSSYNKSMVINVRQCMSDELIAM  485



>ref|XP_002868218.1| hypothetical protein ARALYDRAFT_493365 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44477.1| hypothetical protein ARALYDRAFT_493365 [Arabidopsis lyrata subsp. 
lyrata]
Length=488

 Score =   437 bits (1124),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 224/461 (49%), Positives = 302/461 (66%), Gaps = 10/461 (2%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVVYLVCTF-VLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEE  440
             S   + I L+ +   ++Y++ ++        +  ++ SL   S  T   H++F IA+S +
Sbjct  35    SSRIRYIFLLLTFCFIIYIIFSYGTTFRREQISSIARSLSVFS--TRRRHLLFSIAASHD  92

Query  441   SWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNP  620
             SW +R  +V+LW+ P   R  VFLDR  ++ +     +LPPV +S D S F Y   GG  
Sbjct  93    SWLRRSSYVRLWYSPESTRAVVFLDRGGLESDL----TLPPVIVSKDVSRFPYNFPGGLR  148

Query  621   SAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVV  800
             SAIR+AR V E V L   DVRWFVFGDDDTVFF DNLV  LSKYDH  WYY+G++SE   
Sbjct  149   SAIRVARVVKETVDLGDKDVRWFVFGDDDTVFFVDNLVTVLSKYDHRKWYYVGSNSEFYD  208

Query  801   QNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTH  980
             QN  +SF+MAFGG GFAIS  LAK LAKV DSCL RY H+YGSD+R+ +C++ELGV+LTH
Sbjct  209   QNVRYSFDMAFGGGGFAISASLAKVLAKVLDSCLMRYSHMYGSDSRIFSCVAELGVTLTH  268

Query  981   EPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHR  1160
             EPGFHQ+D+RG++FGLL AHPL PLVSLHH++  DP FP    T+++ HL  AAS D  R
Sbjct  269   EPGFHQIDVRGNIFGLLCAHPLSPLVSLHHLDAVDPFFPKRNRTESVAHLIGAASFDSAR  328

Query  1161  ILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK-DVPYGFDS  1337
             ILQQ+VCYD   + T+SV WGYAVQ++  + LLPD L  Q+++S WR+       Y F +
Sbjct  329   ILQQSVCYDSLNTVTVSVVWGYAVQVYEGNKLLPDLLTLQKTFSTWRRGSGVQSNYMFST  388

Query  1338  RGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLD  1517
             R Y  DPC R  VF++D V S   +G  S Y      NC   +A  R L+ +RV ++KL 
Sbjct  389   REYPRDPCGRPLVFFLDSVGSDGTEGTWSNYNLHRVGNCHRAEAVER-LERVRVLSRKLK  447

Query  1518  LDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              D ++++APRR CCD+ SS  +K++ I IR+C  +EL+ M+
Sbjct  448   HDVEQMVAPRRQCCDI-SSPYNKSMVINIRQCMPDELIAMN  487



>gb|ACN40918.1| unknown [Picea sitchensis]
Length=513

 Score =   437 bits (1125),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 219/423 (52%), Positives = 295/423 (70%), Gaps = 9/423 (2%)
 Frame = +3

Query  369   VSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGT  548
             +S     S T+L +IVFGIASS   W +RK +V LWW+P  MRG V+LD++  + +   +
Sbjct  97    ISSDTTPSNTTLYNIVFGIASSARKWNQRKRYVDLWWKPGVMRGFVWLDQEIGEPQ---S  153

Query  549   DSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDN  728
              SLP + +S DTS FRYT + G  SAIR++R VSE   LN SDV WFV GDDDTVFFP+N
Sbjct  154   ASLPQLKVSEDTSRFRYTFKKGLRSAIRISRIVSETFRLNLSDVHWFVMGDDDTVFFPEN  213

Query  729   LVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHR  908
             L++ LSKYDH  +YYIGT+SE V QN   S+ MA+GG GFAISYPLAKAL K+ DSCL R
Sbjct  214   LLQVLSKYDHNQYYYIGTNSESVEQNVLHSYGMAYGGGGFAISYPLAKALEKMQDSCLDR  273

Query  909   YPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDP  1088
             Y +LYGSDAR+HACL++LGV LT EPGFHQ+D RG++ G L+AHPL PLVSLHH++   P
Sbjct  274   YSYLYGSDARIHACLADLGVPLTKEPGFHQVDFRGNLLGWLSAHPLAPLVSLHHLDAMAP  333

Query  1089  IFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDA  1268
             IFP M  T+A EHL++A  +D  RILQQT+CYD+    ++SVSWGY+V +  S +  P  
Sbjct  334   IFPKMNQTQAFEHLFEAVKVDSSRILQQTICYDKVRQGSLSVSWGYSVHVFDS-IQFPRE  392

Query  1269  LRA-QESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTT  1445
             L + Q+++  WRK   D  + F++R    +PC R  V +++ VS+  + GIT+ Y + T 
Sbjct  393   LESPQQTFMHWRKTMTD-QFMFNTRNVSRNPCLRPAVLFLESVSTGSK-GITTTYTRQTG  450

Query  1446  ENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEE  1625
              +C   K++ + L +IRV + K  L+ K+  +PRRHCCDVL SS + +LEI +R C + E
Sbjct  451   ASCQLGKSALQALQQIRVLSPKSQLNWKQ--SPRRHCCDVLPSSLNNSLEILMRSCLDGE  508

Query  1626  LVY  1634
             ++Y
Sbjct  509   VIY  511



>ref|XP_010435042.1| PREDICTED: uncharacterized protein LOC104718913 [Camelina sativa]
Length=487

 Score =   436 bits (1121),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 216/417 (52%), Positives = 285/417 (68%), Gaps = 7/417 (2%)
 Frame = +3

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             PT   H++F IA+S +SW +R  +V+LW+ P   R  VFLDR   + +     +LPPV +
Sbjct  76    PTRRRHLLFSIAASHDSWLRRSSYVRLWYTPESTRAVVFLDRGGFEPDL----TLPPVVV  131

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             S D S F Y   GG  SAIR+AR V E V     DVRWFVFGDDDTVFF DNLVK LSKY
Sbjct  132   SKDVSRFPYNFPGGLRSAIRVARVVKEIVDRGDKDVRWFVFGDDDTVFFVDNLVKVLSKY  191

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  WYY+G++SE   QN  +SF+MAFGG GFAIS  LAK LAKV DSCL RY H+YGSD
Sbjct  192   DHRKWYYVGSNSEFYDQNVRYSFDMAFGGGGFAISASLAKVLAKVLDSCLMRYSHMYGSD  251

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
             +R+ +CL+ELGV+LTHEPGFHQ+D+RG++FGLL AHPL PLVSLHH++  DP FP M  T
Sbjct  252   SRIFSCLAELGVTLTHEPGFHQVDVRGNIFGLLCAHPLSPLVSLHHLDAVDPFFPKMNRT  311

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +++  L  A+ +D  RILQQ+VCYD   + T+SV WGYA+Q++  + LLP+ L  Q+++S
Sbjct  312   ESVARLIGASGLDTGRILQQSVCYDSLNTVTVSVVWGYAIQVYEGNKLLPELLTLQKTFS  371

Query  1293  PWRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKA  1469
              WR+       Y F +R Y  DPC R  VF++D V S   +G  S Y      NC   +A
Sbjct  372   TWRRGSGVQSNYMFSTRDYPRDPCGRPLVFFLDSVGSDGNEGTWSNYYLHRVGNCHRAEA  431

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
               R L+ IRV ++KL+L ++++ +PRR CCD+ SSS +K++ I IR+C  +EL+ M+
Sbjct  432   VKR-LERIRVLSRKLELGAEQMGSPRRQCCDI-SSSYNKSMVINIRQCMPDELIAMN  486



>ref|XP_009405000.1| PREDICTED: uncharacterized protein LOC103988176 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009405001.1| PREDICTED: uncharacterized protein LOC103988176 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009405002.1| PREDICTED: uncharacterized protein LOC103988176 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=482

 Score =   436 bits (1120),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 212/424 (50%), Positives = 285/424 (67%), Gaps = 16/424 (4%)
 Frame = +3

Query  408   HIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS-LPPVCISGDT  584
             H++FGIASS  SW +RK ++++WWRP  M+G  FLD        +  DS LPP  +S D+
Sbjct  61    HLLFGIASSSRSWPRRKPYLRIWWRPGLMQGAAFLDSPSAPASGDDDDSRLPPARVSADS  120

Query  585   SSFRYTCRGGNPSAIRLARAVSEAVS----------LNHSDVRWFVFGDDDTVFFPDNLV  734
             S+  Y  +GG  SA+R+AR V E V               D+RW V GDDDT+F P+NL 
Sbjct  121   SNLPYAYKGGLRSAVRVARIVKELVDGVVGNGSSPDARSDDIRWVVLGDDDTLFIPENLA  180

Query  735   KTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYP  914
              TL++YD   WYY+G  SE V QN+  SF MAFGG GFAISYPLAKALA+V DSCL RY 
Sbjct  181   GTLARYDWEQWYYVGAGSESVEQNAKHSFSMAFGGGGFAISYPLAKALARVLDSCLVRYA  240

Query  915   HLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIF  1094
             HLYGSD RV +CL+ELGV LTHEPGFHQ D+RGD+FG+L+AHPL PL+SLHH++  +PIF
Sbjct  241   HLYGSDDRVFSCLAELGVGLTHEPGFHQFDLRGDIFGILSAHPLSPLISLHHIDRVEPIF  300

Query  1095  PNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALR  1274
             P MT   AL+HL+KA +IDP RILQQT+CYD     T+SVSWGY VQ+   + LL D L 
Sbjct  301   PGMTHVAALDHLFKAVNIDPGRILQQTICYDSTKLLTVSVSWGYVVQVFEGNQLLVDLLS  360

Query  1275  AQESYSPWRKNKKD--VPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTE  1448
               ++++PWR+ +    +PY  ++R  + DPC+R  +F+ + V+   ++ I S Y +    
Sbjct  361   LPQTFTPWRRGRNSSLIPYMLNTRELNKDPCKRPDIFFFESVALD-KEKIQSNYTRHAFG  419

Query  1449  NCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             NC  + +  ++L +IRV +Q+L   S   LA RR CCDV  +S++  +EI IR+CK++EL
Sbjct  420   NCQQNMSPAKDLKQIRVFSQQLRRQSG--LAIRRECCDVSQTSSETVMEINIRKCKDDEL  477

Query  1629  VYMH  1640
             + MH
Sbjct  478   IAMH  481



>ref|XP_011036975.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105134322 
[Populus euphratica]
Length=506

 Score =   436 bits (1120),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 224/418 (54%), Positives = 293/418 (70%), Gaps = 10/418 (2%)
 Frame = +3

Query  408   HIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS-----LPPVCI  572
             HIVF IASS  S+  R+ +++LW+ P+  R   FLDR+ V    N   S     LPPV I
Sbjct  91    HIVFSIASSSTSFIHRQPYIRLWYNPTTTRAFAFLDREVVGPTGNINRSVIDPTLPPVII  150

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             S DTSSF YT +GG  SAIR+AR V E V LN  DV WFVFGDDDTVFF +NLV  LSKY
Sbjct  151   SKDTSSFPYTFKGGLKSAIRVARVVKEVVELNEPDVDWFVFGDDDTVFFVENLVTVLSKY  210

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  W+Y+G++SE   QN   SFEM FGG GFAISY LAK LA+V DSCL RY HLYGSD
Sbjct  211   DHNGWFYVGSNSESYGQNVKNSFEMGFGGGGFAISYSLAKVLARVLDSCLVRYAHLYGSD  270

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
             AR+ +CL+ELGV L+HEPGFHQ+D+RGD+FG+L+AHPL PLVSLHH++  +PIFPNM+ T
Sbjct  271   ARIFSCLAELGVGLSHEPGFHQVDMRGDLFGMLSAHPLSPLVSLHHLDAVNPIFPNMSKT  330

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +ALEHL+   ++DP RILQQTVCY+  +S T+SV+WGY+VQ+   +  LPD L    ++ 
Sbjct  331   QALEHLFNGVNVDPARILQQTVCYEPVYSLTVSVAWGYSVQVFEGNEFLPDLLTXHRTFM  390

Query  1293  PWRK--NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDK  1466
             PWR+  N +   + F+ R Y  DPC+R  VF+M+ V+S  ++GI S Y +    +C    
Sbjct  391   PWRRGGNAEFNRFMFNIREYPKDPCKRPLVFFMESVTSG-KNGIWSNYIRHDVADCNRGY  449

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             A  +NL+ ++V +QKL+ D +++ APRR CCD LS   + ++ I IR+C  +EL+ MH
Sbjct  450   AM-KNLELVKVLSQKLEPDIEQMKAPRRQCCD-LSPLFNGSMVISIRKCGADELIAMH  505



>ref|XP_010551745.1| PREDICTED: uncharacterized protein LOC104822287 [Tarenaya hassleriana]
Length=488

 Score =   433 bits (1113),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 213/415 (51%), Positives = 290/415 (70%), Gaps = 8/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T   H++F IA+S +SW +R  +V+LW+ P   R  VFLDR   + +     SLPPV +S
Sbjct  79    TRRRHLLFSIAASHDSWLRRSSYVRLWYSPKSTRALVFLDRGGFESDP----SLPPVIVS  134

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              D S F YT  GG  SAIR+AR V EAV     DVRWFVFGDDDT+FF DNL++ LSKYD
Sbjct  135   EDVSRFPYTFPGGLRSAIRVARVVKEAVDRGDLDVRWFVFGDDDTLFFVDNLLRVLSKYD  194

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             +  WYY+G++SE   QN  +SF+MAFGG GFAIS  LA+ LAKV DSCL RY H+YGSD+
Sbjct  195   YRKWYYVGSNSESYDQNVRYSFDMAFGGGGFAISASLARVLAKVLDSCLMRYSHMYGSDS  254

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ +CL+ELGV+LTHEPGFHQ+DIRG++FGLL AHPL PLVSLHH++  DPIFP +  ++
Sbjct  255   RIFSCLAELGVALTHEPGFHQIDIRGNLFGLLCAHPLSPLVSLHHLDAVDPIFPKLNRSE  314

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             A++HL +A ++D  RILQQ+VCYD+  S T+SV WGYA+Q++  + LLPD L  Q++++ 
Sbjct  315   AMDHLMEAVNVDSTRILQQSVCYDQANSLTVSVVWGYAIQVYEGNKLLPDLLSLQKTFTT  374

Query  1296  WRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKAS  1472
             WR+  +    Y F++R Y  DPC R  VF++D V S    G  S Y +    NC   +A 
Sbjct  375   WRRGSRVQSNYMFNTRDYPRDPCERPLVFFLDGVGSDGSGGTWSNYTRHVVGNCR--RAK  432

Query  1473  PRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYM  1637
              + L++IR+ + K++LD +++ +PRRHCCD+ S S D  + I +REC  +E++ M
Sbjct  433   VKLLEQIRILSPKMELDIEQMKSPRRHCCDI-SPSYDALMVINVRECMGDEIIAM  486



>ref|XP_006850470.1| hypothetical protein AMTR_s00035p00105030 [Amborella trichopoda]
 gb|ERN12051.1| hypothetical protein AMTR_s00035p00105030 [Amborella trichopoda]
Length=469

 Score =   432 bits (1111),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 230/453 (51%), Positives = 309/453 (68%), Gaps = 12/453 (3%)
 Frame = +3

Query  279   NIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRKRK  458
             N++L  +SLC   L+  F+  P    LH  ++       TS  HIVFGIASS ++W  R 
Sbjct  25    NLLLFSTSLC---LLLIFLFHP---WLHCFMNTNHPPPFTSPHHIVFGIASSFKTWPPRS  78

Query  459   EFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLA  638
              +V+LWW+ + MRG  +LDR   + E   +  LP + +S DTS+F YT +GG  SAIR++
Sbjct  79    SYVRLWWK-NTMRGYAWLDRLPPQSETLTSSPLPQLKLSEDTSAFSYTYKGGLRSAIRVS  137

Query  639   RAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFS  818
             R V+E+  L   DVRWFV GDDDTVF  +NLV+ L KYDH   YY+G +SE V QN  ++
Sbjct  138   RIVTESFRLGLDDVRWFVMGDDDTVFCVENLVRVLRKYDHRGLYYVGANSESVEQNDMYA  197

Query  819   FEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQ  998
             F MAFGG GFAISY LA+ LA+V DSCL RYPH+YGSDAR++AC+SELGV LT E GFHQ
Sbjct  198   FGMAFGGGGFAISYGLARVLARVMDSCLRRYPHVYGSDARIYACVSELGVGLTAEAGFHQ  257

Query  999   MDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTV  1178
             +DIRG+VFG L++HPL PLVSLHH++  +PIFPNMT  +ALE LYKA   DP R+LQ+TV
Sbjct  258   VDIRGNVFGFLSSHPLEPLVSLHHVDTVEPIFPNMTRIQALERLYKAIGFDPSRVLQRTV  317

Query  1179  CYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKD--VPYGFDSRGYHP  1352
             CYD+  +WTISVSWGY+VQ+    +L PD L  Q ++ PWR+ + +   PY F+++ +  
Sbjct  318   CYDKSKAWTISVSWGYSVQVFDGIVLFPDLLPLQRTFMPWRRGRTNGSAPYMFNTQEFPR  377

Query  1353  DPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKE  1532
             DPC+R   F++D+V +++ D I S Y +    NC F + S RNL +I V ++K D D  +
Sbjct  378   DPCKRPATFFLDKV-NTYSDKIISKYSRHMMVNCNFRRNSARNLGQIIVHSEKQDSDLNQ  436

Query  1533  LLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
             +   RR CC VL SS D  +EIGI++C  EE++
Sbjct  437   MR--RRDCCGVLPSSYDNVMEIGIKKCGPEEMI  467



>gb|KCW89425.1| hypothetical protein EUGRSUZ_A01724 [Eucalyptus grandis]
Length=422

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 215/420 (51%), Positives = 288/420 (69%), Gaps = 8/420 (2%)
 Frame = +3

Query  387   SSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPV  566
             ++PTS  H++F +ASS  S+ +R+ +++LW+ P+  R   FLDR  + +     D LPP 
Sbjct  8     ATPTSRRHLLFAVASSSLSFPRRRPYLRLWYSPNSTRALAFLDR--LPYGGPAPD-LPPT  64

Query  567   CISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLS  746
              +S DTS F YT  GG  SAIR+AR V E        VRW+VFGDDDTVFF DNLV  LS
Sbjct  65    LVSEDTSRFPYTFPGGLRSAIRVARVVKEVADRGEPGVRWYVFGDDDTVFFVDNLVSVLS  124

Query  747   KYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYG  926
             KYDH  WYY+G++SE   QN  +SF+MAFGG GFAIS  LA ALA+V DSCL RY HLYG
Sbjct  125   KYDHTKWYYVGSNSESYDQNINYSFDMAFGGGGFAISGSLAVALARVLDSCLVRYSHLYG  184

Query  927   SDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMT  1106
             SDAR+ +CL+ELGV LTHEPGFHQ+D+RG++FGLL AHPL PLVSLHH++  DPIFPNM 
Sbjct  185   SDARIFSCLAELGVGLTHEPGFHQVDMRGNLFGLLTAHPLSPLVSLHHLDAVDPIFPNMN  244

Query  1107  TTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQES  1286
              T+ALE L++A ++DP R+LQQ+VCYDR  S +ISVSWGYAVQ++  + LLPD L  Q +
Sbjct  245   KTQALELLFEAVNVDPARVLQQSVCYDRTKSLSISVSWGYAVQVYEGNELLPDLLALQRT  304

Query  1287  YSPWRK--NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTF  1460
             ++PWR+  +     Y F++R +  DPC+R   F++  + S   +G+ S Y      +C  
Sbjct  305   FTPWRRSISAGSSRYMFNTREFPKDPCKRPVTFFLHSILSDE-NGVRSSYEGQIVGHCIR  363

Query  1461  DKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
               A  +NL +I V ++KL+ D +++ A RR CCDVL    + ++ I IR+C + EL+ M 
Sbjct  364   GNAL-KNLKKITVFSRKLEHDIEQMKALRRQCCDVL-PIINGSMVIHIRQCGDNELISMQ  421



>ref|XP_006414552.1| hypothetical protein EUTSA_v10025038mg [Eutrema salsugineum]
 gb|ESQ56005.1| hypothetical protein EUTSA_v10025038mg [Eutrema salsugineum]
Length=487

 Score =   428 bits (1100),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 231/480 (48%), Positives = 307/480 (64%), Gaps = 24/480 (5%)
 Frame = +3

Query  225   KMVF-SQAPVKVKPSQNFKNIVL---ICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSS  392
             +M+F +++P  +  S   +NI L   IC  +C+++   TF       +  ++ SL   S 
Sbjct  23    EMLFPTKSPALI--SARVRNIFLLLTICVIVCILFSYGTF---RREKISSIARSLSVFS-  76

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD---SLPP  563
              T   H++F IA+S +SW +R  +V+LW+ P   R  VFLDR        G D   SLP 
Sbjct  77    -TRRRHLLFSIAASHDSWLRRSSYVRLWYTPESTRAVVFLDR-------GGFDPDLSLPQ  128

Query  564   VCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTL  743
             V +S D S F Y   GG  SAIR+AR V E V     DVRWFVFGDDDTVFF DNLV  L
Sbjct  129   VIVSKDVSRFPYNFPGGLRSAIRVARVVKETVDRGDKDVRWFVFGDDDTVFFVDNLVTVL  188

Query  744   SKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLY  923
             SKYDH  WYY+G++SE   QN  +SF+MAFGG GFAIS  L K LAKV DSCL RY H+Y
Sbjct  189   SKYDHRKWYYVGSNSEFYDQNVRYSFDMAFGGGGFAISASLGKVLAKVLDSCLMRYSHMY  248

Query  924   GSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNM  1103
             GSD+R+ +CL+ELGV+LTHEPGFHQ+D+RG++FGLL AHPL PLVSLHH++  DP FP M
Sbjct  249   GSDSRIFSCLAELGVTLTHEPGFHQIDVRGNLFGLLCAHPLSPLVSLHHLDAVDPFFPKM  308

Query  1104  TTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQE  1283
               T+++  L  AAS+D  RILQQ+VCYD   + T+SV WGYAVQ++  + LLPD L  Q+
Sbjct  309   NRTESVARLIGAASLDSARILQQSVCYDSSNTVTVSVVWGYAVQVYEGNKLLPDLLTLQK  368

Query  1284  SYSPWRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTF  1460
             ++S WR+       Y F +R Y  DPC R  VF++D V     +G  S Y   +  NC  
Sbjct  369   TFSTWRRGSGVQSNYMFSTREYPRDPCGRPLVFFLDSVGPDGAEGTWSSYNLHSVGNCHR  428

Query  1461  DKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              +A  R L  IRV ++KL+ + +++  PRR CCD+ SS  +K++ I IR+C  +EL+ M+
Sbjct  429   AEAVKR-LQYIRVLSRKLERNVEQMNPPRRQCCDI-SSPYNKSMVINIRQCMPDELIAMN  486



>emb|CDY57235.1| BnaC01g42120D [Brassica napus]
Length=472

 Score =   426 bits (1096),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 221/461 (48%), Positives = 299/461 (65%), Gaps = 10/461 (2%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEES  443
             S   +NI L+ + L ++Y++ ++          ++ SL     PT   H++F IA+S  S
Sbjct  19    SPGVRNIFLLLTFLFIIYILFSYGTFRRDRFSSLARSLSVF--PTRRRHLLFSIAASHGS  76

Query  444   WRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPS  623
             W  R  +V+LW+ P   R  VFLDR     +     +LPPV +S D S F Y   GG  S
Sbjct  77    WLARSSYVRLWYSPESTRAVVFLDRGGFDPDP----ALPPVTVSEDVSRFPYNFPGGLRS  132

Query  624   AIRLARAVSEAVSL-NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVV  800
             AIR+AR V EAV   ++ DVRWFVFGDDDTVFF DNLV  LSKYDH  W+Y+G++SE   
Sbjct  133   AIRVARVVKEAVDRGDNKDVRWFVFGDDDTVFFVDNLVTVLSKYDHRKWWYVGSNSEFYD  192

Query  801   QNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTH  980
             QN  +SF+MAFGG GFAIS  L K LAKV DSCL RY H+YGSD+R+ +C++ELGV+LTH
Sbjct  193   QNVRYSFDMAFGGGGFAISASLGKVLAKVLDSCLMRYSHMYGSDSRIFSCVAELGVALTH  252

Query  981   EPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHR  1160
             EPGFHQ+D+RG++FGLL AHPL PLVSLHH++  DP FP    T+++  L +AAS D  R
Sbjct  253   EPGFHQIDVRGNLFGLLCAHPLSPLVSLHHLDAVDPFFPKTNRTESVARLIRAASFDSAR  312

Query  1161  ILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK-DVPYGFDS  1337
             ILQQ+VCYD   + T+SV WGYAVQ++  + LLPD L  Q+++S WR+       Y F +
Sbjct  313   ILQQSVCYDSSNTVTVSVVWGYAVQVYEGNKLLPDLLTVQKTFSTWRRGSGVRSNYMFST  372

Query  1338  RGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLD  1517
             R Y  DPC R  VF++D + S    G  S Y   +  NC   +A  + L  IRV ++KL+
Sbjct  373   REYPRDPCARPLVFFLDSLGSDGTGGTWSSYGLHSVGNCHRAEAV-KGLRNIRVLSRKLE  431

Query  1518  LDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             L+ +++  PRR CCD+ SS  +K++ I IR+C  +EL+ M+
Sbjct  432   LNGEQMNPPRRQCCDI-SSPYNKSMVINIRQCMPDELIAMN  471



>ref|XP_009147484.1| PREDICTED: uncharacterized protein LOC103871019 [Brassica rapa]
Length=473

 Score =   425 bits (1093),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 222/462 (48%), Positives = 298/462 (65%), Gaps = 11/462 (2%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEES  443
             S   +NI L+ + L V+Y++ ++          ++ SL     PT   H++F IA+S  S
Sbjct  19    SPRVRNIFLLLTFLFVIYILFSYGTFRRDRFSSLARSLSVF--PTHRRHLLFSIAASHGS  76

Query  444   WRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPS  623
             W  R  +V+LW+ P   R  VFLDR     +     +LPPV +S D S F Y   GG  S
Sbjct  77    WLSRSSYVRLWYSPESTRAVVFLDRGGFDPDP----ALPPVTVSEDVSRFPYNFPGGLRS  132

Query  624   AIRLARAVSEAVSL--NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDV  797
             AIR+AR V EAV    ++ DVRWFVFGDDDTVFF DNLV  LSKYDH  W+Y+G++SE  
Sbjct  133   AIRVARVVKEAVDRGEDNKDVRWFVFGDDDTVFFVDNLVTVLSKYDHRKWWYVGSNSEFY  192

Query  798   VQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLT  977
              QN  +SF+MAFGG GFAIS  L K LAKV DSCL RY H+YGSD+R+ +C++ELGV+LT
Sbjct  193   DQNVRYSFDMAFGGGGFAISASLGKVLAKVLDSCLMRYSHMYGSDSRIFSCVAELGVALT  252

Query  978   HEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPH  1157
             HEPGFHQ+D+RG++FGLL AHPL PLVSLHH++  DP FP    T+++  L +AAS D  
Sbjct  253   HEPGFHQIDVRGNLFGLLCAHPLSPLVSLHHLDAVDPFFPKTNRTESVARLIRAASFDSA  312

Query  1158  RILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK-DVPYGFD  1334
             RILQQ+VCYD   + T+SV WGYAVQ++  + LLPD L  Q+++S WR+       Y F 
Sbjct  313   RILQQSVCYDSSNTVTVSVVWGYAVQVYEGNKLLPDLLTVQKTFSTWRRGSGVRSNYMFS  372

Query  1335  SRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKL  1514
             +R Y  DPC R  VF++D + S    G  S Y   +  NC   +A    L  IRV ++KL
Sbjct  373   TRDYPRDPCARPLVFFLDGLGSDGTGGTWSSYGLHSVGNCRRAEAV-EGLRNIRVLSRKL  431

Query  1515  DLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             +L+ +++  PRR CCD+ SS  +K++ I IR+C  +EL+ M+
Sbjct  432   ELNGEQMNPPRRQCCDI-SSPYNKSMVINIRQCMPDELIAMN  472



>ref|NP_193259.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE83575.1| uncharacterized protein AT4G15240 [Arabidopsis thaliana]
 gb|AHL38698.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=488

 Score =   425 bits (1093),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 213/416 (51%), Positives = 280/416 (67%), Gaps = 7/416 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T   H++F IA+S +SW +R  +V+LW+ P   R  VFLDR  ++ +     +LPPV +S
Sbjct  78    TRRRHLLFSIAASHDSWLRRSSYVRLWYSPESTRAVVFLDRGGLESDL----TLPPVIVS  133

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              D S F Y   GG  SAIR+AR V E V     DVRWFVFGDDDTVFF DNLV  LSKYD
Sbjct  134   KDVSRFPYNFPGGLRSAIRVARVVKETVDRGDKDVRWFVFGDDDTVFFVDNLVTVLSKYD  193

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  W+Y+G++SE   QN  +SF+MAFGG GFAIS  LAK LAKV DSCL RY H+YGSD+
Sbjct  194   HRKWFYVGSNSEFYDQNVRYSFDMAFGGGGFAISASLAKVLAKVLDSCLMRYSHMYGSDS  253

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ +C++ELGV+LTHEPGFHQ+D+RG++FGLL AHPL PLVSLHH++  DP FP    T+
Sbjct  254   RIFSCVAELGVTLTHEPGFHQIDVRGNIFGLLCAHPLSPLVSLHHLDAVDPFFPKRNRTE  313

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             ++ HL  AAS D  RILQQ+VCYD   + T+SV WGYAVQ++  + LLPD L  Q+++S 
Sbjct  314   SVAHLIGAASFDSGRILQQSVCYDSLNTVTVSVVWGYAVQVYEGNKLLPDLLTLQKTFST  373

Query  1296  WRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKAS  1472
             WR+       Y F +R Y  DPC R  VF++D V S   +G  S Y      +C   +A 
Sbjct  374   WRRGSGVQSNYMFSTREYPRDPCGRPLVFFLDSVGSDGTEGTWSNYNIHRVGHCHRAEAV  433

Query  1473  PRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              R L+ IRV + KL+ + +++  PRR CCD+ SS  +K++ I IR+C  +EL+ M+
Sbjct  434   ER-LERIRVLSPKLERNVEQMGLPRRQCCDI-SSPYNKSMVINIRQCMPDELIAMN  487



>emb|CDY22931.1| BnaA01g18690D [Brassica napus]
Length=473

 Score =   424 bits (1091),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 221/462 (48%), Positives = 297/462 (64%), Gaps = 11/462 (2%)
 Frame = +3

Query  264   SQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEES  443
             S   +NI L+ + L V+Y++ ++          ++ SL     PT   H++F IA+S  S
Sbjct  19    SPRVRNIFLLLTFLFVIYILFSYGTFRRDRFSSLARSLSVF--PTQRRHLLFSIAASHGS  76

Query  444   WRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPS  623
             W  R  +V+LW+ P   R  VFLDR     +     +LPPV +S D S F Y   GG  S
Sbjct  77    WLSRSSYVRLWYSPESTRAVVFLDRGGFDPDP----ALPPVTVSEDVSRFPYNFPGGLRS  132

Query  624   AIRLARAVSEAVSL--NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDV  797
             AIR+AR V E V    ++ DVRWFVFGDDDTVFF DNLV  LSKYDH  W+Y+G++SE  
Sbjct  133   AIRVARVVKETVDRGEDNKDVRWFVFGDDDTVFFVDNLVTVLSKYDHRKWWYVGSNSEFY  192

Query  798   VQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLT  977
              QN  +SF+MAFGG GFAIS  L K LAKV DSCL RY H+YGSD+R+ +C++ELGV+LT
Sbjct  193   DQNVRYSFDMAFGGGGFAISASLGKVLAKVLDSCLMRYSHMYGSDSRIFSCVAELGVALT  252

Query  978   HEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPH  1157
             HEPGFHQ+D+RG++FGLL AHPL PLVSLHH++  DP FP    T+++  L +AAS D  
Sbjct  253   HEPGFHQIDVRGNLFGLLCAHPLSPLVSLHHLDAVDPFFPKTNRTESVARLIRAASFDSA  312

Query  1158  RILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK-DVPYGFD  1334
             RILQQ+VCYD   + T+SV WGYAVQ++  + LLPD L  Q+++S WR+       Y F 
Sbjct  313   RILQQSVCYDSSNTVTVSVVWGYAVQVYEGNKLLPDLLTVQKTFSTWRRGSGVRSNYMFS  372

Query  1335  SRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKL  1514
             +R Y  DPC R  VF++D + S    G  S Y   +  NC   +A    L  IRV ++KL
Sbjct  373   TRDYPRDPCARPLVFFLDGLGSDGTGGTWSSYGLHSVGNCRRAEAV-EGLRNIRVLSRKL  431

Query  1515  DLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             +L+ +++  PRR CCD+ SS  +K++ I IR+C  +EL+ M+
Sbjct  432   ELNGEQMNPPRRQCCDI-SSPYNKSMVINIRQCMPDELIAMN  472



>ref|XP_007043332.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOX99163.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=452

 Score =   419 bits (1077),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 212/431 (49%), Positives = 294/431 (68%), Gaps = 12/431 (3%)
 Frame = +3

Query  249   VKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIA  428
             + + PS+  K+++LI S    ++LV      P    L ++ ++   SS T   H+ F IA
Sbjct  31    LNLTPSR-IKDLLLIFSLFISIFLVFRHPQAP----LPLATTVPFPSS-TCRHHLFFSIA  84

Query  429   SSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCR  608
              S  S+ +R  +++LW+ P   R   FLD+      D    +LPPV +SGDT SF YT +
Sbjct  85    CSSNSFPRRSSYIRLWYTPRATRAVAFLDQPVSSLVD---PTLPPVMVSGDTKSFPYTFK  141

Query  609   GGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSS  788
             GG  SAIR+AR V EAV  N + +RWFVFGDDDTVF  DNLVK LSKYDH  W+Y+G++S
Sbjct  142   GGLRSAIRVARVVKEAVERNETGIRWFVFGDDDTVFIVDNLVKVLSKYDHEKWFYVGSNS  201

Query  789   EDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGV  968
             E   QN  +SF+MAFGG GFAISY L K LA+V DSCL RY HLYGSDARV +CL+ELGV
Sbjct  202   ESYEQNLKYSFDMAFGGGGFAISYSLGKVLARVLDSCLMRYAHLYGSDARVWSCLAELGV  261

Query  969   SLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASI  1148
              LTHE GFHQ+D+RG++FG+L AHPL PLVSLHH++  +P+FPNM+ T+ALEH +KA ++
Sbjct  262   GLTHERGFHQVDMRGNLFGMLTAHPLSPLVSLHHLDAMEPVFPNMSKTQALEHFFKAVNV  321

Query  1149  DPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKK-DVPY  1325
             D  RILQQTVCYDR+ S T+SV+WGYA+Q +  + LLPD L  Q+++SPW++       +
Sbjct  322   DSSRILQQTVCYDRFNSLTVSVAWGYAIQFYEGNQLLPDLLSLQKTFSPWKRGANVGAHF  381

Query  1326  GFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVST  1505
              F++R +  D C+R   F+++ V S  ++ + S+Y + +  NC    A  +NL E++V +
Sbjct  382   MFNTREFPKDSCKRPLGFFLESVGSD-KNVVWSIYTRYSDGNCVRTDAI-KNLKEVKVVS  439

Query  1506  QKLDLDSKELL  1538
             QKL+LD +++L
Sbjct  440   QKLELDMEQVL  450



>gb|KDP25871.1| hypothetical protein JCGZ_22901 [Jatropha curcas]
Length=503

 Score =   418 bits (1074),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 213/415 (51%), Positives = 290/415 (70%), Gaps = 8/415 (2%)
 Frame = +3

Query  399   SLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISG  578
             S  H++F IASS  S+ +R  +++LW+  S  R   FLD   V    +   +LPPV +S 
Sbjct  93    SRRHLLFSIASSASSFPRRASYLRLWYNRSSTRAFAFLD---VNSSISNDPTLPPVILSK  149

Query  579   DTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDH  758
             DTS F Y+ +GG  SAIR+AR V EAV L+  DVRWFVFGDDDTVF  +NLVKTLSKYDH
Sbjct  150   DTSRFPYSYKGGLRSAIRVARLVKEAVDLDQPDVRWFVFGDDDTVFLVENLVKTLSKYDH  209

Query  759   GLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDAR  938
               WYYIG++SE  VQN  +SF+MAFGG GFAISY L + LA+V DSCL RY HLYGSDAR
Sbjct  210   DQWYYIGSNSESYVQNVRYSFDMAFGGGGFAISYSLGRVLARVMDSCLVRYAHLYGSDAR  269

Query  939   VHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKA  1118
             + +CL+ELGV LTHEPGFHQ+D+RG++FG+L+AHPL PLVSLHH++  DP+FP+M+   A
Sbjct  270   IFSCLAELGVGLTHEPGFHQVDMRGNLFGMLSAHPLSPLVSLHHLDAVDPLFPSMSKALA  329

Query  1119  LEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPW  1298
              EHL++AA++DP RILQQTVCYD     T+SV+WGY++Q+   + LLPD L  Q ++ PW
Sbjct  330   AEHLFEAANVDPTRILQQTVCYDSTSRLTVSVAWGYSIQVFEGNELLPDLLSLQRTFRPW  389

Query  1299  RK--NKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKAS  1472
             R+  N  +  Y F+ R Y  D C+R  VF+M+ V+S    G+ S Y +  + +C+  +A 
Sbjct  390   RRAANSDNSLYMFNMREYPRDQCKRPLVFFMESVTSGD-AGVWSTYTRHGSGDCSRAEAI  448

Query  1473  PRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYM  1637
              +NL  ++V +  L+ D +++   RR CCD+   S ++++ I IR+C  +EL+ M
Sbjct  449   -KNLKRVKVFSHMLEPDIEQMKVLRRQCCDIY-PSFNESMVISIRQCGVDELISM  501



>ref|XP_008776386.1| PREDICTED: uncharacterized protein LOC103696507 [Phoenix dactylifera]
Length=387

 Score =   411 bits (1057),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 206/391 (53%), Positives = 270/391 (69%), Gaps = 13/391 (3%)
 Frame = +3

Query  492   MRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVS---  662
             MRG VFLD   V        +LPP  +S D S F Y+ +GG  SA+R+AR   E V    
Sbjct  1     MRGFVFLD-SGVGGGVGDDPTLPPTRVSADASRFPYSFKGGLRSAVRVARIAKELVEAVD  59

Query  663   --LNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFG  836
                   DVRW V GDDDTVFFP+NL  TL+KYD    YY+G  SE + QN   SF MAFG
Sbjct  60    GRFAPGDVRWIVLGDDDTVFFPENLAGTLAKYDWERLYYVGGRSEGLTQNMAHSFGMAFG  119

Query  837   GAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGD  1016
             G G AISYPLA+ALAKV DSCL RY HLYGSDAR+ AC++ELGV LT+EPGFHQ+D+RGD
Sbjct  120   GGGIAISYPLARALAKVLDSCLVRYAHLYGSDARIFACITELGVGLTYEPGFHQVDLRGD  179

Query  1017  VFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWF  1196
             + G+L+AHPL PLVSLHH++  +P+FP+M  T AL+HL++A ++DP RILQQTVCYDR  
Sbjct  180   LLGVLSAHPLAPLVSLHHLDNVEPLFPSMNRTMALKHLFEAVNVDPARILQQTVCYDRLK  239

Query  1197  SWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVP--YGFDSRGYHPDPCRRQ  1370
               T+SVSWGY VQ+   + LLPD L  Q++++PWR+N+      Y F++R +  DPC+R 
Sbjct  240   MLTVSVSWGYTVQVFEGNQLLPDLLSLQQTFAPWRRNRNIASGFYIFNTREFPRDPCKRP  299

Query  1371  TVFYMDRV-SSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPR  1547
              +F+++RV S  HR  I S Y +  T +C    +S +NL +IRVS+Q+L+ +  +  APR
Sbjct  300   AIFFLERVFSGRHR--INSNYSRHVTNDCLQGMSSTKNLQQIRVSSQQLNHEIWQ--APR  355

Query  1548  RHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             R CCDVL SS D  ++I +R+CK++EL+ M 
Sbjct  356   RQCCDVLPSSTDTVMKIDVRKCKDDELIAMQ  386



>gb|ABR17242.1| unknown [Picea sitchensis]
Length=492

 Score =   415 bits (1066),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 226/471 (48%), Positives = 297/471 (63%), Gaps = 31/471 (7%)
 Frame = +3

Query  279   NIVLICSSLCVVYLV-----------CTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGI  425
              ++L C    V +LV           C  VLV   N      S++  ++ TSL+HIVFGI
Sbjct  30    GVILCCWLFYVSFLVLSTHPCWQSSDCLAVLVTGDNAGRKLNSVE--ATATSLDHIVFGI  87

Query  426   ASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTC  605
             A+S   W++RK ++ LWW P   RG V+LDR   +    G    PP+ IS DTS F YT 
Sbjct  88    AASAHKWKQRKPYIDLWWEPGRTRGFVWLDRPVNETSPPG----PPIRISEDTSQFNYTH  143

Query  606   RGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTS  785
               G  SAIR++R VSE   L   DVRWFV GDDDT+F P NLV+ L+KYDH  +YYIG++
Sbjct  144   PQGMRSAIRISRIVSEIFRLGLPDVRWFVMGDDDTLFLPQNLVRVLAKYDHNQYYYIGSN  203

Query  786   SEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELG  965
             SE   QN+  S+ MA+GG GFAISYPLA+ LA+V D CLHRYPHLYGSD RV ACL+ELG
Sbjct  204   SESTDQNAMHSYGMAYGGGGFAISYPLARDLAQVQDDCLHRYPHLYGSDQRVQACLAELG  263

Query  966   VSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAAS  1145
             V LT EPGFHQ DI G++FGLLAAHP+ PLVSLHH+E   P+FPNMT   AL HL +AA 
Sbjct  264   VPLTKEPGFHQFDIHGNLFGLLAAHPIAPLVSLHHLESVAPVFPNMTRVGALRHLMEAAR  323

Query  1146  IDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALR-AQESYSPWRKNKKDVP  1322
             +DP R LQQ++CYD    WT+SVSWGY VQ+    + LP  L    +++  W  + K  P
Sbjct  324   VDPDRALQQSICYDARRKWTVSVSWGYCVQVL-DRIELPRVLEFPLQTFVAWGHSMK-TP  381

Query  1323  YGFDSRGYHPDPCRRQTVFYMDRVSSSH-RDGITSVYRKMT-----TENCT--FDKASPR  1478
             + F++R    +PC+R TV +M+  +S +  + + S Y K+        NC+   D   P 
Sbjct  382   FLFNTRPVPRNPCQRATVLFMENAASGNFSEDVVSRYTKLQPPELINSNCSRGHDGDHPN  441

Query  1479  NLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
             +L +I V ++K+  D    +APRRHCC+V+SS+    +EI IR C++ E V
Sbjct  442   SLQKITVFSKKMRPDWT--MAPRRHCCEVISST-KSGMEIEIRSCRDGEAV  489



>ref|XP_010674122.1| PREDICTED: uncharacterized protein LOC104890362 [Beta vulgaris 
subsp. vulgaris]
Length=492

 Score =   411 bits (1057),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 207/462 (45%), Positives = 292/462 (63%), Gaps = 11/462 (2%)
 Frame = +3

Query  282   IVLICSSLCVVYLVCTFVLVPSTNLL---HVSV---SLQDVSSPTSLEHIVFGIASSEES  443
             I L+ S    ++ + +    P+  L    H+S+   + Q    PT+L H+VFGI ++   
Sbjct  27    ICLLISLFLTLFSLKSLYYSPNITLQTQNHISLPEPAPQPHPEPTNLRHVVFGIGAAANK  86

Query  444   WRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPS  623
             W +RK+F+KLWWRP+  RG VFLDR     E+ G D  P + +S DTS F Y+ R G+ S
Sbjct  87    WGRRKDFIKLWWRPNITRGFVFLDRHVNLSENEGLDDYPILEVSEDTSRFGYSYRRGSRS  146

Query  624   AIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQ  803
             A+R+ R VSE V ++  DVRWFV GDDDTVFFPDNLVK L KYDH   YYIG++SE  +Q
Sbjct  147   ALRMTRIVSEMVRMDLEDVRWFVMGDDDTVFFPDNLVKVLQKYDHNNMYYIGSNSETHIQ  206

Query  804   NSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHE  983
             N +F+++MAFGG GFAISYPLA A+ K+ D+C+ RY  LYGSD R+ ACL+ELGV LT E
Sbjct  207   NIYFTYDMAFGGGGFAISYPLALAIEKIQDTCIQRYTGLYGSDDRIQACLAELGVPLTKE  266

Query  984   PGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRI  1163
             PGFHQ D+ G +FGLL AHP+ PLVSLHH+E+ DP+FP M   ++L+HL     +D   +
Sbjct  267   PGFHQCDVYGSLFGLLTAHPVAPLVSLHHIEIVDPLFPYMGRLESLQHLEAPMKLDSEAL  326

Query  1164  LQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRG  1343
             +QQ++CYDR  +WTISVSWGYAVQI    +   D  RA  ++  W K  +   + F++R 
Sbjct  327   MQQSICYDRSRNWTISVSWGYAVQIIRGFVTPRDMQRATRTFLNWHKRDEPTGFSFNTRS  386

Query  1344  YHPDPCRRQTVFYMDRVSSSHRDGITS---VYRKMTTENCTFDKASPRNLDEIRVSTQKL  1514
             +   PC++  ++Y+  V  +    +T    V+++M    C +   +P  +  + V  +KL
Sbjct  387   FSKHPCQKPYIYYLSNVLLNSNANVTVSDYVHQRMPHPWCWWKVENPEKIHRVEV-YKKL  445

Query  1515  DLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             +   K   APRR CC VL++  +  + I + EC E E++  H
Sbjct  446   N-PHKWDQAPRRDCCKVLNTDKESTVAIDVGECTEGEVIEPH  486



>emb|CAB10303.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78566.1| hypothetical protein [Arabidopsis thaliana]
Length=520

 Score =   409 bits (1050),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 213/448 (48%), Positives = 280/448 (63%), Gaps = 39/448 (9%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T   H++F IA+S +SW +R  +V+LW+ P   R  VFLDR  ++ +     +LPPV +S
Sbjct  78    TRRRHLLFSIAASHDSWLRRSSYVRLWYSPESTRAVVFLDRGGLESDL----TLPPVIVS  133

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              D S F Y   GG  SAIR+AR V E V     DVRWFVFGDDDTVFF DNLV  LSKYD
Sbjct  134   KDVSRFPYNFPGGLRSAIRVARVVKETVDRGDKDVRWFVFGDDDTVFFVDNLVTVLSKYD  193

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  W+Y+G++SE   QN  +SF+MAFGG GFAIS  LAK LAKV DSCL RY H+YGSD+
Sbjct  194   HRKWFYVGSNSEFYDQNVRYSFDMAFGGGGFAISASLAKVLAKVLDSCLMRYSHMYGSDS  253

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ +C++ELGV+LTHEPGFHQ+D+RG++FGLL AHPL PLVSLHH++  DP FP    T+
Sbjct  254   RIFSCVAELGVTLTHEPGFHQIDVRGNIFGLLCAHPLSPLVSLHHLDAVDPFFPKRNRTE  313

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             ++ HL  AAS D  RILQQ+VCYD   + T+SV WGYAVQ++  + LLPD L  Q+++S 
Sbjct  314   SVAHLIGAASFDSGRILQQSVCYDSLNTVTVSVVWGYAVQVYEGNKLLPDLLTLQKTFST  373

Query  1296  WRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKAS  1472
             WR+       Y F +R Y  DPC R  VF++D V S   +G  S Y      +C   +A 
Sbjct  374   WRRGSGVQSNYMFSTREYPRDPCGRPLVFFLDSVGSDGTEGTWSNYNIHRVGHCHRAEAV  433

Query  1473  PRNLDEIRVSTQKLDLDSKE--------------------------------LLAPRRHC  1556
              R L+ IRV + KL+ + ++                                +  PRR C
Sbjct  434   ER-LERIRVLSPKLERNVEQVGFINTDRFSVKVPSILPGFTFFFGFLKIKCQMGLPRRQC  492

Query  1557  CDVLSSSADKALEIGIRECKEEELVYMH  1640
             CD+ SS  +K++ I IR+C  +EL+ M+
Sbjct  493   CDI-SSPYNKSMVINIRQCMPDELIAMN  519



>ref|XP_002961368.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ36628.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=568

 Score =   406 bits (1043),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 210/419 (50%), Positives = 278/419 (66%), Gaps = 15/419 (4%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L +IVFGIA+S + W KR+E+VKLWWRP  MRG V+LD    K   + + +LPP+ IS
Sbjct  157   TGLANIVFGIAASAKLWEKRQEYVKLWWRPGEMRGFVWLD----KAVSSWSKALPPMRIS  212

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              DT+ F YT + G  S IR++R VSE    N +DV WFV GDDDT+F P+NLV+ LSKYD
Sbjct  213   EDTAKFNYTNKKGGRSGIRISRVVSETFRQNLTDVHWFVMGDDDTMFVPENLVRILSKYD  272

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+ SE   QN  FS+ MA+GG GFAISYPLAKALAKV D C+ +YP+LYGSD 
Sbjct  273   HRKFYYIGSHSESHTQNIHFSYNMAYGGGGFAISYPLAKALAKVQDRCIMKYPYLYGSDD  332

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ ACLSELGV LT EPGFHQ DI GD FGLLAAHP+ PLVS+HH+++ DP+FPN T  +
Sbjct  333   RIQACLSELGVPLTKEPGFHQFDIYGDAFGLLAAHPVTPLVSIHHLDLIDPVFPNTTQIE  392

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALR-AQESYS  1292
             AL H   +  +DP  +LQQ++CYD++  W+ISVSWGYAVQ++   +L P  L     ++ 
Sbjct  393   ALRHFKSSMRVDPGGVLQQSICYDKYKRWSISVSWGYAVQVY-RGILPPRLLELPMRTFL  451

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT-SVY----RKMTTENCT  1457
              W +   D+ + F++R +   PC + T+FYM  V      G T S Y    R+     C 
Sbjct  452   SWYRRMDDIGFPFNTRPFLKSPCEQPTIFYMKEVGYGDEAGETISSYSRDRRQRGGGECK  511

Query  1458  FD-KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
                + SP +L+EI V+ ++ D DS   LAPRR CC V+ S+  K +E+ +  C+  E +
Sbjct  512   STLQHSPGSLEEIIVTKEQAD-DSWH-LAPRRQCCRVVKSTK-KMIEVSVGNCESGETI  567



>emb|CDY10034.1| BnaC08g44170D [Brassica napus]
Length=332

 Score =   395 bits (1015),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 193/327 (59%), Positives = 235/327 (72%), Gaps = 8/327 (2%)
 Frame = +3

Query  675   DVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAI  854
             +VRW+VFG D+T+F P+NL +TLSKYDH  WYYIG +SE   QNS F  +MAFGG GFA+
Sbjct  8     EVRWYVFGYDNTMFVPENLARTLSKYDHTSWYYIGANSEIYHQNSKFGHDMAFGGGGFAL  67

Query  855   SYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFH-QMDIRGDVFGLL  1031
             S  LA  LAK FDSC+ RYPHLYG D+R+HAC+ ELGV LTHEPGFH Q D++G+  G+L
Sbjct  68    SSSLANVLAKNFDSCIERYPHLYGGDSRIHACVLELGVGLTHEPGFHQQFDVKGNALGIL  127

Query  1032  AAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTIS  1211
              +H  RPLVSLHH    DPIFPN TT  A  HL+ A  +DP RI Q  VCYDRW+SWTIS
Sbjct  128   TSHSTRPLVSLHHEAHIDPIFPNSTTFTAFRHLFSAVEVDPLRIFQLAVCYDRWYSWTIS  187

Query  1212  VSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDR  1391
             VSWGY VQI G HL L D L+ QE++ P         Y F++R  HPDPC+R   F+M+ 
Sbjct  188   VSWGYTVQIEGRHLYLRDVLKTQETWKP--SGGLASVYTFNTREVHPDPCQRPVTFFMEN  245

Query  1392  VSSSHRDG-ITSVYRKMTTENCTFDK-ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDV  1565
             VSSS  DG I SVY K   ENCT+D  +SPR L+EIRV + +LD D ++L APRR CCD+
Sbjct  246   VSSSPGDGTIKSVY-KQAYENCTYDPISSPRKLEEIRVFSTRLDPDIRQLKAPRRQCCDI  304

Query  1566  L--SSSADKALEIGIRECKEEELVYMH  1640
             L  SS+  K +EIGIRECKE+E +Y+H
Sbjct  305   LPTSSTGGKVMEIGIRECKEDEFIYIH  331



>ref|XP_002973713.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ25373.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=592

 Score =   403 bits (1035),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 204/436 (47%), Positives = 285/436 (65%), Gaps = 11/436 (3%)
 Frame = +3

Query  333   VLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFL  512
             V +PST +      +   ++ T+L +IVFGIA+S   W +R+E+VKLWW+ S MRG V+L
Sbjct  164   VEIPSTTI--AKTEIHTTTTATTLYNIVFGIAASSRLWDRRREYVKLWWKSSQMRGFVWL  221

Query  513   DRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFV  692
             D+ +V+ + + TD  PP  IS  T++F YT + G  +AIR++R VSE   +   DV WFV
Sbjct  222   DK-KVRRKWSKTD-YPPFRISSSTAAFNYTNKMGARAAIRISRIVSETFRIGLPDVHWFV  279

Query  693   FGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAK  872
              GDDDT+F P+NLVK LSKYDH  +YYIG+SSE   QN  FS+ MA+GG GFAISYPLA+
Sbjct  280   MGDDDTIFIPENLVKLLSKYDHTKYYYIGSSSESHTQNLHFSYNMAYGGGGFAISYPLAR  339

Query  873   ALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRP  1052
             AL ++ D CLHRYP+L+GSD R+ AC++ELGV L  EPGFHQ DI GD  GLL+AHP+ P
Sbjct  340   ALERMQDGCLHRYPYLFGSDDRIQACMAELGVPLVKEPGFHQFDIYGDASGLLSAHPVSP  399

Query  1053  LVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAV  1232
             L+S+HH++V  PIFPNMT  +AL+HL ++  +D   ILQQ++CYD+W  W+ SVSWGYAV
Sbjct  400   LISIHHLDVIHPIFPNMTQVQALKHLSRSIKVDAPGILQQSICYDKWRKWSFSVSWGYAV  459

Query  1233  QIHGSHLLLPDALR-AQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHR  1409
             Q++   +L P  L     ++  W +  +D  + F +R    +PC   T+FYMD V   + 
Sbjct  460   QVYRG-ILPPRELELPARTFISWYRRTEDSGFPFSTREISRNPCEPPTIFYMDNVGHKNS  518

Query  1410  DGITSVYRKMTTE--NCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSAD  1583
                 S Y + T    +C +  ASP  +D I V   + + +     APRRHCC V++S   
Sbjct  519   SRSYSTYARETKRRGDCRWKMASPGGIDSIMVYRDRTEGNWHT--APRRHCCRVINSD-K  575

Query  1584  KALEIGIRECKEEELV  1631
             + +EI + +C+  E +
Sbjct  576   RNVEIEVGQCRTGEFI  591



>ref|XP_002975764.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ23393.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=595

 Score =   403 bits (1035),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 204/437 (47%), Positives = 287/437 (66%), Gaps = 10/437 (2%)
 Frame = +3

Query  333   VLVPSTNLLHVSV-SLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVF  509
             V +PST +    + +    S+ T+L +IVFGIA+S   W +R+E+VKLWW+ S MRG V+
Sbjct  164   VEIPSTTIAKTEIHTSTSTSTATTLYNIVFGIAASSRLWDRRREYVKLWWKSSQMRGFVW  223

Query  510   LDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWF  689
             LD+ +V+ + + TD  PP  IS  T++F YT + G  +AIR++R VSE   +   DV WF
Sbjct  224   LDK-KVRRKWSKTD-YPPFRISSSTAAFNYTNKMGARAAIRISRIVSETFRIGLPDVHWF  281

Query  690   VFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLA  869
             V GDDDT+F P+NLVK LSKYDH  +YYIG+SSE   QN  FS+ MA+GG GFAISYPLA
Sbjct  282   VMGDDDTIFIPENLVKLLSKYDHTKYYYIGSSSESHTQNLHFSYNMAYGGGGFAISYPLA  341

Query  870   KALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLR  1049
             +AL ++ D CLHRYP+L+GSD R+ AC++ELGV L  EPGFHQ DI GD  GLL+AHP+ 
Sbjct  342   RALERMQDGCLHRYPYLFGSDDRIQACMAELGVPLVKEPGFHQFDIYGDASGLLSAHPVS  401

Query  1050  PLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYA  1229
             PL+S+HH++V  P+FPNMT  +AL+HL ++  +D   ILQQ++CYD+W  W+ SVSWGYA
Sbjct  402   PLISIHHLDVIHPVFPNMTQVQALKHLSRSIKVDAPGILQQSICYDKWRKWSFSVSWGYA  461

Query  1230  VQIHGSHLLLPDALR-AQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSH  1406
             VQ++   +L P  L     ++  W +  +D  + F +R    +PC + T+FYMD V   +
Sbjct  462   VQVYRG-ILPPRELELPARTFISWYRRTEDSGFPFSTREISRNPCEQPTIFYMDNVGHKN  520

Query  1407  RDGITSVYRKMTTE--NCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSA  1580
                  S Y + T    +C +  ASP  +D I V   + + +     APRRHCC V++S  
Sbjct  521   SSRSYSTYARETKRRGDCRWKMASPGGIDSIMVYRDRTEGNWHT--APRRHCCRVINSD-  577

Query  1581  DKALEIGIRECKEEELV  1631
              + +EI + +C+  E +
Sbjct  578   KRNVEIEVGQCRTGEFI  594



>ref|XP_007209898.1| hypothetical protein PRUPE_ppa004142mg [Prunus persica]
 gb|EMJ11097.1| hypothetical protein PRUPE_ppa004142mg [Prunus persica]
Length=527

 Score =   400 bits (1028),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 201/415 (48%), Positives = 277/415 (67%), Gaps = 6/415 (1%)
 Frame = +3

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             PT +  IVFGIA+S + W++RK ++KLW++P+ MRG V+LDR +V+ ++     LPP+ I
Sbjct  110   PTEINDIVFGIAASAKLWKQRKNYIKLWYKPNSMRGIVWLDR-QVEDKNPEGLGLPPIKI  168

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDTS F YT + G+ SAIR++R VSE + L   DVRWFV GDDDTVF  DNLV+ L KY
Sbjct  169   SGDTSGFAYTNKQGHRSAIRISRIVSETLRLGLKDVRWFVMGDDDTVFITDNLVRVLRKY  228

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  +YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL+K+ D C+ RYP LYGSD
Sbjct  229   DHTQYYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAKALSKMQDRCIQRYPGLYGSD  288

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
              R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLV++HH++V +PIFPN T  
Sbjct  289   DRMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVAPLVTMHHLDVVEPIFPNTTRV  348

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +AL+ L     +D   I+QQ++CYD+  SWTISVSWG+AVQI        +      ++ 
Sbjct  349   QALQRLLVPVKLDSAGIMQQSICYDKSKSWTISVSWGFAVQIFRGVFSPREMEMPSRTFL  408

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITS-VYRKMTTENCTFD  1463
              W K      Y F++R    +PC++  VFYM   RV+++    I+  V  ++   +C + 
Sbjct  409   NWYKRADYTAYAFNTRPVSRNPCQKPFVFYMSRVRVNATMNSTISEYVQHRVPHPHCKWK  468

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              A P +LD++ V  +K D    E  +PRR+CC V+ S     + I +  CKE E+
Sbjct  469   MADPADLDKVEVH-KKPDPHLWE-RSPRRNCCRVMKSKKKGPMVIDVGLCKEGEI  521



>ref|XP_006414551.1| hypothetical protein EUTSA_v10025038mg [Eutrema salsugineum]
 gb|ESQ56004.1| hypothetical protein EUTSA_v10025038mg [Eutrema salsugineum]
Length=462

 Score =   397 bits (1020),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 284/448 (63%), Gaps = 23/448 (5%)
 Frame = +3

Query  225   KMVF-SQAPVKVKPSQNFKNIVL---ICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSS  392
             +M+F +++P  +  S   +NI L   IC  +C+++   TF       +  ++ SL   S 
Sbjct  23    EMLFPTKSPALI--SARVRNIFLLLTICVIVCILFSYGTF---RREKISSIARSLSVFS-  76

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD---SLPP  563
              T   H++F IA+S +SW +R  +V+LW+ P   R  VFLDR        G D   SLP 
Sbjct  77    -TRRRHLLFSIAASHDSWLRRSSYVRLWYTPESTRAVVFLDR-------GGFDPDLSLPQ  128

Query  564   VCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTL  743
             V +S D S F Y   GG  SAIR+AR V E V     DVRWFVFGDDDTVFF DNLV  L
Sbjct  129   VIVSKDVSRFPYNFPGGLRSAIRVARVVKETVDRGDKDVRWFVFGDDDTVFFVDNLVTVL  188

Query  744   SKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLY  923
             SKYDH  WYY+G++SE   QN  +SF+MAFGG GFAIS  L K LAKV DSCL RY H+Y
Sbjct  189   SKYDHRKWYYVGSNSEFYDQNVRYSFDMAFGGGGFAISASLGKVLAKVLDSCLMRYSHMY  248

Query  924   GSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNM  1103
             GSD+R+ +CL+ELGV+LTHEPGFHQ+D+RG++FGLL AHPL PLVSLHH++  DP FP M
Sbjct  249   GSDSRIFSCLAELGVTLTHEPGFHQIDVRGNLFGLLCAHPLSPLVSLHHLDAVDPFFPKM  308

Query  1104  TTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQE  1283
               T+++  L  AAS+D  RILQQ+VCYD   + T+SV WGYAVQ++  + LLPD L  Q+
Sbjct  309   NRTESVARLIGAASLDSARILQQSVCYDSSNTVTVSVVWGYAVQVYEGNKLLPDLLTLQK  368

Query  1284  SYSPWRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTF  1460
             ++S WR+       Y F +R Y  DPC R  VF++D V     +G  S Y   +  NC  
Sbjct  369   TFSTWRRGSGVQSNYMFSTREYPRDPCGRPLVFFLDSVGPDGAEGTWSSYNLHSVGNCHR  428

Query  1461  DKASPRNLDEIRVSTQKLDLDSKELLAP  1544
              +A  R L  IRV ++KL+ + +++  P
Sbjct  429   AEAVKR-LQYIRVLSRKLERNVEQVYTP  455



>gb|KHG00530.1| Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe [Gossypium 
arboreum]
Length=531

 Score =   400 bits (1027),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 199/427 (47%), Positives = 281/427 (66%), Gaps = 6/427 (1%)
 Frame = +3

Query  357   LHVSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHE  536
             L V+V + +   PT ++ IVFG+A+S + W++RKE++K+W++P+ MRG V+LD D VK+ 
Sbjct  105   LAVAVQMPNKPKPTEIQDIVFGVAASSKLWQQRKEYIKIWYKPNKMRGVVWLD-DRVKYS  163

Query  537   DNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVF  716
                  +LPPV +S DTS+F YT R G+ SAIR++R V+E + L   +VRWFV GDDDTVF
Sbjct  164   PEDKQTLPPVRVSSDTSNFAYTNRQGHRSAIRISRIVTETLRLKMDNVRWFVMGDDDTVF  223

Query  717   FPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDS  896
               DNL++ L KYDH  +YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKALAK+ D 
Sbjct  224   ITDNLIRILRKYDHTQYYYIGSLSESHIQNIFFSYGMAYGGGGFAISYPLAKALAKMQDR  283

Query  897   CLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHME  1076
             C+ RYP LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLVSLHH++
Sbjct  284   CIQRYPGLYGSDDRMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVTPLVSLHHLD  343

Query  1077  VYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLL  1256
             V +PIFPN+T  +AL+ L     +D   I+QQ++CYD+  SWTISVSWG+AVQI      
Sbjct  344   VVEPIFPNVTRVEALQRLMLPVKLDSAGIMQQSICYDKSKSWTISVSWGFAVQIFRGIFS  403

Query  1257  LPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYR  1433
               +      ++  W +      Y F++R    +PC++  VFYM +V   S  +   S Y 
Sbjct  404   PREIEMPSRTFLNWYRRADYTAYAFNTRPVSRNPCQKPFVFYMSKVGMDSELNQTVSEYE  463

Query  1434  KMTTEN--CTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIR  1607
             +    +  C +  A+P  L E+ +  +K D    +  +PRR+CC V+ S     + + + 
Sbjct  464   RHRVPHPPCRWKMANPGAL-EMVIVNKKPDPHLWD-RSPRRNCCRVMESKEPGTMVVNVG  521

Query  1608  ECKEEEL  1628
              CK+ E+
Sbjct  522   VCKDGEV  528



>ref|XP_010109542.1| hypothetical protein L484_018277 [Morus notabilis]
 gb|EXC23146.1| hypothetical protein L484_018277 [Morus notabilis]
Length=456

 Score =   396 bits (1017),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 214/403 (53%), Positives = 281/403 (70%), Gaps = 11/403 (3%)
 Frame = +3

Query  387   SSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPV  566
             +S T   H++F IASS  SWR+RK +V+LW+ P   R  VFLD  E   + +   SLPP 
Sbjct  60    ASATHRRHLLFSIASSARSWRRRKPYVRLWYNPKSTRAFVFLDSSEPLSDPD--PSLPPA  117

Query  567   CISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLS  746
              +S D S F YT RGG  SAIR+AR V E V      VRWFVFGDDDTVFF DNLV+TLS
Sbjct  118   IVSEDASRFPYTFRGGLRSAIRVARVVKEVVDRGEPGVRWFVFGDDDTVFFVDNLVRTLS  177

Query  747   KYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYG  926
             KYDH  W+Y+G++SE   QN+  SF+MAFGG GFAIS  LA+ALAKVFDSCL RY HLYG
Sbjct  178   KYDHERWFYVGSNSEGYEQNAKNSFDMAFGGGGFAISSSLARALAKVFDSCLVRYAHLYG  237

Query  927   SDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMT  1106
             SDARV +C++ELGV LTHEPGFHQ+D+RG++FGLL+AHPL PL+SLHH++  DPIFPN  
Sbjct  238   SDARVFSCVAELGVGLTHEPGFHQVDVRGNLFGLLSAHPLSPLLSLHHLDAVDPIFPNTN  297

Query  1107  TTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQES  1286
              T+ALE L++A ++DP RILQQTVCYD     TISV+WGYA+Q+   + LLPD L  Q++
Sbjct  298   RTQALERLFEAVNVDPARILQQTVCYDSSRLLTISVAWGYAIQVFEGNELLPDLLSVQKT  357

Query  1287  YSPWRKNKK-DVP-YGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTF  1460
             ++PWR++ + D   Y F+ R +  D C+    F+++ V S   +GI S Y + +  NC  
Sbjct  358   FTPWRRSARVDASHYMFNMRDFPKDICKGPGAFFLESVISDQ-NGIQSNYARYSAGNCPE  416

Query  1461  DKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKA  1589
             D A+ +NL+ IRV ++ L+LD ++  A      +V+S   +K+
Sbjct  417   DNAT-KNLEYIRVFSKTLELDIEQTTA-----INVISEQYEKS  453



>ref|XP_009799907.1| PREDICTED: uncharacterized protein LOC104245902 [Nicotiana sylvestris]
Length=518

 Score =   398 bits (1022),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 205/415 (49%), Positives = 281/415 (68%), Gaps = 8/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPS-GMRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             T LEH+VFGIA+S + W KRKE++KLWW+P   MRG V+LD + VK   N TDSLP V I
Sbjct  104   TELEHVVFGIAASAKLWNKRKEYIKLWWKPEKKMRGIVWLD-NSVKMLKNETDSLPEVRI  162

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDTS + Y  R G+ SAIR++R VSE + L   +VRWFV GDDDTVF  DNL++ L+KY
Sbjct  163   SGDTSHYAYNNRQGHRSAIRISRIVSETLRLGMENVRWFVMGDDDTVFVTDNLLRILNKY  222

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  +YYIG+ SE  +QN +FS+ MA+GG GFAISYPLAKAL K+ D C+ RYP LYGSD
Sbjct  223   DHNQYYYIGSLSESHLQNIYFSYSMAYGGGGFAISYPLAKALDKMQDRCIQRYPGLYGSD  282

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
              R+ AC++ELGV LT E GFHQ D+ G++FGLLA+HP+ PLVSLHH++V +PIFPN+T  
Sbjct  283   DRMQACMAELGVPLTKELGFHQYDVYGNLFGLLASHPVAPLVSLHHLDVVEPIFPNVTQV  342

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             KAL+ L     +D   I+QQ++CYD+  SWTISVSWG+AVQI    L   +      ++ 
Sbjct  343   KALKQLTVPMKLDSAGIMQQSICYDKVNSWTISVSWGFAVQIFRGVLSPREIEMPSRTFL  402

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITSVYR-KMTTENCTFD  1463
              W +      Y F++R    +PC++  VFYM   ++ SS    ++   R ++    C + 
Sbjct  403   NWYRRADYKAYAFNTRPVMRNPCQKPFVFYMSSAKMDSSGNQTMSQYTRHRVPHPLCRWK  462

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              A+P +++ I+V  +K D    +  +PRR+CC VLSS   K++ + +  C+E+E+
Sbjct  463   MANPADVERIQV-YKKPDPHLWD-RSPRRNCCRVLSSKK-KSMVVDVGVCREDEV  514



>ref|XP_007135113.1| hypothetical protein PHAVU_010G102100g [Phaseolus vulgaris]
 gb|ESW07107.1| hypothetical protein PHAVU_010G102100g [Phaseolus vulgaris]
Length=490

 Score =   397 bits (1019),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 203/437 (46%), Positives = 282/437 (65%), Gaps = 9/437 (2%)
 Frame = +3

Query  339   VPSTNLLHVSVSLQDVSSP----TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCV  506
             +P+    H+S++  +  SP    TSL HIVFGI +S + W++RKE++K+WWRP+ MRG V
Sbjct  55    IPTITHHHISITPPEQESPPFEETSLSHIVFGIGASAKLWKQRKEYIKMWWRPNEMRGVV  114

Query  507   FLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRW  686
             +L++ +VK E    +SLP + ISGDTS F+Y    G+ SAIR++R VSE + L   DVRW
Sbjct  115   WLEQ-KVKPEPGDENSLPLLRISGDTSRFKYKNPKGHRSAIRISRIVSETLRLGMKDVRW  173

Query  687   FVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPL  866
             FV GDDDTVF  +NLVK L KYDH  +YYIG+SSE  +QN +FS+ MA+GG GFAISYPL
Sbjct  174   FVMGDDDTVFVAENLVKVLQKYDHNQFYYIGSSSESHLQNIYFSYNMAYGGGGFAISYPL  233

Query  867   AKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPL  1046
             A AL K+ D C+ RYP LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHPL
Sbjct  234   AVALEKMQDRCIQRYPGLYGSDDRIQACMAELGVPLTKEKGFHQFDVYGNLFGLLAAHPL  293

Query  1047  RPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGY  1226
              PLVSLHH++V +PIFPN++  +AL  L     +DP  ++QQ++CYD+  SWT+SVSWGY
Sbjct  294   APLVSLHHLDVVEPIFPNVSRVQALNRLGGPMKLDPAGLMQQSICYDKARSWTVSVSWGY  353

Query  1227  AVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYM-DRVSSS  1403
             AVQI        +      ++  W K      Y F++R      C++  V+++ + V   
Sbjct  354   AVQIFRGIFSAREMEMPARTFLNWYKRADYTSYPFNTRPVSRHVCQKPFVYFLSEAVHGD  413

Query  1404  HRDGITSVY-RKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSA  1580
               +  +S Y R     +C +    P  +  + V  +K+D    +  APRR+CC V  +  
Sbjct  414   AANETSSRYIRVQKNPDCKWKMEDPTRIKSVEVR-KKIDQHLWD-KAPRRNCCRVRRTKK  471

Query  1581  DKALEIGIRECKEEELV  1631
                L I + EC+E+E+V
Sbjct  472   KGTLVIDVGECREDEVV  488



>ref|XP_004243452.1| PREDICTED: uncharacterized protein LOC101248314 [Solanum lycopersicum]
Length=483

 Score =   396 bits (1017),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 225/492 (46%), Positives = 317/492 (64%), Gaps = 20/492 (4%)
 Frame = +3

Query  195   LFISTEITRGKMVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTF--VLVPSTNL---L  359
             +F S+      MV    P  +      K+++LI S+L + YL+     +  P T+     
Sbjct  1     MFSSSNTVEMPMV----PRFIHTQNRLKDLLLIFSTLVIFYLIFLLHHIQTPKTSFNPNP  56

Query  360   HVSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHED  539
             + S +L   S+  S+ H+ F IA+S  S+  R  ++ LW++P+     VFLD D +    
Sbjct  57    NFSKTLS-TSTNLSISHLFFSIAASSSSFSNRLSYINLWYKPNSTNAVVFLD-DPISIST  114

Query  540   NGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSL----NHSDVRWFVFGDDD  707
                 S PP+ +S DTS F Y+   G  SAIR+AR V +   L    N +D RWFVFGDDD
Sbjct  115   LSVSS-PPILVSSDTSKFPYSFPAGRRSAIRIARIVKDTFDLVKNVNFNDTRWFVFGDDD  173

Query  708   TVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKV  887
             TVFF DNLV+ LSKYD   WYY+G +SE   QN  +SF+MAFGG GFA+S PLAK LA+V
Sbjct  174   TVFFTDNLVRVLSKYDCEKWYYVGYNSESFEQNEKYSFDMAFGGGGFALSAPLAKVLARV  233

Query  888   FDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLH  1067
              DSCL RYPHLYGSD+R+ +C++ELGV LTHEPGFHQ+D+RG++FG+LAAHPL PL+SLH
Sbjct  234   LDSCLIRYPHLYGSDSRIFSCVAELGVHLTHEPGFHQVDVRGNLFGILAAHPLSPLLSLH  293

Query  1068  HMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGS  1247
             H++V +P+FP MT  +A++HL++A   DP RIL+QTVCYD+    T+SV+WGYAVQ+   
Sbjct  294   HLDVVEPLFPGMTRIQAVDHLFQAVHADPARILEQTVCYDKSNLLTVSVAWGYAVQVFEG  353

Query  1248  HLLLPDALRAQESYSPWRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITS  1424
             + LLPD L  Q +++PW++ K     Y  ++R    DPC++  VF++ +V SS  DG+ +
Sbjct  354   NQLLPDLLSLQRTFTPWKRGKNVSASYMLNTRVNPSDPCKKPDVFFLKKVLSS-IDGVWT  412

Query  1425  VYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGI  1604
              Y + +   C   K   + L  IRV +QKLD D ++L APRR CCD+ S+  ++ + +GI
Sbjct  413   EYTRHSVGKCV-RKNPTKKLVNIRVFSQKLDFDVEQLKAPRRPCCDI-SAPINETMIVGI  470

Query  1605  RECKEEELVYMH  1640
             R+C  +EL+ M 
Sbjct  471   RQCGHDELISMQ  482



>ref|XP_009347733.1| PREDICTED: uncharacterized protein LOC103939376 [Pyrus x bretschneideri]
 ref|XP_009347734.1| PREDICTED: uncharacterized protein LOC103939377 [Pyrus x bretschneideri]
Length=523

 Score =   397 bits (1021),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/434 (46%), Positives = 284/434 (65%), Gaps = 11/434 (3%)
 Frame = +3

Query  345   STNLLHVSVSLQD-VSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRD  521
             ++ +L +     D  + PT +  IVFGIA+S + W++RK ++KLW++P  MRG V+LDR 
Sbjct  92    TSQMLQLKTQQPDKANQPTEINDIVFGIAASAKLWKQRKNYIKLWYKPKSMRGIVWLDR-  150

Query  522   EVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGD  701
             +V+ ++     LPP+ ISGDTS F YT + G+ SAIR++R VSE + L   +VRWFV GD
Sbjct  151   KVEDKNPEGVGLPPIKISGDTSGFAYTNKQGHRSAIRISRIVSETLRLGLKNVRWFVMGD  210

Query  702   DDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALA  881
             DDTVF  DNLV+ L KYDH  +YYIG+ SE  +QN FFS+ MA+GG GFAISYPLA AL+
Sbjct  211   DDTVFITDNLVRVLRKYDHTQYYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAMALS  270

Query  882   KVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVS  1061
             K+ D C+ RYP LYGSD R+HAC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLV+
Sbjct  271   KMQDRCIQRYPGLYGSDDRMHACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVAPLVT  330

Query  1062  LHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIH  1241
             +HH++V +PIFPN+T  +ALE L+    +D   I+QQ++CYD+  SWTISVSWG+AVQI 
Sbjct  331   MHHLDVVEPIFPNVTRIQALERLFAPVQLDSAGIMQQSICYDKSKSWTISVSWGFAVQIF  390

Query  1242  GSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGI  1418
                    +      ++  W +      Y F++R    +PC++  V+Y+ +V  ++  +  
Sbjct  391   RGVFSPREMEMPSRTFLNWYRRADYTAYAFNTRPVSRNPCQKPFVYYLSKVRFNATTNST  450

Query  1419  TSVYRKMTT--ENCTFDKASPRNLDEIRVSTQKLDLDSKELL--APRRHCCDVLSSSADK  1586
              S Y +  T   +C +  A+P NLD++ V  +     +  L   +PRR+CC ++ S    
Sbjct  451   ISEYVQHRTPHPHCKWKMANPSNLDKVEVHKKP----NPHLWDRSPRRNCCRIVDSKKKG  506

Query  1587  ALEIGIRECKEEEL  1628
              + I +  CKE E+
Sbjct  507   TMVIDVGLCKEGEI  520



>ref|XP_002980904.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ18089.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=576

 Score =   399 bits (1025),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 210/427 (49%), Positives = 279/427 (65%), Gaps = 23/427 (5%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L +IVFGIA+S + W KR+E+VKLWWRP  MRG V+LD    K   + + +LPP+ IS
Sbjct  157   TGLANIVFGIAASAKLWEKRQEYVKLWWRPGEMRGFVWLD----KAVSSWSKALPPMRIS  212

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              DT+ F YT + G  S IR++R VSE    N +DV WFV GDDDT+F P+NLV+ LSKYD
Sbjct  213   EDTAKFNYTNKKGGRSGIRISRVVSETFRQNLTDVHWFVMGDDDTMFVPENLVRILSKYD  272

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+ SE   QN  FS+ MA+GG GFAISYPLAKALAKV D C+ +YP+LYGSD 
Sbjct  273   HRKFYYIGSHSESHTQNIHFSYNMAYGGGGFAISYPLAKALAKVQDRCIMKYPYLYGSDD  332

Query  936   RVHACLSELGVSLTHEPGFHQM--------DIRGDVFGLLAAHPLRPLVSLHHMEVYDPI  1091
             R+ ACLSELGV LT EPGFHQ+        DI GD FGLLAAHP+ PLVS+HH+++ DP+
Sbjct  333   RIQACLSELGVPLTKEPGFHQVLSLFSWQFDIYGDAFGLLAAHPVTPLVSIHHLDLIDPV  392

Query  1092  FPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDAL  1271
             FPN T  +AL H   +  +DP  +LQQ++CYD++  W+ISVSWGYAVQ++   +L P  L
Sbjct  393   FPNTTQIEALRHFKSSMRVDPGGVLQQSICYDKYKRWSISVSWGYAVQVY-RGILPPRLL  451

Query  1272  R-AQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT-SVY----R  1433
                  ++  W +   D+ + F++R +   PC + T+FYM  V      G T S Y    R
Sbjct  452   ELPMRTFLSWYRRMDDIGFPFNTRPFLKSPCEQPTIFYMKEVGYGDEAGETISSYSRDRR  511

Query  1434  KMTTENCTFD-KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRE  1610
             +     C    + SP +L+EI V+ ++ D DS   LAPRR CC V+ S+  K +E+ +  
Sbjct  512   QRGGGECKSTLQHSPGSLEEIIVTKEQAD-DSWH-LAPRRQCCRVVKSTK-KMIEVSVGN  568

Query  1611  CKEEELV  1631
             C+  E +
Sbjct  569   CESGETI  575



>ref|XP_006297529.1| hypothetical protein CARUB_v10013552mg [Capsella rubella]
 gb|EOA30427.1| hypothetical protein CARUB_v10013552mg [Capsella rubella]
Length=488

 Score =   395 bits (1015),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 212/417 (51%), Positives = 284/417 (68%), Gaps = 7/417 (2%)
 Frame = +3

Query  390   SPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVC  569
             SPT   H++F IASS +SW +R  +V+LW+ P   R  VFLDR   + +     SLPP+ 
Sbjct  76    SPTRRRHLLFSIASSHDSWLRRSSYVRLWYSPESTRAFVFLDRGGFESDL----SLPPLV  131

Query  570   ISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSK  749
             +S D S F Y   GG  SAIR+AR   EAV  +  DVRWFVFGDDDTVFF +NLV+ LSK
Sbjct  132   VSEDVSRFPYNFPGGLRSAIRVARIAKEAVDRDDKDVRWFVFGDDDTVFFVENLVRVLSK  191

Query  750   YDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGS  929
             YDH  W+YIG++SE   QN  +SF+MAFGG GFAIS  LA+AL+KV DSCL RY H+YG 
Sbjct  192   YDHRKWWYIGSNSESFDQNVRYSFDMAFGGGGFAISGSLARALSKVMDSCLMRYSHMYGG  251

Query  930   DARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTT  1109
             D+R+ +CL+ELGV+LTHEPGFHQ+D+RG +FGLL AHPL PL+SLHH++  DP+FP M  
Sbjct  252   DSRIFSCLAELGVTLTHEPGFHQIDVRGSLFGLLCAHPLSPLLSLHHLDAVDPLFPKMNR  311

Query  1110  TKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESY  1289
             T+A+ HL +A+++D  R+LQQ+VCYD   S T+SV WGYA+Q++  + LLPD L  Q+++
Sbjct  312   TEAMAHLIRASNVDSSRVLQQSVCYDSSNSVTVSVVWGYAIQVYEGNKLLPDLLSIQKTF  371

Query  1290  SPWRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDK  1466
               WR+       Y F++R    D C R   F +D V S    G  S Y +   ENC    
Sbjct  372   YTWRRGSGVRSNYMFNTREVPRDRCGRPLEFVLDNVGSDGTRGTWSNYTRYIVENCR-RA  430

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYM  1637
              S ++L ++RV + KL+LD +++ APRR CCD+ S S  +++ I IR+C E+EL+ M
Sbjct  431   DSIKHLKQVRVLSHKLELDVEQMKAPRRQCCDI-SPSYKESMVISIRQCMEDELIAM  486



>ref|XP_009801576.1| PREDICTED: uncharacterized protein LOC104247306 isoform X2 [Nicotiana 
sylvestris]
Length=483

 Score =   395 bits (1014),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 227/473 (48%), Positives = 312/473 (66%), Gaps = 24/473 (5%)
 Frame = +3

Query  264   SQN-FKNIVLICSSLCVVYLVCTFVL----VPSTNLL---HVSVSLQDVSSPTSLEHIVF  419
             SQN  K+++L+ S+L + YL+  F+L     P TN +     + +    S+  SL H+ F
Sbjct  20    SQNRLKDLLLLFSTLVIFYLI--FLLHHLHTPKTNFIPNTDYTPTTPPRSTNLSLSHLFF  77

Query  420   GIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRY  599
              IA++  S+  R  F+ LW++P+     +FLD          + S PP+ +S DTS F Y
Sbjct  78    SIAAASSSFSLRLPFINLWYKPNSTNAVIFLD---TPISTTLSVSSPPILVSSDTSKFPY  134

Query  600   TCRGGNPSAIRLARAVSE----AVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLW  767
             +   G  SAIR+AR V +    A ++N S+ RWF+FGDDDTVFF +NLV  LSKYD+  W
Sbjct  135   SFPSGRRSAIRIARIVKDTFDLAKNVNFSNTRWFIFGDDDTVFFTENLVSVLSKYDYEKW  194

Query  768   YYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHA  947
             YY+G +SE   QN  +SF+MAFGG GFA+S PLAK LA V DSCL RYPHLYGSD+RV +
Sbjct  195   YYVGYNSESYEQNEKYSFDMAFGGGGFALSAPLAKVLAGVLDSCLMRYPHLYGSDSRVFS  254

Query  948   CLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEH  1127
             CL+ELGV LTHEPGFHQ+D+RGD+FG+L+AHPL PL+SLHH++  +P+FP MT   A EH
Sbjct  255   CLAELGVRLTHEPGFHQVDVRGDLFGILSAHPLSPLLSLHHLDAVEPLFPGMTRIAATEH  314

Query  1128  LYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKN  1307
             L++A   DP RI QQTVCY++    T+SV+WGYAVQ+   + LLPD L  Q ++ PW++ 
Sbjct  315   LFQAVQADPARIFQQTVCYNKSNLLTVSVAWGYAVQVFEGNELLPDLLSRQPTFRPWKRG  374

Query  1308  KK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASP-RN  1481
             K     Y F++R    DPC R  V+++  V SS RDGI + Y +    NC   ++SP + 
Sbjct  375   KSVAAKYMFNTRVLPSDPCERPAVYFLQNVLSS-RDGIWNEYVRHDG-NCV--RSSPTKE  430

Query  1482  LDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             L +IRV +QKL  D+++L APRR CCD+ SS  ++ + IGIR+C  +EL+ M 
Sbjct  431   LAKIRVFSQKLAFDAEQLKAPRRSCCDI-SSPINETMIIGIRQCGYDELISMQ  482



>ref|XP_003548651.1| PREDICTED: uncharacterized protein LOC100790149 [Glycine max]
Length=492

 Score =   395 bits (1014),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 196/414 (47%), Positives = 267/414 (64%), Gaps = 5/414 (1%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T++ HIVFGI +S + W++RKE++KLWWRP+ MRG V+L++ +VK E    D LPP+ IS
Sbjct  80    TNISHIVFGIGASAKLWKQRKEYIKLWWRPNEMRGVVWLEQ-KVKTEAQNEDFLPPLRIS  138

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              DTS F+Y  + G+ SAIR++R VSE + L    VRWFV GDDDTVF  +NLVK L KYD
Sbjct  139   SDTSRFKYKNQKGHRSAIRISRIVSETLRLGMEGVRWFVMGDDDTVFVAENLVKVLQKYD  198

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+SSE  +QN +FS+ MA+GG GFAISYPLA AL K+ D C+ RYP LYGSD 
Sbjct  199   HNQFYYIGSSSESHLQNIYFSYNMAYGGGGFAISYPLAVALEKMQDRCIQRYPGLYGSDD  258

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLVSLHH++V +PIFPNM+  +
Sbjct  259   RIQACMAELGVPLTKEKGFHQFDVYGNLFGLLAAHPVTPLVSLHHLDVVEPIFPNMSRVQ  318

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+ L +   +DP  ++QQ++CYD+  +WTISVSWGYAVQI        +      ++  
Sbjct  319   ALKRLNRPMKLDPAGLIQQSICYDKARTWTISVSWGYAVQIFRGIFSAREMEMPARTFLN  378

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRV--SSSHRDGITSVYRKMTTENCTFDKA  1469
             W K      Y F++R      C++  V+Y+ R        +  +   R      C +   
Sbjct  379   WYKRADYTAYPFNTRPVSRHVCQKPFVYYLSRAVYDEGANETASQYVRVQQNPECNWKME  438

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
              P  +  + V  +K D    +  APRR+CC V  +     + I + ECKE+ELV
Sbjct  439   DPTQIKVVHV-YKKPDPHLWD-KAPRRNCCRVRRTKKQGTMVIDVGECKEDELV  490



>emb|CDP12059.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   393 bits (1010),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 209/453 (46%), Positives = 291/453 (64%), Gaps = 21/453 (5%)
 Frame = +3

Query  309   VVYLVCTFVLVPSTNLLHVSVSLQDVSSPT-------SLEHIVFGIASSEESWRKRKEFV  467
             ++++  T+V V +  LL+ S S  D   PT        L+HIVFGIA+S + W KRK ++
Sbjct  42    ILFVSATYV-VYTLKLLNNSRSCDDDFLPTHHRKEKTGLDHIVFGIAASAKLWDKRKNYI  100

Query  468   KLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAV  647
             KLWW+   MRG V+LD + VK  +  +D+LP + ISGDTS F YT R G+ SAIR++R V
Sbjct  101   KLWWKGEKMRGIVWLD-NPVKSREEESDTLPELRISGDTSKFAYTNRQGHRSAIRISRIV  159

Query  648   SEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEM  827
             SE + L   +VRWFV GDDDTVF  +NLV+ L+KYDH  +YYIG+ SE  +QN +FS+ M
Sbjct  160   SETLRLGMENVRWFVMGDDDTVFVTENLVRVLNKYDHNQYYYIGSLSESHLQNIYFSYGM  219

Query  828   AFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDI  1007
             A+GG GFAISYPLAKAL K+ DSC+ RYP LYGSD R+ AC++ELGV LT E GFHQ D+
Sbjct  220   AYGGGGFAISYPLAKALEKMQDSCIQRYPGLYGSDDRMQACMAELGVPLTKELGFHQYDV  279

Query  1008  RGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYD  1187
              G++FGLLAAHP+ P V+LHH++V +PIFPN+T  +AL+ L     +D   ++QQ++CYD
Sbjct  280   YGNLFGLLAAHPVAPFVTLHHLDVVEPIFPNVTRVQALQRLLVPMKLDSAGLMQQSICYD  339

Query  1188  RWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRR  1367
                SWT+SVSWG+A+QI    L   +      ++  W +      Y F++R    +PC++
Sbjct  340   SHRSWTVSVSWGFAIQIFRGVLSPREIEMPSRTFLNWYRRADYTAYAFNTRPVMRNPCQK  399

Query  1368  QTVFYMD--RVSSSHRDGITS-VYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELL  1538
               VFY+   R+ SS    IT  V  ++    C +  A P  LD++ V  +       EL 
Sbjct  400   PFVFYLSRARIDSSRNLTITEYVKHRVPHPACKWKMADPAQLDKVEVYKKP----DPELW  455

Query  1539  --APRRHCCDVLSSSADK-ALEIGIRECKEEEL  1628
               +PRR+CC +L S     A+E+G+  C+E E+
Sbjct  456   NRSPRRNCCRILDSKKKSLAVEVGV--CREGEI  486



>ref|XP_004252583.1| PREDICTED: uncharacterized protein LOC101263884 [Solanum lycopersicum]
Length=508

 Score =   393 bits (1010),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 198/422 (47%), Positives = 282/422 (67%), Gaps = 8/422 (2%)
 Frame = +3

Query  375   LQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPS-GMRGCVFLDRDEVKHEDNGTD  551
             LQ+    T++EH+VFGIA+S + W KRKE++KLWW+P   MRG V+LD + VK E N ++
Sbjct  88    LQEEVEKTNIEHVVFGIAASSKLWNKRKEYIKLWWKPEKKMRGVVWLD-NSVKTEKNESN  146

Query  552   SLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNL  731
             SLP + IS DTS F Y  + G+ SAIR++R +SE + L   +VRWFV GDDDTVF  +NL
Sbjct  147   SLPELRISADTSHFTYNNKQGHRSAIRISRILSETLRLGKENVRWFVMGDDDTVFVTENL  206

Query  732   VKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRY  911
             ++ L+KYDH  +YYIG+ SE  +QN +FS+ MA+GG GFAISYPLAKA+ K+ D C+ RY
Sbjct  207   LRILNKYDHNQYYYIGSLSESHLQNIYFSYSMAYGGGGFAISYPLAKAIDKMQDRCIQRY  266

Query  912   PHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPI  1091
             P LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLA+HP+ PLVSLHH++V +PI
Sbjct  267   PGLYGSDDRMQACMAELGVPLTKELGFHQYDVYGNLFGLLASHPITPLVSLHHLDVVEPI  326

Query  1092  FPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDAL  1271
             FPN+T  + L+ L     +D   I+QQ++CYD+  SWTISVSWG+AVQI    L   +  
Sbjct  327   FPNVTQLQGLQKLTVPMKLDSAGIMQQSICYDKVNSWTISVSWGFAVQIFRGILSPREIE  386

Query  1272  RAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITSVYR-KMT  1442
                 ++  W +      Y F++R    +PC++  VFYM   +++S     +T   R ++ 
Sbjct  387   MPSRTFLNWYRRADYTAYAFNTRPVMRNPCQKSFVFYMSSAKMNSYSNQTVTQYTRHRVP  446

Query  1443  TENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEE  1622
                C +  A+P +++ I+V  +K D    +  +PRR+CC VLSS   K++ + +  C E 
Sbjct  447   PPLCRWKMANPADVERIQV-YKKPDPQLWD-RSPRRNCCRVLSSK-KKSMVVDVGVCSEN  503

Query  1623  EL  1628
             E+
Sbjct  504   EV  505



>ref|XP_009598396.1| PREDICTED: uncharacterized protein LOC104094224 [Nicotiana tomentosiformis]
Length=518

 Score =   393 bits (1010),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 206/417 (49%), Positives = 281/417 (67%), Gaps = 12/417 (3%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRP-SGMRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             T LEH+VFGIA+S + W KRKE++KLWW+P   MRG V+LD + VK   N TDSLP V I
Sbjct  104   TELEHVVFGIAASSKLWNKRKEYIKLWWKPEKKMRGIVWLD-NSVKILKNETDSLPDVRI  162

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDTS F Y  R G+ SAIR++R VSE + L   +VRWFV GDDDTVF  DNL++ L+KY
Sbjct  163   SGDTSHFAYKNRQGHRSAIRISRIVSETLRLGMENVRWFVMGDDDTVFVTDNLLRILNKY  222

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  +YYIG+ SE  +QN +FS+ MA+GG GFAISYPLAKAL K+ D C+ RYP LYGSD
Sbjct  223   DHNQYYYIGSLSESHLQNIYFSYSMAYGGGGFAISYPLAKALDKMQDRCIQRYPGLYGSD  282

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
              R+ AC++ELGV LT E GFHQ D+ G++FGLLA+HP+ PLVS HH++V +PIFPN+T  
Sbjct  283   DRMQACMAELGVPLTKELGFHQYDVYGNLFGLLASHPVAPLVSFHHLDVVEPIFPNVTQV  342

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +AL+ L     +D   I+QQ++CYD+  SWTISVSWG+AVQI    L   +      ++ 
Sbjct  343   QALKQLTVPMKLDSAGIMQQSICYDKVNSWTISVSWGFAVQIFRGVLSPREIEMPSRTFL  402

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITSVYR-KMTTENCTFD  1463
              W +      Y F++R    + C++  VFYM   ++ SS    ++   R ++    C + 
Sbjct  403   NWYRRADYKAYAFNTRPVMRNLCQKPFVFYMSSAKMDSSGNQTVSQYTRNRVPHPLCRWK  462

Query  1464  KASPRNLDEIRVSTQKLD--LDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              A+P +++ I+V  +K D  L S+   +PRR+CC VLSS   K++ + +  CKE+E+
Sbjct  463   MANPADVERIQV-FKKPDPHLWSR---SPRRNCCRVLSSKK-KSMVVDVGVCKEDEV  514



>emb|CDY58245.1| BnaA03g58010D [Brassica napus]
Length=464

 Score =   391 bits (1005),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 215/471 (46%), Positives = 292/471 (62%), Gaps = 38/471 (8%)
 Frame = +3

Query  237   SQAPVKVKPSQNFKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIV  416
             S++P  + P    +NI L+ +   +V+ + T+       +  ++ SL   S  T   H++
Sbjct  28    SKSPSLLSP--RVRNIFLLLTFCSIVFTLFTYCTFRRDQISSIARSLPLFS--TQRRHLL  83

Query  417   FGIASSEESWRKRKEFVKLWWRP-SGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSF  593
             F IA+S +SW +R  +V+LW+ P S  R  VFLDR  +  + + T  LPPV +S D S F
Sbjct  84    FSIAASRDSWLRRSSYVRLWYSPNSSTRAVVFLDRRRLDPDPDHT--LPPVIVSQDVSRF  141

Query  594   RYTCRGGNPSAIRLARAVSEAVSL--NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLW  767
              YT  GG  SAIR+AR V E +    ++ DVRWFVFGDDDTVFF DNLV  LSKYDH  W
Sbjct  142   PYTFPGGLRSAIRVARVVKETIDRGDDNKDVRWFVFGDDDTVFFVDNLVTVLSKYDHRKW  201

Query  768   YYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHA  947
             +Y+G++SE   QN  +SF+MAFGG GFAIS  L K LA+V DSCL RY HLYGSD+R+ +
Sbjct  202   WYVGSNSEFYDQNVRYSFDMAFGGGGFAISASLGKVLARVLDSCLMRYAHLYGSDSRIFS  261

Query  948   CLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEH  1127
             CL+ELGV+LTHEPGFHQ+D+RG++FGLL AHPL PLVSLHH++  DP FP    T+++  
Sbjct  262   CLAELGVALTHEPGFHQIDVRGNLFGLLCAHPLAPLVSLHHLDAVDPFFPKTNRTESVAR  321

Query  1128  LYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKN  1307
             L  AAS D  RILQQ+VCYD     T+SV WGYA+Q++  + LLPD L  Q+++S WR+ 
Sbjct  322   LISAASFDSARILQQSVCYDSSNIVTVSVVWGYAIQVYEGNKLLPDLLTLQKTFSTWRRG  381

Query  1308  KKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLD  1487
                               R   +F       S RD     Y+     NC   +A  R L 
Sbjct  382   SG---------------VRSNYMF-------STRD-----YKLHNVGNCHRAEALKR-LQ  413

Query  1488  EIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              IRV ++KL L+ +++  PRR CCD+ SS  + ++ I IR+C  +EL+ M+
Sbjct  414   RIRVLSRKLKLNVEQMNPPRRQCCDI-SSPFNTSMVINIRQCMPDELIAMN  463



>ref|XP_003547038.2| PREDICTED: uncharacterized protein LOC100794154 [Glycine max]
Length=419

 Score =   390 bits (1001),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 200/418 (48%), Positives = 270/418 (65%), Gaps = 15/418 (4%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+H+VFGIA S   W  RKE++K+WWRP   RG V+LD+ +V+ + N  + LP + IS
Sbjct  7     TELKHVVFGIAGSSNLWHIRKEYIKIWWRPKETRGVVWLDK-KVRSQSN--EGLPDIYIS  63

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS FRYT R G  SA+R++R V+E   L   DVRWFV GDDDT+F  DN+V+ LSKYD
Sbjct  64    GDTSKFRYTNRQGQRSALRISRVVTETFKLGMKDVRWFVMGDDDTMFMVDNVVRILSKYD  123

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+SSE  VQN  FS+ MA+GG GFAISYPLA+ LAK+ D C+ RYP LYGSD 
Sbjct  124   HRHFYYIGSSSESHVQNIHFSYAMAYGGGGFAISYPLAQELAKMQDRCIQRYPALYGSDD  183

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT EPGFHQ D+ GD+ GLL AHP+ PLVSLHH++V  PIFP MT  +
Sbjct  184   RIQACMAELGVPLTREPGFHQYDVYGDLLGLLGAHPVSPLVSLHHLDVVQPIFPRMTRVR  243

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL HL ++ + D   I+QQ++CYD+   W+ISVSWGY VQI    L   +      ++  
Sbjct  244   ALRHLMESVNQDSGSIMQQSICYDKQNFWSISVSWGYVVQILRGVLSPRELEMPSRTFLN  303

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT----SVYRKMTTEN--CT  1457
             W K      Y F++R     PC++  V+YM   +++H D  T     VY +  +++  C 
Sbjct  304   WYKRADYTAYAFNTRPVAKHPCQKPFVYYM---TNTHYDSTTKQVVGVYSRDKSKSPFCR  360

Query  1458  FDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSS-SADKALEIGIRECKEEEL  1628
             +   SP  +  + V+ +   L  K+  +PRR CC +LSS  +   L I +  C+E E+
Sbjct  361   WRMNSPEKITSVVVTKKPDPLRWKK--SPRRDCCRILSSRKSTDTLYIWVGNCQEGEV  416



>emb|CBI34374.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   392 bits (1007),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 205/459 (45%), Positives = 290/459 (63%), Gaps = 15/459 (3%)
 Frame = +3

Query  276   KNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQD-VSSPTSLEHIVFGIASSEESWRK  452
             K +V +   + V Y+V T  LV ++      + +   + + T L HIVFGIA+S + W +
Sbjct  36    KLMVWLILFVSVTYVVYTLKLVSTSRACDDDLLITPPLMTRTELRHIVFGIAASAKLWDQ  95

Query  453   RKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIR  632
             RK ++KLWW+P  MRG V+LD       D G   LPPV ISGDTS F YT + G+PSAIR
Sbjct  96    RKNYIKLWWKPKEMRGIVWLDNQVKTRSDEG---LPPVRISGDTSRFSYTNKQGHPSAIR  152

Query  633   LARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSF  812
             ++R VSE   L   DVRWFV GDDDTVF  +NLV+ L+KYDH  +YYIG+ SE  +QN +
Sbjct  153   ISRIVSETFRLRMKDVRWFVMGDDDTVFITENLVRLLAKYDHNQYYYIGSLSESHLQNIY  212

Query  813   FSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGF  992
             FS+ MA+GG GFAISYPLA+AL ++ D C+ RYP LYGSD R+ AC++ELGV LT E GF
Sbjct  213   FSYSMAYGGGGFAISYPLARALERMQDRCIQRYPGLYGSDDRMQACMAELGVPLTKELGF  272

Query  993   HQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQ  1172
             HQ D+ G++FGLLAAHP+ PLVSLHH++V +PIFPN+T  +AL+ L     +D   ++QQ
Sbjct  273   HQYDVYGNLFGLLAAHPVTPLVSLHHLDVVEPIFPNVTRVEALKQLMVPMKLDSAGLMQQ  332

Query  1173  TVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHP  1352
             ++CYD+   WTISVSWG+AVQI        +      ++  W +      Y F++R    
Sbjct  333   SICYDKAKGWTISVSWGFAVQIFRGIFSPREIEMPSRTFLNWYRKADYTAYAFNTRPVSR  392

Query  1353  DPCRRQTVFYMDRV--SSSHRDGITSVYR-KMTTENCTFDKASPRNLDEIRVSTQKLDLD  1523
             +PC++  VFY+ R    SS    ++   R ++    C +  A P ++D + V  +K D  
Sbjct  393   NPCQKPFVFYLSRARFDSSMNQTVSEYARHRVPHPLCRWKMADPADIDRVEV-YKKPDPH  451

Query  1524  SKELLAPRRHCCDVLS----SSADKALEIGIRECKEEEL  1628
               +  +PRR+CC +L     S+ + A+++G+  C+E E+
Sbjct  452   LWQ-RSPRRNCCRILDSKKRSAKNMAIDVGV--CREGEI  487



>ref|XP_008373511.1| PREDICTED: uncharacterized protein LOC103436813 [Malus domestica]
Length=523

 Score =   393 bits (1010),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 198/432 (46%), Positives = 284/432 (66%), Gaps = 7/432 (2%)
 Frame = +3

Query  345   STNLLHVSVSLQD-VSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRD  521
             ++ +L +     D  + PT +  IVFGIA+S + W++RK ++KLW++P  MRG V+LDR 
Sbjct  92    TSQMLQLKTQQPDKANQPTEINDIVFGIAASAKLWKQRKNYIKLWYKPKSMRGIVWLDR-  150

Query  522   EVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGD  701
             EV+ ++     LPP+ ISGDTS F YT + G+ SAIR++R VSE + L   DVRWFV GD
Sbjct  151   EVEDKNPEGVGLPPIKISGDTSGFAYTNKQGHRSAIRISRIVSETLRLGLKDVRWFVMGD  210

Query  702   DDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALA  881
             DDTVF  DNLV+ L KYDH  +YYIG+ SE  +QN FFS+ MA+GG GFAISYPLA AL+
Sbjct  211   DDTVFITDNLVRVLRKYDHTQYYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAMALS  270

Query  882   KVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVS  1061
             K+ D C+ RYP LYGSD R+HAC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLV+
Sbjct  271   KMQDRCIQRYPGLYGSDDRMHACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVAPLVT  330

Query  1062  LHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIH  1241
             +HH++V +PIFPN+T  +AL+ L+    +D   I+QQ++CYD+  SWTISVSWG+AVQI 
Sbjct  331   MHHLDVVEPIFPNVTRIQALQLLFAPVKLDSAGIMQQSICYDKSKSWTISVSWGFAVQIF  390

Query  1242  GSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGI  1418
                    +      ++  W +      Y F++R    + C++  V+Y+ +V  ++  +  
Sbjct  391   RGVFSPREMEMPSRTFLNWYRRADYTAYAFNTRPVSRNACQKPFVYYLSKVRFNATTNST  450

Query  1419  TSVYRKMTT--ENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKAL  1592
              S Y +  T   +C +  A+P +LD++ V  +K D    +  +PRR+CC ++ S     +
Sbjct  451   ISEYVQHRTPHPHCKWKMANPSSLDKVEVH-KKPDPHLWD-RSPRRNCCRIVDSKKKGTM  508

Query  1593  EIGIRECKEEEL  1628
              I +  CKE E+
Sbjct  509   VIDVGLCKEGEI  520



>ref|XP_006580556.1| PREDICTED: uncharacterized protein LOC100818244 [Glycine max]
Length=511

 Score =   392 bits (1008),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 197/414 (48%), Positives = 276/414 (67%), Gaps = 7/414 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L H+VFGIA+S + W +R+ ++KLW+R   MRG V+LD +EVK E++ +D+LPPV IS
Sbjct  99    TDLRHVVFGIAASAKLWEQRRSYIKLWYRARDMRGVVWLD-EEVKSEES-SDALPPVRIS  156

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDT+ F+YT R G+ SAIR++R VSE + L   DVRWFV GDDDTVF  +NL++ L KYD
Sbjct  157   GDTARFKYTNRQGHRSAIRISRIVSETLRLGMKDVRWFVMGDDDTVFVTENLIRVLRKYD  216

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL K+ D C+ RYP LYGSD 
Sbjct  217   HNQFYYIGSLSESHLQNIFFSYNMAYGGGGFAISYPLAKALQKMQDRCIQRYPGLYGSDD  276

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLA+HP+ PLVSLHH++V +PIFPN+T  +
Sbjct  277   RMQACMAELGVPLTKETGFHQYDVYGNLFGLLASHPVTPLVSLHHLDVVEPIFPNVTRVE  336

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+ L      D   ++QQ++CYD+  SWT+SVSWG+AVQI        +      ++  
Sbjct  337   ALQRLTIPMKFDSAGLMQQSICYDKSKSWTVSVSWGFAVQIFRGVFSPREMEMPSRTFLN  396

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYR--KMTTENCTFDK  1466
             W +      Y F++R    +PC++  VFY  +   +S    I S Y   ++   +C ++ 
Sbjct  397   WYRRADYTAYAFNTRPVSRNPCQKPFVFYFSKAKYNSTMQQIVSEYERHRVPHPDCKWNM  456

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             A+P  L+++ V  +K D    +  APRR+CC V  S   + + I +  C+E E+
Sbjct  457   ANPAALNKVEV-YKKPDPHLWD-RAPRRNCCRVRKSKEKRTMVIDVGMCREGEV  508



>ref|XP_006360694.1| PREDICTED: uncharacterized protein LOC102601770 [Solanum tuberosum]
Length=514

 Score =   392 bits (1007),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 198/415 (48%), Positives = 280/415 (67%), Gaps = 8/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPS-GMRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             T+LEH+VFGIA+S + W KRKE++KLWW+P   MRG V+LD + VK E N + SLP + I
Sbjct  101   TNLEHVVFGIAASSKLWNKRKEYIKLWWKPEKKMRGVVWLD-NSVKTEKNESKSLPELRI  159

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             S DTS F Y  + G+ SAIR++R +SE + L   +VRWFV GDDDTVF  +NL++ L+KY
Sbjct  160   SADTSHFAYNNKQGHRSAIRISRILSETLRLGKENVRWFVMGDDDTVFVTENLLRILNKY  219

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  +YYIG+ SE  +QN +FS+ MA+GG GFAISYPLAKA+ K+ D C+ RYP LYGSD
Sbjct  220   DHNQYYYIGSLSESHLQNIYFSYSMAYGGGGFAISYPLAKAIDKMQDRCIQRYPGLYGSD  279

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
              R+ AC++ELGV LT E GFHQ D+ G++FGLLA+HP+ PLVSLHH++V +PIFPN+T  
Sbjct  280   DRMQACMAELGVPLTKELGFHQYDVYGNLFGLLASHPITPLVSLHHLDVVEPIFPNVTQL  339

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +AL+ L     +D   I+QQ++CYD+  SWTISVSWG+AVQI    L   +      ++ 
Sbjct  340   QALQKLTVPMKLDSAGIMQQSICYDKVNSWTISVSWGFAVQIFRGVLSPREIEMPSRTFL  399

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITSVYR-KMTTENCTFD  1463
              W +      Y F++R    +PC++  VFYM   ++ S +   +T   R ++    C + 
Sbjct  400   NWYRRADYTAYAFNTRPVMRNPCQKSFVFYMSSAKMDSYNNQTVTQYTRHRVPHPLCRWK  459

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              A+P +++ I+V  +K D    +  +PRR+CC VLSS   K++ + +  C E+E+
Sbjct  460   MANPADVERIQV-YKKPDPQLWD-RSPRRNCCRVLSSKK-KSMVVDVGVCSEDEV  511



>ref|XP_009799200.1| PREDICTED: uncharacterized protein LOC104245307 [Nicotiana sylvestris]
Length=493

 Score =   391 bits (1004),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 196/417 (47%), Positives = 267/417 (64%), Gaps = 9/417 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+HIVFGIA+S   W KRKE++KLWW+P  MRG V+LD++    ++ G   LP + IS
Sbjct  83    TGLQHIVFGIAASSNLWDKRKEYIKLWWKPGEMRGVVWLDKNVTIKKNEG---LPEIRIS  139

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             G+T+ F YT R GN SA+R++R VSE + L   DVRWFV GDDDTVF  DN+V+ LSKYD
Sbjct  140   GNTTKFLYTNRQGNRSALRISRVVSETLRLGLKDVRWFVMGDDDTVFAVDNVVRVLSKYD  199

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+SSE  +QN FFS+ MA+GG GFAISYPLAK L K+ D C+ RYP LYGSD 
Sbjct  200   HNQYYYIGSSSESHIQNIFFSYAMAYGGGGFAISYPLAKELEKIQDRCIQRYPGLYGSDD  259

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT EPGFHQ D+ G++ GLL AHP+ PLVS+HH++V DPI P M+   
Sbjct  260   RIQACMAELGVPLTREPGFHQYDVYGNLLGLLGAHPVTPLVSIHHLDVVDPIIPRMSRVD  319

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
              L+ L+++   D   I+QQ++CYD+   W+ISVSWGY VQI   ++   +      ++  
Sbjct  320   GLQRLFESMKYDTASIMQQSICYDKQKYWSISVSWGYVVQITRGNISPRELEMPTRTFLN  379

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVY--RKMTTENCTFDK  1466
             W K      Y F++R     PC++  V+Y+        ++ I  +Y   + +   C +  
Sbjct  380   WYKRADYTAYAFNTRPVTKHPCQKPFVYYISTAKFDRSKNQIVGIYHRHRESYPYCRWKI  439

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYM  1637
              SP N++ I V  +K D D  +  APRR CC VL S+ +  L I +  C + E   M
Sbjct  440   ESPENINAI-VVLKKPDNDRWQ-KAPRRDCCKVLPSN-NSNLYIWVDNCGKGETSEM  493



>ref|XP_004169123.1| PREDICTED: uncharacterized LOC101218166 [Cucumis sativus]
Length=547

 Score =   393 bits (1009),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 198/425 (47%), Positives = 269/425 (63%), Gaps = 8/425 (2%)
 Frame = +3

Query  363   VSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDN  542
             VS+ L+     T L+HIVFGIA S   W KRKE++KLWWRP   RG V+LD+      + 
Sbjct  123   VSLPLKLQRYDTELKHIVFGIAGSSNLWVKRKEYIKLWWRPKETRGVVWLDKKVYAKRNE  182

Query  543   GTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFP  722
             G   LP + ISGDTS F+YT R G  SA+R++R VSE + L   DVRWFV GDDDTVF  
Sbjct  183   G---LPEIRISGDTSRFKYTNRQGQRSALRISRVVSETLRLGMKDVRWFVMGDDDTVFMV  239

Query  723   DNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCL  902
             +N+V+ LSKYDH  +YYIG+SSE  VQN +FS+ MA+GG GFAISYPLAK L K+ D C+
Sbjct  240   ENVVRVLSKYDHSQFYYIGSSSESHVQNIYFSYAMAYGGGGFAISYPLAKELEKMQDKCI  299

Query  903   HRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVY  1082
              RYP LYGSD R+ AC++ELGV LT EPGFHQ D+ GD+ GLL AHP+ PL+SLHH++V 
Sbjct  300   QRYPGLYGSDDRIQACMAELGVPLTREPGFHQYDVYGDLLGLLGAHPVTPLLSLHHLDVV  359

Query  1083  DPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLP  1262
             +PIFP MT  KAL+ L++++++D   I+QQ++CYD+   W+ISVSWGY VQI    +   
Sbjct  360   EPIFPKMTRVKALQRLFQSSNLDSSSIMQQSICYDKKRYWSISVSWGYVVQILRGVISPR  419

Query  1263  DALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITSVYR-  1433
             +      ++  W +      Y F++R     PC++  +FYM   R   + +  +    R 
Sbjct  420   ELEMPTRTFLNWYRRADYTAYAFNTRPVTKHPCQKPFIFYMGTTRYDRTKKQTVGIYIRD  479

Query  1434  KMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIREC  1613
             K     C +  +SP  +D + +  +K D   +   +PRR CC VL S     L + +  C
Sbjct  480   KSRHPFCRWKMSSPDKIDSV-IILKKPD-PYRWQKSPRRDCCRVLPSHKPSTLYLSVGNC  537

Query  1614  KEEEL  1628
             +  E+
Sbjct  538   RGAEI  542



>ref|XP_009363408.1| PREDICTED: uncharacterized protein LOC103953398 [Pyrus x bretschneideri]
Length=523

 Score =   391 bits (1005),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 198/432 (46%), Positives = 282/432 (65%), Gaps = 7/432 (2%)
 Frame = +3

Query  345   STNLLHVSVSLQD-VSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRD  521
             ++ +L +     D  + PT +  IVFGIA+S + W +RK ++KLW++P  MRG V+LDR 
Sbjct  92    TSQILQLKTQKPDKANQPTEISDIVFGIAASAKLWEQRKNYIKLWYKPKSMRGIVWLDR-  150

Query  522   EVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGD  701
             EV+ ++     LPP+ ISGDTS F YT + G+ SAIR++R VSE + L   DVRWFV GD
Sbjct  151   EVEDKNPEGAGLPPIKISGDTSGFTYTNKQGHRSAIRISRIVSETLRLGLKDVRWFVMGD  210

Query  702   DDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALA  881
             DDTVF  DNLV+ L KYDH  +YYIG+ SE  +QN FFS+ MA+GG GFAISYPLA AL+
Sbjct  211   DDTVFITDNLVRVLRKYDHTQYYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLALALS  270

Query  882   KVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVS  1061
             K+ D C+ RYP LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLV+
Sbjct  271   KMQDRCIQRYPGLYGSDDRMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVVPLVT  330

Query  1062  LHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIH  1241
             +HH++V +PIFPN+T  +AL+ L+    +D   I+QQ++CYD+  SWTISVSWG+AVQI 
Sbjct  331   MHHLDVVEPIFPNVTRIQALQRLFIPVKLDSAGIIQQSICYDKSKSWTISVSWGFAVQIF  390

Query  1242  GSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGI  1418
                    +      ++  W +      Y F++R    +PC++  V+Y+ +V  ++  +  
Sbjct  391   RGVFSPREMEMPSRTFLNWYRRADYTAYAFNTRPVSRNPCQKPFVYYLSKVRFNATTNST  450

Query  1419  TSVYRKMTT--ENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKAL  1592
              S Y +  T   +C +  A+P NL ++ V  +K D    +  +PRR+CC ++ S     +
Sbjct  451   ISEYVQHRTPHPHCKWKMANPSNLYKVEVH-KKPDPHLWD-RSPRRNCCRIMESKRKGTM  508

Query  1593  EIGIRECKEEEL  1628
              I +  CKE E+
Sbjct  509   VIDVGLCKEGEI  520



>ref|XP_003532915.1| PREDICTED: uncharacterized protein LOC100795943 [Glycine max]
Length=503

 Score =   390 bits (1003),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 196/414 (47%), Positives = 273/414 (66%), Gaps = 6/414 (1%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L H+VFGIA+S + W +RK ++KLW+R   MRG V+LD ++VK E+N +D+LPPV IS
Sbjct  90    TDLRHLVFGIAASAKLWDQRKSYIKLWYRARDMRGVVWLD-EKVKSEENNSDTLPPVRIS  148

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDT+ F+YT R G+ SAIR++R VSE + L   DVRWFV GDDDTVF  +NL++ L KYD
Sbjct  149   GDTARFKYTNRQGHRSAIRISRIVSETLRLGMKDVRWFVMGDDDTVFVTENLIRVLRKYD  208

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL K+ D C+ RYP LYGSD 
Sbjct  209   HNELYYIGSLSESHLQNIFFSYNMAYGGGGFAISYPLAKALQKMQDRCIQRYPALYGSDD  268

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLA+HP+ PLVSLHH++V +PIFPN+T  +
Sbjct  269   RMQACMAELGVPLTKEIGFHQYDVYGNLFGLLASHPVTPLVSLHHLDVVEPIFPNVTQVE  328

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+ L     +D   ++QQ++CYD+  SWT+SVSWG+AV+I        +      ++  
Sbjct  329   ALQRLTIPMKLDSAGLMQQSICYDKSKSWTVSVSWGFAVEIFRGVFSPREMEMPSRTFLN  388

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYR--KMTTENCTFDK  1466
             W +      Y F++R    +PC++  VFY  +   +S    I S Y   ++   +C +  
Sbjct  389   WYRRADYTAYAFNTRPVSRNPCQKPFVFYFSKAKYNSTMQQIVSEYERHRVPHPDCRWKM  448

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             A+P   D++ V  +K D    +  APRR+CC V  S     + I +  C++ E+
Sbjct  449   ANPAAFDKVEV-YKKPDPHLWD-RAPRRNCCRVRKSKEKGTMVIDVDMCRDGEV  500



>gb|KHN33433.1| hypothetical protein glysoja_005475 [Glycine soja]
Length=544

 Score =   392 bits (1007),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 200/419 (48%), Positives = 270/419 (64%), Gaps = 15/419 (4%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+H+VFGIA S   W  RKE++K+WWRP   RG V+LD+ +V+ + N  + LP + IS
Sbjct  132   TELKHVVFGIAGSSNLWHIRKEYIKIWWRPKETRGVVWLDK-KVRSQSN--EGLPDIYIS  188

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS FRYT R G  SA+R++R V+E   L   DVRWFV GDDDT+F  DN+V+ LSKYD
Sbjct  189   GDTSKFRYTNRQGQRSALRISRVVTETFKLGMKDVRWFVMGDDDTMFMVDNVVRILSKYD  248

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+SSE  VQN  FS+ MA+GG GFAISYPLA+ LAK+ D C+ RYP LYGSD 
Sbjct  249   HRHFYYIGSSSESHVQNIHFSYAMAYGGGGFAISYPLAQELAKMQDRCIQRYPALYGSDD  308

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT EPGFHQ D+ GD+ GLL AHP+ PLVSLHH++V  PIFP MT  +
Sbjct  309   RIQACMAELGVPLTREPGFHQYDVYGDLLGLLGAHPVSPLVSLHHLDVVQPIFPRMTRVR  368

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL HL ++ + D   I+QQ++CYD+   W+ISVSWGY VQI    L   +      ++  
Sbjct  369   ALRHLMESVNQDSGSIMQQSICYDKQNFWSISVSWGYVVQILRGVLSPRELEMPSRTFLN  428

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT----SVYRKMTTEN--CT  1457
             W K      Y F++R     PC++  V+YM   +++H D  T     VY +  +++  C 
Sbjct  429   WYKRADYTAYAFNTRPVAKHPCQKPFVYYM---TNTHYDSTTKQVVGVYSRDKSKSPFCR  485

Query  1458  FDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSS-SADKALEIGIRECKEEELV  1631
             +   SP  +  + V+ +   L  K+  +PRR CC +LSS  +   L I +  C+E E+ 
Sbjct  486   WRMNSPDKITSVVVTKKPDPLRWKK--SPRRDCCRILSSRKSTNTLYIWVGNCQESEVT  542



>ref|XP_009769878.1| PREDICTED: uncharacterized protein LOC104220673 [Nicotiana sylvestris]
Length=496

 Score =   390 bits (1002),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 194/415 (47%), Positives = 269/415 (65%), Gaps = 9/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+HIVFGIA+S   W KRKE++KLWWRP   RG V+LD++    + N  ++LP + IS
Sbjct  84    TELKHIVFGIAASSNLWDKRKEYIKLWWRPGETRGVVWLDKNV---KTNRNEALPDIKIS  140

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS F YT R G  SA+R++R VSE + L   DVRWFV GDDDTVF  +N+V+ LSKYD
Sbjct  141   GDTSKFLYTNRQGKRSALRISRVVSETLRLGLKDVRWFVMGDDDTVFIVENVVRVLSKYD  200

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+SSE  VQN FFS+ MA+GG GFAISYPLAK L K+ D C+ RYP LYGSD 
Sbjct  201   HNQYYYIGSSSESHVQNIFFSYAMAYGGGGFAISYPLAKELEKMQDRCIQRYPGLYGSDD  260

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++ GLL AHP+ PLVSLHH++V DPIFP M+   
Sbjct  261   RIQACMAELGVPLTKERGFHQYDVYGNLLGLLGAHPVSPLVSLHHLDVVDPIFPGMSRVS  320

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
              L+ L+++A +D   ++QQ++CYD+   W+IS+SWGY VQI   ++   +      ++  
Sbjct  321   GLQRLFESAKLDSASLMQQSICYDKERYWSISISWGYVVQIIRGNISPRELEMPTRTFLN  380

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSH-RDGITSVY--RKMTTENCTFDK  1466
             W +      Y F++R     PC++  V+YM+       R  I  +Y   +  +  C +  
Sbjct  381   WYRRADYTAYAFNTRPVAKHPCQKPFVYYMNTAKYDRTRKQIVGIYYRHREPSPYCRWKV  440

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKA-LEIGIRECKEEEL  1628
              SP N++ I V  ++ D  ++   +PRR CC VL S+  K  L + +  C++ E+
Sbjct  441   ESPENINNI-VLLKRPD-SNRWQKSPRRECCGVLPSNNSKTNLYMWVGSCRDGEI  493



>ref|XP_003542010.2| PREDICTED: uncharacterized protein LOC100778156 [Glycine max]
Length=538

 Score =   392 bits (1006),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 200/421 (48%), Positives = 272/421 (65%), Gaps = 15/421 (4%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+H+VFGIA S   W  RKE++K+WWRP   RG V+LD+ +V+ + N  + LP + IS
Sbjct  126   TELKHVVFGIAGSSNLWHIRKEYIKIWWRPKKTRGVVWLDQ-KVRTQSN--EGLPDIHIS  182

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS FRYT R G  SA+R++R V+E + L   DVRWFV GDDDTVF  DN+V+ LSKYD
Sbjct  183   GDTSKFRYTNRQGQRSALRISRVVTETLKLGMKDVRWFVMGDDDTVFMVDNVVRILSKYD  242

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+SSE  VQN  FS+ MA+GG GFAISYPLA+ LAK+ D C+ RYP LYGSD 
Sbjct  243   HRHFYYIGSSSESHVQNIHFSYAMAYGGGGFAISYPLAQELAKMQDRCIQRYPALYGSDD  302

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT EPGFHQ D+ GD+ GLL AHP+ PLVSLHH++V  PIFP MT  +
Sbjct  303   RIQACMAELGVPLTREPGFHQYDVYGDLLGLLGAHPVSPLVSLHHLDVVQPIFPRMTRVR  362

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL HL ++ + D   I+QQ++CYD+   W+ISVSWGY VQI    L   +      ++  
Sbjct  363   ALRHLMESVNQDSGSIMQQSICYDKHSFWSISVSWGYVVQILRGVLSPRELEMPSRTFLN  422

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT----SVYRKMTTEN--CT  1457
             W +      Y F++R     PC++  V+YM+   ++H D  T     VY +  +++  C 
Sbjct  423   WYRRADYTAYAFNTRPVAKHPCQKPFVYYMN---NTHYDSTTKQVVGVYSRDKSKSPFCR  479

Query  1458  FDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSS-SADKALEIGIRECKEEELVY  1634
             +   SP  +  + V+ +   L  K+  +PRR CC +LSS  +   L I +  C+E E+  
Sbjct  480   WRMNSPEKITSVVVTKKPDPLRWKK--SPRRDCCRLLSSRKSANTLYIWVGNCQEGEVTE  537

Query  1635  M  1637
             +
Sbjct  538   L  538



>ref|XP_002531833.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF30553.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=498

 Score =   390 bits (1002),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 194/414 (47%), Positives = 266/414 (64%), Gaps = 8/414 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+HIVFGIA+S   W KRKE+VK+WWRP   RG V++DR  V+   N  D LP + +S
Sbjct  87    TELKHIVFGIAASANLWEKRKEYVKIWWRPRETRGIVWMDR-RVRSRRN--DGLPEIRVS  143

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              DTS F+Y+ R G+ SAIR++R VSE + L   DVRWFV GDDDTVF  +N+V+ LSKYD
Sbjct  144   ADTSRFKYSNRQGHRSAIRISRVVSETLRLGLKDVRWFVMGDDDTVFIVENVVRILSKYD  203

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YY+G+SSE  +QN +FS+ MA+GG GFAISYPLA+ LAK+ D C+ RYP LYGSD 
Sbjct  204   HRQFYYVGSSSESHLQNIYFSYAMAYGGGGFAISYPLAQQLAKMQDKCIQRYPGLYGSDD  263

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC+SELGV LT EPGFHQ D+ GD+ GLL AHP+ PL SLHH++V  P+FP MT  K
Sbjct  264   RIQACMSELGVPLTKEPGFHQYDVYGDLLGLLGAHPVTPLASLHHLDVVQPVFPRMTRVK  323

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+HL+++  +D   I+QQ++CYD+   W+ISVSWG+ VQI    +   +      ++  
Sbjct  324   ALQHLFQSVRLDSGSIMQQSICYDKKRYWSISVSWGFVVQIWRGVISPRELETPTRTFLN  383

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSH-RDGITSVYRKMTTEN--CTFDK  1466
             W +      Y F++R     PC +  +FYM        +  I SVY +  +    C +  
Sbjct  384   WYRKADYTAYAFNTRPVTKHPCLKPFIFYMSATKYDRAKKHIVSVYNRHKSRAPYCRWRM  443

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             ASP  ++ + V  +   L  +   +PRR C  VL S+    L + + +C+E E+
Sbjct  444   ASPEKINSVVVLKRPDILRWQR--SPRRDCSRVLPSNRSSTLYLWVGDCREGEI  495



>ref|XP_010529619.1| PREDICTED: uncharacterized protein LOC104806420 [Tarenaya hassleriana]
Length=527

 Score =   391 bits (1005),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 199/415 (48%), Positives = 270/415 (65%), Gaps = 6/415 (1%)
 Frame = +3

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             PT L H+VFGIA+S + W++RKE++K+W++P  MRG V+LD+ EV+ +      LPPV I
Sbjct  112   PTDLHHVVFGIAASSKLWKQRKEYIKIWYKPKFMRGYVWLDK-EVRADAGDKGDLPPVKI  170

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDTSSF Y  + G+ SA+R++R VSE + L   +VRWFV GDDDTVF  DNL++ L KY
Sbjct  171   SGDTSSFPYKNKQGHRSALRISRIVSETLRLGPKNVRWFVMGDDDTVFVTDNLIRVLRKY  230

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL+K+ D C+ RYP LYGSD
Sbjct  231   DHEQMYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAKALSKMQDRCIQRYPALYGSD  290

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
              R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ P VS+HH++V +PIFPN T  
Sbjct  291   DRMQACMAELGVPLTKEIGFHQYDVYGNLFGLLAAHPVTPFVSMHHLDVVEPIFPNTTRV  350

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             KAL+ L     +D   +LQQ++CYD++ SWTISVSWGYAVQ+        +      ++ 
Sbjct  351   KALKRLTIPMQLDSAGLLQQSICYDKYKSWTISVSWGYAVQVFRGIFSPREMEMPSRTFL  410

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT-SVYRKMTTEN--CTFD  1463
              W K      Y F++R     PC++  VFYM       +   T S Y ++   +  C + 
Sbjct  411   NWYKRADYTAYAFNTRPVSRHPCQKPFVFYMSGAKFDRQLNTTVSEYSRLRVPHPACRWK  470

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              A P  ++ I V  +K D    E  +PRR+CC VL +  +  L I +  C+E E+
Sbjct  471   MADPAEVNTI-VVYKKQDPHLWE-RSPRRNCCRVLQTKRNNTLWINVGICREGEV  523



>ref|XP_004148789.1| PREDICTED: uncharacterized protein LOC101218166 [Cucumis sativus]
Length=547

 Score =   392 bits (1006),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 198/425 (47%), Positives = 268/425 (63%), Gaps = 8/425 (2%)
 Frame = +3

Query  363   VSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDN  542
             VS  L+     T L+HIVFGIA S   W KRKE++KLWWRP   RG V+LD+      + 
Sbjct  123   VSFPLKLQRYDTELKHIVFGIAGSSNLWVKRKEYIKLWWRPKETRGVVWLDKKVYAKRNE  182

Query  543   GTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFP  722
             G   LP + ISGDTS F+YT R G  SA+R++R VSE + L   DVRWFV GDDDTVF  
Sbjct  183   G---LPEIRISGDTSRFKYTNRQGQRSALRISRVVSETLRLGMKDVRWFVMGDDDTVFMV  239

Query  723   DNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCL  902
             +N+V+ LSKYDH  +YYIG+SSE  VQN +FS+ MA+GG GFAISYPLAK L K+ D C+
Sbjct  240   ENVVRVLSKYDHSQFYYIGSSSESHVQNIYFSYAMAYGGGGFAISYPLAKELEKMQDKCI  299

Query  903   HRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVY  1082
              RYP LYGSD R+ AC++ELGV LT EPGFHQ D+ GD+ GLL AHP+ PL+SLHH++V 
Sbjct  300   QRYPGLYGSDDRIQACMAELGVPLTREPGFHQYDVYGDLLGLLGAHPVTPLLSLHHLDVV  359

Query  1083  DPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLP  1262
             +PIFP MT  KAL+ L++++++D   I+QQ++CYD+   W+ISVSWGY VQI    +   
Sbjct  360   EPIFPKMTRVKALQRLFQSSNLDSSSIMQQSICYDKKRYWSISVSWGYVVQILRGVISPR  419

Query  1263  DALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITSVYR-  1433
             +      ++  W +      Y F++R     PC++  +FYM   R   + +  +    R 
Sbjct  420   ELEMPTRTFLNWYRRADYTAYAFNTRPVTKHPCQKPFIFYMGTTRYDRTKKQTVGIYIRD  479

Query  1434  KMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIREC  1613
             K     C +  +SP  +D + +  +K D   +   +PRR CC VL S     L + +  C
Sbjct  480   KSRHPFCRWKMSSPDKIDSV-IILKKPD-PYRWQKSPRRDCCRVLPSHKPSTLYLSVGNC  537

Query  1614  KEEEL  1628
             +  E+
Sbjct  538   RGAEI  542



>ref|XP_006439493.1| hypothetical protein CICLE_v10019694mg [Citrus clementina]
 ref|XP_006476515.1| PREDICTED: uncharacterized protein LOC102619699 [Citrus sinensis]
 gb|ESR52733.1| hypothetical protein CICLE_v10019694mg [Citrus clementina]
Length=527

 Score =   391 bits (1004),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 200/418 (48%), Positives = 275/418 (66%), Gaps = 8/418 (2%)
 Frame = +3

Query  384   VSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPP  563
             V   T + HIVFGIA+S + W +RKE++K+W++P+ MRG V+LD D VK   N TD+LPP
Sbjct  112   VQRATEIHHIVFGIAASAKLWNQRKEYIKIWYQPNDMRGVVWLD-DSVK--SNETDNLPP  168

Query  564   VCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTL  743
             V IS DTS F Y  + G+ SAIR++R VSE + L   +VRWFV GDDDTVF  +NLV+ L
Sbjct  169   VKISSDTSQFPYKNKQGHRSAIRISRIVSETLRLGLRNVRWFVMGDDDTVFITENLVRVL  228

Query  744   SKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLY  923
              KYDH  +YYIG+ SE  +QN +FS+ MA+GG GFAISYPLAKAL K+ D C+HRYP LY
Sbjct  229   RKYDHNQYYYIGSLSESHLQNIYFSYGMAYGGGGFAISYPLAKALVKMQDRCIHRYPGLY  288

Query  924   GSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNM  1103
             GSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLVSLHH++V +PIFPNM
Sbjct  289   GSDDRMQACMAELGVPLTKEFGFHQYDVYGNLFGLLAAHPVTPLVSLHHLDVVEPIFPNM  348

Query  1104  TTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQE  1283
             T  +AL+HL     +D   ++QQ++CYD+  +WTISVSWG+AVQI        +      
Sbjct  349   TRVQALQHLMVPKKLDSAALMQQSICYDKRRTWTISVSWGFAVQIFRGIFSPREMEMPSR  408

Query  1284  SYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRV--SSSHRDGITSVYR-KMTTENC  1454
             ++  W +      Y F++R    + C++  VFYM +   +S+    ++   R ++    C
Sbjct  409   TFLNWYRRADYTAYAFNTRPVSRNHCQKPFVFYMSKAEFNSTMNQTVSEYARHRIPHPQC  468

Query  1455  TFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              +  A+P  LD + V  +K D    +  +PRR+CC VL S     +EI +  C+  E+
Sbjct  469   RWKMANPAELDTL-VIYKKPDPYLWD-RSPRRNCCRVLKSKKKGVMEIDVGVCRPGEV  524



>ref|XP_010276911.1| PREDICTED: uncharacterized protein LOC104611526 [Nelumbo nucifera]
Length=525

 Score =   391 bits (1004),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 196/413 (47%), Positives = 267/413 (65%), Gaps = 8/413 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+HIVFGIA+S   W +RK ++K+WWRP  MRG V+LD     H+D G   LPP+ IS
Sbjct  116   TGLQHIVFGIAASARLWEQRKNYIKIWWRPKEMRGIVWLDNPVKSHKDEG---LPPLKIS  172

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS F Y  R G+ SAIR++R VSE + L   DVRWFV GDDDTVF P+NLV+ LSKYD
Sbjct  173   GDTSRFSYKNRQGHRSAIRISRIVSETLRLGMKDVRWFVMGDDDTVFIPENLVRVLSKYD  232

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+ SE  +QN +FS+ MA+GG GFAISYPLAK L K+ D C+ RYP LYGSD 
Sbjct  233   HNQFYYIGSLSESHLQNIYFSYGMAYGGGGFAISYPLAKELEKMQDRCIQRYPGLYGSDD  292

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT + GFHQ D+ G++FGLLAAHP+ PLVSLHH++V +PIFPN+T  K
Sbjct  293   RMQACMAELGVPLTKDLGFHQYDVYGNLFGLLAAHPVTPLVSLHHLDVVEPIFPNVTRVK  352

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+ L     +D   ++QQ++CYD+  SWT+SVSWG+AVQI        +      ++  
Sbjct  353   ALQRLMVPMKLDSAGLMQQSICYDKEKSWTLSVSWGFAVQIFRGVFSPREMEMPSRTFLN  412

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFY--MDRVSSSHRDGITSVYR-KMTTENCTFDK  1466
             W +      Y F++R    +PC++  VFY  M +  S+ +  ++  +R ++    C +  
Sbjct  413   WYRKADYTAYAFNTRPVTRNPCQKPFVFYLSMAKYDSTTKQTVSEYHRHRVPHPVCRWKM  472

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEE  1625
             A P +++  RV   K         +PRR+CC V+ S     + I +  C+E E
Sbjct  473   ADPEDIE--RVVVYKRPDPHLWDKSPRRNCCRVMPSGKRGNVVIDVGVCREGE  523



>ref|XP_004245574.1| PREDICTED: uncharacterized protein LOC101249113 [Solanum lycopersicum]
Length=516

 Score =   390 bits (1002),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 201/421 (48%), Positives = 276/421 (66%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   QDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSG-MRGCVFLDRDEVKHEDNGTDS  554
             ++    T LEHIVFGIA+S + W KRK+++KLWW+P   MRG V+LD+  VK      +S
Sbjct  97    EETEEKTGLEHIVFGIAASAKLWDKRKDYIKLWWKPEEEMRGIVWLDK-PVKTSKGDGES  155

Query  555   LPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLV  734
             LP + ISGDTS F Y  R G+ SAIR++R VSE + L   +VRWFV GDDDTVF  DNLV
Sbjct  156   LPELRISGDTSRFAYKNRQGHRSAIRISRIVSETLRLGMENVRWFVMGDDDTVFVTDNLV  215

Query  735   KTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYP  914
             + L+KYDH  +YYIG+SSE  +QN +FS+ MA+GG GFAISYPLAKAL K+ D C+ RYP
Sbjct  216   RILNKYDHNQYYYIGSSSESHLQNIYFSYNMAYGGGGFAISYPLAKALEKMQDKCIQRYP  275

Query  915   HLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIF  1094
              LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLA+HP+ PLV+LHH++V +PIF
Sbjct  276   GLYGSDDRMQACMAELGVPLTKELGFHQYDVYGNLFGLLASHPIAPLVTLHHLDVVEPIF  335

Query  1095  PNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALR  1274
             PN+T  +AL  L     +D   ++QQ++CYD+  SWTISVSWG+AVQI    L   +   
Sbjct  336   PNVTRVQALRRLTLPMKLDSAGLMQQSICYDKANSWTISVSWGFAVQIFRGVLSPREMEM  395

Query  1275  AQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITSVYR-KMTT  1445
                ++  W K      Y F++R    +PC++  VFY+   ++  S    ++   R ++  
Sbjct  396   PSRTFLNWYKRADYTAYAFNTRPVARNPCQKPFVFYLSSAKMDPSSNQTVSQYSRHRVPH  455

Query  1446  ENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEE  1625
               C +    P ++D ++V  +K D    +  +PRR+CC VLSS   K + + +  CKE E
Sbjct  456   PACKWKTTDPADVDRVQV-YKKPDPHLWD-RSPRRNCCRVLSSKG-KNMVVDVGVCKEGE  512

Query  1626  L  1628
             L
Sbjct  513   L  513



>ref|XP_006360583.1| PREDICTED: uncharacterized protein LOC102586004 [Solanum tuberosum]
Length=483

 Score =   389 bits (999),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 223/489 (46%), Positives = 313/489 (64%), Gaps = 20/489 (4%)
 Frame = +3

Query  195   LFISTEITRGKMVFSQAPVKVKPSQNFKNIVLICSSLCVVYLVCTF--VLVPSTNLLHVS  368
             +F S+      MV    P  +      K+++LI S+L + YL+     +  P T+     
Sbjct  1     MFSSSNTVEMPMV----PRFIHTQNRLKDLLLIFSTLVIFYLIFLLHHIHTPKTSFNPNP  56

Query  369   VSLQDVSSPT--SLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDN  542
                +  S PT  S+ H+ F IA+S  S+  R  ++ LW++P+     VFLD D +     
Sbjct  57    NFSKTPSIPTNLSISHLFFSIAASSSSFSNRLSYINLWYKPNSTNAVVFLD-DPISISTL  115

Query  543   GTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSL----NHSDVRWFVFGDDDT  710
                S PP+ +S DTS F Y+   G  SAIR+AR V +   L    N +D RWFVFGDDDT
Sbjct  116   SVSS-PPILVSSDTSKFPYSFPAGRRSAIRIARIVKDTFDLVKNVNFNDTRWFVFGDDDT  174

Query  711   VFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVF  890
             VFF DNLV+ LSKYD   WYY+G +SE   QN  +SF+MAFGG GFA+S PLAK LA+V 
Sbjct  175   VFFTDNLVRVLSKYDCEKWYYVGYNSESFEQNEKYSFDMAFGGGGFALSAPLAKGLARVL  234

Query  891   DSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHH  1070
             DSCL RYPHLYGSD+R+ +C++ELGV LT EPGFHQ+D+RG++FG+LAAHPL PL+SLHH
Sbjct  235   DSCLIRYPHLYGSDSRIFSCVAELGVHLTREPGFHQVDVRGNLFGILAAHPLSPLLSLHH  294

Query  1071  MEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSH  1250
             ++V +P+FP MT  +A+ HL++A   DP RIL+QTVCYD+    T+SV+WGYAVQ+   +
Sbjct  295   LDVVEPLFPGMTRIQAVNHLFQAVHADPARILEQTVCYDKSILLTVSVAWGYAVQVFEGN  354

Query  1251  LLLPDALRAQESYSPWRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSV  1427
              LLPD L  Q +++PW++ K     Y  ++R    DPC++  VF++ +V  S  DGI + 
Sbjct  355   QLLPDLLSLQRTFTPWKRGKNVSANYMLNTRSNPSDPCKKPDVFFLKKVLPS-IDGIWTE  413

Query  1428  YRKMTTENCTFDKASP-RNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGI  1604
             Y +     C   +++P + L +IRV +QKL  D ++L APRR CCD+ SS  ++ + +GI
Sbjct  414   YTRHNVGKCV--RSNPTKKLVKIRVFSQKLAFDVEQLKAPRRPCCDI-SSPINETMIVGI  470

Query  1605  RECKEEELV  1631
             R+C  +EL+
Sbjct  471   RQCGHDELI  479



>ref|XP_007040329.1| Beta-1,3-glucosyltransferase [Theobroma cacao]
 gb|EOY24830.1| Beta-1,3-glucosyltransferase [Theobroma cacao]
Length=541

 Score =   391 bits (1004),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 197/414 (48%), Positives = 272/414 (66%), Gaps = 6/414 (1%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T +  +VFGIA+S + W++RKE++K+W++P+ MRG V+LD D VK+      +LPPV +S
Sbjct  128   TEIHDVVFGIAASSKLWQQRKEYIKIWYKPNQMRGVVWLD-DRVKYSPEDKGTLPPVRVS  186

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              DTS+F YT R G+ SAIR++R V+E + L    VRWFV GDDDTVF  DNLV+ L KYD
Sbjct  187   SDTSNFAYTNRQGHRSAIRISRIVTETLRLKMDYVRWFVMGDDDTVFITDNLVRILRKYD  246

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKALAK+ D C+ RYP LYGSD 
Sbjct  247   HTQYYYIGSLSESHIQNIFFSYGMAYGGGGFAISYPLAKALAKMQDRCIQRYPGLYGSDD  306

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PL SLHH++V +PIFPN+T  +
Sbjct  307   RMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVTPLASLHHLDVVEPIFPNVTRVQ  366

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+ L   + +D   I+QQ++CYD+  SWTISVSWG+AVQI        +      ++  
Sbjct  367   ALQRLMLPSKLDSAGIMQQSICYDKTKSWTISVSWGFAVQIFRGIFSPREMEMPSRTFLN  426

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYRKMTTEN--CTFDK  1466
             W +      Y F++R    +PC++  VFYM RV   S  +   S Y +    +  C +  
Sbjct  427   WYRRADYTAYAFNTRPVSRNPCQKPFVFYMSRVRMDSELNQTVSEYERHRVPHPPCRWKM  486

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             A P  LD + V+ +K D    +  +PRR+CC V+ S     + + +  CK+ E+
Sbjct  487   ADPAELDMVIVN-KKPDPHLWD-RSPRRNCCRVMESKEQGTMVVNVGVCKDGEV  538



>ref|XP_010651091.1| PREDICTED: uncharacterized protein LOC104879559 [Vitis vinifera]
Length=517

 Score =   390 bits (1002),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 197/428 (46%), Positives = 272/428 (64%), Gaps = 10/428 (2%)
 Frame = +3

Query  357   LHVSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHE  536
             L +++ L      T L+HIVFGIA+S + W +RK+++K WWRP   RG V+LD+      
Sbjct  91    LELALPLSSQLFDTELKHIVFGIAASSKLWEQRKQYIKQWWRPRVTRGVVWLDKPVRTRR  150

Query  537   DNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVF  716
             + G   LP + IS DTS F+YT R G+ SA+R++R VSE + L   DVRWFV GDDDTVF
Sbjct  151   NEG---LPLIQISRDTSRFKYTNRQGDRSALRISRVVSETLRLGMKDVRWFVMGDDDTVF  207

Query  717   FPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDS  896
               DN+V+ LSKYDH  +YYIG+SSE   QN FFS+ MA+GG GFAISYPLA  LAKV D 
Sbjct  208   VVDNVVRILSKYDHRQFYYIGSSSESHTQNIFFSYAMAYGGGGFAISYPLAIELAKVQDR  267

Query  897   CLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHME  1076
             C+ RYP LYGSD R+ AC++ELGV LT E GFHQ D+ GD+ GLLAAHP+ PLVS+HH++
Sbjct  268   CIQRYPGLYGSDDRMQACMAELGVPLTREAGFHQYDVYGDLLGLLAAHPVTPLVSIHHLD  327

Query  1077  VYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLL  1256
             V DPIFP M+  K+L+ L+++  +D   I+QQ++CYD+  SW+IS+SWGY VQI    + 
Sbjct  328   VVDPIFPGMSQVKSLQRLFESIKLDSSSIMQQSICYDKKRSWSISISWGYVVQILRGIVS  387

Query  1257  LPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITSVY  1430
               +      ++  W +      Y F++R     PC++  +FYM   R+  + R  +  VY
Sbjct  388   PRELEMPTRTFLNWYRKADYTAYAFNTRPVTKHPCQKPFIFYMSTTRLDRARRQTV-GVY  446

Query  1431  RKMTTEN--CTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGI  1604
              +    +  C +   SP  +D I V  +  DL  +   +PRR CC VL S    ++ + +
Sbjct  447   SRHRGRHPACRWKMDSPEKIDSITVLKRPDDLRWQR--SPRRDCCRVLPSRRSSSMYLWV  504

Query  1605  RECKEEEL  1628
               C+E E+
Sbjct  505   GNCRESEI  512



>ref|XP_007207320.1| hypothetical protein PRUPE_ppa004846mg [Prunus persica]
 gb|EMJ08519.1| hypothetical protein PRUPE_ppa004846mg [Prunus persica]
Length=489

 Score =   389 bits (999),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 192/415 (46%), Positives = 266/415 (64%), Gaps = 10/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+HI+FGIA+S   W KRKE++K+WWRP   RG V+LD+      + G   LP + IS
Sbjct  78    TELKHIMFGIAASSNLWEKRKEYIKVWWRPKETRGVVWLDKRVRIRRNEG---LPEIRIS  134

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDT  F+YT R G  SA+R++R VSE + L   DVRWFV GDDDTVF  +N+V+ L+KYD
Sbjct  135   GDTRGFKYTNRQGQRSALRISRVVSETLRLGVKDVRWFVMGDDDTVFMVENVVRILNKYD  194

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YY+G+SSE  +QN FFS+ MA+GG GFAISYPLA  L K+ D C+ RYP LYGSD 
Sbjct  195   HTQFYYVGSSSESHIQNIFFSYSMAYGGGGFAISYPLAVELEKMQDRCIQRYPGLYGSDD  254

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ GD+ GLL+AHP+ PLVSLHH++V +PIFP+MT  K
Sbjct  255   RMQACMTELGVPLTKETGFHQFDVYGDLLGLLSAHPVTPLVSLHHLDVVEPIFPHMTRVK  314

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRA-QESYS  1292
             AL HL++   +D   ++QQT+CYD+   W+IS+SWGY VQI    ++ P  L     ++ 
Sbjct  315   ALHHLFQTVKLDSASVMQQTICYDKDRYWSISISWGYVVQIFRG-IISPRELETPSRTFL  373

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSH-RDGITSVY--RKMTTENCTFD  1463
              W +      Y F++R  +  PC++  +FYM+       R  I + Y  +K    +C + 
Sbjct  374   NWYRRADYTAYAFNTRPVYKHPCQKAFIFYMNSTRYDEGRKKIIAHYTRQKFPVPHCRWK  433

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              ASP  +D + V  +   L  ++  +PRR CC +L S     + + I  C+  E+
Sbjct  434   MASPETVDTVVVFKRPDPLRWQK--SPRRDCCRILPSQKKTTMYLMIDYCRVGEV  486



>ref|XP_002279187.1| PREDICTED: uncharacterized protein LOC100267372 [Vitis vinifera]
Length=527

 Score =   390 bits (1003),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 197/418 (47%), Positives = 272/418 (65%), Gaps = 14/418 (3%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L HIVFGIA+S + W +RK ++KLWW+P  MRG V+LD       D G   LPPV IS
Sbjct  114   TELRHIVFGIAASAKLWDQRKNYIKLWWKPKEMRGIVWLDNQVKTRSDEG---LPPVRIS  170

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS F YT + G+PSAIR++R VSE   L   DVRWFV GDDDTVF  +NLV+ L+KYD
Sbjct  171   GDTSRFSYTNKQGHPSAIRISRIVSETFRLRMKDVRWFVMGDDDTVFITENLVRLLAKYD  230

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+ SE  +QN +FS+ MA+GG GFAISYPLA+AL ++ D C+ RYP LYGSD 
Sbjct  231   HNQYYYIGSLSESHLQNIYFSYSMAYGGGGFAISYPLARALERMQDRCIQRYPGLYGSDD  290

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLVSLHH++V +PIFPN+T  +
Sbjct  291   RMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVTPLVSLHHLDVVEPIFPNVTRVE  350

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+ L     +D   ++QQ++CYD+   WTISVSWG+AVQI        +      ++  
Sbjct  351   ALKQLMVPMKLDSAGLMQQSICYDKAKGWTISVSWGFAVQIFRGIFSPREIEMPSRTFLN  410

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRV--SSSHRDGITSVYR-KMTTENCTFDK  1466
             W +      Y F++R    +PC++  VFY+ R    SS    ++   R ++    C +  
Sbjct  411   WYRKADYTAYAFNTRPVSRNPCQKPFVFYLSRARFDSSMNQTVSEYARHRVPHPLCRWKM  470

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLS----SSADKALEIGIRECKEEEL  1628
             A P ++D + V  +K D    +  +PRR+CC +L     S+ + A+++G+  C+E E+
Sbjct  471   ADPADIDRVEV-YKKPDPHLWQ-RSPRRNCCRILDSKKRSAKNMAIDVGV--CREGEI  524



>ref|XP_008465293.1| PREDICTED: uncharacterized protein LOC103502944 [Cucumis melo]
Length=545

 Score =   391 bits (1004),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 195/414 (47%), Positives = 264/414 (64%), Gaps = 8/414 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+HIVFGIA S   W KRKE++KLWWRP   RG V+LD+      + G   LP + IS
Sbjct  132   TQLKHIVFGIAGSSNLWVKRKEYIKLWWRPKETRGVVWLDKKVYAKRNEG---LPEIRIS  188

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS F+YT R G  SA+R++R VSE + L   DVRWFV GDDDTVF  +N+V+ LSKYD
Sbjct  189   GDTSRFKYTNRQGQRSALRISRVVSETLRLGMKDVRWFVMGDDDTVFMVENVVRVLSKYD  248

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+SSE  VQN +FS+ MA+GG GFAISYPLAK L K+ D C+ RYP LYGSD 
Sbjct  249   HRQFYYIGSSSESHVQNIYFSYAMAYGGGGFAISYPLAKELEKMQDRCIQRYPGLYGSDD  308

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT EPGFHQ D+ GD+ GLL AHP+ PL+SLHH++V +PIFP MT  +
Sbjct  309   RIQACMAELGVPLTREPGFHQYDVYGDLLGLLGAHPVTPLLSLHHLDVVEPIFPRMTRVR  368

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+ L++++++D   I+QQ++CYD+   W+ISVSWGY VQI    +   +      ++  
Sbjct  369   ALQRLFQSSNLDSSSIMQQSICYDKKRYWSISVSWGYVVQILRGVISPRELEMPTRTFLN  428

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITSVYR-KMTTENCTFDK  1466
             W +      Y F++R     PC++  +FYM   R   + +  +    R K     C +  
Sbjct  429   WYRRADYTAYAFNTRPVTKHPCQKPFIFYMGTTRYDRTKKQTVGVYIRDKSRHPFCRWKM  488

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             +SP  +D I +  +K D   +   +PRR CC VL S     L + +  C+  E+
Sbjct  489   SSPDKIDSI-IILKKPD-PYRWQKSPRRDCCRVLPSHKPSTLYLSVGNCRGAEI  540



>emb|CDP00131.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   389 bits (1000),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 196/443 (44%), Positives = 281/443 (63%), Gaps = 11/443 (2%)
 Frame = +3

Query  315   YLVCTFVLVPSTNLLHVSVSLQD--VSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPS  488
             + +C     P+ N+   + + ++  +SSPT++ HIVFGI  S  +W  R  +  LWW+ S
Sbjct  59    WFICPECPNPTDNISRTACNTEEGPISSPTNITHIVFGIGGSTSTWNDRSHYSALWWQDS  118

Query  489   GMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLN  668
               RG V+LD+ E   +    ++ PP  +S D + FRYT    + SA+RL+R V ++  + 
Sbjct  119   VTRGFVWLDK-EPDADTPWPENSPPYRVSSDWTRFRYTS---SQSAVRLSRIVVDSFRVG  174

Query  669   HSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGF  848
               DVRWFV GDDDTVFFPDNLV  L+KYDH   YY+G +SE V Q++  S++MAFGG G 
Sbjct  175   LPDVRWFVMGDDDTVFFPDNLVTVLAKYDHRQMYYVGGNSESVEQDTTHSYDMAFGGGGI  234

Query  849   AISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGL  1028
             AISYPLA  L +V D CL RY + YGSD RV AC+ ELGVSLT E GFHQ+DIRGD+FGL
Sbjct  235   AISYPLAAELVRVMDGCLDRYYNFYGSDERVWACIKELGVSLTRERGFHQIDIRGDLFGL  294

Query  1029  LAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTI  1208
             LAAHP+ PLVSLHH++   P+FPN+T  ++LE+L +A  +DP +I+QQ+ CY  W+ W++
Sbjct  295   LAAHPMVPLVSLHHLDHVKPLFPNLTQHESLENLIQAYHMDPAQIMQQSFCYHGWYKWSV  354

Query  1209  SVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD  1388
             S+SWGYA QI+ S ++  D  +  +++  WR +  + P+ F++R  +PDPC R  V+Y++
Sbjct  355   SISWGYAAQIYPSLVIAGDLEKPLQTFRTWR-SWSNGPFIFNTRPVNPDPCERPAVYYIE  413

Query  1389  RVSSSHRDGITSVYRKMTT--ENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCD  1562
              +      G  + Y +     ENC         +   RV    L +D KE  +PRR CC+
Sbjct  414   GIGEDGNGGTLTSYTRSIAEPENCRGGHQG-HAVGIERVLVSALKMDQKEWKSPRRRCCE  472

Query  1563  VLSSSADKALEIGIRECKEEELV  1631
             +  SS D  L++ IR C ++E +
Sbjct  473   I-KSSKDGTLKVLIRRCNQQESI  494



>ref|XP_008222523.1| PREDICTED: uncharacterized protein LOC103322387 isoform X1 [Prunus 
mume]
Length=516

 Score =   390 bits (1002),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 191/415 (46%), Positives = 267/415 (64%), Gaps = 10/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+HI+FGIA+S   W KRKE++K+WWRP   RG V+LD+      + G   LP + IS
Sbjct  105   TELKHIMFGIAASSNLWEKRKEYIKVWWRPKETRGVVWLDKRVRTRRNEG---LPEIRIS  161

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDT  F+YT R G  SA+R++R VSE + L   DVRWFV GDDDTVF  +N+V+ L+KYD
Sbjct  162   GDTRGFKYTNRQGQRSALRISRVVSETLRLGVKDVRWFVMGDDDTVFMVENVVRILNKYD  221

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YY+G+SSE  +QN FFS+ MA+GG GFAISYPLA  L K+ D C+ RYP LYGSD 
Sbjct  222   HTQFYYVGSSSESHIQNIFFSYSMAYGGGGFAISYPLAVELEKMQDRCIQRYPGLYGSDD  281

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ GD+ GLL+AHP+ PLVSLHH++V +PIFP+MT  K
Sbjct  282   RMQACMTELGVPLTKETGFHQYDVYGDLLGLLSAHPVTPLVSLHHLDVVEPIFPHMTRVK  341

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRA-QESYS  1292
             AL HL++   +D   ++QQT+CYD+   W+IS+SWGY VQI    ++ P  L     ++ 
Sbjct  342   ALHHLFQTVKLDSASVMQQTICYDKDRYWSISISWGYVVQIFRG-IISPRELETPSRTFL  400

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSH-RDGITSVY--RKMTTENCTFD  1463
              W +      Y F++R  +  PC++  +FY++       R  I + Y  +K    +C + 
Sbjct  401   NWYRRADYTAYAFNTRPVYKHPCQKAFIFYINSTRYDEGRKKIIAYYTRQKFPVPHCRWK  460

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              ASP  +D + V  +   L  ++  +PRR CC +L S  +  + + I  C+  E+
Sbjct  461   MASPETIDTVVVFKKPDPLRWQK--SPRRDCCRILPSQKNTTMYLMIDYCRVGEV  513



>ref|XP_007016624.1| Uncharacterized protein TCM_041982 [Theobroma cacao]
 gb|EOY34243.1| Uncharacterized protein TCM_041982 [Theobroma cacao]
Length=511

 Score =   390 bits (1001),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 189/412 (46%), Positives = 264/412 (64%), Gaps = 8/412 (2%)
 Frame = +3

Query  402   LEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGD  581
             L+HI FGIA+S   W  RKE++K+WWRP+  RG V++D+      + G   LP + +S D
Sbjct  95    LKHIAFGIAASSNLWDIRKEYIKVWWRPTETRGVVWMDKQVRTRRNEG---LPEIRVSQD  151

Query  582   TSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHG  761
             TS F+YT + G+ SA+R++R VSE + L   D+RWFV GDDDTVF  DN+V+ LSKYDH 
Sbjct  152   TSKFKYTNKQGSRSALRISRVVSETLKLGMKDIRWFVMGDDDTVFIVDNVVRVLSKYDHT  211

Query  762   LWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARV  941
              +YY+G++SE  +QN FFS+ MAFGG GFAISYPLAK LAK+ D C+ RYP LYGSD R+
Sbjct  212   QFYYVGSASESHIQNIFFSYAMAFGGGGFAISYPLAKELAKMQDRCIQRYPALYGSDDRI  271

Query  942   HACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKAL  1121
              AC++ELGV LT E GFHQ D+ G++ GLL AHP+ PLVSLHH++V +PIFP M   +AL
Sbjct  272   QACMAELGVPLTRELGFHQYDVYGELLGLLGAHPVTPLVSLHHLDVVEPIFPGMKRARAL  331

Query  1122  EHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWR  1301
              HL +AA  D   ++QQ++CYD    W+ISVSWGY VQI    +   +      ++  W 
Sbjct  332   AHLLEAAKEDSASLVQQSICYDSKRFWSISVSWGYVVQISRGVMSPRELEMPTRTFLNWY  391

Query  1302  KNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS--SSHRDGITSVYR-KMTTENCTFDKAS  1472
             +      Y F++R     PC++  VFYM ++    + +  I   YR K  +  C +  AS
Sbjct  392   RRADYTAYAFNTRPVERHPCQKPFVFYMSKIKYDRARKQTIGVYYRHKTRSRYCRWRMAS  451

Query  1473  PRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             P  +  + V  ++ DL  ++  +PRR CC VL S  +  + + +  C+E E+
Sbjct  452   PERIYSVVVLKKRDDLRWQK--SPRRDCCRVLPSRKNNTMVLSVGNCREGEV  501



>gb|KHN30225.1| hypothetical protein glysoja_010603 [Glycine soja]
Length=546

 Score =   391 bits (1004),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 200/419 (48%), Positives = 271/419 (65%), Gaps = 15/419 (4%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+H+VFGIA S   W  RKE++K+WWRP   RG V+LD+ +V+ + N  + LP + IS
Sbjct  134   TELKHVVFGIAGSSNLWHIRKEYIKIWWRPKKTRGVVWLDQ-KVRTQSN--EGLPDIHIS  190

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS FRYT R G  SA+R++R V+E + L   DVRWFV GDDDTVF  DN+V+ LSKYD
Sbjct  191   GDTSKFRYTNRQGQRSALRISRVVTETLKLGMKDVRWFVMGDDDTVFMVDNVVRILSKYD  250

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+SSE  VQN  FS+ MA+GG GFAISYPLA+ LAK+ D C+ RYP LYGSD 
Sbjct  251   HRHFYYIGSSSESHVQNIHFSYAMAYGGGGFAISYPLAQELAKMQDRCIQRYPALYGSDD  310

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT EPGFHQ D+ GD+ GLL AHP+ PLVSLHH++V  PIFP MT  +
Sbjct  311   RIQACMAELGVPLTREPGFHQYDVYGDLLGLLGAHPVSPLVSLHHLDVVQPIFPRMTRVR  370

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL HL ++ + D   I+QQ++CYD+   W+ISVSWGY VQI    L   +      ++  
Sbjct  371   ALRHLMESVNQDSGSIMQQSICYDKHSFWSISVSWGYVVQILRGVLSPRELEMPSRTFLN  430

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT----SVYRKMTTEN--CT  1457
             W +      Y F++R     PC++  V+YM+   ++H D  T     VY +  +++  C 
Sbjct  431   WYRRADYTAYAFNTRPVAKHPCQKPFVYYMN---NTHYDSTTKQVVGVYSRDKSKSPFCR  487

Query  1458  FDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSS-SADKALEIGIRECKEEELV  1631
             +   SP  +  + V+ +   L  K+  +PRR CC +LSS  +   L I +  C+E E+ 
Sbjct  488   WRMNSPDKITSVVVTKKPDPLRWKK--SPRRDCCRLLSSRKSANTLYIWVGNCQEGEVT  544



>ref|XP_009801574.1| PREDICTED: uncharacterized protein LOC104247306 isoform X1 [Nicotiana 
sylvestris]
Length=488

 Score =   389 bits (999),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 227/478 (47%), Positives = 313/478 (65%), Gaps = 29/478 (6%)
 Frame = +3

Query  264   SQN-FKNIVLICSSLCVVYLVCTFVL----VPSTNLL---HVSVSLQDVSSPTSLEHIVF  419
             SQN  K+++L+ S+L + YL+  F+L     P TN +     + +    S+  SL H+ F
Sbjct  20    SQNRLKDLLLLFSTLVIFYLI--FLLHHLHTPKTNFIPNTDYTPTTPPRSTNLSLSHLFF  77

Query  420   GIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRY  599
              IA++  S+  R  F+ LW++P+     +FLD          + S PP+ +S DTS F Y
Sbjct  78    SIAAASSSFSLRLPFINLWYKPNSTNAVIFLD---TPISTTLSVSSPPILVSSDTSKFPY  134

Query  600   TCRGGNPSAIRLARAVSE----AVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLW  767
             +   G  SAIR+AR V +    A ++N S+ RWF+FGDDDTVFF +NLV  LSKYD+  W
Sbjct  135   SFPSGRRSAIRIARIVKDTFDLAKNVNFSNTRWFIFGDDDTVFFTENLVSVLSKYDYEKW  194

Query  768   YYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHA  947
             YY+G +SE   QN  +SF+MAFGG GFA+S PLAK LA V DSCL RYPHLYGSD+RV +
Sbjct  195   YYVGYNSESYEQNEKYSFDMAFGGGGFALSAPLAKVLAGVLDSCLMRYPHLYGSDSRVFS  254

Query  948   CLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEH  1127
             CL+ELGV LTHEPGFHQ+D+RGD+FG+L+AHPL PL+SLHH++  +P+FP MT   A EH
Sbjct  255   CLAELGVRLTHEPGFHQVDVRGDLFGILSAHPLSPLLSLHHLDAVEPLFPGMTRIAATEH  314

Query  1128  LYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKN  1307
             L++A   DP RI QQTVCY++    T+SV+WGYAVQ+   + LLPD L  Q ++ PW++ 
Sbjct  315   LFQAVQADPARIFQQTVCYNKSNLLTVSVAWGYAVQVFEGNELLPDLLSRQPTFRPWKRG  374

Query  1308  KK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASP-RN  1481
             K     Y F++R    DPC R  V+++  V SS RDGI + Y +    NC   ++SP + 
Sbjct  375   KSVAAKYMFNTRVLPSDPCERPAVYFLQNVLSS-RDGIWNEYVRHDG-NCV--RSSPTKE  430

Query  1482  LDEIRVSTQKLDLDSKELL-----APRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             L +IRV +QKL  D++++L     APRR CCD+ SS  ++ + IGIR+C  +EL+ M 
Sbjct  431   LAKIRVFSQKLAFDAEQVLCLHLKAPRRSCCDI-SSPINETMIIGIRQCGYDELISMQ  487



>ref|XP_001751279.1| predicted protein [Physcomitrella patens]
 gb|EDQ83596.1| predicted protein [Physcomitrella patens]
Length=418

 Score =   386 bits (992),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 198/425 (47%), Positives = 274/425 (64%), Gaps = 20/425 (5%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T +  IVFGIA + + W  RKE++KLWW+PS MRG VFLD  E  + D   D  PP  IS
Sbjct  1     TDISRIVFGIAGARDMWWGRKEYLKLWWKPSKMRGFVFLD--EKPYGDYWIDDWPPYRIS  58

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              +TS F YT +GG+ SAIR++R +SE + ++  +V WFV GDDDT+FF DNLV+ LSKYD
Sbjct  59    ENTSHFEYTYKGGSRSAIRISRILSEMLRMDLPNVDWFVMGDDDTLFFEDNLVQVLSKYD  118

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H   YYIG++SE  +QN  FS+ MAFGG GFAISYPLAKAL K+ D CL RYPHL+GSD 
Sbjct  119   HTKMYYIGSNSESHLQNIHFSYNMAFGGGGFAISYPLAKALEKIQDDCLARYPHLFGSDD  178

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTT--  1109
             R+ AC++ELG+ LT EPGFHQ+D+ GD+ GLLAAHP  PLV+LHH+E+  PIFPN  T  
Sbjct  179   RMQACMAELGIPLTKEPGFHQLDVVGDISGLLAAHPAAPLVTLHHLEIVQPIFPNTATKN  238

Query  1110  ---TKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQ  1280
                 +AL+HL KAA ++   ILQQ++CYDR+  W+ S+SWGY VQ+H   +   +    Q
Sbjct  239   FTRVEALKHLLKAAEVEAASILQQSICYDRFLKWSFSISWGYVVQVHKGFVSPRELQIPQ  298

Query  1281  ESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRV------SSSHRDGI--TSVYRK  1436
             +++  W K++  V + F++R Y  + C++ T F+M+ V      S    +G+     Y K
Sbjct  299   KTFKSWHKDQNKVTFPFNTRDYPENVCQQPTRFFMESVKPTAVNSEGEMEGVFQREYYEK  358

Query  1437  MTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECK  1616
               T   T    S   +  IRV  +K+D    ++  PRR CC +  +  ++ ++I +  C 
Sbjct  359   KYTCAETLQPLS--TVHRIRVLRKKIDPSWYQM--PRRSCCRI-RNWENENIDIHVGLCG  413

Query  1617  EEELV  1631
             + E +
Sbjct  414   DSESI  418



>ref|XP_004242083.1| PREDICTED: uncharacterized protein LOC101253909 [Solanum lycopersicum]
Length=488

 Score =   389 bits (998),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 200/436 (46%), Positives = 275/436 (63%), Gaps = 13/436 (3%)
 Frame = +3

Query  345   STNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDE  524
             S N   +S+        T L+HIVFGIA+S   W KRKE++KLWWRP  MRG V+LD++ 
Sbjct  61    SENSTSISLKENRGEPETGLKHIVFGIAASTNLWDKRKEYIKLWWRPGEMRGVVWLDKNV  120

Query  525   V--KHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFG  698
                K+ED     LP + IS +T+ F YT R GN SA+R++R VSE + L   +VRWFV G
Sbjct  121   TIKKNED-----LPEIRISENTTKFLYTNRQGNRSALRISRVVSETIRLGLKNVRWFVMG  175

Query  699   DDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKAL  878
             DDDTVF  DN+V+ LSKYDH  +YYIG+SSE  +QN FFS+ MA+GG GFAISYPLAK L
Sbjct  176   DDDTVFNVDNVVRLLSKYDHNQYYYIGSSSESHIQNIFFSYAMAYGGGGFAISYPLAKEL  235

Query  879   AKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLV  1058
              K+ D CL RYP LYGSD R+ AC++ELGV LT EPGFHQ D+ G++ GLL AHP+ PLV
Sbjct  236   EKIQDRCLQRYPGLYGSDDRIQACMAELGVPLTREPGFHQYDVYGNLLGLLGAHPVTPLV  295

Query  1059  SLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQI  1238
             S+HH++V DPI P M+    L+H++++   D   I+QQ++CYD+   W+ISVSWGY VQI
Sbjct  296   SIHHLDVVDPIIPRMSRVDGLQHIFESMKYDTASIMQQSICYDKQKYWSISVSWGYVVQI  355

Query  1239  HGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDG  1415
                ++   +      ++  W K      Y F++R     PC++  V+Y+       +++ 
Sbjct  356   TRGNISPRELEMPTRTFLNWYKRADYTAYAFNTRPVTKHPCQKPFVYYISAAKYDRNKNQ  415

Query  1416  ITSVY--RKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKA  1589
             I  +Y   + +   C +   SP ++  I V  +K D D++   A RR CC VL S+ +  
Sbjct  416   IVGIYHRHRESYPYCRWKIESPESISAI-VVLKKPD-DNRWQKAARRDCCKVLPSN-NSY  472

Query  1590  LEIGIRECKEEELVYM  1637
             L I + +C+E E   M
Sbjct  473   LYIWVGKCREGETSEM  488



>ref|XP_010046420.1| PREDICTED: uncharacterized protein LOC104435352 [Eucalyptus grandis]
Length=502

 Score =   389 bits (999),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 192/414 (46%), Positives = 267/414 (64%), Gaps = 8/414 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T ++HIVFGIA+S   W KRKE++KLWWRP   RG V+LD+  V+   N  + LP + IS
Sbjct  91    TEIKHIVFGIAASSNLWEKRKEYIKLWWRPKETRGVVWLDK-RVRTWRN--EPLPEIRIS  147

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS F+YT R G  +A+R++R +SE + L   DVRWFV GDDDTVF  DN+V+ LSKYD
Sbjct  148   GDTSKFKYTNRQGQRAALRISRVISETLRLGMKDVRWFVMGDDDTVFIVDNVVRILSKYD  207

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YY+G+SSE  VQN +FS+ MA+GG GFAISYPLA  LAK+ D C+ RYP LYGSD 
Sbjct  208   HRQFYYVGSSSESHVQNIYFSYAMAYGGGGFAISYPLAVELAKMQDKCIQRYPGLYGSDD  267

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT EPGFHQ D+ GD+ GLL AHP+ PLVS+HH++V +P+FP MT  +
Sbjct  268   RMQACMAELGVPLTKEPGFHQYDVYGDLLGLLGAHPVTPLVSIHHLDVVEPVFPRMTRVR  327

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL HL+++   D   I+QQ++CYD+  SW+ISVSWGY VQ+        +      ++  
Sbjct  328   ALRHLFESVKHDSASIMQQSICYDKRRSWSISVSWGYVVQVIRGVTSPRELEMPTRTFLN  387

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT-SVYRKMTTE--NCTFDK  1466
             W +      Y F++R     PC++  ++YM+ V        T  +Y +  +   +C +  
Sbjct  388   WYRRADYTAYAFNTRPVMKHPCQKPFIYYMNSVKYDRAKKQTLGIYSRQRSRHPSCRWKM  447

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              SP N++ I V  ++ D  ++   +PRR CC +L S     L I +  C+  E+
Sbjct  448   DSPENINSI-VVLKRPD-SNRWQKSPRRDCCRILPSRKSSILYIWVGNCRNGEI  499



>ref|XP_009619167.1| PREDICTED: uncharacterized protein LOC104111223 [Nicotiana tomentosiformis]
Length=493

 Score =   388 bits (997),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 193/414 (47%), Positives = 268/414 (65%), Gaps = 10/414 (2%)
 Frame = +3

Query  402   LEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGD  581
             L+HIVFGIA+S   W KRKE++KLWWRP   RG V+LD++    + N  ++LP + ISGD
Sbjct  82    LKHIVFGIAASSNLWEKRKEYIKLWWRPGETRGVVWLDKNV---KTNRNEALPDIKISGD  138

Query  582   TSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHG  761
             TS F YT R G  SA+R++R VSE + L   DVRWFV GDDDTVF  +N+V+ LSKYDH 
Sbjct  139   TSKFLYTNRQGKRSALRISRVVSETLRLGLKDVRWFVMGDDDTVFIVENVVRVLSKYDHN  198

Query  762   LWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARV  941
              +YYIG+SSE  VQN FFS+ MA+GG GFAISYPLAK L K+ D C+ RYP LYGSD R+
Sbjct  199   QYYYIGSSSESHVQNIFFSYAMAYGGGGFAISYPLAKELEKMQDRCIQRYPGLYGSDDRI  258

Query  942   HACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKAL  1121
              AC++ELGV LT E GFHQ D+ G++ GLL AHP+ PLVSLHH++V DPIFP M+    L
Sbjct  259   QACMAELGVPLTKERGFHQYDVYGNLLGLLGAHPVTPLVSLHHLDVVDPIFPGMSRVSGL  318

Query  1122  EHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWR  1301
             + L+++A +D   ++QQ++CYD+   W+ISVSWGY VQI   ++   +      ++  W 
Sbjct  319   QRLFESAKLDSASLMQQSICYDKERYWSISVSWGYVVQIIRGNISPRELEMPTRTFLNWY  378

Query  1302  KNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSH-RDGITSVY--RKMTTENCTFDKAS  1472
             +      Y F++R     PC++  V+YM+       R  I  +Y   +  +  C +   S
Sbjct  379   RRADYTAYAFNTRPVTKHPCQKPFVYYMNTAKYDRTRKQIIGIYYRHREPSPYCRWKVES  438

Query  1473  PRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKA--LEIGIRECKEEEL  1628
             P N++ I V  ++ D  ++   +PRR CC VL S+ +    L + +  C++ E+
Sbjct  439   PENINNI-VLLKRPD-SNRWQKSPRRECCGVLPSNNNSKTNLYMWVGSCRDGEI  490



>ref|XP_009611458.1| PREDICTED: uncharacterized protein LOC104104945 [Nicotiana tomentosiformis]
Length=493

 Score =   388 bits (997),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 195/417 (47%), Positives = 267/417 (64%), Gaps = 9/417 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T  +HIVFGIA+S   W KRKE++KLWW+P  MRG V+LD++    ++ G   LP + IS
Sbjct  83    TGPQHIVFGIAASSNLWDKRKEYIKLWWKPGEMRGVVWLDKNVTIKKNEG---LPEIRIS  139

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             G+TS F YT R GN SA+R++R VSE + L   DVRWFV GDDDTVF  DN+V+ LSKYD
Sbjct  140   GNTSKFLYTNRQGNRSALRISRVVSETLRLGLKDVRWFVMGDDDTVFAVDNVVRVLSKYD  199

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+SSE  +QN FFS+ MA+GG GFAISYPLAK L K+ D C+ RYP LYGSD 
Sbjct  200   HNQYYYIGSSSESHIQNIFFSYAMAYGGGGFAISYPLAKELEKIQDRCIQRYPGLYGSDD  259

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT EPGFHQ D+ G++ GLL AHP+ PLVS+HH++V DPI P M+   
Sbjct  260   RIQACMAELGVPLTREPGFHQYDVYGNLLGLLGAHPVTPLVSIHHLDVVDPIVPRMSRVD  319

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
              L+ L+++   D   I+QQ++CYD+   W+ISVSWGY VQI   ++   +      ++  
Sbjct  320   GLQRLFESMKYDTASIMQQSICYDKQKYWSISVSWGYVVQITRGNISPRELEMPTRTFLN  379

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVY--RKMTTENCTFDK  1466
             W K      Y F++R     PC++  V+Y+        ++ I  +Y   + +   C +  
Sbjct  380   WYKRADYTAYAFNTRPVTKHPCQKPFVYYISTAKFDRSKNQIVGIYHRHRESYPYCRWKI  439

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYM  1637
              SP N++ I V  ++ D +++   APRR CC VL S+ +  L I I  C + E   M
Sbjct  440   ESPENINAI-VVLKRPD-NNRWQKAPRRDCCKVLPSN-NSNLYIWIDSCGKGETSEM  493



>ref|XP_008222530.1| PREDICTED: uncharacterized protein LOC103322387 isoform X2 [Prunus 
mume]
Length=512

 Score =   389 bits (998),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 190/411 (46%), Positives = 265/411 (64%), Gaps = 10/411 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+HI+FGIA+S   W KRKE++K+WWRP   RG V+LD+      + G   LP + IS
Sbjct  105   TELKHIMFGIAASSNLWEKRKEYIKVWWRPKETRGVVWLDKRVRTRRNEG---LPEIRIS  161

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDT  F+YT R G  SA+R++R VSE + L   DVRWFV GDDDTVF  +N+V+ L+KYD
Sbjct  162   GDTRGFKYTNRQGQRSALRISRVVSETLRLGVKDVRWFVMGDDDTVFMVENVVRILNKYD  221

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YY+G+SSE  +QN FFS+ MA+GG GFAISYPLA  L K+ D C+ RYP LYGSD 
Sbjct  222   HTQFYYVGSSSESHIQNIFFSYSMAYGGGGFAISYPLAVELEKMQDRCIQRYPGLYGSDD  281

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ GD+ GLL+AHP+ PLVSLHH++V +PIFP+MT  K
Sbjct  282   RMQACMTELGVPLTKETGFHQYDVYGDLLGLLSAHPVTPLVSLHHLDVVEPIFPHMTRVK  341

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRA-QESYS  1292
             AL HL++   +D   ++QQT+CYD+   W+IS+SWGY VQI    ++ P  L     ++ 
Sbjct  342   ALHHLFQTVKLDSASVMQQTICYDKDRYWSISISWGYVVQIFRG-IISPRELETPSRTFL  400

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSH-RDGITSVY--RKMTTENCTFD  1463
              W +      Y F++R  +  PC++  +FY++       R  I + Y  +K    +C + 
Sbjct  401   NWYRRADYTAYAFNTRPVYKHPCQKAFIFYINSTRYDEGRKKIIAYYTRQKFPVPHCRWK  460

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECK  1616
              ASP  +D + V  +   L  ++  +PRR CC +L S  +  + + I  C+
Sbjct  461   MASPETIDTVVVFKKPDPLRWQK--SPRRDCCRILPSQKNTTMYLMIDYCR  509



>emb|CDY44101.1| BnaA01g13090D [Brassica napus]
Length=515

 Score =   389 bits (998),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 195/430 (45%), Positives = 274/430 (64%), Gaps = 10/430 (2%)
 Frame = +3

Query  363   VSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKH---  533
             + V +     PT L H+VFGIA+S + W++RKE++K+W++P  MRG V+LD++  K+   
Sbjct  84    IKVKVDAADEPTDLNHVVFGIAASAKLWKQRKEYIKIWYKPKHMRGYVWLDKEVKKNSSR  143

Query  534   --EDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDD  707
               E++  D LPP+ IS  T+ F YT + G  SA+R++R VSE + L   +VRWFV GDDD
Sbjct  144   SNEEDEDDLLPPIKISAGTAYFPYTNKQGQRSALRISRIVSEMLRLGLKNVRWFVMGDDD  203

Query  708   TVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKV  887
             TVF  DNL++ L KYDH   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL+K+
Sbjct  204   TVFVTDNLIRVLRKYDHEQMYYIGSLSESHLQNIFFSYSMAYGGGGFAISYPLAKALSKM  263

Query  888   FDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLH  1067
              D C+ RYP LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ P VS+H
Sbjct  264   QDRCIQRYPALYGSDDRMQACMAELGVPLTKEIGFHQYDVYGNLFGLLAAHPVTPFVSMH  323

Query  1068  HMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGS  1247
             H++V +PIFPNMT  +AL+ L     +D   +LQQ++CYD+  SW+ISVSWGYAVQI   
Sbjct  324   HLDVVEPIFPNMTRVRALKKLTVPMKLDSAGLLQQSICYDKHKSWSISVSWGYAVQIFRG  383

Query  1248  HLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGIT  1421
                  +      ++  W K      Y F++R    +PC++  VFYM   R        ++
Sbjct  384   IFSPREMEMPSRTFLNWYKRADYTAYAFNTRPVSRNPCQKPFVFYMSSTRFDKQLNTTVS  443

Query  1422  SVYR-KMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEI  1598
                R ++   +C +   +P  ++ I V  +K D    E  +PRR+CC VL +  +  L I
Sbjct  444   EYTRHRVPHPSCRWKMTNPAEINTI-VVYKKPDPHLWE-RSPRRNCCRVLQTKRNNTLWI  501

Query  1599  GIRECKEEEL  1628
              +  C+E E+
Sbjct  502   NVGVCREAEV  511



>ref|XP_008238941.1| PREDICTED: uncharacterized protein LOC103337556 [Prunus mume]
Length=512

 Score =   389 bits (998),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 198/415 (48%), Positives = 270/415 (65%), Gaps = 18/415 (4%)
 Frame = +3

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             PT +  IVFGIA+S + W++RK ++KLW++P  MRG V+LDR     +  G   LPP+ I
Sbjct  110   PTEINDIVFGIAASAKLWKQRKNYIKLWYKPQSMRGIVWLDRQVEDKKPEGL-GLPPIKI  168

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDTS F YT + G+ SAIR++R VSE + L   DVRWFV GDDDTVF  DNLV+ L KY
Sbjct  169   SGDTSGFAYTNKQGHRSAIRISRIVSETLRLGLKDVRWFVMGDDDTVFITDNLVRVLRKY  228

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  +YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL+K+ D C+ RYP LYGSD
Sbjct  229   DHTQYYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAKALSKMQDRCIQRYPGLYGSD  288

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
              R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLV++HH++V +PIFPN T  
Sbjct  289   DRMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVAPLVTMHHLDVVEPIFPNTTRV  348

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +AL+            ++QQ++CYD+  SWTISVSWG+AVQI        +      ++ 
Sbjct  349   QALQ------------LMQQSICYDKSKSWTISVSWGFAVQIFRGVFSPREMEMPSRTFL  396

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITS-VYRKMTTENCTFD  1463
              W K      Y F++R    +PC++  VFYM   RV+++    I+  V  ++   +C + 
Sbjct  397   NWYKRADYTAYAFNTRPVSRNPCQKPFVFYMSKVRVNATMNSTISEYVQHRVPHPHCKWK  456

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              A P +LD++ V  +K D    E  +PRR+CC V+ S     + I +  CKE E+
Sbjct  457   MADPADLDKVEVH-KKPDPHLWE-RSPRRNCCRVMESKKKGTMVIDVGLCKEGEI  509



>ref|XP_008437319.1| PREDICTED: uncharacterized protein LOC103482775 [Cucumis melo]
Length=512

 Score =   389 bits (998),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 198/435 (46%), Positives = 277/435 (64%), Gaps = 11/435 (3%)
 Frame = +3

Query  345   STNLLHVSVSLQD---VSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLD  515
             +T  + +S S Q     ++ T L H+VFGIA+S + W +RK ++KLW++P  MRG V+LD
Sbjct  79    ATAAISLSTSSQGGLPTTNQTELRHVVFGIAASAKLWEQRKNYIKLWFKPEEMRGTVWLD  138

Query  516   RDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVF  695
             R     ED  +D LPP+ ISGDTS F Y  R G+ SAIR++R VSE   L   DVRWFV 
Sbjct  139   RKVKIDED--SDELPPIRISGDTSKFAYKNRQGHRSAIRISRIVSETFRLGLKDVRWFVM  196

Query  696   GDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKA  875
             GDDDTVF  DNL++ L KYDH  +YYIG+ SE  +QN +FS+ MA+GG GFAISYPLA+A
Sbjct  197   GDDDTVFVTDNLLRVLRKYDHTQYYYIGSLSESHLQNIYFSYSMAYGGGGFAISYPLAEA  256

Query  876   LAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPL  1055
             L K+ D C+ RYP LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ P 
Sbjct  257   LVKMQDRCIQRYPGLYGSDDRMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPIAPF  316

Query  1056  VSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQ  1235
             VSLHH+++ +PIFPN+T  +AL+ L     +D   ++QQ++CY +  +WTISVSWGYA+Q
Sbjct  317   VSLHHLDIVEPIFPNVTRLQALDRLKIPMKLDSAGLMQQSICYYKSNTWTISVSWGYAIQ  376

Query  1236  IHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDR---VSSSH  1406
             I    L   +      ++  W +      Y F++R    +PC++  VFY+      +S+ 
Sbjct  377   IFRGILSPREVEMPSRTFLNWYRRADYTAYAFNTRPVSRNPCQKAFVFYLSNALLTNSTT  436

Query  1407  RDGITSVYR-KMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSAD  1583
              + ++   R +     C +   SP  +D ++V  +K D    E  +PRR+CC V+ S   
Sbjct  437   GETVSKYIRHRAPQPACKWKSPSPSIIDFVKV-IKKTDPKLWE-RSPRRNCCRVMKSKEK  494

Query  1584  KALEIGIRECKEEEL  1628
             K L + +  CKE E+
Sbjct  495   KTLMVEVGMCKEGEI  509



>ref|XP_009776276.1| PREDICTED: uncharacterized protein LOC104226084 [Nicotiana sylvestris]
Length=498

 Score =   388 bits (996),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 193/429 (45%), Positives = 271/429 (63%), Gaps = 10/429 (2%)
 Frame = +3

Query  366   SVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNG  545
             S ++Q     T L HIVFGI SS  +W  RKE+VKLWW+P+ MRG V+LD+  +   +  
Sbjct  73    SNTIQTTPEKTQLHHIVFGIGSSRTTWNYRKEYVKLWWKPNKMRGFVWLDKPAMSKNNQS  132

Query  546   TD-----SLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDT  710
             T      SLP + IS +TS F+YT + G+ S IR++R +SE V ++  +VRWFV GDDDT
Sbjct  133   TSIYNVTSLPEIKISSNTSRFKYTNQKGDRSGIRISRIISETVRMDLKNVRWFVMGDDDT  192

Query  711   VFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVF  890
              F P+NLV+ L KYDH  +YYIG+ SE   QN  FS+ MA+GG GFAISYPLAKAL K+ 
Sbjct  193   FFVPENLVRVLRKYDHNQYYYIGSVSETHWQNHEFSYNMAYGGGGFAISYPLAKALEKIQ  252

Query  891   DSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHH  1070
             D C+ +YPHLYGSD R+ ACL+ELGV LT E GFHQ D+ G V G L+AHP+ PLVSLHH
Sbjct  253   DKCIEKYPHLYGSDDRIQACLAELGVPLTKEVGFHQFDLHGSVMGFLSAHPVAPLVSLHH  312

Query  1071  MEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSH  1250
             ++   PIFP ++  +AL  L K   +D   ++QQ++CYDR   WT+SVSWGY+VQI+   
Sbjct  313   LDKVQPIFPKLSRVEALRRLNKPIKLDSAGLMQQSICYDRSRGWTVSVSWGYSVQINRGI  372

Query  1251  LLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYM--DRVSSSHRDGITS  1424
             L   +  +   +++ W     +  + F++R YH + C+R   FY+  +   +++R     
Sbjct  373   LPAREMEKPITTFNDWYATGDENSFTFNTRPYHKNACQR-PFFYLLSNAYVTTNRTTSDY  431

Query  1425  VYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGI  1604
             VY       C +  A P N+  + V  +K D +  +  +PRR+CC VL +S +  L + +
Sbjct  432   VYDGARGSKCKWRMADPSNVRHVEV-YKKPDPNLWD-KSPRRNCCRVLPTSKNDTLLVDV  489

Query  1605  RECKEEELV  1631
              EC+E E +
Sbjct  490   GECREGETI  498



>ref|XP_011073166.1| PREDICTED: uncharacterized protein LOC105158188 isoform X2 [Sesamum 
indicum]
Length=524

 Score =   389 bits (998),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 205/416 (49%), Positives = 276/416 (66%), Gaps = 9/416 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSG-MRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             T LEHIVFGIA+S + W+KRKE++KLWW+P   +RG V+LDR  VK   N T SLP + I
Sbjct  110   TGLEHIVFGIAASAKLWQKRKEYIKLWWKPEERIRGFVWLDR-RVKTYKNETGSLPELRI  168

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSD-VRWFVFGDDDTVFFPDNLVKTLSK  749
             SGDTS+FRY  + G+ SAIR++R VSE + L   D VRWFV GDDDTVF  DNLV+ L+K
Sbjct  169   SGDTSNFRYKNKQGHRSAIRISRIVSETLRLGGMDNVRWFVMGDDDTVFVTDNLVRILNK  228

Query  750   YDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGS  929
             YDH  +YYIG+SSE  +QN +FS+ MA+GG GFAISYPLAKAL K+ D C+ RYP LYGS
Sbjct  229   YDHNQYYYIGSSSESHLQNIYFSYGMAYGGGGFAISYPLAKALEKIQDRCIQRYPGLYGS  288

Query  930   DARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTT  1109
             D R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHPL PLVSLHH++V +PIFPN+T 
Sbjct  289   DDRIQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPLTPLVSLHHLDVVEPIFPNVTQ  348

Query  1110  TKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESY  1289
              +AL+ L     +D   ++QQ++CY +   WTISVSWG+AVQI    +   +      ++
Sbjct  349   VEALQRLKIPMRLDSAGLMQQSICYHKTNGWTISVSWGFAVQIFRGVMSPREIEMPPRTF  408

Query  1290  SPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYRKMTTEN--CTF  1460
               W K      Y F++R    +PC++  +FY+      SH +   S Y +    +  C +
Sbjct  409   LNWYKRGDYKAYAFNTRPVMRNPCQKPFIFYLSTARMESHTNQTVSEYTQHRDPHPACKW  468

Query  1461  DKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
                 P ++D + V  +K D    +  APRR+CC V+SS   ++L I +  C+E E+
Sbjct  469   KMVDPADIDRVEV-YKKPDPHLWD-RAPRRNCCRVVSSK-KQSLVINVGVCEEGEV  521



>emb|CDP11822.1| unnamed protein product [Coffea canephora]
 emb|CDP10889.1| unnamed protein product [Coffea canephora]
Length=266

 Score =   379 bits (973),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 176/272 (65%), Positives = 213/272 (78%), Gaps = 7/272 (3%)
 Frame = +3

Query  825   MAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMD  1004
             MAFGGAGFAISYPLAK LA+  DSC+ RYPHLYGSD R+HACL+ELGV+LTHEPGFHQMD
Sbjct  1     MAFGGAGFAISYPLAKVLAEHLDSCIDRYPHLYGSDGRIHACLTELGVTLTHEPGFHQMD  60

Query  1005  IRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCY  1184
             +RG++FGLLAAHP RPLVSLHH++   PIFP MT  +AL+HL +A  +D  R LQQTVCY
Sbjct  61    VRGNIFGLLAAHPTRPLVSLHHLDAVKPIFPKMTAMEALKHLLEATKVDSQRTLQQTVCY  120

Query  1185  DRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCR  1364
             DRWFSWT+SVSWGYAVQ+ G +  LP A+  QE+Y PW++    + +  ++  Y PDPC+
Sbjct  121   DRWFSWTLSVSWGYAVQLVGFNEFLPVAVLMQETYVPWKRGPLYINHNLNTAKYQPDPCK  180

Query  1365  RQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAP  1544
             R  VF+ DRVSSS RDGI S+Y+K T  NCTFDK     + E+RV ++KLDLD K+L AP
Sbjct  181   RPVVFFFDRVSSS-RDGIASIYKK-TENNCTFDK-----IQEVRVFSKKLDLDIKQLQAP  233

Query  1545  RRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             RR CCDVL SSAD+ +EI IREC  EEL+YMH
Sbjct  234   RRQCCDVLPSSADRVMEINIRECGAEELIYMH  265



>ref|XP_002867706.1| hypothetical protein ARALYDRAFT_492523 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43965.1| hypothetical protein ARALYDRAFT_492523 [Arabidopsis lyrata subsp. 
lyrata]
Length=527

 Score =   389 bits (998),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 196/421 (47%), Positives = 269/421 (64%), Gaps = 8/421 (2%)
 Frame = +3

Query  384   VSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLD---RDEVKHEDNGTDS  554
             V   T L H+VFGIA+S + W++RKE++K+W++P  MRG V+LD   R  V  +D+    
Sbjct  105   VDKLTDLNHVVFGIAASSKLWKQRKEYIKIWYKPKHMRGYVWLDKEVRKSVSDDDDDEKL  164

Query  555   LPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLV  734
             LPPV ISG T+SF YT + G  SA+R++R VSE + L   +VRWFV GDDDTVF  DNL+
Sbjct  165   LPPVKISGGTASFPYTNKQGQRSALRISRIVSETLRLGPKNVRWFVMGDDDTVFVTDNLI  224

Query  735   KTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYP  914
             + L KYDH   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL+K+ D C+ RYP
Sbjct  225   RVLRKYDHEQMYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAKALSKMQDRCIQRYP  284

Query  915   HLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIF  1094
              LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ P VS+HH++V +PIF
Sbjct  285   ALYGSDDRMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVTPFVSMHHLDVVEPIF  344

Query  1095  PNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALR  1274
             PNMT  +AL+ L +   +D   +LQQ++CYD+  SWTISVSWGYAVQI        +   
Sbjct  345   PNMTRVRALKKLTQPMKLDSAGLLQQSICYDKHKSWTISVSWGYAVQIFRGIFSPREMEM  404

Query  1275  AQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITS---VYRKMTT  1445
                ++  W K      Y F++R    +PC++  VFYM       +   T       +++ 
Sbjct  405   PSRTFLNWYKRADYTAYAFNTRPVSRNPCQKPFVFYMSSTKFDQQLNTTVSEYTIHRVSH  464

Query  1446  ENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEE  1625
              +C +   +P  ++ I V  +K D    E  +PRR+CC VL +  +  L I +  C+  E
Sbjct  465   PSCRWKMTNPAEINTI-VVYKKPDPHLWE-RSPRRNCCRVLQTKRNNTLWINVGVCRAGE  522

Query  1626  L  1628
             +
Sbjct  523   V  523



>ref|XP_010422090.1| PREDICTED: uncharacterized protein LOC104707437 [Camelina sativa]
Length=510

 Score =   388 bits (996),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 196/419 (47%), Positives = 273/419 (65%), Gaps = 10/419 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRD-EVKHEDNGTDSLPPVCI  572
             T L H+VFGIA+S + W+ RKE++K+W++P  MRG V+LD++ ++K +    ++LPPV I
Sbjct  91    TDLNHVVFGIAASSKLWKHRKEYIKIWFKPKKMRGYVWLDKEVKIKSDAGDQENLPPVRI  150

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAV----SLNHSDVRWFVFGDDDTVFFPDNLVKT  740
             SG+TSSF YT + G+ SAIR++R VSE +    S++  +VRWFV GDDDTVF  DNL++ 
Sbjct  151   SGNTSSFPYTNKKGHRSAIRISRIVSETLMNLDSVSKKNVRWFVMGDDDTVFVTDNLIRV  210

Query  741   LSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHL  920
             L KYDH   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLA AL+K+ D C+ RYP L
Sbjct  211   LRKYDHEQMYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAVALSKMQDRCIQRYPAL  270

Query  921   YGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPN  1100
             YGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ P VS+HH++V +PIFPN
Sbjct  271   YGSDDRMQACMAELGVPLTKEIGFHQYDVHGNLFGLLAAHPVTPFVSMHHLDVLEPIFPN  330

Query  1101  MTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQ  1280
             MT  +A++ L     ID   ILQQ++CYD++ SWTISVSWGYAVQ+        +     
Sbjct  331   MTRVRAIKKLTTPMKIDSSGILQQSICYDKYKSWTISVSWGYAVQVFRGSFSPREMEMPS  390

Query  1281  ESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYRKMTTEN--  1451
              ++  W K      Y F++R    +PC+   VFYM  V      +   S Y +    +  
Sbjct  391   RTFLNWYKKADYTAYAFNTRPVSRNPCQTPFVFYMSNVKFDPQLNTTVSEYTRHRVRHPA  450

Query  1452  CTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             C +D A+P  ++ I V  +K D       +PR++CC VL +  +  L I +  C+  E+
Sbjct  451   CRWDMANPEEINTI-VVYKKPDPHLWN-RSPRKNCCRVLQTKRNNTLWINVGVCRAGEV  507



>ref|XP_006343942.1| PREDICTED: uncharacterized protein LOC102586899 [Solanum tuberosum]
Length=523

 Score =   388 bits (997),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 200/413 (48%), Positives = 273/413 (66%), Gaps = 8/413 (2%)
 Frame = +3

Query  402   LEHIVFGIASSEESWRKRKEFVKLWWRPSG-MRGCVFLDRDEVKHEDNGTDSLPPVCISG  578
             LEHIVFGIA+S + W KRKE++KLWW+P   MRG V+LD+  VK      +SLP + ISG
Sbjct  112   LEHIVFGIAASAKLWDKRKEYIKLWWKPEEEMRGIVWLDK-PVKTSKGDGESLPELRISG  170

Query  579   DTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDH  758
             DTS F Y  R G+ SAIR++R VSE + L   +VRWFV GDDDTVF  DNLV+ L+KYDH
Sbjct  171   DTSRFAYRNRQGHRSAIRISRIVSETLRLGRENVRWFVMGDDDTVFVTDNLVRILNKYDH  230

Query  759   GLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDAR  938
               +YYIG+SSE  +QN +FS+ MA+GG GFAISYPLAKAL K+ D C+ RYP LYGSD R
Sbjct  231   NQYYYIGSSSESHLQNIYFSYSMAYGGGGFAISYPLAKALEKMQDKCIQRYPGLYGSDDR  290

Query  939   VHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKA  1118
             + AC++ELGV LT E GFHQ D+ G++FGLLA+HP+ PLV+LHH++V +PIFPN+T  +A
Sbjct  291   MQACMAELGVPLTKELGFHQYDVYGNLFGLLASHPIAPLVTLHHLDVVEPIFPNVTRVQA  350

Query  1119  LEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPW  1298
             L  L     +D   ++QQ++CYD+   WTISVSWG+AVQI    L   +      ++  W
Sbjct  351   LRRLTVPMKLDSAGLMQQSICYDKANGWTISVSWGFAVQIFRGVLSPREIEMPSRTFLNW  410

Query  1299  RKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITSVYR-KMTTENCTFDKA  1469
              K      Y F++R    +PC++  VFY+   ++  S    ++   R ++    C +   
Sbjct  411   YKRADYTAYAFNTRPVARNPCQKPFVFYLSSAKMDPSSNQTVSQYTRHRVPHPACKWKTT  470

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              P ++D ++V  +K D    +  +PRR+CC VLSS   K++ + +  CKE EL
Sbjct  471   DPADVDRVQV-YKKSDPHLWD-RSPRRNCCRVLSSKG-KSMVVDVGVCKEGEL  520



>gb|KDO59856.1| hypothetical protein CISIN_1g010984mg [Citrus sinensis]
 gb|KDO59857.1| hypothetical protein CISIN_1g010984mg [Citrus sinensis]
 gb|KDO59858.1| hypothetical protein CISIN_1g010984mg [Citrus sinensis]
Length=494

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 233/476 (49%), Positives = 314/476 (66%), Gaps = 22/476 (5%)
 Frame = +3

Query  249   VKVKPSQNF-----KNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQD----VSSPTS  401
             +K+ PS+       KN +L+ S L ++YL   F   PS   LH    L       ++P +
Sbjct  28    IKMMPSRTLTPSALKNSILLFSFLLIIYL---FFYYPS---LHAPPRLLSSHVVTANPLT  81

Query  402   LEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGD  581
               H++F IASS  SW +R+ +V+LW+ P+  R   FLDR        G  SLP + IS D
Sbjct  82    RRHLLFSIASSSSSWPRRRSYVRLWYSPNSTRALTFLDR-AADSSSAGDPSLPRIVISAD  140

Query  582   TSSFRYTCRGGNPSAIRLARAVSEAVSLN--HSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             TS F +T   G  SA+R+AR V EAV L    + VRWFVFGDDDTVFF DNLVKTLSKYD
Sbjct  141   TSKFPFTFPKGLRSAVRVARVVKEAVDLTDEKAGVRWFVFGDDDTVFFVDNLVKTLSKYD  200

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
                W+Y+G++SE   QN+  SF MAFGG GFAIS+ LA+ LA   DSCL RY HLYGSDA
Sbjct  201   DDRWFYVGSNSEGYEQNAKHSFGMAFGGGGFAISHSLARVLAGALDSCLMRYAHLYGSDA  260

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             RV +CL ELGV LT EPGFHQ+D+RGD+FG+L+AHPL PL+SLHH++  DPIFPNM  T+
Sbjct  261   RVFSCLVELGVGLTPEPGFHQLDMRGDMFGMLSAHPLSPLLSLHHLDAIDPIFPNMNRTQ  320

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+HL+KA ++DP RILQQTVCYD+    T+SV+WG+AVQ++  + LLPD L  Q +++ 
Sbjct  321   ALQHLFKAVNVDPARILQQTVCYDQSSQLTVSVAWGFAVQVYEGNQLLPDLLSLQRTFTS  380

Query  1296  WRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKAS  1472
             WR+    +  + F+ R Y  DPC+R  VF+++ V  SH + + S Y K    NC      
Sbjct  381   WRRGSNVESHFMFNLRDYPRDPCKRPIVFFLESV-LSHNNSVQSNYVKHVVGNCARADVV  439

Query  1473  PRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              R +++IRV ++KL+LD +E+ +PRR CCD+   + ++++ I IR+C   EL+ MH
Sbjct  440   -RKIEKIRVFSEKLELDVEEMKSPRRQCCDIF-PTYNESMNIKIRQCGGNELISMH  493



>ref|XP_006339795.1| PREDICTED: uncharacterized protein LOC102583570 [Solanum tuberosum]
Length=437

 Score =   385 bits (988),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 195/417 (47%), Positives = 270/417 (65%), Gaps = 9/417 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRD--EVKHEDN--GTDSLPP  563
             T L HIVFGI SS  +W  RKE+VKLWW P+ MRG V+LD++     + DN   T SLP 
Sbjct  21    TQLHHIVFGIGSSNATWNYRKEYVKLWWNPNKMRGFVWLDKNMSSTSNYDNVTATTSLPK  80

Query  564   VCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTL  743
             + IS DTS FRYT + G+ S IR++R +SE V  +  +VRW+V GDDDT F P+NLV+ L
Sbjct  81    IMISSDTSRFRYTNKNGDRSGIRISRVLSETVRADSKNVRWYVMGDDDTFFVPENLVRVL  140

Query  744   SKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLY  923
              KYDH  +YYIG+ SE   QN  FS+ MA+GG GFAISYPLAKA+ K+ D C+ RYP+LY
Sbjct  141   RKYDHKQYYYIGSVSETHWQNHEFSYNMAYGGGGFAISYPLAKAIEKMQDKCIQRYPYLY  200

Query  924   GSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNM  1103
             GSD R+ AC++ELGV LT E GFHQ D+ G+V GLL+AHP+ PL+SLHH++  +PIFPN+
Sbjct  201   GSDDRMQACMAELGVPLTKEVGFHQFDLYGNVMGLLSAHPVSPLISLHHLDKIEPIFPNV  260

Query  1104  TTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQE  1283
             T  KAL+ L K  ++D   ++QQ++CYDR   WTISVSWGY+VQI+   L   +  +   
Sbjct  261   TRVKALKRLKKPITLDSAGLMQQSICYDRPRKWTISVSWGYSVQINRGILPAREIEKPIT  320

Query  1284  SYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRV-SSSHRDGITSVYRK--MTTENC  1454
             +++ W     +    F++R YH + C+R   + +    +S+  D  TSVY         C
Sbjct  321   TFNDWYGTNDENSLTFNTRPYHGNGCQRPYFYLLSNAYASTTNDTTTSVYAHDGAPGGKC  380

Query  1455  TFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEE  1625
              +  A P  +  ++V  +K D +  +  +PRR+CC VL ++ +  L I + EC+  E
Sbjct  381   KWRMADPSRIRHVKV-YKKPDPNLWD-KSPRRNCCRVLPTNKNDTLLIDVGECRNGE  435



>ref|XP_004231192.2| PREDICTED: uncharacterized protein LOC101264770 [Solanum lycopersicum]
Length=493

 Score =   387 bits (993),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 192/414 (46%), Positives = 268/414 (65%), Gaps = 5/414 (1%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L HIVFGI SS  +W  RKE+VKLWW P+ MRG V+LD++ + +++  T SLP + IS
Sbjct  83    TQLHHIVFGIGSSSATWNNRKEYVKLWWNPNKMRGFVWLDKN-MNYDNVTTTSLPKIMIS  141

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              DTS F YT + G+ S IR++R +SE V  +  +VRW+V GDDDT F P+NLV+ L KYD
Sbjct  142   SDTSKFSYTNKNGDRSGIRISRVLSETVRADSGNVRWYVMGDDDTFFVPENLVRVLRKYD  201

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG  SE   QN  FS+ MA+GG GFAISYPLAKA+ K+ D C+ RYP+LYGSD 
Sbjct  202   HKQYYYIGIVSETHWQNHEFSYNMAYGGGGFAISYPLAKAIEKMQDKCIQRYPYLYGSDD  261

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G+V GLL+AHP+ PL+SLHH++  +PIFP++T  K
Sbjct  262   RMQACMAELGVPLTKEVGFHQFDLYGNVMGLLSAHPVAPLISLHHLDKIEPIFPHVTRVK  321

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+ L K  ++D   ++QQ++CYDR   WTISVSWGY VQI+   L   +  +   +++ 
Sbjct  322   ALKRLKKPITLDSAGLMQQSICYDRPRKWTISVSWGYLVQINRGILPAREIEKPIATFND  381

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRK--MTTENCTFDKA  1469
             W + K +    F++R YH   C+R   + +    +S  D  TSVY         C +  A
Sbjct  382   WYQTKDENSLTFNTRPYHGKGCQRPYFYLLSNAYASTNDTTTSVYEHDGAPGGKCKWRMA  441

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
              P  +  + V  +K D +  +  +PRR+CC VL ++ +  L I + EC+  E +
Sbjct  442   DPSKIRHVEV-YKKPDPNLWD-KSPRRNCCRVLPTNKNDTLLIDVGECRNGEPI  493



>emb|CDX94192.1| BnaC07g38260D [Brassica napus]
Length=508

 Score =   387 bits (995),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/418 (47%), Positives = 271/418 (65%), Gaps = 8/418 (2%)
 Frame = +3

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHE---DNGTDSLPP  563
             PT L H+VFGIA+S + W++RKE++K+W++P  MRG V+LD+   K+    D+  D LPP
Sbjct  89    PTDLSHVVFGIAASAKLWKQRKEYIKIWYKPKHMRGYVWLDKAVKKNNTSNDDDEDLLPP  148

Query  564   VCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTL  743
             V ISG T+SF YT + G  SA+R++R VSE + L   +VRWFV GDDDTVF  DNL++ L
Sbjct  149   VRISGGTASFPYTNKQGQRSALRISRIVSEMLRLGPKNVRWFVMGDDDTVFVTDNLIRVL  208

Query  744   SKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLY  923
              KYDH   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL+K+ D C+ RYP LY
Sbjct  209   RKYDHEQMYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAKALSKMQDRCIQRYPALY  268

Query  924   GSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNM  1103
             GSD R+ AC++ELGV LT E GFHQ D+ G +FGLLAAHP+ P VS+HH++V +PIFPNM
Sbjct  269   GSDDRMQACMAELGVPLTKELGFHQYDVYGSLFGLLAAHPVTPFVSVHHLDVVEPIFPNM  328

Query  1104  TTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQE  1283
             T  +AL+ L     +D   +LQQ++CYD+  SWT+SVSWGYAVQI        +      
Sbjct  329   TRVRALKKLTVPMKLDSAGLLQQSICYDKHKSWTVSVSWGYAVQIFRGIFSPREMEMPTR  388

Query  1284  SYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT-SVY--RKMTTENC  1454
             ++  W K      Y F++R     PC++  V+YM       +   T S Y   +++  +C
Sbjct  389   TFLNWYKRADYTAYAFNTRPVSRQPCQKPFVYYMSTTKFDKQLNTTVSEYTRHRVSHPSC  448

Query  1455  TFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              +  A+P  ++ I V  +K D    E  +PRR+CC VL +  +  L I +  C++ E+
Sbjct  449   KWKMANPAEINTI-VVYKKPDPHLWE-RSPRRNCCRVLQTKRNNTLWINVGVCRDGEV  504



>ref|XP_007160097.1| hypothetical protein PHAVU_002G292100g [Phaseolus vulgaris]
 gb|ESW32091.1| hypothetical protein PHAVU_002G292100g [Phaseolus vulgaris]
Length=515

 Score =   387 bits (995),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 195/414 (47%), Positives = 270/414 (65%), Gaps = 7/414 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L H+VFGIA+S + W KRK ++KLW+R   MRG V+LD ++VK E++ +D+LPPV IS
Sbjct  103   TELRHVVFGIAASAKLWEKRKNYIKLWYRAQEMRGVVWLD-EKVKSEED-SDALPPVRIS  160

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDT+ FRYT + G+ SAIR++R V+E + L   DVRWFV GDDDTVF  +NL++ L KYD
Sbjct  161   GDTARFRYTNKQGHRSAIRISRIVAETLRLGMKDVRWFVMGDDDTVFVTENLIRVLRKYD  220

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+ SE  +QN +FS+ MA+GG GFAISYPLAKAL ++ D C+ RYP LYGSD 
Sbjct  221   HKQFYYIGSLSESHLQNIYFSYNMAYGGGGFAISYPLAKALNEMQDRCIQRYPGLYGSDD  280

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLA+HP+ PLVSLHH++V +PIFPN+T  +
Sbjct  281   RMQACMAELGVPLTKEIGFHQYDVYGNLFGLLASHPVTPLVSLHHLDVVEPIFPNVTRVE  340

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+ L     +D   ++QQ++CYD+  SWT+SVSWG+AVQI+       +      ++  
Sbjct  341   ALQRLTIPMKLDSAGLMQQSICYDKSKSWTVSVSWGFAVQIYRGVFSPREMEMPSRTFLN  400

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYR--KMTTENCTFDK  1466
             W +      Y F++R    +PC++  VFY      +S    I S Y   ++    C +  
Sbjct  401   WYRRADYTAYAFNTRPVSRNPCQKPFVFYFSNAKYNSTMQHIVSEYERHRVPHPECRWKM  460

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             ASP  LD++ V  +          +PRR+CC V  S     + I +  C E EL
Sbjct  461   ASPAALDKVEVYKKPDPYLWNR--SPRRNCCRVKRSKEKGKMVIDVGVCSEGEL  512



>ref|XP_006447476.1| hypothetical protein CICLE_v10015015mg [Citrus clementina]
 ref|XP_006447477.1| hypothetical protein CICLE_v10015015mg [Citrus clementina]
 ref|XP_006447480.1| hypothetical protein CICLE_v10015015mg [Citrus clementina]
 ref|XP_006447482.1| hypothetical protein CICLE_v10015015mg [Citrus clementina]
 ref|XP_006447483.1| hypothetical protein CICLE_v10015015mg [Citrus clementina]
 ref|XP_006447485.1| hypothetical protein CICLE_v10015015mg [Citrus clementina]
 ref|XP_006469723.1| PREDICTED: uncharacterized protein LOC102620781 isoform X1 [Citrus 
sinensis]
 ref|XP_006469724.1| PREDICTED: uncharacterized protein LOC102620781 isoform X2 [Citrus 
sinensis]
 ref|XP_006469725.1| PREDICTED: uncharacterized protein LOC102620781 isoform X3 [Citrus 
sinensis]
 gb|ESR60716.1| hypothetical protein CICLE_v10015015mg [Citrus clementina]
 gb|ESR60717.1| hypothetical protein CICLE_v10015015mg [Citrus clementina]
 gb|ESR60720.1| hypothetical protein CICLE_v10015015mg [Citrus clementina]
 gb|ESR60722.1| hypothetical protein CICLE_v10015015mg [Citrus clementina]
 gb|ESR60723.1| hypothetical protein CICLE_v10015015mg [Citrus clementina]
 gb|ESR60725.1| hypothetical protein CICLE_v10015015mg [Citrus clementina]
Length=494

 Score =   387 bits (993),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 233/476 (49%), Positives = 314/476 (66%), Gaps = 22/476 (5%)
 Frame = +3

Query  249   VKVKPSQNF-----KNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQD----VSSPTS  401
             +K+ PS+       KN +L+ S L ++YL   F   PS   LH    L       ++P +
Sbjct  28    IKMMPSRTLTPSALKNSILLFSFLLIIYL---FFYYPS---LHAPPRLLSSHVVTANPLT  81

Query  402   LEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGD  581
               H++F IASS  SW +R+ +V+LW+ P+  R   FLDR        G  SLP + IS D
Sbjct  82    RRHLLFSIASSSSSWPRRRSYVRLWYSPNSTRALTFLDR-AADSSSAGDPSLPRIVISAD  140

Query  582   TSSFRYTCRGGNPSAIRLARAVSEAVSLN--HSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             TS F +T   G  SA+R+AR V EAV L    + VRWFVFGDDDTVFF DNLVKTLSKYD
Sbjct  141   TSKFPFTFPKGLRSAVRVARVVKEAVDLTDEKAGVRWFVFGDDDTVFFVDNLVKTLSKYD  200

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
                W+Y+G++SE   QN+  SF MAFGG GFAIS+ LA+ LA   DSCL RY HLYGSDA
Sbjct  201   DDRWFYVGSNSEGYEQNAKHSFGMAFGGGGFAISHSLARVLAGALDSCLMRYAHLYGSDA  260

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             RV +CL ELGV LT EPGFHQ+D+RGD+FG+L+AHPL PL+SLHH++  DPIFPNM  T+
Sbjct  261   RVFSCLVELGVGLTPEPGFHQLDMRGDMFGMLSAHPLSPLLSLHHLDAIDPIFPNMNRTQ  320

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+HL+KA ++DP RILQQTVCYD+    T+SV+WG+AVQ++  + LLPD L  Q +++ 
Sbjct  321   ALQHLFKAVNVDPARILQQTVCYDQSSQLTVSVAWGFAVQVYEGNQLLPDLLSLQRTFTS  380

Query  1296  WRKNKK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKAS  1472
             WR+    +  + F+ R Y  DPC+R  VF+++ V  SH + + S Y K    NC      
Sbjct  381   WRRGSNVESHFMFNLRDYPRDPCKRPIVFFLESV-LSHNNSVQSNYVKHVVGNCAGADVV  439

Query  1473  PRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              R +++IRV ++KL+LD +E+ +PRR CCD+   + ++++ I IR+C   EL+ MH
Sbjct  440   -RKIEKIRVFSEKLELDVEEMKSPRRQCCDIF-PTYNESMNIKIRQCGGNELISMH  493



>ref|XP_006846343.1| hypothetical protein AMTR_s00012p00258210 [Amborella trichopoda]
 gb|ERN08018.1| hypothetical protein AMTR_s00012p00258210 [Amborella trichopoda]
Length=505

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 195/424 (46%), Positives = 278/424 (66%), Gaps = 13/424 (3%)
 Frame = +3

Query  378   QDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSL  557
              +  SPT + HI+FGIA S ++WR R  ++ LWW P+  RG V+LD    K+      S 
Sbjct  84    NNFRSPTKIGHILFGIAGSSKTWRNRGPYIDLWWEPNKTRGHVWLDSPPTKYP--WPSSS  141

Query  558   PPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVK  737
             PP  IS +T+ F    +   P AIR+AR + E+ +L  SDVRWFV GDDDTVFF DNLVK
Sbjct  142   PPFRISENTAIFNGYNKHEMPFAIRMARVLLESFNLGLSDVRWFVMGDDDTVFFVDNLVK  201

Query  738   TLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPH  917
              L+KYDH  ++YIG +SE VVQN   S++MAFGG G+A+SYPLAKAL+++FD C+ RY  
Sbjct  202   VLAKYDHNKYFYIGGNSESVVQNMAHSYDMAFGGGGYAVSYPLAKALSRIFDDCIRRYQT  261

Query  918   LYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFP  1097
             LYGSD  + +C++E+GV LT EPGFHQ+D+ GD++GLL+AHP+ PL+SLHH++   PIFP
Sbjct  262   LYGSDHIIQSCVAEVGVRLTKEPGFHQIDLLGDIYGLLSAHPMSPLLSLHHLDYIAPIFP  321

Query  1098  NMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRA  1277
              MT  +AL+ L KA+  +P ++LQQ++CY +  +W+ISVSWGY+VQI+   +  P  L  
Sbjct  322   GMTRIQALKVLLKASKANPPQLLQQSICYHKEHNWSISVSWGYSVQIY-QKIYPPGFLTI  380

Query  1278  Q-ESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS--SSHRDGITSVY---RKM  1439
               +++ PWRK+   + + F++R    DPC + TVF+ D V   S   + I +VY      
Sbjct  381   PLQTFKPWRKSGV-LSFMFNTRPLSTDPCEKPTVFFFDSVKPVSPFVNLIETVYVGREDR  439

Query  1440  TTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKE  1619
             +   C  +++ P  +DE+R+ ++  D+    +   RR CC+VL SS     EI IREC +
Sbjct  440   SISACNLNQSLPNIVDEVRIFSELQDI---RVAGSRRQCCEVLPSSGMNVTEIRIRECLD  496

Query  1620  EELV  1631
             +E V
Sbjct  497   DENV  500



>ref|XP_011073151.1| PREDICTED: uncharacterized protein LOC105158188 isoform X1 [Sesamum 
indicum]
 ref|XP_011073159.1| PREDICTED: uncharacterized protein LOC105158188 isoform X1 [Sesamum 
indicum]
Length=534

 Score =   388 bits (996),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 205/415 (49%), Positives = 275/415 (66%), Gaps = 9/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSG-MRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             T LEHIVFGIA+S + W+KRKE++KLWW+P   +RG V+LDR  VK   N T SLP + I
Sbjct  110   TGLEHIVFGIAASAKLWQKRKEYIKLWWKPEERIRGFVWLDR-RVKTYKNETGSLPELRI  168

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSD-VRWFVFGDDDTVFFPDNLVKTLSK  749
             SGDTS+FRY  + G+ SAIR++R VSE + L   D VRWFV GDDDTVF  DNLV+ L+K
Sbjct  169   SGDTSNFRYKNKQGHRSAIRISRIVSETLRLGGMDNVRWFVMGDDDTVFVTDNLVRILNK  228

Query  750   YDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGS  929
             YDH  +YYIG+SSE  +QN +FS+ MA+GG GFAISYPLAKAL K+ D C+ RYP LYGS
Sbjct  229   YDHNQYYYIGSSSESHLQNIYFSYGMAYGGGGFAISYPLAKALEKIQDRCIQRYPGLYGS  288

Query  930   DARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTT  1109
             D R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHPL PLVSLHH++V +PIFPN+T 
Sbjct  289   DDRIQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPLTPLVSLHHLDVVEPIFPNVTQ  348

Query  1110  TKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESY  1289
              +AL+ L     +D   ++QQ++CY +   WTISVSWG+AVQI    +   +      ++
Sbjct  349   VEALQRLKIPMRLDSAGLMQQSICYHKTNGWTISVSWGFAVQIFRGVMSPREIEMPPRTF  408

Query  1290  SPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYRKMTTEN--CTF  1460
               W K      Y F++R    +PC++  +FY+      SH +   S Y +    +  C +
Sbjct  409   LNWYKRGDYKAYAFNTRPVMRNPCQKPFIFYLSTARMESHTNQTVSEYTQHRDPHPACKW  468

Query  1461  DKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEE  1625
                 P ++D + V  +K D    +  APRR+CC V+SS   ++L I +  C+E E
Sbjct  469   KMVDPADIDRVEV-YKKPDPHLWD-RAPRRNCCRVVSSK-KQSLVINVGVCEEGE  520



>gb|KFK28899.1| hypothetical protein AALP_AA7G062500 [Arabis alpina]
Length=524

 Score =   387 bits (994),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 198/422 (47%), Positives = 275/422 (65%), Gaps = 9/422 (2%)
 Frame = +3

Query  384   VSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVK----HEDNGTD  551
             V+ PT L+H+VFGIA+S + W++RKE++K+W++P  MRG V+LD+   K     E++  D
Sbjct  101   VNEPTDLQHVVFGIAASSKLWKQRKEYIKIWYKPKHMRGYVWLDKQVKKSLNNDEEDDDD  160

Query  552   SLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNL  731
              LPPV ISGDT++F YT + G  SA+R++R VSE + L   +VRWFV GDDDTVF  DNL
Sbjct  161   VLPPVKISGDTANFPYTNKQGQRSALRISRIVSEMMRLGLKNVRWFVMGDDDTVFVTDNL  220

Query  732   VKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRY  911
             ++ L KYDH   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL+K+ D C+ RY
Sbjct  221   IRVLRKYDHEQMYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAKALSKMQDRCIQRY  280

Query  912   PHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPI  1091
             P LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ P VS+HH++V +PI
Sbjct  281   PALYGSDDRMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVTPFVSMHHLDVVEPI  340

Query  1092  FPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDAL  1271
             FPNMT  ++L+ L     +D   +LQQ++CYD++ SWTISVSWGYAVQI        +  
Sbjct  341   FPNMTRVRSLKKLTTPMKLDSAGLLQQSICYDKYKSWTISVSWGYAVQIFRGVFSPREME  400

Query  1272  RAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT-SVYRKMTTE  1448
                 ++  W K      Y F++R    +PC++  VFYM       +   T S Y +   +
Sbjct  401   MPSRTFLNWYKRADYTAYAFNTRPVSRNPCQKPFVFYMSSTKFDQQLNTTVSEYTRHRVK  460

Query  1449  --NCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEE  1622
               +C +   +P  ++ I V  +K D    E  +PRR+CC VL +  +  L I +  C+  
Sbjct  461   HPSCRWKMTNPGEINTI-VVYKKPDPHLWE-RSPRRNCCRVLQTKRNNTLWINVGVCRAG  518

Query  1623  EL  1628
             E+
Sbjct  519   EV  520



>ref|XP_004298826.1| PREDICTED: uncharacterized protein LOC101314371 [Fragaria vesca 
subsp. vesca]
Length=523

 Score =   387 bits (994),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/414 (47%), Positives = 267/414 (64%), Gaps = 8/414 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             TS++HIVFGIA+S + W +RK ++KLW++P  MRG V+LDR        G   LPP+ IS
Sbjct  108   TSVKHIVFGIAASAKLWSQRKNYIKLWYKPDTMRGIVWLDRAVANQTREG---LPPIKIS  164

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS F Y+ + G+ SAIR++R VSE + L   DVRWFV GDDDTVF  DNLV+ L KYD
Sbjct  165   GDTSEFGYSNKQGHRSAIRISRIVSETLRLGLKDVRWFVMGDDDTVFITDNLVRVLRKYD  224

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL+K+ D C+ RYP LYGSD 
Sbjct  225   HTQYYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAKALSKMQDRCIQRYPGLYGSDD  284

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLV++HH++V +PIFPN+T  +
Sbjct  285   RMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVAPLVTMHHLDVVEPIFPNVTRVQ  344

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+ L     +D   I+QQ++CYD+  SWTISVSWG+AVQI        +      ++  
Sbjct  345   ALQRLMVPVKLDSAGIMQQSICYDKSRSWTISVSWGFAVQIFRGVFSPREMEMPSRTFLN  404

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT---SVYRKMTTENCTFDK  1466
             W +      Y F++R    +PC++  VFY+ +V  +     T    V  ++    C +  
Sbjct  405   WYRRADYTAYAFNTRPVSRNPCQKPFVFYLSKVKFNSTMNTTFSEYVQHRVPHPLCKWKM  464

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             A P   +++ V  +K D       +PRR+CC V +S     + I +  CKE E+
Sbjct  465   ADPAAFEKVEV-YKKPDPQLWN-RSPRRNCCRVRNSKKKGTMVIDVGLCKEGEI  516



>ref|XP_004251447.1| PREDICTED: uncharacterized protein LOC101264891 [Solanum lycopersicum]
Length=496

 Score =   386 bits (992),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 193/423 (46%), Positives = 278/423 (66%), Gaps = 10/423 (2%)
 Frame = +3

Query  375   LQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDS  554
             L+     T+L+H+VFGIA+S   W KRKE++KLWW+P   RG V+LD + VK  +N  + 
Sbjct  76    LRKKEEETNLKHVVFGIAASSILWDKRKEYIKLWWKPGETRGVVWLD-ENVKINNN--EP  132

Query  555   LPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLV  734
             LP + IS DT+ F YT R G+ SA+R++R VSE + L   DVRWFV GDDDTVFF +N+V
Sbjct  133   LPDIKISDDTTKFHYTNRQGSRSALRISRVVSETLRLGLKDVRWFVMGDDDTVFFVENVV  192

Query  735   KTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYP  914
             + LSKYDH  +YYIG+SSE  VQN FFS+ MA+GG GFAISYPLAK L K+ D C+ RYP
Sbjct  193   RVLSKYDHNQYYYIGSSSESHVQNIFFSYSMAYGGGGFAISYPLAKELEKMQDRCIQRYP  252

Query  915   HLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIF  1094
              LYGSD R+ +C++ELGV LT E GFHQ D+ G++ GLL AHP+ PLVSLHH++V DPIF
Sbjct  253   GLYGSDDRIQSCMAELGVPLTKERGFHQYDVYGNLLGLLGAHPVTPLVSLHHLDVVDPIF  312

Query  1095  PNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALR  1274
             P ++  + L+ L++++ +D   ++QQ++CYD+   W+ISVSWGY VQI   ++   +   
Sbjct  313   PGISRVEGLQRLFESSRLDSANLMQQSICYDKERYWSISVSWGYVVQIIRGNVSPRELEM  372

Query  1275  AQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSH-RDGITSVY--RKMTT  1445
                ++  W K      Y F++R     PC++  V+YM+     H R+ I  +Y   +  +
Sbjct  373   PTRTFLNWYKRADYTAYAFNTRPVTRHPCQKPFVYYMNTAKIDHSRNQIIGIYYRHREPS  432

Query  1446  ENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKA--LEIGIRECKE  1619
              +C +   SP N++ I V  ++ D +++   +PRR CC VL S+ +    L + +  C++
Sbjct  433   PSCRWKIESPENINNI-VLLKRPD-NNRWQKSPRRDCCGVLPSNNNSKSNLYMWVGSCRD  490

Query  1620  EEL  1628
              E+
Sbjct  491   GEI  493



>gb|KEH18823.1| transferring glycosyl group transferase [Medicago truncatula]
Length=489

 Score =   386 bits (991),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/418 (46%), Positives = 271/418 (65%), Gaps = 7/418 (2%)
 Frame = +3

Query  387   SSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPV  566
              + T++ HIVFGI +S + W+KRKE++KLWW+P+ MRG V+L++ +VK + N  D LP +
Sbjct  74    QTKTNISHIVFGIGASAKLWKKRKEYIKLWWKPNQMRGIVWLEQ-KVKIDSNDEDLLPLL  132

Query  567   CISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLS  746
              IS DTS F+Y    G+ SAIR++R VSE V L   +VRWFV GDDDT F  +NLV  L 
Sbjct  133   KISEDTSKFKYKNSKGHRSAIRISRIVSETVRLGMENVRWFVMGDDDTFFVAENLVNVLK  192

Query  747   KYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYG  926
             KYDH  +YYIG++SE  +QN +FS+ MA+GG GFAISYPLA AL K+ D C+ RYP LYG
Sbjct  193   KYDHNQFYYIGSNSESHLQNIYFSYNMAYGGGGFAISYPLAVALEKMQDRCIQRYPGLYG  252

Query  927   SDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMT  1106
             SD R+ AC++ELG+ LT E GFHQ D+ G++FGLLAAHP+ PLVSLHH++V +PIFPN++
Sbjct  253   SDDRIQACMAELGIPLTKEKGFHQFDVYGNLFGLLAAHPVTPLVSLHHLDVVEPIFPNVS  312

Query  1107  TTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQES  1286
               +AL+ L    ++DP  ++QQ++CYD+  +WTISVSWGYAVQI+       +      +
Sbjct  313   RVQALKRLTAPMNLDPAGLIQQSICYDKTRTWTISVSWGYAVQIYRGIFSAREMEMPART  372

Query  1287  YSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYM-DRVSSSHRDGITSVY-RKMTTENCTF  1460
             +  W K      Y F++R    + C++  V+Y+ + V     D   S Y R  +  +C +
Sbjct  373   FLNWYKRADYTAYPFNTRPVSRNVCQKPFVYYLSNAVYDKDTDETASRYVRVQSNPDCKW  432

Query  1461  DKASPRNLDEIRVSTQ-KLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
                 P  +  I V  +   +L  K   +PRR+CC +  S     + I + EC+E+E V
Sbjct  433   KMEDPSQIKLIVVYKKTNPNLWDK---SPRRNCCRIQDSKRKGTMVIDVGECREDEAV  487



>ref|XP_006303976.1| hypothetical protein CARUB_v10008901mg [Capsella rubella]
 gb|EOA36874.1| hypothetical protein CARUB_v10008901mg [Capsella rubella]
Length=507

 Score =   386 bits (992),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 198/423 (47%), Positives = 268/423 (63%), Gaps = 13/423 (3%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSG-MRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             T L+H+VFGIA+S + W+ R+++VKLWWRP+G M G V+LD   +   DN + +LPP+ I
Sbjct  82    TELKHVVFGIAASAKLWKHRRDYVKLWWRPNGEMNGVVWLD-THIGQNDNASTTLPPIRI  140

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSL-----NHSDVRWFVFGDDDTVFFPDNLVK  737
             S DTS F+Y    G  SAIR+ R VSE V L     +  +VRW V GDDDTVFFP+NLVK
Sbjct  141   SSDTSRFKYRYPKGLRSAIRITRIVSETVRLLNGTESEKNVRWIVMGDDDTVFFPENLVK  200

Query  738   TLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPH  917
              L KYDH  +YYIG+SSE  +QN  FS+ MA+GG GFAISYPLAKAL K+ D C+ RY  
Sbjct  201   VLRKYDHQQFYYIGSSSESHIQNLKFSYGMAYGGGGFAISYPLAKALEKMQDRCIQRYSE  260

Query  918   LYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFP  1097
             LYGSD R+HAC+SELGV LT E GFHQ+D+ G + GLL+AHPL PLVS+HH+++ DP+FP
Sbjct  261   LYGSDDRIHACMSELGVPLTKEVGFHQIDLYGKLLGLLSAHPLAPLVSIHHLDLIDPVFP  320

Query  1098  NMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRA  1277
             NM    A++    +A +D   + QQ++CYD    WT+SVSWGY VQI    L   + L  
Sbjct  321   NMGRVNAMQRFMVSARLDSASLAQQSICYDPAHRWTVSVSWGYTVQIIRGVLSAKEMLIP  380

Query  1278  QESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRV---SSSHRDGITSV-YRKMTT  1445
               ++  W K   +  Y F++R     PC+R  V+Y+       +SHR     V +  M  
Sbjct  381   TRTFIDWYKRADEKSYAFNTRPISKSPCQRPRVYYLSNALPDLASHRTASEYVRWYDMWD  440

Query  1446  ENCTFDKASPRNLDEIRVSTQKLDLDS-KELLAPRRHCCDVLSSSADKALEIGIRECKEE  1622
               C +D + P  ++ + +  +K D D   +  APRR CC VL +  +  + I +  CK+ 
Sbjct  441   PECDWDMSDPSEIERV-IVYKKPDPDRWDKHRAPRRDCCRVLPTKKNGTMVIDVGACKDG  499

Query  1623  ELV  1631
             E+V
Sbjct  500   EIV  502



>emb|CDY61924.1| BnaA03g58710D [Brassica napus]
Length=509

 Score =   386 bits (992),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/418 (47%), Positives = 272/418 (65%), Gaps = 8/418 (2%)
 Frame = +3

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKH---EDNGTDSLPP  563
             PT L H+VFGIA+S + W++RKE++K+W++P  MRG V+LD++  K+    D+  D LPP
Sbjct  90    PTDLSHVVFGIAASAKLWKQRKEYIKIWYKPKHMRGYVWLDKEVKKNITSTDDDEDLLPP  149

Query  564   VCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTL  743
             V ISG T+SF YT + G  SA+R++R VSE + L   +VRWFV GDDDTVF  DNL++ L
Sbjct  150   VRISGGTASFPYTNKQGQRSALRISRIVSEMLRLGPRNVRWFVMGDDDTVFVTDNLIRVL  209

Query  744   SKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLY  923
              KYDH   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL+K+ D C+ RYP LY
Sbjct  210   RKYDHEQMYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAKALSKMQDRCIQRYPALY  269

Query  924   GSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNM  1103
             GSD R+ AC++ELGV LT E GFHQ D+ G +FGLLAAHP+ P VS+HH++V +PIFPNM
Sbjct  270   GSDDRMQACMAELGVPLTKELGFHQYDVYGSLFGLLAAHPVTPFVSVHHLDVVEPIFPNM  329

Query  1104  TTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQE  1283
             T  ++L+ L     +D   +LQQ++CYD+  SWT+SVSWGYAVQI        +      
Sbjct  330   TRVRSLKKLTVPMKLDSAGLLQQSICYDKHKSWTVSVSWGYAVQIFRGIFSPREMEMPSR  389

Query  1284  SYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT-SVY--RKMTTENC  1454
             ++  W K      Y F++R     PC++  V+YM       +   T S Y   +++  +C
Sbjct  390   TFLNWYKRADYTAYAFNTRPVSRQPCQKPFVYYMSTTKFDKQLNTTVSEYTRHRVSHPSC  449

Query  1455  TFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              +  A+P  ++ I V  +K D    E  +PRR+CC VL +  +  L I +  C++ E+
Sbjct  450   KWKMANPAEINTI-VVYKKPDPHLWE-RSPRRNCCRVLQTKRNNTLWINVGVCRDGEV  505



>gb|KHN26942.1| hypothetical protein glysoja_031019 [Glycine soja]
Length=515

 Score =   386 bits (992),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 191/414 (46%), Positives = 266/414 (64%), Gaps = 5/414 (1%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T++ HIVFGI +S + W++RKE++KLWWRP+ MRG V+L++ +VK E    + LPP+ IS
Sbjct  103   TNISHIVFGIGASAKLWKQRKEYIKLWWRPNEMRGVVWLEQ-KVKAEPQDENFLPPLRIS  161

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              DTS F+Y    G+ SAIR++R VSE + L   DVRWFV GDDDTVF  +NLVK L KYD
Sbjct  162   SDTSRFKYKNPKGHRSAIRISRIVSETLRLGMEDVRWFVMGDDDTVFVAENLVKVLQKYD  221

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+SSE  +QN +FS+ MA+GG GFAISYPLA AL K+ D C+ RYP LYGSD 
Sbjct  222   HNQFYYIGSSSESHLQNIYFSYNMAYGGGGFAISYPLAVALEKMQDRCIQRYPGLYGSDD  281

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++ GLLAAHP+ PLVSLHH++V +PIFPN++  +
Sbjct  282   RIQACMAELGVPLTKEKGFHQFDVYGNLLGLLAAHPVTPLVSLHHLDVVEPIFPNVSRVQ  341

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+ L     +DP  ++QQ++CYD+  +WTISVSWGYAVQI        +      ++  
Sbjct  342   ALKRLKGPMKLDPAGLIQQSICYDKARTWTISVSWGYAVQIFRGTFSAREMEMPARTFLN  401

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRV--SSSHRDGITSVYRKMTTENCTFDKA  1469
             W K      Y F++R      C++  V+Y+ +        +  +   R     +C +   
Sbjct  402   WYKRADYTAYPFNTRPVSRHVCQKPFVYYLSKAVYDEGANETASQYVRVQQNPDCKWKME  461

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
              P  +  + V  +K D    +  APRR+CC V  +     + I + EC+E+E+V
Sbjct  462   DPTQIKVVEV-YKKPDPHLWD-KAPRRNCCRVRRTKKKGTMVIDVGECREDEVV  513



>ref|XP_010112315.1| hypothetical protein L484_011181 [Morus notabilis]
 gb|EXC33204.1| hypothetical protein L484_011181 [Morus notabilis]
Length=511

 Score =   386 bits (991),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 198/426 (46%), Positives = 266/426 (62%), Gaps = 8/426 (2%)
 Frame = +3

Query  363   VSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDN  542
             V V  +   S T L+HIVFGIA+S   W KR+E++K WWR    RG V+LD+      D 
Sbjct  89    VMVHGEQSGSDTKLKHIVFGIAASSNLWDKRREYIKAWWRAGETRGVVWLDKKVRIRRDE  148

Query  543   GTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFP  722
             G   LP + ISGDTS F+YT R G  SA+R++R VSE + L   DVRWFV GDDDTVF  
Sbjct  149   G---LPEIRISGDTSKFKYTNRQGRRSALRISRVVSETLRLGMKDVRWFVMGDDDTVFVV  205

Query  723   DNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCL  902
             DNLV+ LSKYDH  +YY+G+SSE  VQN +FS+ MA+GG GFAISYPLAK L K+ D C+
Sbjct  206   DNLVRVLSKYDHNQFYYVGSSSESHVQNIYFSYGMAYGGGGFAISYPLAKELEKMQDRCI  265

Query  903   HRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVY  1082
              RYP LYGSD R+ AC++ELGV LT E GFHQ D+ GD+ GLL AHP+ PL+SLHH++V 
Sbjct  266   QRYPGLYGSDDRMQACMAELGVPLTKEAGFHQYDVYGDLLGLLGAHPVTPLLSLHHIDVV  325

Query  1083  DPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLP  1262
             +P+FP  T  KAL+ L+++   D   I+QQ++CYD+  SW+ISVSWGYAVQI    L   
Sbjct  326   EPLFPRTTRVKALQRLFQSVKHDSASIMQQSICYDKRRSWSISVSWGYAVQILRGVLSPR  385

Query  1263  DALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSH-RDGITSVYRKM  1439
             +      ++  W        Y F++R     PC++  VFYM+ V     +  +  VY + 
Sbjct  386   ELETPTRTFLNWYPRADYTAYAFNTRPVTKHPCQKPFVFYMNNVRYDRSKRQVVGVYARD  445

Query  1440  TTEN--CTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIREC  1613
              + +  C +   SP  +D I V  +   L  ++  +PRR CC VL S     + + +  C
Sbjct  446   RSRHPYCRWKMESPDKIDSIVVLKRPDPLRWQK--SPRRDCCRVLPSHKKSTMYLWVGSC  503

Query  1614  KEEELV  1631
             +  E++
Sbjct  504   RGGEII  509



>ref|XP_010447528.1| PREDICTED: uncharacterized protein LOC104730116 isoform X1 [Camelina 
sativa]
 ref|XP_010447533.1| PREDICTED: uncharacterized protein LOC104730116 isoform X2 [Camelina 
sativa]
Length=526

 Score =   387 bits (993),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 194/415 (47%), Positives = 273/415 (66%), Gaps = 7/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+H+VFGIA+S   W++RKE++K+W++P+ MRG V+L++  VK E++  +SLPPV IS
Sbjct  113   TGLQHVVFGIAASARLWKQRKEYIKIWYKPNQMRGYVWLEK-PVKEEEDDENSLPPVRIS  171

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS F Y  + G+ SAIR++R V+E + L   DVRWFV GDDDTVF  +NL++ L KYD
Sbjct  172   GDTSKFPYKNKQGHRSAIRISRIVTETLKLGLKDVRWFVMGDDDTVFVAENLIRVLRKYD  231

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H   YYIG+ SE  +QN +FS+ MA+GG GFAISYPLA AL+K+ D C+ RYP LYGSD 
Sbjct  232   HTQMYYIGSLSESHLQNIYFSYGMAYGGGGFAISYPLAVALSKMQDRCIKRYPALYGSDD  291

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLV++HH++V +PIFPNMT   
Sbjct  292   RMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVAPLVTVHHLDVVEPIFPNMTRVD  351

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+HL   A +D   ++QQ++CYD+   WT+SVSWG+AVQI        +      ++  
Sbjct  352   ALKHLQAPAKLDSAGLMQQSICYDKRRKWTVSVSWGFAVQIFRGIFSAREIEMPSRTFLN  411

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT-SVYR--KMTTENCTFDK  1466
             W +      Y F++R     PC++  V+YM          +T S Y   ++    C +  
Sbjct  412   WYRRADYTAYAFNTRPVSRHPCQKPFVYYMTSTRVHPVTNMTVSRYEIHRVAHPECRWKM  471

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
             A+P ++  I +  +K D    +  +PRR+CC V  S  +  LEI +  CKE E+V
Sbjct  472   ANPGDIKTI-IVYKKPDPHLWD-RSPRRNCCRV-KSKKNNTLEISVAVCKEGEVV  523



>gb|KHG15704.1| Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe [Gossypium 
arboreum]
Length=502

 Score =   385 bits (990),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 204/477 (43%), Positives = 288/477 (60%), Gaps = 30/477 (6%)
 Frame = +3

Query  288   LICSSLCVVYLVCTFVLV-------PST------NLLHV--SVSLQDVSSP--------T  398
             L+ SS+ ++ ++C F  +       PS       N LHV        VSSP        T
Sbjct  30    LVVSSVLLISIICIFYNLSFSNASNPSNHRSNIINTLHVVDQAMPPPVSSPPKLGPPEKT  89

Query  399   SLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISG  578
             +L H+VFGIA+S   W  RK ++KLWW+   MRG V+LD+      D+    LPPV IS 
Sbjct  90    TLHHLVFGIAASARLWEHRKNYIKLWWKSQEMRGTVWLDKAVANRSDDHL--LPPVKISC  147

Query  579   DTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDH  758
             DTS F+Y    G+ SAIR++R VSE + L   DVRWFV GDDDT F P+NLV+ LSKYDH
Sbjct  148   DTSKFKYKNLKGHRSAIRISRIVSETLRLGFEDVRWFVMGDDDTYFVPENLVRVLSKYDH  207

Query  759   GLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDAR  938
                YYIG+ SE  +QN  FS+ MA+GG GFAISYPLAKALAK+ D C+ RYP LYGSD R
Sbjct  208   NQLYYIGSLSESHLQNIHFSYGMAYGGGGFAISYPLAKALAKMQDRCIQRYPGLYGSDDR  267

Query  939   VHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKA  1118
             +HAC++ELG+ LT EPGFHQ D+ G + GLL+AHP+ PL+S+HH++V +PIFPN+   +A
Sbjct  268   IHACMAELGIPLTKEPGFHQYDVYGSLLGLLSAHPVAPLISIHHLDVVEPIFPNVNRVQA  327

Query  1119  LEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPW  1298
             L+ L     +D   I+QQ+VCYD+  SWTISVSWGY VQI+     + +      ++  W
Sbjct  328   LQRLRVPIKLDSAAIMQQSVCYDKTRSWTISVSWGYTVQIYRGIFSVREMEMPARTFLNW  387

Query  1299  RKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRV---SSSHRDGITSVYRKMTTENCTFDKA  1469
              K      + F++R      C++  VFY+       ++++     V  ++ +  C ++ A
Sbjct  388   YKRADYSGFSFNTRPVARHACQKPFVFYLSNALYNKNTNQTASEYVQDRLPSSECKWNMA  447

Query  1470  SPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
             +P  ++ ++V  +K D    +  APRR+CC VL       + I +R C E++++ + 
Sbjct  448   NPSRIERVQV-YKKPDPHLWD-KAPRRNCCRVLPRKKKGTMAIDVRVCGEDDVIELQ  502



>ref|XP_006287536.1| hypothetical protein CARUB_v10000749mg [Capsella rubella]
 gb|EOA20434.1| hypothetical protein CARUB_v10000749mg [Capsella rubella]
Length=511

 Score =   385 bits (990),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 199/439 (45%), Positives = 280/439 (64%), Gaps = 14/439 (3%)
 Frame = +3

Query  342   PSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRD  521
             P+   L V V+  +  + T L H+VFGIA+S + W+ RKE++K+W++P  MRG V+LD++
Sbjct  73    PAKKALTVPVTAAEHEA-TDLNHVVFGIAASSKLWKHRKEYIKIWFKPKKMRGYVWLDKE  131

Query  522   -EVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAV-----SLNHSDVR  683
              ++K +    ++LPPV ISG+TSSFRYT + G+ SAIR++R VSE +          +VR
Sbjct  132   VKIKSDAGDQENLPPVRISGNTSSFRYTNKKGHRSAIRISRIVSETLMNLDSEEKKKNVR  191

Query  684   WFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYP  863
             WFV GDDDTVF  DNL++ L KYDH   YYIG+ SE  +QN FFS+ MA+GG GFAISYP
Sbjct  192   WFVMGDDDTVFVTDNLIRVLRKYDHEQMYYIGSLSESHLQNIFFSYGMAYGGGGFAISYP  251

Query  864   LAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHP  1043
             LA AL+K+ D C+ RYP LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP
Sbjct  252   LAVALSKMQDRCIQRYPALYGSDDRMQACMAELGVPLTKEIGFHQYDVHGNLFGLLAAHP  311

Query  1044  LRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWG  1223
             + P VS+HH++V +PIFPNMT  +A++ L     ID   +LQQ++CYD++ SWTISVSWG
Sbjct  312   VIPFVSMHHLDVVEPIFPNMTRVRAIKKLTTPMKIDSAGLLQQSICYDKYKSWTISVSWG  371

Query  1224  YAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-S  1400
             YAVQ+        +      ++  W K      Y F++R    +PC+   VF+M  V   
Sbjct  372   YAVQVFRGSFSPREMEMPSRTFLNWYKRADYTAYAFNTRPVSRNPCQTPFVFHMSNVKFD  431

Query  1401  SHRDGITSVYRKMTTEN--CTFDKASPRNLDEIRVSTQ-KLDLDSKELLAPRRHCCDVLS  1571
                +   S Y +    +  C +D A+P  ++ I V  +    L S+   +PRR+CC VL 
Sbjct  432   PQLNTTVSEYTRHQDRHPACRWDMANPEEINNIVVYKEPDPHLWSR---SPRRNCCRVLQ  488

Query  1572  SSADKALEIGIRECKEEEL  1628
             +  +  L I +  C+  E+
Sbjct  489   TKRNNTLWINVGVCRAGEV  507



>ref|XP_011041961.1| PREDICTED: uncharacterized protein LOC105137785 [Populus euphratica]
Length=500

 Score =   385 bits (989),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 193/415 (47%), Positives = 270/415 (65%), Gaps = 10/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+HIVFGIA+S + W+KRKE+VK+WWRP   RG V++DR +V+   N  + LP + IS
Sbjct  86    TELKHIVFGIAASADLWQKRKEYVKVWWRPKQTRGIVWMDR-QVRSPSN--EGLPQIRIS  142

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              DTS F+Y+ + G+ SA+R++R VSE + L   DVRWFV GDDDTVF  DN+V+ LSKYD
Sbjct  143   ADTSRFKYSNKKGHRSALRISRVVSETLRLGLKDVRWFVMGDDDTVFIVDNVVRILSKYD  202

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H   YY+G+SSE  +QN +FS+ MA+GG GFAIS PLA+ LAK+ D C+ RYP LYGSD 
Sbjct  203   HRQLYYVGSSSESHLQNIYFSYSMAYGGGGFAISQPLAQELAKMQDRCIRRYPGLYGSDD  262

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++E+GV L+ E GFHQ D+ GD+ GLLAAHP+ PL SLHH++V  PIFP M+  +
Sbjct  263   RIQACMAEIGVPLSKESGFHQYDVYGDLLGLLAAHPVAPLASLHHIDVVQPIFPGMSRAR  322

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+HL+K+  +D   I+QQ++CYD+   W+ISVSWGY VQI    +   +      ++  
Sbjct  323   ALQHLFKSVQLDSASIMQQSICYDKNRYWSISVSWGYVVQIWRGVVSPRELETPARTFLN  382

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYM--DRVSSSHRDGITSVY--RKMTTENCTFD  1463
             W +      Y F++R     PC +  VFYM   +   + +  I  VY  RK  +  C + 
Sbjct  383   WYRKADYTAYTFNTRPVTKHPCMKPFVFYMSTSKYDRAKKRAI-GVYTRRKSPSPYCRWK  441

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              ASP  +D I V  +   L  + L +PRR CC VL ++    + + +  C++ E+
Sbjct  442   MASPERIDSIVVLKRPDTL--RWLKSPRRDCCRVLPANKASTMYLWVGNCRDGEI  494



>ref|XP_002314204.1| hypothetical protein POPTR_0009s03140g [Populus trichocarpa]
 gb|EEE88159.1| hypothetical protein POPTR_0009s03140g [Populus trichocarpa]
Length=499

 Score =   385 bits (989),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 192/415 (46%), Positives = 267/415 (64%), Gaps = 10/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+HIVFGIA+S + W+KRKE+VK+WWRP   RG V++DR      D G   LP + IS
Sbjct  85    TELKHIVFGIAASADLWQKRKEYVKVWWRPKQTRGIVWMDRQVRSPSDEG---LPQIRIS  141

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              DTS F+Y+ + G+ SA+R++R VSE + L   DVRWFV GDDDTVF  DN+V+ LSKYD
Sbjct  142   ADTSRFKYSNKKGHRSALRISRVVSETLRLGLKDVRWFVMGDDDTVFIVDNVVRILSKYD  201

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H   YY+G+SSE  +QN +FS+ MA+GG GFAIS PLA+ LAK+ D C+ RYP LYGSD 
Sbjct  202   HRQLYYVGSSSESHLQNIYFSYSMAYGGGGFAISQPLAQELAKMQDRCIRRYPGLYGSDD  261

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++E+GV L+ E GFHQ D+ GD+ GLLAAHP+ PL SLHH++V  PIFP M+  +
Sbjct  262   RIQACMAEIGVPLSKESGFHQYDVYGDLLGLLAAHPVAPLASLHHIDVVQPIFPGMSRAR  321

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+HL+K+  +D   ++QQ++CYD+   W+ISVSWGY VQI    +   +      ++  
Sbjct  322   ALQHLFKSVQLDSASVMQQSICYDKNRYWSISVSWGYVVQIWRGVVSPRELETPARTFLN  381

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYM--DRVSSSHRDGITSVY--RKMTTENCTFD  1463
             W +      Y F++R     PC +  VFYM   +   + +  I  VY  RK  +  C + 
Sbjct  382   WYRKADYTAYTFNTRPVTKHPCMKPFVFYMSTSKYDRAKKRAI-GVYTRRKSPSPYCRWK  440

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              ASP  +D I V  +   L  + L +PRR CC VL ++    + + +  C++ E+
Sbjct  441   MASPERIDSIVVLKRPDTL--RWLKSPRRDCCRVLPTNKASTMYLWVGNCRDGEI  493



>ref|XP_011080920.1| PREDICTED: uncharacterized protein LOC105164063 [Sesamum indicum]
Length=518

 Score =   386 bits (991),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 204/419 (49%), Positives = 275/419 (66%), Gaps = 9/419 (2%)
 Frame = +3

Query  387   SSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSG-MRGCVFLDRDEVKHEDNGTDSLPP  563
             S  T LEHIVFGIA+S + W KRKE++KLWW P   MRG V+LD   VK   N + SLP 
Sbjct  101   SGKTGLEHIVFGIAASAKLWDKRKEYIKLWWEPEKKMRGIVWLD-SPVKTYSNESGSLPE  159

Query  564   VCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLN-HSDVRWFVFGDDDTVFFPDNLVKT  740
             + ISGDTS F Y  + G+ SAIR++R VSE + L    +VRWFV GDDDTVF  DNLV+ 
Sbjct  160   LRISGDTSRFAYKNKQGHRSAIRISRIVSETLRLGGMENVRWFVMGDDDTVFVTDNLVRI  219

Query  741   LSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHL  920
             L+KYDH  +YY+G+ SE  +QN +FS+ MA+GG GFAISYPLAKAL K+ D C+ RYP L
Sbjct  220   LNKYDHNQYYYVGSLSESHLQNIYFSYGMAYGGGGFAISYPLAKALEKMQDRCIQRYPGL  279

Query  921   YGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPN  1100
             YGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLVSLHH++V +PIFPN
Sbjct  280   YGSDDRMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVTPLVSLHHLDVVEPIFPN  339

Query  1101  MTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQ  1280
             +T  +AL+ L     +D   ++QQ++CYD+   WT+SVSWG+A+QI    L   +     
Sbjct  340   VTRVQALQRLKIPMQLDSAGLMQQSICYDKTNGWTVSVSWGFAIQIFRGVLSPREIEMPS  399

Query  1281  ESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYRKMTTEN--  1451
              ++  W +      Y F++R    +PC++  VFY+ R +  S+ +  TS Y +  T    
Sbjct  400   RTFLNWYRRADYTAYAFNTRPVMRNPCQKPFVFYLSRANIKSNMNLTTSEYTRHHTPQPL  459

Query  1452  CTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             C +  A P ++D + V  +K D    +  +PRR+CC VLSS   K+L I +  C E E+
Sbjct  460   CKWKMAEPGDIDWVEV-YKKPDPHLWD-RSPRRNCCRVLSSK-KKSLTIDVGVCGEGEI  515



>ref|XP_009763260.1| PREDICTED: uncharacterized protein LOC104215204 [Nicotiana sylvestris]
Length=516

 Score =   385 bits (990),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 198/415 (48%), Positives = 272/415 (66%), Gaps = 8/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPS-GMRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             T LEHIVFGIA+S + W KRK+++KLWW+P   MRG V+LD+  VK   +   +LP + I
Sbjct  103   TGLEHIVFGIAASAKLWEKRKDYIKLWWKPEEKMRGIVWLDK-PVKTVKDDRGALPELRI  161

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDTS F YT R G+ SAIR++R VSE + L   +VRWFV GDDDTVF  DNLV+ L+KY
Sbjct  162   SGDTSRFSYTNRQGHRSAIRISRIVSETLRLGMENVRWFVMGDDDTVFVTDNLVRILNKY  221

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  +YYIG+ SE  +QN +FS+ MA+GG GFAISYPLAKAL K+ D C+ RYP LYGSD
Sbjct  222   DHNQYYYIGSLSESHLQNIYFSYSMAYGGGGFAISYPLAKALEKMQDKCIQRYPGLYGSD  281

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
              R+ AC++ELGV LT E GFHQ D+ G++FGLLA+HP+ PLV+LHH++V +PIFPN+T  
Sbjct  282   DRMQACMAELGVPLTKELGFHQYDVYGNLFGLLASHPIAPLVTLHHLDVVEPIFPNVTRV  341

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +AL+ L     +D   ++QQ++CYDR   WT+S+SWG+AVQI    L   +      ++ 
Sbjct  342   QALQRLTVPMKLDSAGLMQQSICYDRTNGWTVSISWGFAVQIFRGILSPREIEMPSRTFL  401

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYRKMTTEN--CTFD  1463
              W K      Y F++R    +PC++  VFY+       + +   S Y +    +  C + 
Sbjct  402   NWYKRADYTAYAFNTRPVARNPCQKPFVFYLSNAKLDPYNNQTVSQYTRHRVPHPACKWK  461

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              A P  +D I+V  +K D    +  +PRR+CC VL S A K + + +  C+E E+
Sbjct  462   MADPAVVDRIQVH-KKPDPHLWD-RSPRRNCCRVLRSKA-KGMVVDVGVCREGEV  513



>ref|XP_010436096.1| PREDICTED: uncharacterized protein LOC104719814 [Camelina sativa]
Length=526

 Score =   386 bits (991),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 193/415 (47%), Positives = 273/415 (66%), Gaps = 7/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+H+VFGIA+S   W++RKE++K+W++P+ MRG V+L++  VK E++  +SLPPV IS
Sbjct  113   TGLQHVVFGIAASARLWKQRKEYIKIWYKPNQMRGYVWLEK-PVKEEEDDENSLPPVRIS  171

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS F Y  + G+ SAIR++R V+E + L   DVRWFV GDDDTVF  +NL++ L KYD
Sbjct  172   GDTSKFPYKNKQGHRSAIRISRIVTETLKLGLKDVRWFVMGDDDTVFVAENLIRVLRKYD  231

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H   YYIG+ SE  +QN +FS+ MA+GG GFAISYPLA AL+K+ D C+ RYP LYGSD 
Sbjct  232   HTQMYYIGSLSESHLQNIYFSYGMAYGGGGFAISYPLAVALSKMQDRCIKRYPALYGSDD  291

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLV++HH++V +PIFPNMT   
Sbjct  292   RMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVAPLVTVHHLDVVEPIFPNMTRVD  351

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+HL   A +D   ++QQ++CYD+   WT+SVSWG+AVQI        +      ++  
Sbjct  352   ALKHLQAPAKLDSAGLMQQSICYDKRRKWTVSVSWGFAVQIFRGIFSAREIEMPSRTFLN  411

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT-SVYR--KMTTENCTFDK  1466
             W +      Y F++R     PC++  V+YM          +T S Y   ++    C +  
Sbjct  412   WYRRADYTAYAFNTRPVSRHPCQKPFVYYMTSTGVHPVTNMTVSRYEIHRVAHPECRWKM  471

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
             A+P ++  + +  +K D    +  +PRR+CC V  S  +  LEI +  CKE E+V
Sbjct  472   ANPGDIKTV-IVYKKPDPHLWD-RSPRRNCCRV-KSKKNNTLEISVAVCKEGEVV  523



>ref|XP_010455541.1| PREDICTED: uncharacterized protein LOC104737134 isoform X1 [Camelina 
sativa]
 ref|XP_010455542.1| PREDICTED: uncharacterized protein LOC104737134 isoform X2 [Camelina 
sativa]
Length=508

 Score =   385 bits (989),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 272/421 (65%), Gaps = 12/421 (3%)
 Frame = +3

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD--SLPPV  566
             PT L H+VFGIA+S + W+ RKE++K+W++P  MRG V+LD+ EVK + +  D  +LPPV
Sbjct  87    PTDLNHVVFGIAASSKLWKHRKEYIKIWFKPKKMRGYVWLDK-EVKTKSDAVDQENLPPV  145

Query  567   CISGDTSSFRYTCRGGNPSAIRLARAVSEAV----SLNHSDVRWFVFGDDDTVFFPDNLV  734
              ISG+TSSF YT + G+ SAIR++R VSE +    S++  +VRWFV GDDDTVF  DNL+
Sbjct  146   RISGNTSSFPYTNKKGHRSAIRISRIVSETLMNLDSVSKKNVRWFVMGDDDTVFVTDNLI  205

Query  735   KTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYP  914
             + L KYDH   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLA AL+K+ D C+ RYP
Sbjct  206   RVLRKYDHEQMYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAVALSKMQDRCIQRYP  265

Query  915   HLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIF  1094
              LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ P VS+HH++V +PIF
Sbjct  266   ALYGSDDRMQACMAELGVPLTKEIGFHQYDVHGNLFGLLAAHPVTPFVSMHHLDVVEPIF  325

Query  1095  PNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALR  1274
             PNMT  +A++ L     ID   ILQQ++CYD++ SWTISVSWGY VQ+        +   
Sbjct  326   PNMTRVRAIKKLTTPIKIDSAGILQQSICYDKYKSWTISVSWGYTVQVFRGSFSPREMEM  385

Query  1275  AQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYRKMTTEN  1451
                ++  W K      Y F++R    + C+   VFYM  V      +   S Y +    +
Sbjct  386   PSRTFLNWYKKADYTAYAFNTRPVSRNSCQTPFVFYMSNVKFDPQLNTTVSEYTRHQVRH  445

Query  1452  --CTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEE  1625
               C +D A+P  ++ I V  +K D       +PR++CC VL +  +  L I +  C+  E
Sbjct  446   PACRWDMANPEEINTI-VVYKKPDPHLWN-RSPRKNCCRVLQTKRNNTLWINVGVCRAGE  503

Query  1626  L  1628
             +
Sbjct  504   V  504



>ref|NP_567683.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAN72287.1| At4g23490/F16G20_190 [Arabidopsis thaliana]
 gb|AEE84765.1| uncharacterized protein AT4G23490 [Arabidopsis thaliana]
 gb|AHL38681.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=526

 Score =   386 bits (991),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 194/420 (46%), Positives = 270/420 (64%), Gaps = 7/420 (2%)
 Frame = +3

Query  384   VSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKH--EDNGTDSL  557
             V   T L H+VFGIA+S + W++RKE++K+W++P  MRG V+LD++  K   +D+    L
Sbjct  105   VDKLTDLNHVVFGIAASSKLWKQRKEYIKIWYKPKRMRGYVWLDKEVKKSLSDDDDEKLL  164

Query  558   PPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVK  737
             PPV ISG T+SF YT + G  SA+R++R VSE + L   +VRWFV GDDDTVF  DNL++
Sbjct  165   PPVKISGGTASFPYTNKQGQRSALRISRIVSETLRLGPKNVRWFVMGDDDTVFVIDNLIR  224

Query  738   TLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPH  917
              L KYDH   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL+K+ D C+ RYP 
Sbjct  225   VLRKYDHEQMYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAKALSKMQDRCIQRYPA  284

Query  918   LYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFP  1097
             LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ P VS+HH++V +PIFP
Sbjct  285   LYGSDDRMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVTPFVSMHHLDVVEPIFP  344

Query  1098  NMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRA  1277
             NMT  +AL+ + +   +D   +LQQ++CYD+  SWTISVSWGYAVQI        +    
Sbjct  345   NMTRVRALKKITEPMKLDSAGLLQQSICYDKHKSWTISVSWGYAVQIFRGIFSPREMEMP  404

Query  1278  QESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITS---VYRKMTTE  1448
               ++  W K      Y F++R    +PC++  VFYM       +   T       +++  
Sbjct  405   SRTFLNWYKRADYTAYAFNTRPVSRNPCQKPFVFYMSSTKFDQQLNTTVSEYTIHRVSHP  464

Query  1449  NCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             +C +   +P  ++ I V  +K D    E  +PRR+CC VL +  +  L I +  C+  E+
Sbjct  465   SCRWKMTNPAEINTI-VVYKKPDPHLWE-RSPRRNCCRVLQTKRNNTLWINVGVCRAGEV  522



>ref|XP_006365158.1| PREDICTED: uncharacterized protein LOC102606181 [Solanum tuberosum]
Length=494

 Score =   385 bits (988),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 190/416 (46%), Positives = 272/416 (65%), Gaps = 10/416 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+H+VFGIA S   W KRKE++KLWW+P   RG V+LD    K + N  ++LP + IS
Sbjct  81    TMLKHVVFGIAGSSILWDKRKEYIKLWWKPGETRGVVWLDE---KIKINNNEALPDIRIS  137

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              DT++F YT R G  SA+R++R VSE + L   DVRWFV GDDDTVFF +N+V+ LSKYD
Sbjct  138   DDTTNFHYTNRQGRRSALRISRVVSETLRLGLKDVRWFVMGDDDTVFFVENVVRVLSKYD  197

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+SSE  VQN FFS+ MA+GG GFAISYPLAK L K+ D C+ RYP LYGSD 
Sbjct  198   HNQYYYIGSSSESHVQNIFFSYSMAYGGGGFAISYPLAKELEKMQDRCIQRYPGLYGSDD  257

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++ GLL AHP+ PLVSLHH++V DPIFP ++   
Sbjct  258   RIQACMAELGVPLTKERGFHQYDVYGNLLGLLGAHPVTPLVSLHHLDVVDPIFPGISRVN  317

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
              L+ L++++ +D   ++QQ++CYD+   W+ISVSWGY VQI   ++   +      ++  
Sbjct  318   GLQRLFESSKLDSANLMQQSICYDKERYWSISVSWGYVVQIIRGNVSPRELEMPSRTFLN  377

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSH-RDGITSVY--RKMTTENCTFDK  1466
             W +      Y F++R     PC++  V+YM+     H R+ I  +Y   + ++ +C +  
Sbjct  378   WYRRADYTAYAFNTRPVTKHPCQKPFVYYMNTAKFDHSRNQIIGIYYRHRESSPSCRWKI  437

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKA--LEIGIRECKEEEL  1628
              SP  ++ I V  ++ D +++   +PRR CC VL S+ +    L + +  C++ E+
Sbjct  438   ESPEKINNI-VLLKRPD-NNRWQKSPRRDCCGVLPSNNNSKSNLYMWVGSCRDGEI  491



>ref|XP_002868593.1| hypothetical protein ARALYDRAFT_916060 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44852.1| hypothetical protein ARALYDRAFT_916060 [Arabidopsis lyrata subsp. 
lyrata]
Length=522

 Score =   385 bits (990),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 195/415 (47%), Positives = 271/415 (65%), Gaps = 7/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T  +H+VFGIA+S   W++RKE++K+W++P+ MRG V+L++  VK E+    SLPPV IS
Sbjct  109   TGYQHVVFGIAASARLWKQRKEYIKIWYKPNQMRGYVWLEK-PVKEEEEDEISLPPVKIS  167

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS F Y  + G+ SAIR++R V+E + L   DVRWFV GDDDTVF  +NL++ L KYD
Sbjct  168   GDTSKFPYKNKQGHRSAIRISRIVTETLKLGLKDVRWFVMGDDDTVFVAENLIRVLRKYD  227

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H   YYIG+ SE  +QN +FS+ MA+GG GFAISYPLA AL+K+ D C+ RYP LYGSD 
Sbjct  228   HNQMYYIGSLSESHLQNIYFSYGMAYGGGGFAISYPLAVALSKMQDRCIKRYPALYGSDD  287

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLV+LHH++V +PIFPNMT   
Sbjct  288   RMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVAPLVTLHHLDVVEPIFPNMTRVD  347

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+HL   A +D   ++QQ++CYD+   WT+SVSWG+AVQI        +      ++  
Sbjct  348   ALKHLQVPAKLDSAGLMQQSICYDKRRKWTVSVSWGFAVQIFRGIFSAREIEMPSRTFLN  407

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT-SVYR--KMTTENCTFDK  1466
             W +      Y F++R     PC++  VFYM   S      +T S Y   ++    C +  
Sbjct  408   WYRRADYTAYAFNTRPVSRHPCQKPFVFYMTSTSVHPVTNMTVSRYEIHRVGHPQCRWKM  467

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
             A+P ++  + +  +K D    +  +PRR+CC V  S  +  LEI +  CKE E+V
Sbjct  468   ANPGDIKTV-IVYKKPDPHLWD-RSPRRNCCRV-KSKKNNTLEISVAVCKEGEVV  519



>ref|XP_006829033.1| hypothetical protein AMTR_s00001p00252920 [Amborella trichopoda]
 gb|ERM96449.1| hypothetical protein AMTR_s00001p00252920 [Amborella trichopoda]
Length=506

 Score =   385 bits (988),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 199/420 (47%), Positives = 268/420 (64%), Gaps = 14/420 (3%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             TSL HI+FGIA+S   W +RKE++KLWWRPS MRG V+LDR        G   LP V IS
Sbjct  89    TSLSHIMFGIAASASLWEQRKEYIKLWWRPSEMRGVVWLDRTVKIKRGEG---LPTVKIS  145

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSD-VRWFVFGDDDTVFFPDNLVKTLSKY  752
             G+TS F Y  R G+ SAIR++R VSE + L+  + V WFV GDDDTVF  DNLV+ LSKY
Sbjct  146   GNTSGFAYKNRQGHRSAIRISRIVSETLRLDGIEGVHWFVMGDDDTVFVVDNLVRILSKY  205

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  +YYIG+ SE  +QN +FS+ MA+GG GFAISYPLAKAL+K+ D C+ RYP LYGSD
Sbjct  206   DHNQFYYIGSLSESHLQNIYFSYGMAYGGGGFAISYPLAKALSKMQDRCIQRYPGLYGSD  265

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
              R+ AC++ELGV LT EPGFHQ D+ G++FGLLAAHP+ PLVSLHH++V +PIFPN+T  
Sbjct  266   DRMQACMAELGVPLTKEPGFHQYDVYGNLFGLLAAHPVTPLVSLHHLDVVEPIFPNVTRV  325

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +AL  L+     D   ++QQ++CYDR   W+ SVSWGYAVQI        +      ++ 
Sbjct  326   EALRRLHGPMKADSAGLMQQSICYDRTREWSFSVSWGYAVQIFRGVFSPRELEMPSRTFL  385

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITSVYR----KMTTENC  1454
              W +      Y F++R     PC++  VFY D  R +++H     +V R    ++    C
Sbjct  386   NWYRRADYTAYAFNTRPVSRHPCQKPFVFYFDSLRYTTTHDTQAITVTRYSRHRVPAPEC  445

Query  1455  TFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSS--ADKALEIGIRECKEEEL  1628
              +   SP  ++ I V  +   L   +  +PRR+CC V++      K + I + EC++ E+
Sbjct  446   RWRMVSPAKIEWIEVRKKPDPLLWNK--SPRRNCCRVMTEKEVGAKGVSIEVGECRDGEI  503



>ref|XP_010441307.1| PREDICTED: uncharacterized protein LOC104724513 [Camelina sativa]
Length=526

 Score =   385 bits (989),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/415 (47%), Positives = 273/415 (66%), Gaps = 7/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+H+VFGIA+S   W++RKE++K+W++P+ MRG V+L++  VK E++  +SLPPV IS
Sbjct  113   TGLQHVVFGIAASARLWKQRKEYIKIWYKPNQMRGYVWLEK-PVKEEEDDENSLPPVRIS  171

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS F Y  + G+ SAIR++R V+E + L   DVRWFV GDDDTVF  +NL++ L KYD
Sbjct  172   GDTSKFPYKNKQGHRSAIRISRIVTETLKLGLKDVRWFVMGDDDTVFVAENLIRVLRKYD  231

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H   YYIG+ SE  +QN +FS+ MA+GG GFAISYPLA AL+K+ D C+ RYP LYGSD 
Sbjct  232   HTQMYYIGSLSESHLQNIYFSYGMAYGGGGFAISYPLAVALSKMQDRCIKRYPALYGSDD  291

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLV++HH++V +PIFPNMT   
Sbjct  292   RMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVAPLVTVHHLDVVEPIFPNMTRVY  351

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+HL   A +D   ++QQ++CYD+   WT+SVSWG+AVQI        +      ++  
Sbjct  352   ALKHLQAPAKLDSAGLMQQSICYDKRRKWTVSVSWGFAVQIFRGIFSAREIEMPSRTFLN  411

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT-SVYR--KMTTENCTFDK  1466
             W +      Y F++R     PC++  V+YM          +T S Y   ++    C +  
Sbjct  412   WYRRADYTAYAFNTRPVSRHPCQKPFVYYMTSTGVHPVTNMTVSRYEIHRVAHPECRWKM  471

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
             A+P ++  + +  +K D    +  +PRR+CC V  S  +  LEI +  CKE E+V
Sbjct  472   ANPGDIKTV-IVYKKPDPHLWD-RSPRRNCCRV-KSKKNSTLEISVAVCKEGEVV  523



>ref|XP_010538809.1| PREDICTED: uncharacterized protein LOC104813025 [Tarenaya hassleriana]
Length=524

 Score =   385 bits (989),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 198/418 (47%), Positives = 272/418 (65%), Gaps = 12/418 (3%)
 Frame = +3

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             PT L H+VFGIA+S + W++RKE++K+W++P  MR  V+LD+ EV+ +    D LPPV I
Sbjct  109   PTDLRHVVFGIAASSKLWKQRKEYIKIWFKPKYMRVYVWLDK-EVRADAGDKDELPPVKI  167

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDTSSF Y  + G+ SA+R++R VSE + L    VRWFV GDDDTVF  DNL++ L KY
Sbjct  168   SGDTSSFPYKNKQGHRSALRISRIVSETLRLGPKSVRWFVMGDDDTVFVTDNLIRVLRKY  227

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL K+ D C+ RYP LYGSD
Sbjct  228   DHEQMYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAKALGKMQDRCIQRYPALYGSD  287

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
              R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ P VS+HH++V +PIFPN T  
Sbjct  288   DRMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVAPFVSMHHLDVVEPIFPNTTRV  347

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +AL+ L     +D   + QQ++CYD++ SWTISVSWGY VQI    +   +      ++ 
Sbjct  348   RALKRLTVPMKLDSAGLFQQSICYDKYKSWTISVSWGYTVQISRGIISPREMEMPSRTFL  407

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRD----GITSVY--RKMTTENC  1454
              W K      Y F++R    +PC++  VFY   VSS+  D       S Y   ++ + +C
Sbjct  408   NWYKRADYTAYAFNTRPVSRNPCQKPFVFY---VSSAKLDVQMNTTVSEYSRHRVPSPDC  464

Query  1455  TFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              +  A+P +++ + V  +K D    +  +PRR+CC VL S     L I +  C+E E+
Sbjct  465   RWKIANPADVNTV-VVYKKPDPHLWD-RSPRRNCCRVLQSKRSNTLWINVGLCREGEV  520



>ref|NP_198961.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB08517.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94378.1| At5g41460 [Arabidopsis thaliana]
 gb|AAW50706.1| At5g41460 [Arabidopsis thaliana]
 gb|AED94681.1| uncharacterized protein AT5G41460 [Arabidopsis thaliana]
 gb|AHL38591.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=524

 Score =   385 bits (988),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 191/416 (46%), Positives = 270/416 (65%), Gaps = 8/416 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T  +H+VFGIA+S   W++RKE++K+W++P+ MR  V+L++   + ++    SLPPV IS
Sbjct  110   TGFQHVVFGIAASARLWKQRKEYIKIWYKPNQMRSYVWLEKPVTEEDEEDEISLPPVKIS  169

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS F Y  + G+ SAIR++R V+E + L   DVRWFV GDDDTVF  +NL++ L KYD
Sbjct  170   GDTSKFPYKNKQGHRSAIRISRIVTETLKLGLKDVRWFVMGDDDTVFVAENLIRVLRKYD  229

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H   YYIG+ SE  +QN +FS+ MA+GG GFAISYPLA AL+K+ D C+ RYP LYGSD 
Sbjct  230   HNQMYYIGSLSESHLQNIYFSYGMAYGGGGFAISYPLAVALSKMQDRCIKRYPALYGSDD  289

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLV+LHH++V +PIFPNMT   
Sbjct  290   RMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVAPLVTLHHLDVVEPIFPNMTRVD  349

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+HL   A +D   ++QQ++CYD+   WT+SVSWG+AVQI        +      ++  
Sbjct  350   ALKHLQVPAKLDSAGLMQQSICYDKRRKWTVSVSWGFAVQIFRGIFSAREIEMPSRTFLN  409

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYR----KMTTENCTFD  1463
             W +      Y F++R     PC++  VFYM   +  HR    +V R    ++    C + 
Sbjct  410   WYRRADYTAYAFNTRPVSRHPCQKPFVFYMTS-TRVHRVTNMTVSRYEIHRVAHPECRWK  468

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
              A+P ++  + +  +K D    +  +PRR+CC V  S  +  LEI +  CKE E+V
Sbjct  469   MANPSDIKTV-IVYKKPDPHLWD-RSPRRNCCRV-KSKKNNTLEISVAVCKEGEVV  521



>ref|XP_006396919.1| hypothetical protein EUTSA_v10028593mg [Eutrema salsugineum]
 gb|ESQ38372.1| hypothetical protein EUTSA_v10028593mg [Eutrema salsugineum]
Length=506

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 200/434 (46%), Positives = 282/434 (65%), Gaps = 15/434 (3%)
 Frame = +3

Query  363   VSVSLQDVSS---PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKH  533
             +SV+++ V++   PT L+++VFGIA+S + W+ RKE++K+W++P  MRG V+LD+ EVK 
Sbjct  72    ISVAVEAVAAEQEPTDLKNVVFGIAASSKLWKHRKEYIKIWYKPKKMRGYVWLDK-EVKI  130

Query  534   EDN--GTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAV----SLNHSDVRWFVF  695
             E +  G  +LPPV ISGDT+SF YT + G+ SAIR++R VSE +    S +  +VRWFV 
Sbjct  131   ESDAAGEQNLPPVKISGDTASFPYTNKKGHRSAIRISRIVSETLMSLDSDSRKNVRWFVM  190

Query  696   GDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKA  875
             GDDDTVF  +NL++ L KYDH   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLA A
Sbjct  191   GDDDTVFVTENLIRVLRKYDHEQMYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAVA  250

Query  876   LAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPL  1055
             L+K+ D C+ RYP LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ P 
Sbjct  251   LSKIQDRCIKRYPALYGSDDRMQACMAELGVPLTKEQGFHQYDVHGNLFGLLAAHPVTPF  310

Query  1056  VSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQ  1235
             VS+HH++V +PIFPNMT  +A++ L     +D   +LQQ++CYD+  SWTISVSWGYAVQ
Sbjct  311   VSMHHLDVVEPIFPNMTRVRAIKKLTTPMKLDSAALLQQSICYDKSKSWTISVSWGYAVQ  370

Query  1236  IHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDG  1415
             +        +      ++  W K      Y F++R    + C++  VFYM          
Sbjct  371   VFRGSFSPREMEMPSRTFLNWYKKADYTAYAFNTRPVSRNACQKPFVFYMSNAKFDQELN  430

Query  1416  IT-SVYRKMTTEN--CTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADK  1586
              T S Y +    +  C ++ A+P  ++ I V  +K D    +  +PRR+CC VL +  + 
Sbjct  431   TTVSEYTRHQVRHPACGWEMANPEEINTI-VVYKKPDPHLWD-RSPRRNCCTVLQTMRNN  488

Query  1587  ALEIGIRECKEEEL  1628
              L I +  CK  E+
Sbjct  489   TLWINVGVCKAGEV  502



>gb|KCW71570.1| hypothetical protein EUGRSUZ_E00106 [Eucalyptus grandis]
Length=490

 Score =   384 bits (985),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 199/430 (46%), Positives = 275/430 (64%), Gaps = 12/430 (3%)
 Frame = +3

Query  375   LQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLD-----RDEVKHED  539
             L    +PT+L HIVFGIASS + W  RK+++K+WW+P  MRG V+LD     RD    +D
Sbjct  63    LSPPPTPTALHHIVFGIASSAKLWHHRKDYLKIWWQPDRMRGVVWLDEPPPRRDAAGGQD  122

Query  540   NGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSL-NHSDVRWFVFGDDDTVF  716
             + T  LPPV IS DTS FRY    G+ SA+R++R VSE   L +  +VRW V GDDDTVF
Sbjct  123   DST-LLPPVKISSDTSGFRYKNPKGDHSAVRISRVVSETFRLLDGEEVRWLVMGDDDTVF  181

Query  717   FPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDS  896
               +NLV+ LSKYDH  +YYIG+ SE  +QN +FS+ M +GG GFAISY LA+AL ++ D 
Sbjct  182   VAENLVRVLSKYDHNQYYYIGSWSESHLQNIYFSYNMGYGGGGFAISYALARALERMQDR  241

Query  897   CLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHME  1076
             CL RYP LYGSD RV AC++ELGV LT EPGFHQ D+ G+VFGLLAAHP+ PL+SLHH++
Sbjct  242   CLRRYPGLYGSDDRVQACMAELGVPLTREPGFHQFDVYGNVFGLLAAHPITPLISLHHLD  301

Query  1077  VYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLL  1256
             V +PIFP  T  +AL+ L     +D   ++QQ++CYDR  SWT+SVSWGYAVQ++    L
Sbjct  302   VIEPIFPEKTQFQALQRLRTPLELDSAALIQQSICYDRTRSWTVSVSWGYAVQVYRGIHL  361

Query  1257  LPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYM-DRVSSSHRDGITSVYR  1433
               D      ++  W K      + F++R    +PC +  V+++ D V  +  +   S Y 
Sbjct  362   PRDVETPSRTFLHWYKRSDPAGFTFNTRPLSKNPCEKPFVYFLSDAVHDAGTNATVSEYV  421

Query  1434  K--MTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIR  1607
             +  + + +C +  A P  +  + V  +K D    +  APRR+CC VL +     +E+ + 
Sbjct  422   QHGLPSPDCKWKIADPSRIRRVEVH-KKPDPHLWD-KAPRRNCCMVLPTKKKSTMEVNVG  479

Query  1608  ECKEEELVYM  1637
             EC+E+E V +
Sbjct  480   ECREDENVEL  489



>emb|CDP08959.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   384 bits (987),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 191/417 (46%), Positives = 261/417 (63%), Gaps = 8/417 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+HI FGIA+S   W KRKE++KLWWRP   RG V+LD+      + G   LP + IS
Sbjct  100   TELKHIAFGIAASSNLWDKRKEYIKLWWRPGETRGAVWLDKKVSTGRNEG---LPDIKIS  156

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             G+TS F+YT R G  SA+R++R VSE + L   DVRWFV GDDDTVF  +N+++ LSKYD
Sbjct  157   GNTSEFKYTNRQGKRSALRISRVVSETLRLGMKDVRWFVMGDDDTVFVVENVLRVLSKYD  216

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+SSE  +QN FFS+ MA+GG GFAISYPLA  + K+ D C+ RYP LYGSD 
Sbjct  217   HNQYYYIGSSSESHIQNIFFSYAMAYGGGGFAISYPLALEIEKMQDRCIQRYPGLYGSDD  276

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT EPGFHQ D+ G++ GLL AHP+ PLVSLHH++V  PIFP +   +
Sbjct  277   RIQACMAELGVPLTREPGFHQYDVYGNLLGLLGAHPVTPLVSLHHLDVVAPIFPQLNRVQ  336

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             +L+HL+++   D   I+QQ++CYD+   W+ISVSWGY VQI    +   +      ++  
Sbjct  337   SLQHLFESVKQDSASIIQQSICYDKKRYWSISVSWGYVVQIFRGVISPRELEMPTRTFLN  396

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYR--KMTTENCTFDK  1466
             W K      Y F++R     PC++  ++YM        R+ I  VY   K ++  C +  
Sbjct  397   WYKRADYTAYAFNTRPVTKHPCQKPFLYYMSSTKYDEGRNQIIGVYSRFKESSPYCRWTM  456

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYM  1637
              SP  L+ + V   K    S+   +PRR CC VL S     + I + +C+  E+  M
Sbjct  457   ESPEKLNTVIV--LKRPDSSRWQKSPRRDCCRVLPSKRSTNMYIWVGKCRMGEVSEM  511



>ref|XP_004143975.1| PREDICTED: uncharacterized protein LOC101214810 [Cucumis sativus]
 ref|XP_004161480.1| PREDICTED: uncharacterized protein LOC101225154 [Cucumis sativus]
 gb|KGN50070.1| hypothetical protein Csa_5G152850 [Cucumis sativus]
Length=507

 Score =   384 bits (987),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 196/434 (45%), Positives = 275/434 (63%), Gaps = 14/434 (3%)
 Frame = +3

Query  357   LHVSVSLQDVSSPTS------LEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDR  518
             LH   +   +S PTS      L H+VFGIA+S + W +RK ++KLW++P  MRG V+LDR
Sbjct  75    LHNLTTTAAISLPTSSQNQTELRHVVFGIAASAKLWEQRKNYIKLWFKPEKMRGTVWLDR  134

Query  519   DEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFG  698
                  ED  +D LPP+ ISGDTS F Y  R G+ SAIR++R VSE   L   DVRWFV G
Sbjct  135   KVKIDED--SDELPPIRISGDTSKFAYKNRQGHRSAIRISRIVSETFRLGLKDVRWFVMG  192

Query  699   DDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKAL  878
             DDDTVF  +NL++ L KYDH  +YYIG+ SE  +QN +FS+ MA+GG GFAISYPLA+AL
Sbjct  193   DDDTVFVTENLLRVLRKYDHTQYYYIGSLSESHLQNIYFSYSMAYGGGGFAISYPLAEAL  252

Query  879   AKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLV  1058
              K+ D C+ RYP LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLL+AHP+ P V
Sbjct  253   VKMQDRCIQRYPGLYGSDDRMQACMAELGVPLTKELGFHQYDVYGNLFGLLSAHPIAPFV  312

Query  1059  SLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQI  1238
             SLHH+++ +PIFPN T  +AL+ L     +D   +LQQ++CY +  +WTISVSWGYA+QI
Sbjct  313   SLHHLDIVEPIFPNATRLQALDRLKIPMELDSAGLLQQSICYHKSNTWTISVSWGYAIQI  372

Query  1239  HGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD---RVSSSHR  1409
                 L   +      ++  W +      Y F++R    +PC++  VFY+    + +S+  
Sbjct  373   FRGILSPREVEMPSRTFLNWYRRADYTAYAFNTRPVARNPCQKAFVFYLSNALQTNSTTG  432

Query  1410  DGITSVYR-KMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADK  1586
               ++   R +     C +   SP +++ ++V  +K D    E  +PRR+CC V+ S   K
Sbjct  433   QTVSKYIRHRAPQPACKWKSPSPSSIEFVKV-IKKADPKLWE-RSPRRNCCRVMKSKEKK  490

Query  1587  ALEIGIRECKEEEL  1628
              L + +  CK+ E+
Sbjct  491   TLMVEVGICKDGEI  504



>ref|XP_009108177.1| PREDICTED: uncharacterized protein LOC103833880 [Brassica rapa]
 emb|CDX86792.1| BnaA09g21820D [Brassica napus]
Length=498

 Score =   384 bits (986),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 193/418 (46%), Positives = 270/418 (65%), Gaps = 11/418 (3%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L H+VFGIA+S + W+KRKE++K+W++P  MRG V+LD++     D   ++LPP+ IS
Sbjct  81    TDLNHVVFGIAASSKLWKKRKEYIKIWYKPKKMRGYVWLDKEVTDAGDQ--ENLPPIRIS  138

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSD----VRWFVFGDDDTVFFPDNLVKTL  743
             GDTSSF Y  + G+ SAIRL+R +SE +    SD    VRWFV GDDDTVF  DNL++ L
Sbjct  139   GDTSSFPYANKKGSRSAIRLSRIISETLKHLDSDSRKSVRWFVMGDDDTVFVTDNLIRVL  198

Query  744   SKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLY  923
              KYDHG  YYIG+ SE  +QN FFS+ MA+GG GFAISYPLA AL+K+ D C+ RYP LY
Sbjct  199   RKYDHGQMYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAVALSKIQDRCIQRYPALY  258

Query  924   GSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNM  1103
             GSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ P VS+HH++V +PIFPNM
Sbjct  259   GSDDRIQACMAELGVPLTKEQGFHQYDVHGNLFGLLAAHPVTPFVSMHHLDVVEPIFPNM  318

Query  1104  TTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQE  1283
             T  ++++ L     +D   +LQQ++CYD++ SWT+SVSWGYAVQ+        +      
Sbjct  319   TRVRSIKKLTTPMKLDSAGVLQQSICYDKYKSWTVSVSWGYAVQVFRGSFSPREMEMPSR  378

Query  1284  SYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGIT-SVYRKMTTEN--C  1454
             ++  W K      Y F++R    +PC++  VFYM       +   T S Y +    +  C
Sbjct  379   TFLNWYKKADYTAYAFNTRPVSRNPCQKPFVFYMSGAKFDKQLNTTVSEYTRHRVPHPAC  438

Query  1455  TFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              ++  +P  ++ I V  +K D    +  +PRR+CC VL +  +  L I +  C+  E+
Sbjct  439   RWEMTNPGEINTI-VVYKKPDPHLWD-RSPRRNCCRVLQTKRNNTLWINVGVCRAGEV  494



>ref|XP_010435007.1| PREDICTED: uncharacterized protein LOC104718882 [Camelina sativa]
Length=510

 Score =   384 bits (987),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 198/420 (47%), Positives = 272/420 (65%), Gaps = 12/420 (3%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTD--SLPPVC  569
             T L H+VFGIA+S + W+ RKE++K+W++P  MRG V+LD+ EVK + +  D  +LPPV 
Sbjct  91    TDLNHVVFGIAASSKLWKHRKEYIKIWFKPKKMRGYVWLDK-EVKTKSDAVDQENLPPVR  149

Query  570   ISGDTSSFRYTCRGGNPSAIRLARAVSEAV----SLNHSDVRWFVFGDDDTVFFPDNLVK  737
             ISG+TSSF YT + G+ SAIR++R VSE +    S++  +VRWFV GDDDTVF  DNL++
Sbjct  150   ISGNTSSFPYTNKKGHRSAIRISRIVSETLMNLDSVSKKNVRWFVMGDDDTVFVTDNLIR  209

Query  738   TLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPH  917
              L KYDH   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLA AL+K+ D C+ RYP 
Sbjct  210   VLRKYDHEQMYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAVALSKMQDRCIQRYPA  269

Query  918   LYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFP  1097
             LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ P VS+HH++V +PIFP
Sbjct  270   LYGSDDRMQACMAELGVPLTKETGFHQYDVHGNLFGLLAAHPVTPFVSMHHLDVVEPIFP  329

Query  1098  NMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRA  1277
             NMT  +A++ L     ID   ILQQ++CYD++ SWTISVSWGYAVQ+        +    
Sbjct  330   NMTRVRAIKKLTTPMKIDSAGILQQSICYDKYKSWTISVSWGYAVQVFRGSFSPREMEMP  389

Query  1278  QESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYRKMTTEN-  1451
               ++  W K      Y F++R    + C+   VFYM  V      +   S Y +    + 
Sbjct  390   SRTFLNWYKRADYTAYAFNTRPVSRNHCQTPFVFYMSNVKFDPQLNTTVSEYTRHQVRHP  449

Query  1452  -CTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              C +D A+P  ++ I V  +K D       +PR++CC VL +  +  L I +  C+  E+
Sbjct  450   ACRWDMANPEEINTI-VVYKKPDPHLWN-RSPRKNCCRVLQTKRNNTLWINVGVCRAGEV  507



>ref|XP_010055094.1| PREDICTED: uncharacterized protein LOC104443417 [Eucalyptus grandis]
Length=506

 Score =   384 bits (986),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 199/430 (46%), Positives = 275/430 (64%), Gaps = 12/430 (3%)
 Frame = +3

Query  375   LQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLD-----RDEVKHED  539
             L    +PT+L HIVFGIASS + W  RK+++K+WW+P  MRG V+LD     RD    +D
Sbjct  79    LSPPPTPTALHHIVFGIASSAKLWHHRKDYLKIWWQPDRMRGVVWLDEPPPRRDAAGGQD  138

Query  540   NGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSL-NHSDVRWFVFGDDDTVF  716
             + T  LPPV IS DTS FRY    G+ SA+R++R VSE   L +  +VRW V GDDDTVF
Sbjct  139   DST-LLPPVKISSDTSGFRYKNPKGDHSAVRISRVVSETFRLLDGEEVRWLVMGDDDTVF  197

Query  717   FPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDS  896
               +NLV+ LSKYDH  +YYIG+ SE  +QN +FS+ M +GG GFAISY LA+AL ++ D 
Sbjct  198   VAENLVRVLSKYDHNQYYYIGSWSESHLQNIYFSYNMGYGGGGFAISYALARALERMQDR  257

Query  897   CLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHME  1076
             CL RYP LYGSD RV AC++ELGV LT EPGFHQ D+ G+VFGLLAAHP+ PL+SLHH++
Sbjct  258   CLRRYPGLYGSDDRVQACMAELGVPLTREPGFHQFDVYGNVFGLLAAHPITPLISLHHLD  317

Query  1077  VYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLL  1256
             V +PIFP  T  +AL+ L     +D   ++QQ++CYDR  SWT+SVSWGYAVQ++    L
Sbjct  318   VIEPIFPEKTQFQALQRLRTPLELDSAALIQQSICYDRTRSWTVSVSWGYAVQVYRGIHL  377

Query  1257  LPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYM-DRVSSSHRDGITSVYR  1433
               D      ++  W K      + F++R    +PC +  V+++ D V  +  +   S Y 
Sbjct  378   PRDVETPSRTFLHWYKRSDPAGFTFNTRPLSKNPCEKPFVYFLSDAVHDAGTNATVSEYV  437

Query  1434  K--MTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIR  1607
             +  + + +C +  A P  +  + V  +K D    +  APRR+CC VL +     +E+ + 
Sbjct  438   QHGLPSPDCKWKIADPSRIRRVEVH-KKPDPHLWD-KAPRRNCCMVLPTKKKSTMEVNVG  495

Query  1608  ECKEEELVYM  1637
             EC+E+E V +
Sbjct  496   ECREDENVEL  505



>emb|CDP20373.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   384 bits (987),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 197/430 (46%), Positives = 271/430 (63%), Gaps = 14/430 (3%)
 Frame = +3

Query  375   LQDVSSP--TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGT  548
             +Q+  +P  T L HIVFGIA+S   W +RK +VKLWWRP  MRG V+LD+  V       
Sbjct  91    VQESENPGKTQLHHIVFGIAASSHLWSQRKNYVKLWWRPGEMRGFVWLDK-TVSTGTEDD  149

Query  549   DSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDN  728
             +SLP + +S DT+ FRY    G+ SA+RL R VSE + L   DVRW V GDDDT F  DN
Sbjct  150   NSLPTLKLSSDTTKFRYKNTEGDRSALRLTRIVSETLRLGLEDVRWIVMGDDDTFFVADN  209

Query  729   LVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHR  908
             LV+ LSKYDH  +YYIG++SE  +QN  FS+ MA+GG GFAISYPLAKAL K+ D+C+ R
Sbjct  210   LVRVLSKYDHNQFYYIGSNSESHLQNIRFSYNMAYGGGGFAISYPLAKALEKIQDNCIQR  269

Query  909   YPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDP  1088
             YP LYGSD RVHACL+ELGV LT E GFHQ D+ G+VFG+LAAHP+ PLVSLHH+++  P
Sbjct  270   YPELYGSDDRVHACLAELGVPLTKELGFHQFDLFGNVFGILAAHPIAPLVSLHHLDLILP  329

Query  1089  IFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDA  1268
             IFPN+   +AL+ L     +D   + QQ++CYD   +WTISVSWGYAVQI    +   + 
Sbjct  330   IFPNVNQVEALQRLKVPMELDSAALAQQSICYDNARNWTISVSWGYAVQIIRGVVTPREM  389

Query  1269  LRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITS------VY  1430
                  S+  W K   +  + F++R  + + C+R  V+ +   S++H + +T+      VY
Sbjct  390   ELPARSFVNWYKRADETGFTFNTRSLNKNSCQRPAVYTL---SAAHYNPLTNQTVSQYVY  446

Query  1431  RKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRE  1610
              K +   C +  A P  + ++ V  +       +  + RR+CC +L S     + I + E
Sbjct  447   YKKSGHQCEWKMADPSQIRKVEVYKKPNPFLWDK--SRRRNCCRLLPSEKKDTMIIDVGE  504

Query  1611  CKEEELVYMH  1640
             C E+E++ M+
Sbjct  505   CVEDEIIEMY  514



>ref|XP_003517477.1| PREDICTED: uncharacterized protein LOC100801444 [Glycine max]
Length=511

 Score =   384 bits (986),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 193/416 (46%), Positives = 272/416 (65%), Gaps = 12/416 (3%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L H+VFGIA+S + W  RK ++K+W++   MRG V+LD D VK   N ++ LPP  +S
Sbjct  99    TELRHLVFGIAASSKLWEHRKNYIKIWYKKEKMRGVVWLD-DRVKR--NPSEGLPPTKVS  155

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              DTS+F YT + G+ SAIR++R V+E + + H DVRWFV GDDDTVF  DNL++ L+KYD
Sbjct  156   TDTSNFVYTNKLGHRSAIRISRIVTETLRMGHKDVRWFVMGDDDTVFVTDNLLRILNKYD  215

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL+K+ D C+ RYP LYGSD 
Sbjct  216   HNYMYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAKALSKMQDRCIQRYPALYGSDD  275

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLVSLHH++V +PIFPN T  +
Sbjct  276   RMQACMAELGVPLTKEIGFHQYDVYGNLFGLLAAHPVTPLVSLHHLDVVEPIFPNATRVE  335

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             A++ L     +D   ++QQ++C+DR   WTISVSWG+AVQI        +      ++  
Sbjct  336   AIKRLTIPMKLDSASLIQQSICHDRNRRWTISVSWGFAVQIFRGIFTQREMEMPSRTFLN  395

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITSVYRK-MTTENCTFDK  1466
             W +      Y F++R +  +PC++  VFY    +++S+ +  +T   R  + +  C ++ 
Sbjct  396   WYRRADYTAYAFNTRPFSRNPCQKPFVFYFSKAKLNSTLQQTVTDYERDPIPSPECRWNM  455

Query  1467  ASPRNLDEIRVSTQKLDLDSKELL--APRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             A P  LD+I V  +K       L   APRR+CC V+ S+    L+I +  C++ E 
Sbjct  456   ADPSALDKIEVHKKK----DPHLWDRAPRRNCCRVMKSNKTGILKIEVAVCRDGEF  507



>gb|KFK33009.1| hypothetical protein AALP_AA6G318400 [Arabis alpina]
Length=507

 Score =   384 bits (985),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 198/447 (44%), Positives = 283/447 (63%), Gaps = 12/447 (3%)
 Frame = +3

Query  309   VVYLVCTFVLVPSTNLLHVSVSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPS  488
             VV  +   VL  S  L+ +  +      PT L H+VFGIA+S   W++RKE++K+W++P 
Sbjct  64    VVRRLNDIVLNSSQPLILLHSNQTKSPPPTDLRHVVFGIAASARLWKQRKEYIKIWYKPD  123

Query  489   GMRGCVFLDR--DEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVS  662
              MRG V+L++  +E K ++N   +LPP+ ISG+TS F Y  + G+ SAIR++R V+E + 
Sbjct  124   TMRGYVWLEKPVNESKKDEN---TLPPIKISGETSKFPYKNKQGHRSAIRISRIVTETLK  180

Query  663   LNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGA  842
             L   DVRWFV GDDDTVF P+NL++ LSKYD    YYIG+ SE  +QN +FS+ MA+GG 
Sbjct  181   LGLKDVRWFVMGDDDTVFVPENLIRVLSKYDSNQMYYIGSLSESHLQNIYFSYGMAYGGG  240

Query  843   GFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVF  1022
             GFA+SYPLA AL+K+ D C+ RYP LYGSD R+ AC++ELGV LT E GFHQ D+ G++F
Sbjct  241   GFAVSYPLAVALSKMQDRCIMRYPVLYGSDDRMQACMAELGVPLTKELGFHQYDVYGNLF  300

Query  1023  GLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSW  1202
             GLLAAHP+ PLV+LHH++V +PIFPN+T  +AL+ L   A +D   ++QQ++CYD+   W
Sbjct  301   GLLAAHPVAPLVTLHHLDVVEPIFPNVTRVEALKRLQVPAKLDSAGLMQQSICYDKRRKW  360

Query  1203  TISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFY  1382
             T+SVSWG+AVQI        +      ++  W +      Y F++R     PC++  V+Y
Sbjct  361   TVSVSWGFAVQIFRGTFSAREIEMPSRTFLNWYRRADYTAYAFNTRPVSRHPCQKPFVYY  420

Query  1383  MDRVSSSHRDGITSVYR----KMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRR  1550
             M   +  H     +V R     +    C +  A+P +L +  +  +K D    E  +PRR
Sbjct  421   MT-TAGVHPTTNMTVSRYESHNVAQPKCRWKMANPGDLIKTVIVYKKPDPHLWE-RSPRR  478

Query  1551  HCCDVLSSSADKALEIGIRECKEEELV  1631
             +CC V  S  +  LEI +  CKE E+V
Sbjct  479   NCCRV-KSKKNNTLEISVAVCKEGEVV  504



>ref|XP_010255246.1| PREDICTED: uncharacterized protein LOC104595986 [Nelumbo nucifera]
Length=522

 Score =   384 bits (987),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 193/415 (47%), Positives = 269/415 (65%), Gaps = 10/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L  IVFGIA+S   W +RK ++K+WWRP  MRG V+LD+    H+D G   LPP+ IS
Sbjct  111   TGLHQIVFGIAASARLWEQRKHYIKVWWRPDKMRGIVWLDKPVKTHKDEG---LPPLKIS  167

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
              +TS F YT R G+ SAIR++R VSE + L   +VRWFV GDDDTVF P+NLV+ LSKYD
Sbjct  168   DETSQFPYTNRQGHRSAIRISRIVSETLRLGMKNVRWFVMGDDDTVFIPENLVRVLSKYD  227

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+ SE  +QN +FS+ MA+GG GFAISYPLAKAL K+ D C+ RYP LYGSD 
Sbjct  228   HNQFYYIGSLSESHLQNIYFSYGMAYGGGGFAISYPLAKALDKMQDRCIQRYPGLYGSDD  287

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLVSLHH++V +PIFPN+T  +
Sbjct  288   RMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVTPLVSLHHIDVVEPIFPNVTRVE  347

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+ L     +D   ++QQ++CYD+  SWT+SVSWG+AVQI    L   +      ++  
Sbjct  348   ALQRLMVPKKLDSAGLMQQSICYDKPKSWTVSVSWGFAVQIIRGVLSPREMEMPSRTFLN  407

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITSVYR-KMTTENCTFDK  1466
             W +      Y F++R    +PC++  VFY+   R   + +  ++   R ++    C +  
Sbjct  408   WYRRADYTAYAFNTRPVTRNPCQKPFVFYLSTARYDPATKQTVSEYLRHQVPHPACRWKM  467

Query  1467  ASPRNLDEIRVSTQK-LDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
               P  ++ + V  +    L  K   +PRR+CC +L S   +++ I +  C+E E+
Sbjct  468   PDPAGVESVVVYKRPDPHLWDK---SPRRNCCRILPSVKSESMVIDVGVCREGEI  519



>ref|XP_009595643.1| PREDICTED: uncharacterized protein LOC104091909 [Nicotiana tomentosiformis]
Length=513

 Score =   384 bits (986),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 198/415 (48%), Positives = 273/415 (66%), Gaps = 10/415 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPS-GMRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             T LEHIVFGIA+S + W KRK+++KLWW+P   MRG V+LD+     +D   D+LP + I
Sbjct  102   TGLEHIVFGIAASAKLWEKRKDYIKLWWKPEEKMRGIVWLDKPVKTVKD---DALPELRI  158

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDTS F YT R G+ SAIR++R VSE + L   +VRWFV GDDDTVF  DNLV+ L+KY
Sbjct  159   SGDTSRFSYTNRQGHRSAIRISRIVSETLRLGMENVRWFVMGDDDTVFVTDNLVRILNKY  218

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  +YYIG+ SE  +QN +FS+ MA+GG GFAISYPLAKAL K+ D C+ RYP LYGSD
Sbjct  219   DHNQYYYIGSLSESHLQNIYFSYSMAYGGGGFAISYPLAKALEKMQDKCIQRYPGLYGSD  278

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
              R+ AC++ELGV LT E GFHQ D+ G++FGLLA+HP+ PLV+LHH++V +PIFPN+T  
Sbjct  279   DRMQACMAELGVPLTKEIGFHQYDVYGNLFGLLASHPIAPLVTLHHLDVVEPIFPNVTRV  338

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +AL+ L     +D   ++QQ++CYDR   WT+SVSWG+AVQI    L   +      ++ 
Sbjct  339   QALQRLTVPMKLDSAGLMQQSICYDRANGWTVSVSWGFAVQIFRGILSPREIEMPSRTFL  398

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVYRKMTTEN--CTFD  1463
              W K      Y F++R    +PC++  VFY+       + +   S Y +    +  C + 
Sbjct  399   NWYKRADYTAYAFNTRPVARNPCQKPFVFYLSHAKMDPYNNQTVSQYTRHRVPHPACKWK  458

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              A P ++D I+V  +K D    +  + RR+CC VL S A K++ + +  C+E E+
Sbjct  459   MADPADVDRIQVH-KKPDPHLWD-RSQRRNCCRVLRSKA-KSMVVDVGVCREGEV  510



>ref|XP_009612604.1| PREDICTED: uncharacterized protein LOC104105883 isoform X2 [Nicotiana 
tomentosiformis]
Length=484

 Score =   382 bits (982),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 223/472 (47%), Positives = 304/472 (64%), Gaps = 21/472 (4%)
 Frame = +3

Query  264   SQN-FKNIVLICSSLCVVYLVCTFVL----VPSTNLLHVSVSLQDVSSPT---SLEHIVF  419
             SQN  K+++L+ S+L + YL+  F+L     P T  +           P+   SL H+ F
Sbjct  20    SQNRLKDLLLLFSTLIIFYLI--FLLHHLHTPKTTFIPNPDYTPTTPPPSTNLSLSHLFF  77

Query  420   GIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRY  599
              IA++  S+  R  ++ LW++P+     +FLD          +     + +S DTS+F Y
Sbjct  78    SIAAASSSFSLRLPYINLWYKPNSTNAVIFLDTPISSTPSVSSPP---ILVSSDTSNFPY  134

Query  600   TCRGGNPSAIRLARAVSE----AVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLW  767
             +   G  SAIR+AR V +    A ++N S+ RWF+FGDDDTVFF +NLV  LSKYD+  W
Sbjct  135   SFPSGRRSAIRIARIVKDTFDLAKNVNFSNTRWFIFGDDDTVFFTENLVSVLSKYDYEKW  194

Query  768   YYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHA  947
             YY+G +SE   QN  +SF+MAFGG GFA+S PLAK LA V DSCL RYPHLYGSD+RV +
Sbjct  195   YYVGYNSESYEQNEKYSFDMAFGGGGFALSAPLAKVLAGVLDSCLMRYPHLYGSDSRVFS  254

Query  948   CLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEH  1127
             CL+ELGV LTHEPGFHQ+D+RGD+FG+L+AHPL PL+SLHH++  +P+FP MT   A EH
Sbjct  255   CLAELGVHLTHEPGFHQVDVRGDLFGILSAHPLSPLLSLHHLDAVEPLFPGMTRIAATEH  314

Query  1128  LYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKN  1307
             L++A   DP RILQQTVCYD+    T+SV+WGYAVQ+   + LLPD L  Q ++ PW++ 
Sbjct  315   LFQAVHADPARILQQTVCYDKSNLLTVSVAWGYAVQVFEGNELLPDLLSRQPTFRPWKRG  374

Query  1308  KK-DVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYRKMTTENCTFDKASPRNL  1484
             K     Y F+SR +  DPC+R  VF++  V SS RDGI + Y +    NC     S + L
Sbjct  375   KNVAAKYMFNSRVFPSDPCKRPAVFFLQNVLSS-RDGIWTEYIRHDLGNCVRSNLS-KKL  432

Query  1485  DEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELVYMH  1640
              +IRV +QKL  D+++L   RR CCD+ SS  ++ + IGIR+C   EL+ M 
Sbjct  433   VKIRVFSQKLAFDAEQLKPLRRPCCDI-SSPINETMIIGIRQCGHGELISMQ  483



>ref|XP_009137051.1| PREDICTED: uncharacterized protein LOC103861091 [Brassica rapa]
Length=527

 Score =   384 bits (986),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 193/427 (45%), Positives = 271/427 (63%), Gaps = 9/427 (2%)
 Frame = +3

Query  369   VSLQDVSSPTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGT  548
             V +     PT L H+VFGIA+S + W++RKE++K+W++P  MRG V+LD++  K+  +  
Sbjct  99    VKVDAADEPTDLNHVVFGIAASAKLWKQRKEYIKIWYKPKHMRGYVWLDKEVKKNISSND  158

Query  549   DS----LPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVF  716
             +     LPP+ IS  T+ F YT + G  SA+R++R VSE + L   +VRWFV GDDDTVF
Sbjct  159   EDDDDLLPPIKISAGTAYFPYTNKQGQRSALRISRIVSEMLRLGLKNVRWFVMGDDDTVF  218

Query  717   FPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDS  896
               DNL++ L KYDH   YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL+K+ D 
Sbjct  219   VTDNLIRVLRKYDHEQMYYIGSLSESHLQNIFFSYSMAYGGGGFAISYPLAKALSKMQDR  278

Query  897   CLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHME  1076
             C+ RYP LYGSD R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ P VS+HH++
Sbjct  279   CIQRYPALYGSDDRMQACMAELGVPLTKEIGFHQYDVYGNLFGLLAAHPVTPFVSMHHLD  338

Query  1077  VYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLL  1256
             V +PIFPNMT  +AL+ L     +D   +LQQ++CYD+  SW+ISVSWGYAVQI      
Sbjct  339   VVEPIFPNMTRVRALKKLTVPMKLDSAGLLQQSICYDKHKSWSISVSWGYAVQIFRGIFS  398

Query  1257  LPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMD--RVSSSHRDGITSVY  1430
               +      ++  W K      Y F++R    +PC++  VFYM   R        ++   
Sbjct  399   PREMEMPSRTFLNWYKRADYTAYAFNTRPVSRNPCQKPFVFYMSSTRFDKQLNTTVSEYT  458

Query  1431  R-KMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIR  1607
             R ++   +C +   +P  ++ I V  +K D    E  +PRR+CC VL +  +  L I + 
Sbjct  459   RHRVPHPSCRWKMTNPAEINTI-VVYKKPDPHLWE-RSPRRNCCRVLQTKRNNTLWINVG  516

Query  1608  ECKEEEL  1628
              C+E E+
Sbjct  517   VCREAEV  523



>dbj|BAE71200.1| hypothetical protein [Trifolium pratense]
Length=515

 Score =   384 bits (985),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 194/415 (47%), Positives = 270/415 (65%), Gaps = 8/415 (2%)
 Frame = +3

Query  393   PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCI  572
             PT L H+VFGIA+S + W +RK ++KLW+R   MRG V+LD  +VK E N  +SLPPV I
Sbjct  103   PTDLRHVVFGIAASAKLWEQRKNYIKLWYRSKDMRGVVWLD-SKVKTEKN--ESLPPVRI  159

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             SGDTS F Y  + G+ SAIR++R VSE + L   DVRWFV GDDDTVF  +NLV+ L KY
Sbjct  160   SGDTSKFAYKNKQGHRSAIRISRIVSETLRLGMKDVRWFVMGDDDTVFVTENLVRILRKY  219

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH  +YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL K+ D C+ RYP LYGSD
Sbjct  220   DHNQFYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAKALHKMQDRCIQRYPGLYGSD  279

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
              R+HAC++ELGV LT E GFHQ D+ G++ GLLA+HP+ PLVSLHH++V +PIFPN+T  
Sbjct  280   DRMHACMAELGVPLTKETGFHQYDVYGNLLGLLASHPVTPLVSLHHLDVVEPIFPNVTRV  339

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
             +AL+ L     +D   ++QQ++CYD+   WT+SVSWG+ VQI        +      ++ 
Sbjct  340   EALQRLTIPMKLDSAGLMQQSICYDKSNRWTVSVSWGFVVQIFRGVFSPREMEMPSRTFL  399

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSS--SHRDGITSVYR-KMTTENCTFD  1463
              W +      Y F++R    +PC++  VFY  +  S  + +  +T   R ++    C + 
Sbjct  400   NWYRRADYTAYAFNTRPVSRNPCQKPFVFYFSKAKSNDTTQQTLTEYERHRVPHPECRWR  459

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
              A+P ++D++ V  +K D    +  APRR+CC V+ S     + + +  C+  E+
Sbjct  460   MANPSSIDKVEV-YKKPDPHLWD-RAPRRNCCRVMKSKKKGTMVVDVGMCRGNEV  512



>ref|XP_006367660.1| PREDICTED: uncharacterized protein LOC102595998 [Solanum tuberosum]
Length=494

 Score =   383 bits (983),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 198/431 (46%), Positives = 274/431 (64%), Gaps = 15/431 (3%)
 Frame = +3

Query  366   SVSLQDVSS--PTSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEV--KH  533
             S+S+Q+ +    T L+HIVFGIA+S   W KRKE++KLWWRP  MRG V+LD++    K+
Sbjct  72    SLSVQENTGDPETGLKHIVFGIAASTNLWDKRKEYIKLWWRPGEMRGVVWLDKNVTIKKN  131

Query  534   EDNGTDSLPPVCISGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTV  713
             ED     LP + IS +T+ F YT R GN SA+R++R VSE + L   +VRWFV GDDDTV
Sbjct  132   ED-----LPEIRISENTTKFLYTNRQGNRSALRISRVVSETIRLGLKNVRWFVMGDDDTV  186

Query  714   FFPDNLVKTLSKYDHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFD  893
             F  DN+V+ LSKYDH  +YYIG+SSE  +QN FFS+ MA+GG GFAISYPLAK L K+ D
Sbjct  187   FNVDNVVRVLSKYDHNQYYYIGSSSESHIQNIFFSYAMAYGGGGFAISYPLAKELEKIQD  246

Query  894   SCLHRYPHLYGSDARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHM  1073
              CL RYP LYGSD R+ AC++ELGV LT EPGFHQ D+ G++ GLL AHP+ PLVS+HH+
Sbjct  247   RCLQRYPGLYGSDDRIQACMAELGVPLTREPGFHQYDVYGNLLGLLGAHPVTPLVSIHHL  306

Query  1074  EVYDPIFPNMTTTKALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHL  1253
             +V DPI P M+    L+ ++++   D   I+QQ++CYD+   W+ISVSWGY VQI   ++
Sbjct  307   DVVDPIIPRMSRIDGLQRVFESMKYDTASIMQQSICYDKQKYWSISVSWGYVVQITRGNI  366

Query  1254  LLPDALRAQESYSPWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSH-RDGITSVY  1430
                +      ++  W K      Y F++R     PC++  V+Y+        ++ I  +Y
Sbjct  367   SPRELEMPTRTFLNWYKRADYTAYAFNTRPVTKHPCQKPFVYYISAAKYDRSKNQIVGIY  426

Query  1431  --RKMTTENCTFDKASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGI  1604
                + +   C +   SP +++ I V  +K D D++   A RR CC VL S+ +  L I +
Sbjct  427   HRHRESYPYCRWKIESPESINAI-VVLKKPD-DNRWQKAARRDCCKVLPSN-NSYLYIWV  483

Query  1605  RECKEEELVYM  1637
               C+  E   M
Sbjct  484   GNCRAGETSEM  494



>ref|XP_004503683.1| PREDICTED: uncharacterized protein LOC101490078 [Cicer arietinum]
Length=513

 Score =   383 bits (984),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 193/414 (47%), Positives = 271/414 (65%), Gaps = 8/414 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T+L H+VFGIA+S + W +RK ++KLW+  + MRG V+LD ++VK E N  +SLPPV IS
Sbjct  102   TNLRHVVFGIAASAKLWEQRKNYIKLWYNATEMRGVVWLD-NKVKTEKN--ESLPPVRIS  158

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS F Y  + G+ SAIR++R VSE + L   DVRWFV GDDDTVF  +NL++ L KYD
Sbjct  159   GDTSKFAYKNKQGHRSAIRISRIVSETLRLGMKDVRWFVMGDDDTVFVTENLIRILRKYD  218

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YYIG+ SE  +QN FFS+ MA+GG GFAISYPLAKAL K+ D C+ RYP LYGSD 
Sbjct  219   HNQFYYIGSLSESHLQNIFFSYGMAYGGGGFAISYPLAKALHKMQDRCIQRYPGLYGSDD  278

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+HAC++ELGV LT E GFHQ D+ G++FGLLA+HP+ PLVSLHH++V +PIFPN+T  +
Sbjct  279   RMHACMAELGVPLTKETGFHQYDVYGNLFGLLASHPVTPLVSLHHLDVVEPIFPNVTRVE  338

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+ L     +D   ++QQ++CYD+   WT+SVSWG+ VQI        +      ++  
Sbjct  339   ALQRLTIPMKLDSAGLMQQSICYDKSKHWTVSVSWGFTVQIFRGVFSPREMEMPSRTFLN  398

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRV--SSSHRDGITSVYR-KMTTENCTFDK  1466
             W +      Y F++R    +PC++  VFY  +   + + +  +T   R ++    C +  
Sbjct  399   WYRRADYTAYAFNTRPVSRNPCQKPFVFYFSKAEYNDTMQQTLTEYERHRVPHPECRWKM  458

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             A P +L+ + V  +K D    +  APRR+CC V+ S     + I +  C+E E+
Sbjct  459   ADPSSLNRVEV-YKKPDPHLWD-RAPRRNCCRVMKSKEKGTMVIDVGMCREGEV  510



>ref|XP_009140092.1| PREDICTED: uncharacterized protein LOC103864083 [Brassica rapa]
Length=521

 Score =   383 bits (984),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 191/416 (46%), Positives = 269/416 (65%), Gaps = 7/416 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVK-HEDNGTDSLPPVCI  572
             T L H+VFGIA+S   W++RKE++KLW++P+ MRG V+L++   +  ++N T++LPPV I
Sbjct  106   TDLRHVVFGIAASARLWKQRKEYIKLWYKPNQMRGYVWLEKPVKRLDQENETNNLPPVKI  165

Query  573   SGDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKY  752
             S DTS F Y  + G+ SAIR++R V+E + L   DVRWFV GDDDTVF  +NL++ L KY
Sbjct  166   SADTSKFPYKNKQGHRSAIRISRIVTETLKLGLKDVRWFVMGDDDTVFVAENLIRVLRKY  225

Query  753   DHGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSD  932
             DH   YYIG+ SE  +QN +FS+ MA+GG GFA+SYPLA AL+K+ D C+ RYP LYGSD
Sbjct  226   DHNQMYYIGSLSESHLQNIYFSYGMAYGGGGFAVSYPLAVALSKMQDRCIKRYPALYGSD  285

Query  933   ARVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTT  1112
              R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLV+LHH++V +PIFPNMT  
Sbjct  286   DRMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVAPLVTLHHLDVVEPIFPNMTRV  345

Query  1113  KALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYS  1292
              AL+ L   A +D   ++QQ++CYD+   WT+SVSWGYAVQI        +      ++ 
Sbjct  346   DALKRLQMPAMLDSAGLMQQSICYDKRRKWTVSVSWGYAVQIFRGVFSAREMEMPSRTFL  405

Query  1293  PWRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVY---RKMTTENCTFD  1463
              W +      Y F++R     PC++  VFYM          +T  +    ++    C + 
Sbjct  406   NWYRRADYTAYAFNTRPVSRHPCQKPFVFYMTTTGVHPMTNMTVSHYESHRVAQPECRWK  465

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
              A+P +L  + +  +K D    +  +PRR+CC V  S  +  LEI +  CKE E+V
Sbjct  466   MANPGDLRTV-IVYKKPDPHLWD-RSPRRNCCRV-KSKKNNTLEISVAVCKEGEVV  518



>ref|XP_006405352.1| hypothetical protein EUTSA_v10027721mg [Eutrema salsugineum]
 gb|ESQ46805.1| hypothetical protein EUTSA_v10027721mg [Eutrema salsugineum]
Length=519

 Score =   383 bits (984),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 191/416 (46%), Positives = 271/416 (65%), Gaps = 8/416 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L H+VFGIA+S   W++RKE++K+W++P+ MRG V+L++   K +++   SLPP+ IS
Sbjct  105   TELRHVVFGIAASARLWKQRKEYIKIWYKPNQMRGYVWLEKPVKKLDEDDEISLPPIKIS  164

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDTS F Y  + G+ SAIR++R V+E + L   DVRWFV GDDDTVF  +NL++ L KYD
Sbjct  165   GDTSKFPYKNKQGHRSAIRISRIVTETLKLGLKDVRWFVMGDDDTVFVAENLIRVLRKYD  224

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H   YYIG+ SE  +QN +FS+ MA+GG GFA+SYPLA AL+K+ D C+ RYP LYGSD 
Sbjct  225   HNQMYYIGSLSESHLQNIYFSYGMAYGGGGFAVSYPLAVALSKMQDRCIKRYPALYGSDD  284

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ G++FGLLAAHP+ PLV+LHH++V +PIFPNMT   
Sbjct  285   RMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVAPLVTLHHLDVVEPIFPNMTRVN  344

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL+ L   A++D   ++QQ++CYD+   WT+SVSWG+AVQI        +      ++  
Sbjct  345   ALKRLQVPATLDSAGLMQQSICYDKRRKWTVSVSWGFAVQIFRGVFSAREIEMPSRTFLN  404

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVSSSHRDGITSVYR----KMTTENCTFD  1463
             W +      Y F++R     PC++  VFYM   +  H     +V R    ++    C + 
Sbjct  405   WYRRADYTAYAFNTRPVSRHPCQKPFVFYMT-TAGVHPTTNMTVSRYESHRVAQPECRWK  463

Query  1464  KASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
              A+P +L  + +  +K D    +  +PRR+CC V  S  +  LEI +  CKE E+V
Sbjct  464   MANPGDLRTV-IVYKKPDPHLWD-RSPRRNCCRV-KSKKNNTLEISVAVCKEGEVV  516



>ref|XP_010457107.1| PREDICTED: uncharacterized protein LOC104738639 isoform X1 [Camelina 
sativa]
Length=508

 Score =   382 bits (982),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 204/466 (44%), Positives = 285/466 (61%), Gaps = 21/466 (5%)
 Frame = +3

Query  273   FKNIVLICSSLCVVYLVCTFVLVPSTNLLHVSVSLQDVSSP--TSLEHIVFGIASSEESW  446
             F  + LI SS   V  +  F + P      V    + V +P  T L+H+VFGIA+S + W
Sbjct  46    FYPLNLISSSYQPVGSLIKFSVSP------VGSGSKPVPNPEQTDLKHVVFGIAASAKLW  99

Query  447   RKRKEFVKLWWRPSG-MRGCVFLDRDEVKHEDNGTDSLPPVCISGDTSSFRYTCRGGNPS  623
             + R+++VKLWW+P+G M G V+LD+  +   DN + +LPP+ IS DTS F+Y    G  S
Sbjct  100   KHRRDYVKLWWKPNGEMNGVVWLDK-HIAQNDNVSATLPPIKISSDTSRFKYKYPNGLRS  158

Query  624   AIRLARAVSEAVSL-----NHSDVRWFVFGDDDTVFFPDNLVKTLSKYDHGLWYYIGTSS  788
             AIR+ R VSE V L     +  +VRW V GDDDTVFFP+NLVK L KYDH  +YYIG+ S
Sbjct  159   AIRITRIVSETVRLLNGTESEKNVRWIVMGDDDTVFFPENLVKVLRKYDHKQFYYIGSPS  218

Query  789   EDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDARVHACLSELGV  968
             E  +QN  FS+ MA+GG GFAISYPLAKAL K+ D C+ RY  LYGSD R+HAC+SELGV
Sbjct  219   ESHIQNLKFSYGMAYGGGGFAISYPLAKALEKMQDRCIQRYSELYGSDDRIHACMSELGV  278

Query  969   SLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTKALEHLYKAASI  1148
              LT E GFHQ+D+ G + GLL+AHPL PLVS+HH+++ DP+FPNM    A++    +A +
Sbjct  279   PLTKEVGFHQIDLYGKLLGLLSAHPLAPLVSIHHLDLVDPVFPNMGRVNAMQRFMVSAKL  338

Query  1149  DPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSPWRKNKKDVPYG  1328
             D   + QQ++CYD+   WT+SVSWGY VQI    L   + L    ++  W K  ++  Y 
Sbjct  339   DSASLAQQSICYDKARRWTVSVSWGYTVQIIRGVLSAKEMLIPTRTFIDWYKRAEEKSYA  398

Query  1329  FDSRGYHPDPCRRQTVFYMDRV---SSSHRDGITSV-YRKMTTENCTFDKASPRNLDEIR  1496
             F++R +  + C+R  V+Y+       + HR     V +  M    C +  + P  ++ + 
Sbjct  399   FNTRPFSKNACQRPRVYYLSNALPDLALHRTASEYVRWYDMWDPECDWHMSDPSEIERV-  457

Query  1497  VSTQKLDLDS-KELLAPRRHCCDVLSSSADKALEIGIRECKEEELV  1631
             +  +K D D      APRR CC VL +  +  + I +  CK++E+V
Sbjct  458   IVYKKPDPDRWNRDRAPRRDCCRVLPTKKNGTMVIDVGACKDDEIV  503



>ref|XP_009358373.1| PREDICTED: uncharacterized protein LOC103949004 [Pyrus x bretschneideri]
Length=525

 Score =   383 bits (984),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 189/414 (46%), Positives = 261/414 (63%), Gaps = 8/414 (2%)
 Frame = +3

Query  396   TSLEHIVFGIASSEESWRKRKEFVKLWWRPSGMRGCVFLDRDEVKHEDNGTDSLPPVCIS  575
             T L+HI+FGIA+S   W KRKE++K+WWRP   RG V+LD+ E    + G   LP + IS
Sbjct  114   TELKHIMFGIAASSNLWEKRKEYIKVWWRPKETRGVVWLDKKERTRRNEG---LPEIRIS  170

Query  576   GDTSSFRYTCRGGNPSAIRLARAVSEAVSLNHSDVRWFVFGDDDTVFFPDNLVKTLSKYD  755
             GDT  F+YT R G  SA+R++R VSE + L   DVRWFV GDDDTVF  +N+V+ L+KYD
Sbjct  171   GDTRGFKYTNRQGQRSALRISRVVSETLRLGVKDVRWFVMGDDDTVFMVENVVRILNKYD  230

Query  756   HGLWYYIGTSSEDVVQNSFFSFEMAFGGAGFAISYPLAKALAKVFDSCLHRYPHLYGSDA  935
             H  +YY+G+SSE  +QN FFS+ MA+GG GFAISYPLA  L K+ D C+ RYP LYGSD 
Sbjct  231   HTQFYYVGSSSESHIQNIFFSYSMAYGGGGFAISYPLALELEKMQDRCIQRYPGLYGSDD  290

Query  936   RVHACLSELGVSLTHEPGFHQMDIRGDVFGLLAAHPLRPLVSLHHMEVYDPIFPNMTTTK  1115
             R+ AC++ELGV LT E GFHQ D+ GD+ GLL+AHP+ PLVSLHH++V +P+FP+M   K
Sbjct  291   RMQACMAELGVPLTKETGFHQYDVYGDLLGLLSAHPVTPLVSLHHLDVVEPVFPHMGRVK  350

Query  1116  ALEHLYKAASIDPHRILQQTVCYDRWFSWTISVSWGYAVQIHGSHLLLPDALRAQESYSP  1295
             AL HL ++  +D   I+QQ++CYD+   W+ISVSWGY VQI    +   +      ++  
Sbjct  351   ALHHLSRSVKLDSASIMQQSICYDKDRYWSISVSWGYVVQIVRGIMSPRELETPSRTFLN  410

Query  1296  WRKNKKDVPYGFDSRGYHPDPCRRQTVFYMDRVS-SSHRDGITSVY--RKMTTENCTFDK  1466
             W +      Y F++R     PC++  +FY+        R  I   Y   K    +C +  
Sbjct  411   WYRRADYTAYAFNTRPVSKHPCQKPFIFYLSSTRYDEDRKKIIGYYTRHKSPVPHCRWKM  470

Query  1467  ASPRNLDEIRVSTQKLDLDSKELLAPRRHCCDVLSSSADKALEIGIRECKEEEL  1628
             ASP  +D I V  +   L  ++  +PRR CC +L S  +  + + +  C+  E+
Sbjct  471   ASPEQVDSIVVLKRPDPLRWEK--SPRRDCCRILPSQKNSTMYLLVDNCRLGEV  522



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5474489051310