BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85316_g1_i1 len=691 path=[669:0-690]

Length=691
                                                                      Score     E

ref|XP_006358609.1|  PREDICTED: putative cytochrome c oxidase sub...    159   1e-45   
ref|XP_004245856.2|  PREDICTED: putative cytochrome c oxidase sub...    156   5e-44   
ref|XP_007156616.1|  hypothetical protein PHAVU_002G003400g             120   2e-30   
ref|XP_006590596.1|  PREDICTED: putative cytochrome c oxidase sub...    114   4e-28   
ref|XP_002528789.1|  cytochrome C oxidase polypeptide vib, putative     114   7e-28   Ricinus communis
ref|XP_004512202.1|  PREDICTED: putative cytochrome c oxidase sub...    113   9e-28   
gb|KEH27487.1|  cytochrome C oxidase, subunit VIb family protein        113   9e-28   
gb|KDP45959.1|  hypothetical protein JCGZ_11862                         113   1e-27   
ref|XP_011084123.1|  PREDICTED: putative cytochrome c oxidase sub...    110   8e-27   
emb|CDP13408.1|  unnamed protein product                                109   3e-26   
gb|EYU18246.1|  hypothetical protein MIMGU_mgv1a016649mg                108   5e-26   
ref|XP_010461103.1|  PREDICTED: putative cytochrome c oxidase sub...    105   1e-24   
ref|XP_009107983.1|  PREDICTED: putative cytochrome c oxidase sub...    105   1e-24   
emb|CDY44662.1|  BnaA08g06780D                                          104   2e-24   
gb|KHN34875.1|  Putative cytochrome c oxidase subunit 6b-like           104   3e-24   
ref|XP_010478694.1|  PREDICTED: putative cytochrome c oxidase sub...    103   4e-24   
ref|NP_174548.1|  putative cytochrome c oxidase subunit 6b-like         103   7e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891005.1|  predicted protein                                  103   1e-23   
ref|XP_004148521.1|  PREDICTED: putative cytochrome c oxidase sub...    102   1e-23   
gb|KFK45002.1|  hypothetical protein AALP_AA1G331400                    101   5e-23   
ref|XP_008229512.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...  99.4    1e-22   
ref|XP_008465918.1|  PREDICTED: putative cytochrome c oxidase sub...    100   2e-22   
ref|XP_003559516.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...  99.4    2e-22   
gb|AAF25969.1|AC017118_6  F6N18.10                                      100   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007210023.1|  hypothetical protein PRUPE_ppa016849mg           96.3    2e-21   
ref|XP_010478695.1|  PREDICTED: putative cytochrome c oxidase sub...  95.5    6e-21   
ref|XP_006415157.1|  hypothetical protein EUTSA_v10009443mg           93.2    6e-20   
ref|XP_010501741.1|  PREDICTED: putative cytochrome c oxidase sub...  80.1    5e-15   
ref|XP_006304557.1|  hypothetical protein CARUB_v10011555mg           73.9    1e-13   
ref|XP_011084122.1|  PREDICTED: putative cytochrome c oxidase sub...  72.0    1e-12   
ref|XP_009402008.1|  PREDICTED: LOW QUALITY PROTEIN: putative cyt...  70.5    3e-12   
ref|XP_006658829.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  71.6    3e-12   
ref|XP_010534085.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  72.0    3e-12   
ref|XP_010534086.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  71.2    4e-12   
ref|XP_003562686.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  70.9    5e-12   
ref|XP_010521174.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  70.9    8e-12   
gb|EMT25976.1|  Cytochrome c oxidase subunit 6B                       70.5    8e-12   
dbj|BAJ94958.1|  predicted protein                                    70.5    9e-12   
gb|KCW71840.1|  hypothetical protein EUGRSUZ_E00322                   68.2    1e-11   
ref|XP_006453502.1|  hypothetical protein CICLE_v10010074mg           67.8    1e-11   
ref|XP_002454158.1|  hypothetical protein SORBIDRAFT_04g025700        67.8    2e-11   Sorghum bicolor [broomcorn]
gb|AAM92706.1|  putative cytochrome c oxidase subunit                 69.7    2e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010274628.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...  67.8    2e-11   
ref|XP_009349099.1|  PREDICTED: cytochrome c oxidase subunit 6b-2     67.8    2e-11   
ref|XP_011009575.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  69.7    2e-11   
ref|XP_010914058.1|  PREDICTED: cytochrome c oxidase subunit 6b-3     67.4    2e-11   
ref|XP_010545443.1|  PREDICTED: cytochrome c oxidase subunit 6b-2     67.4    2e-11   
ref|XP_008444857.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  69.7    2e-11   
gb|KHG12789.1|  Cytochrome c oxidase subunit 6b-2 -like protein       67.4    2e-11   
emb|CDP02891.1|  unnamed protein product                              67.4    2e-11   
gb|ABK96664.1|  unknown                                               69.7    2e-11   Populus trichocarpa x Populus deltoides
ref|XP_007013954.1|  Cytochrome c oxidase subunit 6b                  67.4    2e-11   
ref|XP_002307362.1|  cytochrome c oxidase 6b family protein           69.7    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_008360325.1|  PREDICTED: cytochrome c oxidase subunit 6b-2     67.4    3e-11   
gb|ABK92629.1|  unknown                                               69.3    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_002325099.1|  hypothetical protein POPTR_0018s10890g           67.0    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_004958350.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  69.3    3e-11   
ref|XP_008223569.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  67.0    3e-11   
ref|XP_008223568.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  67.0    3e-11   
ref|XP_007225925.1|  hypothetical protein PRUPE_ppa012107mg           68.9    3e-11   
ref|XP_007226359.1|  hypothetical protein PRUPE_ppa022392mg           67.8    4e-11   
ref|XP_004953063.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  66.6    4e-11   
ref|XP_009413575.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  68.9    4e-11   
dbj|BAC10187.1|  putative cytochrome c oxidase subunit 6b-1           68.9    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004976105.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...  66.6    4e-11   
ref|XP_010268397.1|  PREDICTED: cytochrome c oxidase subunit 6b-2     66.6    4e-11   
ref|XP_006284746.1|  hypothetical protein CARUB_v10006010mg           67.8    4e-11   
ref|XP_008678787.1|  PREDICTED: cytochrome c oxidase subunit 6b-3     66.6    4e-11   
ref|XP_002463195.1|  hypothetical protein SORBIDRAFT_02g039590        69.3    4e-11   Sorghum bicolor [broomcorn]
ref|XP_002867470.1|  hypothetical protein ARALYDRAFT_913717           66.6    5e-11   
ref|XP_004152624.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  68.9    5e-11   
ref|XP_009110136.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...  67.4    5e-11   
ref|XP_008386123.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  68.6    5e-11   
ref|XP_006412997.1|  hypothetical protein EUTSA_v10026527mg           67.8    5e-11   
gb|EYU34304.1|  hypothetical protein MIMGU_mgv1a025239mg              66.2    5e-11   
ref|XP_007141211.1|  hypothetical protein PHAVU_008G176600g           68.2    5e-11   
ref|XP_011016796.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  68.6    6e-11   
ref|NP_001053212.1|  Os04g0498200                                     66.2    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010278031.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  66.2    7e-11   
gb|ACG47964.1|  cytochrome c oxidase subunit                          67.8    7e-11   Zea mays [maize]
ref|XP_010535301.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome c...  68.2    7e-11   
gb|EEC82467.1|  hypothetical protein OsI_26908                        68.2    7e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001140389.1|  uncharacterized protein LOC100272443             67.8    7e-11   Zea mays [maize]
ref|NP_194535.2|  cytochrome c oxidase, subunit 6b                    65.9    7e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KHG12868.1|  Cytochrome c oxidase subunit 6b-1 -like protein       68.2    7e-11   
ref|XP_010929208.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...  65.9    7e-11   
emb|CDX91679.1|  BnaC08g05980D                                        66.6    8e-11   
ref|XP_010278032.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  65.9    8e-11   
ref|XP_006650155.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  67.8    8e-11   
ref|XP_010498713.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  68.2    8e-11   
ref|NP_001050275.1|  Os03g0390400                                     67.8    8e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003557780.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  67.8    8e-11   
ref|XP_010459999.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  68.2    9e-11   
ref|XP_010025934.1|  PREDICTED: cytochrome c oxidase subunit 6b-1     68.2    9e-11   
emb|CDY41480.1|  BnaA08g20820D                                        66.6    9e-11   
gb|EEC75393.1|  hypothetical protein OsI_11877                        67.8    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_003580071.1|  PREDICTED: cytochrome c oxidase subunit 6b-2     65.5    1e-10   
gb|AAM63485.1|  cytochrome c oxidase subunit, putative                67.8    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KHN17535.1|  Cytochrome c oxidase subunit 6b-1                     65.5    1e-10   
ref|XP_003542317.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  65.5    1e-10   
gb|ACG48101.1|  cytochrome c oxidase subunit                          67.4    1e-10   Zea mays [maize]
ref|NP_173661.1|  cytochrome C oxidase 6B                             67.8    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890515.1|  hypothetical protein ARALYDRAFT_889753           67.8    1e-10   
ref|XP_008658230.1|  PREDICTED: uncharacterized protein LOC100272...  67.4    1e-10   
ref|XP_003549519.1|  PREDICTED: cytochrome c oxidase subunit 6b-3     65.5    1e-10   
gb|EAZ40696.1|  hypothetical protein OsJ_25165                        68.6    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|ACF79897.1|  unknown                                               67.4    1e-10   Zea mays [maize]
ref|XP_010483320.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  65.5    1e-10   
ref|NP_001131473.1|  hypothetical protein                             67.4    1e-10   Zea mays [maize]
ref|XP_002271982.1|  PREDICTED: cytochrome c oxidase subunit 6b-2     65.1    1e-10   Vitis vinifera
ref|XP_006433933.1|  hypothetical protein CICLE_v10002573mg           67.4    1e-10   
gb|KFM23023.1|  Cytochrome c oxidase subunit 6B                       66.2    1e-10   
emb|CDP01101.1|  unnamed protein product                              67.4    1e-10   
gb|ACU17340.1|  unknown                                               65.1    1e-10   Glycine max [soybeans]
ref|XP_006472562.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  67.4    1e-10   
ref|XP_008658229.1|  PREDICTED: uncharacterized protein LOC100272...  67.4    1e-10   
ref|XP_010916711.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  66.6    2e-10   
emb|CDY19008.1|  BnaC01g20600D                                        65.5    2e-10   
ref|XP_004984149.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  67.0    2e-10   
ref|XP_010047036.1|  PREDICTED: cytochrome c oxidase subunit 6b-2     65.1    2e-10   
gb|ABK95863.1|  unknown                                               67.0    2e-10   Populus trichocarpa [western balsam poplar]
emb|CDX92861.1|  BnaC07g41190D                                        67.0    2e-10   
ref|XP_010916710.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  66.6    2e-10   
ref|XP_004490381.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  66.6    2e-10   
ref|XP_010278029.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  65.9    2e-10   
ref|XP_007154837.1|  hypothetical protein PHAVU_003G151900g           64.3    3e-10   
gb|EPS59241.1|  hypothetical protein M569_15568                       65.9    3e-10   
ref|XP_007018715.1|  Cytochrome C oxidase polypeptide vib, putative   66.6    3e-10   
ref|XP_008219336.1|  PREDICTED: cytochrome c oxidase subunit 6b-1     66.6    3e-10   
ref|XP_010539459.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  64.3    3e-10   
ref|XP_009409166.1|  PREDICTED: cytochrome c oxidase subunit 6b-1     66.2    3e-10   
ref|XP_010675986.1|  PREDICTED: cytochrome c oxidase subunit 6b-1     66.2    3e-10   
ref|XP_009103236.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  66.2    3e-10   
ref|XP_010539460.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  64.3    3e-10   
ref|XP_004309856.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  64.3    3e-10   
gb|KEH32587.1|  cytochrome C oxidase, subunit VIb family protein      64.3    3e-10   
ref|XP_008794399.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...  64.3    3e-10   
emb|CDY46649.1|  BnaA07g10470D                                        66.2    3e-10   
gb|AFK38546.1|  unknown                                               64.3    3e-10   
ref|XP_010103131.1|  Cytochrome c oxidase subunit 6b-1                65.5    3e-10   
ref|XP_010477504.1|  PREDICTED: cytochrome c oxidase subunit 6b-1     66.2    3e-10   
emb|CDY00453.1|  BnaC07g13730D                                        66.2    3e-10   
gb|KFK44340.1|  hypothetical protein AALP_AA1G245300                  65.9    4e-10   
ref|XP_002282064.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  65.9    4e-10   Vitis vinifera
ref|XP_009373077.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  65.5    5e-10   
gb|KFK27323.1|  hypothetical protein AALP_AA8G367900                  63.5    5e-10   
ref|XP_004507784.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...  63.5    5e-10   
dbj|BAJ88586.1|  predicted protein                                    63.5    5e-10   
ref|XP_009373072.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  65.5    5e-10   
ref|XP_002864529.1|  hypothetical protein ARALYDRAFT_918963           63.5    5e-10   
ref|XP_002282033.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  65.9    5e-10   Vitis vinifera
ref|XP_008804786.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  65.5    5e-10   
ref|XP_010658140.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  65.9    5e-10   
ref|XP_006305630.1|  hypothetical protein CARUB_v10010326mg           65.9    5e-10   
ref|XP_008452371.1|  PREDICTED: cytochrome c oxidase subunit 6b-2     63.5    5e-10   
ref|XP_011079340.1|  PREDICTED: cytochrome c oxidase subunit 6b-2     63.5    6e-10   
ref|XP_009799940.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  65.5    6e-10   
ref|NP_568867.1|  cytochrome c oxidase subunit 6b-2                   63.5    6e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009777811.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  65.5    6e-10   
ref|XP_008356355.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  65.1    6e-10   
ref|XP_009632005.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  65.5    6e-10   
ref|XP_010272991.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  65.5    7e-10   
ref|XP_006305631.1|  hypothetical protein CARUB_v10010326mg           65.5    7e-10   
ref|XP_004252528.1|  PREDICTED: cytochrome c oxidase subunit 6b-1     65.1    7e-10   
ref|XP_011074207.1|  PREDICTED: cytochrome c oxidase subunit 6b-1     65.5    7e-10   
ref|XP_004144708.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  63.5    7e-10   
ref|XP_004144709.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  63.2    8e-10   
gb|KDP41415.1|  hypothetical protein JCGZ_15822                       65.1    8e-10   
ref|XP_002989279.1|  hypothetical protein SELMODRAFT_129448           63.2    8e-10   
ref|XP_002281992.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  65.1    8e-10   Vitis vinifera
gb|EYU36481.1|  hypothetical protein MIMGU_mgv1a015237mg              64.7    9e-10   
ref|XP_003615162.1|  Subunit 6b of cytochrome c oxidase               65.1    9e-10   
gb|KHG00496.1|  Cytochrome c oxidase subunit 6b-1 -like protein       64.7    9e-10   
ref|XP_006360302.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  65.1    9e-10   
ref|XP_009145340.1|  PREDICTED: cytochrome c oxidase subunit 6b-1     64.7    9e-10   
gb|ABK23944.1|  unknown                                               63.2    1e-09   Picea sitchensis
ref|XP_004299671.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  64.7    1e-09   
ref|XP_004162692.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  63.2    1e-09   
ref|XP_011069843.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  62.4    1e-09   
ref|XP_003544809.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  64.3    1e-09   
gb|KHN35491.1|  Cytochrome c oxidase subunit 6b-1                     64.3    1e-09   
ref|XP_009623905.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  64.3    1e-09   
emb|CBI25309.3|  unnamed protein product                              65.1    1e-09   
gb|ABK23476.1|  unknown                                               63.9    1e-09   Picea sitchensis
gb|KHN26096.1|  Cytochrome c oxidase subunit 6b-1                     63.9    2e-09   
ref|NP_001236320.1|  uncharacterized protein LOC100306272             63.9    2e-09   
ref|XP_009137757.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...  62.0    2e-09   
gb|AAM64280.1|  cytochrome c oxidase subunit 6b                       61.6    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002528213.1|  cytochrome C oxidase polypeptide vib, putative   61.6    3e-09   Ricinus communis
gb|KHG23610.1|  Cytochrome c oxidase subunit 6b-1 -like protein       62.0    3e-09   
ref|XP_009144153.1|  PREDICTED: cytochrome c oxidase subunit 6b-2     61.6    3e-09   
gb|EYU37118.1|  hypothetical protein MIMGU_mgv1a022157mg              62.0    3e-09   
ref|XP_002513958.1|  cytochrome C oxidase polypeptide vib, putative   63.5    3e-09   Ricinus communis
ref|XP_009600161.1|  PREDICTED: cytochrome c oxidase subunit 6b-3     61.2    3e-09   
ref|XP_006343565.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  61.2    4e-09   
gb|EPS74026.1|  hypothetical protein M569_00726                       65.9    4e-09   
ref|XP_009390533.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  60.8    4e-09   
ref|XP_010267072.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  62.4    4e-09   
ref|XP_008782171.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  63.5    5e-09   
ref|XP_006363287.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  62.8    5e-09   
ref|XP_004237938.1|  PREDICTED: cytochrome c oxidase subunit 6b-1     62.8    5e-09   
ref|XP_008781379.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...  60.8    5e-09   
emb|CDY04815.1|  BnaC05g17740D                                        62.4    6e-09   
gb|AFK42242.1|  unknown                                               62.4    7e-09   
ref|XP_005646865.1|  cytochrome c oxidase subunit H                   60.1    1e-08   
ref|XP_010687691.1|  PREDICTED: cytochrome c oxidase subunit 6b-2     60.1    1e-08   
ref|XP_001784031.1|  predicted protein                                59.7    1e-08   
dbj|BAJ88460.1|  predicted protein                                    59.7    1e-08   
ref|XP_004242645.1|  PREDICTED: cytochrome c oxidase subunit 6b-2     59.3    2e-08   
ref|XP_002947475.1|  hypothetical protein VOLCADRAFT_48974            58.9    2e-08   
ref|XP_010926331.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  61.6    2e-08   
gb|ABD64590.1|  mitochondrial cytochrome c oxidase subunit 6b         60.5    2e-08   Chlamydomonas sp. ICE-L
emb|CAB36775.1|  putative protein                                     60.5    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001691399.1|  mitochondrial cytochrome c oxidase subunit       60.1    3e-08   Chlamydomonas reinhardtii
ref|XP_001763315.1|  predicted protein                                58.2    4e-08   
ref|XP_002965431.1|  hypothetical protein SELMODRAFT_84137            57.8    7e-08   
ref|XP_005707710.1|  cytochrome c oxidase subunit VIb                 57.8    8e-08   
ref|XP_003064158.1|  predicted protein                                58.2    8e-08   
ref|XP_001421861.1|  predicted protein                                56.6    2e-07   Ostreococcus lucimarinus CCE9901
ref|NP_001048358.1|  Os02g0791400                                     56.2    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002978684.1|  hypothetical protein SELMODRAFT_59940            55.8    3e-07   
gb|EEC74151.1|  hypothetical protein OsI_09238                        55.8    4e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_002493850.1|  Subunit VIb of cytochrome c oxidase              55.8    4e-07   Komagataella phaffii GS115
ref|XP_007262758.1|  cytochrome c oxidase, subunit VIb                55.8    4e-07   
ref|XP_005841976.1|  hypothetical protein GUITHDRAFT_149927           55.8    4e-07   
gb|AAP80832.1|  cytochrome c oxidase subunit 6b-1                     55.5    5e-07   Griffithsia japonica
ref|XP_004986287.1|  PREDICTED: uncharacterized protein LOC101775406  58.2    5e-07   
gb|ACW82405.1|  cytochrome c oxidase subunit 6b                       57.4    5e-07   Larix kaempferi [karamatsu]
gb|KHN34761.1|  Cytochrome c oxidase subunit 6b-2                     55.5    6e-07   
gb|KDP38756.1|  hypothetical protein JCGZ_04109                       55.1    8e-07   
ref|XP_006453501.1|  hypothetical protein CICLE_v10010074mg           54.7    8e-07   
emb|CDI53501.1|  probable COX12-cytochrome-c oxidase, subunit VIB     55.1    8e-07   
ref|XP_008039169.1|  cytochrome c oxidase subunit VIb                 55.1    8e-07   
ref|XP_007387899.1|  cytochrome c oxidase subunit VIb                 55.1    9e-07   
ref|XP_006386412.1|  hypothetical protein POPTR_0002s10020g           57.0    9e-07   
ref|XP_006828021.1|  hypothetical protein AMTR_s00008p00250560        55.8    9e-07   
gb|EMS18372.1|  cytochrome c oxidase subunit VIb                      54.7    1e-06   
ref|XP_004984148.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  56.6    1e-06   
gb|EPS93615.1|  cytochrome c oxidase subunit VIb                      54.7    1e-06   
ref|XP_007371404.1|  cytochrome c oxidase subunit VIb                 54.7    1e-06   
gb|AFK39313.1|  unknown                                               54.7    1e-06   
dbj|GAC71816.1|  cytochrome c oxidase, subunit VIb/COX12              55.5    1e-06   
ref|XP_444921.1|  hypothetical protein                                54.3    1e-06   Candida glabrata CBS 138
gb|EEC77562.1|  hypothetical protein OsI_16493                        53.9    2e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_003083867.1|  putative cytochrome c oxidase subunit 6b-1 (...  54.3    2e-06   
ref|XP_005715645.1|  Cytochrome c oxidase subunit 6b-1                53.9    2e-06   
gb|KDQ53110.1|  hypothetical protein JAAARDRAFT_39484                 53.9    2e-06   
ref|XP_455857.1|  hypothetical protein                                53.9    2e-06   Kluyveromyces lactis NRRL Y-1140
ref|XP_006416198.1|  hypothetical protein EUTSA_v10008804mg           55.8    2e-06   
ref|XP_001644818.1|  hypothetical protein Kpol_1041p18                53.9    2e-06   Vanderwaltozyma polyspora DSM 70294
gb|EMD33294.1|  hypothetical protein CERSUDRAFT_117921                53.9    2e-06   
ref|XP_974620.1|  PREDICTED: cytochrome c oxidase subunit 6B2 iso...  53.9    2e-06   Tribolium castaneum [rust-red flour beetle]
ref|XP_001642972.1|  hypothetical protein Kpol_1046p4                 53.9    2e-06   Vanderwaltozyma polyspora DSM 70294
ref|XP_008190597.1|  PREDICTED: cytochrome c oxidase subunit 6B2 ...  54.3    3e-06   
ref|XP_007299744.1|  cytochrome c oxidase subunit VIb                 53.5    3e-06   
emb|CBI33954.3|  unnamed protein product                              53.5    3e-06   
ref|NP_588322.2|  cytochrome c oxidase subunit VIb (predicted)        53.5    3e-06   Schizosaccharomyces pombe
ref|XP_010929209.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...  53.1    3e-06   
ref|XP_006845475.1|  hypothetical protein AMTR_s00019p00135210        53.5    3e-06   
ref|XP_005844765.1|  hypothetical protein CHLNCDRAFT_138605           54.3    3e-06   
ref|XP_002173711.1|  cytochrome c oxidase subunit VIb                 53.1    3e-06   Schizosaccharomyces japonicus yFS275
gb|EST05549.1|  cytochrome c oxidase, subunit VIb/COX12               53.1    4e-06   
ref|XP_002165950.1|  PREDICTED: cytochrome c oxidase subunit 6B-like  53.1    4e-06   
ref|XP_007426914.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  53.5    4e-06   
emb|CCF52863.1|  probable COX12-cytochrome-c oxidase, subunit VIB     53.1    4e-06   
ref|XP_007512788.1|  predicted protein                                53.9    4e-06   
gb|KHN25113.1|  Cytochrome c oxidase subunit 6b-3                     52.8    4e-06   
gb|AIU99749.1|  mitochondrial cytochrome c oxidase subunit VIb        53.1    4e-06   
gb|ABK26488.1|  unknown                                               54.3    4e-06   Picea sitchensis
emb|CCK68260.1|  hypothetical protein KNAG_0A05980                    53.1    4e-06   
emb|CDO91794.1|  unnamed protein product                              53.1    4e-06   
gb|AGO12712.1|  AaceriADR240Cp                                        52.8    5e-06   
ref|XP_003686491.1|  hypothetical protein TPHA_0G02210                53.1    5e-06   
ref|XP_008658228.1|  PREDICTED: uncharacterized protein LOC100272...  55.1    5e-06   
dbj|BAO40090.1|  cytochrome c oxidase subunit 6B                      52.8    5e-06   
ref|XP_008598810.1|  cytochrome oxidase c subunit VIb                 53.1    5e-06   
gb|KEY70406.1|  hypothetical protein S7711_06574                      53.1    5e-06   
ref|XP_007842213.1|  subunit vib of cytochrome c oxidase              52.8    5e-06   
gb|EPX70840.1|  cytochrome c oxidase subunit VIb                      52.8    5e-06   
gb|KDQ24589.1|  subunit VIb of cytochrome c oxidase, COX6B            52.8    5e-06   
ref|XP_007393250.1|  hypothetical protein PHACADRAFT_251841           52.8    6e-06   
emb|CBQ73024.1|  probable COX12-cytochrome-c oxidase, subunit VIB     52.8    6e-06   
ref|NP_001165174.1|  cytochrome c oxidase subunit VIb polypeptide...  52.8    6e-06   
ref|XP_001728910.1|  hypothetical protein MGL_3904                    52.4    6e-06   
ref|XP_005644079.1|  cytochrome c oxidase subunit H                   53.1    7e-06   
ref|XP_009545239.1|  hypothetical protein HETIRDRAFT_148489           52.4    7e-06   
ref|NP_001165173.1|  cytochrome c oxidase subunit VIb polypeptide...  52.4    7e-06   
emb|CAE01625.3|  OSJNBa0029H02.2                                      52.4    7e-06   
ref|XP_004179208.1|  hypothetical protein TBLA_0B08740                52.4    8e-06   
ref|XP_003957996.1|  hypothetical protein KAFR_0F02640                52.4    8e-06   
ref|XP_006459144.1|  COX6B subunit VIb of cytochrome c oxidase        52.4    8e-06   
ref|XP_008658227.1|  PREDICTED: uncharacterized protein LOC100272...  54.3    1e-05   
gb|EPB85052.1|  cytochrome c oxidase subunit 6b                       52.0    1e-05   
gb|KDO81040.1|  hypothetical protein CISIN_1g029538mg                 53.9    1e-05   
ref|XP_002427088.1|  cytochrome c oxidase subunit VIb isoform 1, ...  52.0    1e-05   
gb|KDN53415.1|  putative COX12-cytochrome-c oxidase, subunit VIB      52.0    1e-05   
ref|XP_007877792.1|  hypothetical protein PFL1_02090                  52.0    1e-05   
ref|XP_001838761.2|  hypothetical protein CC1G_13336                  52.0    1e-05   
ref|XP_007331472.1|  COX6B subunit VIb of cytochrome c oxidase        52.0    1e-05   
ref|XP_002011254.1|  GI16427                                          51.6    1e-05   
emb|CDK28523.1|  unnamed protein product                              51.6    1e-05   
ref|XP_006607864.1|  PREDICTED: cytochrome c oxidase subunit 6B2-...  51.6    2e-05   
ref|XP_316509.4|  AGAP006471-PB                                       51.6    2e-05   
ref|XP_001524150.1|  cytochrome c oxidase polypeptide VIb             51.6    2e-05   
gb|EKG18120.1|  Cytochrome c oxidase subunit VIb                      51.6    2e-05   
ref|NP_984336.1|  ADR240Cp                                            51.2    2e-05   
ref|NP_001165874.1|  cytochrome c oxidase subunit VIb polypeptide 1   51.6    2e-05   
ref|XP_002494748.1|  ZYRO0A08734p                                     51.2    2e-05   
emb|CDH58799.1|  cytochrome c oxidase subunit vib                     51.2    2e-05   
emb|CCA67044.1|  probable COX12-cytochrome-c oxidase, subunit VIB     51.6    2e-05   
emb|CCM04696.1|  predicted protein                                    52.0    2e-05   
ref|XP_003670238.1|  hypothetical protein NDAI_0E01790                51.2    2e-05   
ref|XP_007765493.1|  cytochrome c oxidase subunit VIb                 51.2    2e-05   
emb|CDR42382.1|  CYFA0S09e02410g1_1                                   51.2    2e-05   
ref|XP_007342910.1|  cytochrome c oxidase, subunit VIb                51.2    2e-05   
ref|XP_002762544.1|  PREDICTED: cytochrome c oxidase subunit 6B2 ...  51.2    2e-05   
ref|XP_011123340.1|  hypothetical protein AOL_s00081g221              51.2    2e-05   
ref|XP_011104449.1|  cox12p                                           51.2    2e-05   
ref|NP_013139.1|  cytochrome c oxidase subunit VIb                    50.8    3e-05   
gb|EJT41301.1|  COX12-like protein                                    50.8    3e-05   
ref|NP_728295.1|  cytochrome c oxidase subunit VIb, isoform B         50.8    3e-05   
gb|ETN62337.1|  cytochrome c oxidase,-subunit VIb                     50.8    3e-05   
ref|NP_001005102.1|  cytochrome c oxidase subunit 6B1                 50.8    3e-05   
ref|XP_007587440.1|  putative cytochrome c oxidase polypeptide vi...  50.8    3e-05   
ref|XP_001963575.1|  GF20466                                          50.8    3e-05   
gb|AAP88308.1|  cytochrome c oxidase polypeptide VIb                  50.8    3e-05   
gb|EWC47572.1|  cytochrome c oxidase subunit 6B                       50.8    3e-05   
gb|ACO72858.1|  GH28726p                                              51.6    3e-05   
gb|AAR09978.1|  similar to Drosophila melanogaster CG14235            50.8    3e-05   
ref|XP_003225071.1|  PREDICTED: cytochrome c oxidase subunit 6B1 ...  50.8    3e-05   
gb|EPY52005.1|  cytochrome c oxidase subunit VIb                      50.8    3e-05   
ref|XP_003673351.1|  hypothetical protein NCAS_0A04060                50.8    3e-05   
emb|CCE39624.1|  hypothetical protein CPAR2_600370                    50.8    3e-05   
ref|XP_003871476.1|  Cox12 protein                                    50.8    3e-05   
gb|ESZ90214.1|  cytochrome c oxidase polypeptide VIb                  50.8    3e-05   
gb|KFH65271.1|  cytochrome c oxidase subunit VIb                      50.4    3e-05   
emb|CCX05188.1|  Similar to Cytochrome c oxidase subunit 6B; acc....  50.8    4e-05   
gb|KFH71317.1|  cytochrome c oxidase subunit VIb                      50.4    4e-05   
gb|ACO11927.1|  Cytochrome c oxidase subunit VIb isoform 2            51.6    4e-05   
ref|NP_728294.1|  cytochrome c oxidase subunit VIb, isoform A         50.8    4e-05   
ref|XP_002553881.1|  KLTH0E09350p                                     50.4    4e-05   
gb|KFX86820.1|  hypothetical protein V490_08809                       50.4    4e-05   
gb|ACO12705.1|  Cytochrome c oxidase subunit VIb isoform 2            51.2    4e-05   
gb|ESW99527.1|  cytochrome c oxidase subunit VIb                      50.4    4e-05   
ref|XP_002615198.1|  conserved hypothetical protein                   50.4    5e-05   
gb|KFZ12815.1|  hypothetical protein V502_06919                       50.4    5e-05   
ref|XP_007744691.1|  cytochrome c oxidase subunit 6b                  50.4    5e-05   
emb|CDF88452.1|  BN860_10616g1_1                                      50.1    5e-05   
emb|CEJ80496.1|  Putative Cytochrome c oxidase subunit 6B             50.4    5e-05   
ref|XP_008714934.1|  hypothetical protein HMPREF1541_02357            50.4    5e-05   
ref|XP_003488965.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...  50.4    5e-05   
ref|XP_002965634.1|  hypothetical protein SELMODRAFT_39649            49.7    5e-05   
gb|ELR05726.1|  cytochrome c oxidase subunit VIb                      50.1    5e-05   
ref|XP_002024406.1|  GL14818                                          50.1    5e-05   
gb|EFX84358.1|  hypothetical protein DAPPUDRAFT_230594                50.1    5e-05   
emb|CDS07306.1|  Putative Cytochrome c oxidase subunit 6b             50.1    6e-05   
gb|KEF57864.1|  cytochrome c oxidase subunit 6b                       50.1    6e-05   
emb|CDH49691.1|  cytochrome c oxidase subunit vib                     50.1    6e-05   
gb|EQB53716.1|  hypothetical protein CGLO_06549                       50.4    6e-05   
ref|XP_002057976.1|  GJ15830                                          49.7    7e-05   
emb|CCD34814.1|  similar to cytochrome c oxidase polypeptide vib      49.7    7e-05   
ref|XP_009160788.1|  cytochrome c oxidase subunit VIb                 50.1    7e-05   
gb|EJU04694.1|  cytochrome c oxidase subunit VIb                      49.7    8e-05   
ref|XP_001588942.1|  hypothetical protein SS1G_10490                  49.7    8e-05   
ref|XP_008731981.1|  hypothetical protein G647_09456                  49.7    8e-05   
gb|KFA66669.1|  hypothetical protein S40285_03038                     49.7    9e-05   
ref|XP_001546161.1|  cytochrome c oxidase polypeptide VIb             49.7    9e-05   
ref|XP_004994976.1|  cytochrome c oxidase polypeptide VIb             49.7    9e-05   
emb|CCT67300.1|  probable COX12-cytochrome-c oxidase, subunit VIB     49.7    9e-05   
gb|KFB34820.1|  AGAP006471-PB-like protein                            49.3    1e-04   
ref|XP_007723026.1|  cytochrome c oxidase subunit 6b                  49.7    1e-04   
ref|XP_007273603.1|  cytochrome c oxidase polypeptide vib             49.3    1e-04   
gb|ABI83781.1|  cytochrome c oxidase subunit VIb                      49.3    1e-04   
ref|XP_004346437.1|  cytochrome c oxidase polypeptide vib             49.3    1e-04   
ref|XP_005844675.1|  hypothetical protein CHLNCDRAFT_138570           49.3    1e-04   
ref|XP_006960765.1|  cytochrome c oxidase, subunit VIb                49.3    1e-04   
gb|ENH87830.1|  cytochrome c oxidase polypeptide vib                  49.3    1e-04   
gb|EUC57569.1|  COX6B subunit VIb of cytochrome C oxidase             49.3    1e-04   
ref|XP_001880979.1|  predicted protein                                49.3    1e-04   
gb|EGU76168.1|  hypothetical protein FOXB_13340                       49.3    1e-04   
gb|EMG50114.1|  Cytochrome c oxidase polypeptide VIb, putative        49.3    1e-04   
gb|KGB75864.1|  cytochrome c oxidase subunit 6b                       49.3    1e-04   
ref|XP_006674976.1|  hypothetical protein BATDEDRAFT_8182             49.3    1e-04   
ref|XP_008643509.1|  PREDICTED: uncharacterized protein LOC100192...  50.4    1e-04   
ref|XP_009231415.1|  PREDICTED: cytochrome c oxidase subunit 6B2      49.3    1e-04   
ref|XP_459400.1|  DEHA2E01628p                                        49.3    1e-04   
ref|XP_001653503.1|  cytochrome c oxidase,-subunit VIb, putative      49.3    1e-04   
gb|EMT68539.1|  Cytochrome c oxidase subunit 6B                       49.3    1e-04   
gb|KDE07254.1|  cytochrome c oxidase subunit 6B                       48.9    1e-04   
ref|XP_007823846.1|  cytochrome c oxidase polypeptide VIb             49.3    1e-04   
gb|KID75929.1|  cytochrome c oxidase polypeptide VIb                  49.3    1e-04   
emb|CAN71453.1|  hypothetical protein VITISV_018238                   52.0    1e-04   
gb|KFH48595.1|  Cytochrome c oxidase subunit 6B-like protein          48.9    1e-04   
ref|XP_006961690.1|  predicted protein                                48.9    1e-04   
ref|XP_003682914.1|  hypothetical protein TDEL_0G03360                49.3    1e-04   
ref|XP_504034.1|  YALI0E16709p                                        48.9    1e-04   
gb|EHL01196.1|  putative Cytochrome c oxidase subunit 6B              48.9    1e-04   
ref|XP_003647286.1|  hypothetical protein Ecym_6069                   48.9    1e-04   
ref|XP_002392571.1|  hypothetical protein MPER_07829                  48.9    1e-04   
ref|XP_007812866.1|  cytochrome c oxidase polypeptide VIb             49.3    1e-04   
gb|KID91522.1|  cytochrome c oxidase polypeptide VIb                  49.3    2e-04   
ref|XP_007835668.1|  Cytochrome c oxidase subunit 6B                  48.9    2e-04   
gb|EIF47242.1|  cytochrome c oxidase subunit vib                      48.9    2e-04   
ref|XP_007783359.1|  cytochrome c oxidase subunit 6B                  48.9    2e-04   
gb|KHO02021.1|  Cytochrome c oxidase, subunit VIb                     48.9    2e-04   
ref|XP_003052010.1|  predicted protein                                48.9    2e-04   
ref|XP_003195015.1|  hypothetical protein CGB_F4700C                  48.5    2e-04   
ref|NP_653214.2|  cytochrome c oxidase subunit 6B2                    48.9    2e-04   
ref|XP_009252376.1|  hypothetical protein FPSE_00981                  48.9    2e-04   
ref|XP_007761675.1|  cytochrome c oxidase subunit 6b                  48.9    2e-04   
ref|XP_001995561.1|  GH17817                                          48.5    2e-04   
ref|XP_005097282.1|  PREDICTED: cytochrome c oxidase subunit 6B2-...  49.7    2e-04   
ref|XP_003344954.1|  hypothetical protein SMAC_06731                  48.5    2e-04   
ref|XP_963513.1|  hypothetical protein NCU11339                       48.5    2e-04   
gb|KFM74266.1|  Cytochrome c oxidase subunit 6B1                      48.5    2e-04   
gb|KDN65971.1|  putative cytochrome oxidase c subunit VIb             48.5    2e-04   
ref|XP_006669752.1|  cytochrome c oxidase polypeptide VIb             48.5    2e-04   
gb|EFX06706.1|  cytochrome c oxidase polypeptide vib                  48.5    2e-04   
ref|XP_007716592.1|  hypothetical protein COCCADRAFT_107429           48.5    2e-04   
emb|CCF46925.1|  cytochrome c oxidase subunit 6B                      48.5    2e-04   
gb|EHK24487.1|  hypothetical protein TRIVIDRAFT_185984                48.5    2e-04   
emb|CCO28530.1|  cytochrome c oxidase subunit VIb                     48.5    2e-04   
gb|EHK49022.1|  hypothetical protein TRIATDRAFT_255074                48.5    2e-04   
ref|XP_009229971.1|  cytochrome c oxidase subunit 6B                  48.5    2e-04   
ref|XP_007914822.1|  putative cytochrome c oxidase polypeptide vi...  48.5    2e-04   
ref|XP_010615221.1|  PREDICTED: cytochrome c oxidase subunit 6B2 ...  48.5    2e-04   
ref|XP_007589706.1|  cytochrome c oxidase subunit 6B                  48.5    2e-04   
ref|XP_007635704.1|  PREDICTED: cytochrome c oxidase subunit 6B2      48.5    2e-04   
gb|EFY96844.2|  cytochrome c oxidase polypeptide VIb                  48.5    2e-04   
ref|XP_005084179.1|  PREDICTED: cytochrome c oxidase subunit 6B2-...  48.5    2e-04   
ref|XP_003657724.1|  hypothetical protein THITE_2123681               48.5    2e-04   
ref|XP_003717823.1|  cytochrome c oxidase subunit 6B                  48.5    2e-04   
ref|XP_007699783.1|  hypothetical protein COCSADRAFT_36742            48.5    2e-04   
ref|XP_001653504.1|  cytochrome c oxidase,-subunit VIb, putative      48.5    2e-04   
ref|XP_003807151.1|  PREDICTED: cytochrome c oxidase subunit 6B2      48.5    3e-04   
ref|XP_571555.1|  hypothetical protein CNF01340                       48.1    3e-04   
gb|ENN73614.1|  hypothetical protein YQE_09861                        48.1    3e-04   
ref|XP_007685262.1|  hypothetical protein COCMIDRAFT_87778            48.1    3e-04   
emb|CCH44891.1|  Cytochrome c oxidase subunit VIb isoform 1           48.1    3e-04   
gb|EXU99854.1|  cytochrome c oxidase subunit VIb                      48.1    3e-04   
ref|XP_004204203.1|  Piso0_000031                                     48.1    3e-04   
emb|CDS11818.1|  hypothetical protein LRAMOSA11462                    48.5    3e-04   
ref|XP_007920222.1|  hypothetical protein MYCFIDRAFT_60691            48.1    3e-04   
gb|EFQ30052.1|  cytochrome oxidase c subunit VIb                      48.1    3e-04   
dbj|BAM18074.1|  cytochrome c oxidase,-subunit VIb                    48.1    3e-04   
gb|KDR14446.1|  Cytochrome c oxidase subunit 6B                       48.1    3e-04   
ref|XP_007996346.1|  PREDICTED: cytochrome c oxidase subunit 6B2      48.1    3e-04   
ref|XP_009013960.1|  hypothetical protein HELRODRAFT_75683            48.1    3e-04   
ref|NP_001180312.1|  cytochrome c oxidase subunit 6B2                 48.1    3e-04   
ref|XP_008312477.1|  PREDICTED: cytochrome c oxidase subunit 6B1      48.1    3e-04   
ref|XP_386444.1|  hypothetical protein FG06268.1                      47.8    3e-04   
ref|XP_003666873.1|  hypothetical protein MYCTH_2311966               48.1    3e-04   
ref|XP_004529676.1|  PREDICTED: cytochrome c oxidase subunit 6B2-...  47.8    3e-04   
gb|KEQ80178.1|  cytochrome oxidase c subunit VIb                      48.1    3e-04   
ref|XP_006826853.1|  hypothetical protein AMTR_s00010p00114440        47.8    3e-04   
ref|XP_007734757.1|  cytochrome c oxidase subunit 6b                  48.1    3e-04   
gb|KEQ97623.1|  hypothetical protein AUEXF2481DRAFT_37162             48.1    3e-04   
ref|XP_002838037.1|  hypothetical protein                             47.8    3e-04   
ref|XP_005369386.1|  PREDICTED: cytochrome c oxidase subunit 6B2-...  48.1    4e-04   
emb|CEG63622.1|  Putative Cytochrome c oxidase subunit 6b             47.8    4e-04   
ref|XP_007377513.1|  hypothetical protein SPAPADRAFT_143142           47.8    4e-04   
ref|XP_011107037.1|  hypothetical protein H072_1045                   47.8    4e-04   
ref|XP_002075313.1|  GK15866                                          47.8    4e-04   
ref|XP_003032240.1|  hypothetical protein SCHCODRAFT_85217            47.8    4e-04   
gb|KEQ63297.1|  cytochrome c oxidase, subunit VIb                     47.8    4e-04   
ref|NP_001165815.1|  cytochrome c oxidase subunit 6B1                 47.8    4e-04   
ref|NP_001034174.1|  cytochrome c oxidase subunit 6B2                 47.8    4e-04   
emb|CCC07529.1|  unnamed protein product                              47.8    4e-04   
gb|KDQ15810.1|  hypothetical protein BOTBODRAFT_157549                47.8    4e-04   
ref|XP_005100893.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  47.8    5e-04   
ref|XP_002548465.1|  cytochrome c oxidase polypeptide VIb             47.8    5e-04   
ref|XP_002421184.1|  cytochrome c oxidase polypeptide VIb, putative   47.4    5e-04   
gb|KGQ84406.1|  cytochrome c oxidase subunit 6b                       47.4    5e-04   
gb|EWG43497.1|  cytochrome c oxidase subunit 6b                       47.4    5e-04   
ref|XP_001225575.1|  conserved hypothetical protein                   47.4    5e-04   
gb|EIE75314.1|  hypothetical protein RO3G_00018                       47.4    5e-04   
ref|XP_004529675.1|  PREDICTED: cytochrome c oxidase subunit 6B2-...  47.4    5e-04   
emb|CDP94750.1|  Protein Bm7068, isoform a                            48.5    5e-04   
emb|CCE31178.1|  probable COX12-cytochrome-c oxidase, subunit VIB     47.4    5e-04   
ref|XP_002479382.1|  cytochrome c oxidase polypeptide vib             47.4    5e-04   
ref|XP_007786885.1|  Cytochrome c oxidase subunit 6B                  47.4    5e-04   
ref|NP_899665.1|  cytochrome c oxidase subunit 6B2 isoform 1          47.4    5e-04   
dbj|GAM35182.1|  cytochrome c oxidase polypeptide                     47.4    5e-04   
ref|XP_001899145.1|  cytochrome oxidase c subunit VIb family protein  48.1    5e-04   
gb|EKC39860.1|  Cytochrome c oxidase subunit 6B                       47.4    5e-04   
gb|EHJ78864.1|  hypothetical protein KGM_10332                        47.4    6e-04   
ref|XP_007296937.1|  cytochrome c oxidase polypeptide VIb             47.4    6e-04   
gb|EPE07777.1|  cytochrome c oxidase subunit 6b                       47.4    6e-04   
ref|XP_003707648.1|  PREDICTED: cytochrome c oxidase subunit 6B2-...  47.4    6e-04   
ref|XP_003802955.1|  PREDICTED: cytochrome c oxidase subunit 6B2-...  47.4    6e-04   
gb|KEQ71293.1|  cytochrome c oxidase, subunit VIb                     47.4    6e-04   
ref|XP_755632.1|  cytochrome c oxidase polypeptide vib                47.4    6e-04   
ref|XP_001744850.1|  hypothetical protein                             47.4    6e-04   
gb|EXX69637.1|  cytochrome c oxidase subunit VIb                      47.4    6e-04   
ref|XP_005312125.1|  PREDICTED: spidroin-2                            50.4    6e-04   
ref|XP_007505778.1|  PREDICTED: cytochrome c oxidase subunit 6B2-...  48.5    6e-04   
dbj|GAA95995.1|  hypothetical protein E5Q_02653                       47.4    7e-04   
gb|KEZ43773.1|  hypothetical protein SAPIO_CDS3918                    47.0    7e-04   
gb|EIE83567.1|  hypothetical protein RO3G_08272                       47.0    7e-04   
gb|EXM25876.1|  cytochrome c oxidase subunit 6b                       47.8    7e-04   



>ref|XP_006358609.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Solanum 
tuberosum]
Length=115

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDSKLDAGKKASANAIG  397
            ++A +DPHDKMRGRDVNKVA+GEQ+PRPVH+ GTVS PPPPSSTD   +  +KA ANAI 
Sbjct  2    SSAQVDPHDKMRGRDVNKVAKGEQSPRPVHEFGTVSMPPPPSSTDHLFETEEKAKANAIA  61

Query  396  ERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHED  250
            + IRHCY  F  Y +C++EKG  D+ECEK+ K + SSCPS+WIEKWHE+
Sbjct  62   DEIRHCYACFRSYLKCVEEKGNKDSECEKLEKAFKSSCPSEWIEKWHEE  110



>ref|XP_004245856.2| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Solanum 
lycopersicum]
Length=162

 Score =   156 bits (395),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -2

Query  585  KMSAAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDSKLDAGKKASAN  406
            KMS+A  +DPHDKMR RDVNKVA+GEQAPRPVH+ GTVS PPPPSSTD   +  +KA AN
Sbjct  48   KMSSAQ-VDPHDKMRSRDVNKVAKGEQAPRPVHEFGTVSKPPPPSSTDHLFETEEKAKAN  106

Query  405  AIGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            AI + IR CY  F  Y +C++EKG  D ECEK+   + SSCPS+WIEKWHE+R
Sbjct  107  AIADEIRRCYACFHSYLKCVEEKGNKDLECEKLGNAFKSSCPSEWIEKWHEER  159



>ref|XP_007156616.1| hypothetical protein PHAVU_002G003400g [Phaseolus vulgaris]
 gb|ESW28610.1| hypothetical protein PHAVU_002G003400g [Phaseolus vulgaris]
Length=131

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 84/123 (68%), Gaps = 11/123 (9%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDSKLDAGKKASANAIG  397
            +AA +DPHDKMR RDVNKVARG+QAPRP HQ GTVS PPPPSST +  D   K   + I 
Sbjct  2    SAAQVDPHDKMRARDVNKVARGQQAPRPAHQYGTVSPPPPPSSTHTPGDTNNKEGKSDIS  61

Query  396  E-----------RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHED  250
            E           + RHCY +++EY RCIQ+KG+   EC+K+   + SSCPS+WI +W ++
Sbjct  62   EKGAELAESSDYKTRHCYAKYVEYHRCIQQKGETAPECQKLGTYFRSSCPSEWITEWDKE  121

Query  249  REQ  241
            REQ
Sbjct  122  REQ  124



>ref|XP_006590596.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Glycine 
max]
Length=132

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 84/125 (67%), Gaps = 14/125 (11%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDSKLDAGKKAS-----  412
            +AA +DPHDKMR RDVNKVARGEQAPRP H+ GTVS PPPPSST S +D  +        
Sbjct  2    SAAQVDPHDKMRARDVNKVARGEQAPRPAHEFGTVSPPPPPSSTHS-IDTKRNKKDEKPS  60

Query  411  --------ANAIGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWH  256
                    AN+   + R CY++++EY RCIQ+KG+   +CEK+   + S CP++WI +W 
Sbjct  61   IAENGAELANSTDYKTRQCYVKYVEYNRCIQQKGEKATDCEKLGTHFRSFCPTEWIAEWD  120

Query  255  EDREQ  241
            ++RE+
Sbjct  121  KEREE  125



>ref|XP_002528789.1| cytochrome C oxidase polypeptide vib, putative [Ricinus communis]
 gb|EEF33611.1| cytochrome C oxidase polypeptide vib, putative [Ricinus communis]
Length=133

 Score =   114 bits (284),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 78/125 (62%), Gaps = 13/125 (10%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVS-APPPPSSTDSKLDAGKK------  418
            + A ++PHDKM+ RDVNKVARGEQAPRP H+ G VS  P PP     +L   +       
Sbjct  2    SGAEVEPHDKMKSRDVNKVARGEQAPRPPHEHGHVSKIPSPPVDNKHRLQEDEDEYELED  61

Query  417  ---ASANA---IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWH  256
               A A+A      + RHCY ++LEY +CIQEKGKD  EC K AK Y S CP +W+E+W+
Sbjct  62   PGTAPADARFPSMNQTRHCYTRYLEYHKCIQEKGKDAPECGKFAKYYRSLCPVEWVERWN  121

Query  255  EDREQ  241
            E RE 
Sbjct  122  EQREM  126



>ref|XP_004512202.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Cicer 
arietinum]
Length=127

 Score =   113 bits (283),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 87/119 (73%), Gaps = 7/119 (6%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDS---KLDAGKKASAN  406
            + A +DPHDKMR RDV+KVARGEQAPRP H+ GTVS PPPPSST++   +++  +  + N
Sbjct  2    SGAQMDPHDKMRARDVSKVARGEQAPRPAHEFGTVSPPPPPSSTNNDKKRIEQVETTNNN  61

Query  405  A----IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
                 I  + RHCY ++++Y RCIQ KG++ +ECEKI + + S CP++WI +W ++R++
Sbjct  62   VESPPINYQTRHCYAEYVQYHRCIQHKGENASECEKIGRHFRSMCPTEWITEWDKERKE  120



>gb|KEH27487.1| cytochrome C oxidase, subunit VIb family protein [Medicago truncatula]
Length=133

 Score =   113 bits (283),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 85/125 (68%), Gaps = 13/125 (10%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDSKLDA------GKKA  415
            + A +DPHDKMR RD++KVARGEQAPRP H+ GTVS PPPPSST++  D       G+ A
Sbjct  2    SGAQVDPHDKMRARDLSKVARGEQAPRPPHEFGTVSPPPPPSSTNNTHDIKNNNNKGENA  61

Query  414  SANAIGE-------RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWH  256
                 G        + RHCY++++EY+RCIQ+KG+  NECEKI     S CP++WI +W 
Sbjct  62   RTAENGSESPSNNYQTRHCYVKYVEYQRCIQQKGEKANECEKIGTHLRSMCPTKWISEWD  121

Query  255  EDREQ  241
            ++RE+
Sbjct  122  QEREE  126



>gb|KDP45959.1| hypothetical protein JCGZ_11862 [Jatropha curcas]
Length=138

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 79/129 (61%), Gaps = 18/129 (14%)
 Frame = -2

Query  579  SAAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPP--------------SSTD  442
            S  A ++PH+KMR RDVNKVARGEQAP+P HQ G +   P P              +  +
Sbjct  3    SVGAQVEPHEKMRARDVNKVARGEQAPKPPHQYGHIDKTPSPPIHNKYPHQINNKENEEE  62

Query  441  SKLDAGKKASANA---IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQW  271
              ++AG  A A+       + RHCY ++LEY +CI+EKGKD  ECEK AK Y S CP +W
Sbjct  63   GWVEAGT-APADVRFPTTNQTRHCYTRYLEYHKCIKEKGKDATECEKFAKYYRSFCPDEW  121

Query  270  IEKWHEDRE  244
            IE+W++ RE
Sbjct  122  IERWNDQRE  130



>ref|XP_011084123.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like isoform 
X2 [Sesamum indicum]
Length=113

 Score =   110 bits (275),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 71/106 (67%), Gaps = 5/106 (5%)
 Frame = -2

Query  564  LDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDSKLDAGKKASANA----IG  397
            ++PHDKMRGRDV+KVARGEQAPRP  Q   VS  PPPSST  K++     S       + 
Sbjct  6    VEPHDKMRGRDVSKVARGEQAPRPPQQSPQVSRAPPPSSTTPKVETETTRSLQLKKENLS  65

Query  396  ERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKW  259
             ++R CY  + +Y +CIQEKG +  EC+K+A+ Y S CP +WIEKW
Sbjct  66   NQMRRCYDSYYDYHKCIQEKGTEAQECKKVAEYYKSMCP-EWIEKW  110



>emb|CDP13408.1| unnamed protein product [Coffea canephora]
Length=133

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 79/125 (63%), Gaps = 12/125 (10%)
 Frame = -2

Query  582  MSAAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDSKLD-AGKKASAN  406
            MS  A +DPHDKMR RDVNKVARGEQA RP +    VS  PPP+STD K + AG+K    
Sbjct  1    MSTDAAIDPHDKMRSRDVNKVARGEQASRPPNDHPIVSKAPPPTSTDPKPNKAGEKDDVE  60

Query  405  AIG-----------ERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKW  259
             +G            ++R+C I++ E+ RCI E  +D ++C+K ++ Y + CP +W+EKW
Sbjct  61   DLGAAPADDAPRFTNQLRNCCIRYYEFYRCIMENEEDTSKCDKFSEYYRALCPYEWVEKW  120

Query  258  HEDRE  244
              +RE
Sbjct  121  DVERE  125



>gb|EYU18246.1| hypothetical protein MIMGU_mgv1a016649mg [Erythranthe guttata]
Length=113

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 5/110 (5%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDSKLDAGKKASA----  409
            +A+ ++P +KMR RDVN+VARGEQAPRP  Q   VS  PPPSST +K++     S     
Sbjct  2    SASTVEPQEKMRARDVNRVARGEQAPRPPQQSPPVSRAPPPSSTTTKVETETNRSLQLKK  61

Query  408  NAIGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKW  259
            +    ++R CY  + EY +CIQEKGKD  EC+K+ + Y S CP +WIEKW
Sbjct  62   DNSSNQMRLCYDSYHEYHKCIQEKGKDAQECKKVQEYYKSMCP-EWIEKW  110



>ref|XP_010461103.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Camelina 
sativa]
Length=128

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 74/118 (63%), Gaps = 8/118 (7%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSST---DSKLDAGKKASAN  406
            ++A +DPHDKMR RD++KVARG+QAPRP H PGTVS PP   +T       D G++  + 
Sbjct  2    SSAQMDPHDKMRSRDLSKVARGQQAPRPAHAPGTVSPPPQNEATFRAKRGEDGGQEKDSE  61

Query  405  A-----IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            A     +    RHC+ ++++Y +CI++ G+D N+C  +     S CP + +EKW + R
Sbjct  62   ADERSPVTNETRHCFNRYMQYHKCIEKNGRDANDCNNLRDYVRSMCPEELVEKWEKQR  119



>ref|XP_009107983.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Brassica 
rapa]
Length=128

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 8/118 (7%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSST---DSKLDAGKKASAN  406
            ++A +DPHDKMR RD++KVARG+QAPRP H PGTVS PP   +T       D G++  + 
Sbjct  2    SSAQMDPHDKMRSRDLSKVARGQQAPRPTHAPGTVSPPPQNEATFRAKRGEDGGEETDSA  61

Query  405  -----AIGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
                  + +  RHC+ ++++Y RC++ KG+D N+C  +     + CP   +EKW E R
Sbjct  62   RDELFQVTKETRHCFNRYMQYHRCLEGKGRDANDCNSLRDYVRTMCPETLVEKWEEQR  119



>emb|CDY44662.1| BnaA08g06780D [Brassica napus]
Length=128

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 74/119 (62%), Gaps = 8/119 (7%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSST---DSKLDAGKKASAN  406
            ++A +DPHDKMR RD++KVARG+QAPRP H PGTVS PP   +T       D G++  + 
Sbjct  2    SSAQMDPHDKMRSRDLSKVARGQQAPRPTHAPGTVSPPPQNEATFQAKRGEDGGEETDSA  61

Query  405  A-----IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
                  + +  RHC+ ++++Y RC++ KG+D N+C  +     + CP   +EKW E R+
Sbjct  62   RDELFPVTKETRHCFNRYMQYHRCLEGKGRDANDCNSLRDYVRTMCPETLVEKWEEQRK  120



>gb|KHN34875.1| Putative cytochrome c oxidase subunit 6b-like [Glycine soja]
Length=129

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 82/125 (66%), Gaps = 17/125 (14%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDSKLDAGKKAS-----  412
            +AA +DPHDKMR RDVNKVARGEQAPRP H+ GTVS PPPPSST S +D  +        
Sbjct  2    SAAQVDPHDKMRARDVNKVARGEQAPRPAHEFGTVSPPPPPSSTHS-IDTKRNKKDEKPS  60

Query  411  --------ANAIGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWH  256
                    AN+   + R CY++++E   CIQ+KG+   +CEK+   + S CP++WI +W 
Sbjct  61   IAENGAELANSTDYKTRQCYVKYVE---CIQQKGEKATDCEKLGTHFRSFCPTEWIAEWD  117

Query  255  EDREQ  241
            ++RE+
Sbjct  118  KEREE  122



>ref|XP_010478694.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like isoform 
X1 [Camelina sativa]
Length=128

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 74/118 (63%), Gaps = 8/118 (7%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSST---DSKLDAGKKASAN  406
            ++A +DPHDKMR RD++KVARG+QAPRP H PGTVS PP   +T       + G++  + 
Sbjct  2    SSAQMDPHDKMRSRDLSKVARGQQAPRPAHAPGTVSPPPQNEATFQAKRGEEGGQEKDSE  61

Query  405  A-----IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            A     +    RHC+ ++++Y +CI++ G+D N+C  +     S CP + +EKW + R
Sbjct  62   ADERSPVTNETRHCFNRYMQYHKCIEKNGRDANDCNNLRDYVRSMCPEELVEKWEKQR  119



>ref|NP_174548.1| putative cytochrome c oxidase subunit 6b-like [Arabidopsis thaliana]
 sp|Q9LPJ2.2|CX6BL_ARATH RecName: Full=Putative cytochrome c oxidase subunit 6b-like [Arabidopsis 
thaliana]
 gb|AEE31520.1| putative cytochrome c oxidase subunit 6b-like [Arabidopsis thaliana]
Length=134

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 75/115 (65%), Gaps = 10/115 (9%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSST--DSKLDAGKKASANA  403
            ++A +DPHDKMR RD++KVARG+QAPRP H PGTVS PP   +T    + D+G++  A A
Sbjct  2    SSAQMDPHDKMRSRDISKVARGQQAPRPAHTPGTVSPPPENEATFRAKRGDSGRETDA-A  60

Query  402  IGERI------RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEK-W  259
            + ER       RHC+ +F++Y +CI++ G+D N+C  +     S CP + + K W
Sbjct  61   VEERFPVTNETRHCFNRFMQYHKCIEKNGRDANDCNNLRDYVRSICPEELVSKIW  115



>ref|XP_002891005.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67264.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=151

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 74/122 (61%), Gaps = 11/122 (9%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSST------DSKLDAGKKA  415
            ++A +DPHDKMR RD++KVARG+QAPRP H PGTVS PP   +T      +   ++G++ 
Sbjct  2    SSAQMDPHDKMRSRDISKVARGQQAPRPAHTPGTVSPPPQNEATFRAKRGEDSGESGEEV  61

Query  414  SANA-----IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHED  250
             +       +    RHC+ +F++Y +CI++ G+D  +C  +     S CP   ++KW E 
Sbjct  62   DSTVEKRFPVTNETRHCFNRFMQYNKCIEKNGRDAYDCNNLRDYVRSMCPKDLVDKWEEQ  121

Query  249  RE  244
            R+
Sbjct  122  RK  123



>ref|XP_004148521.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Cucumis 
sativus]
 ref|XP_004163766.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Cucumis 
sativus]
 gb|KGN60435.1| hypothetical protein Csa_3G910720 [Cucumis sativus]
Length=149

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 80/140 (57%), Gaps = 29/140 (21%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGT---------VSAPPPPSSTDSKLDAG  424
            +A+ +DPHDKMR RD++KVARGEQAPRP H+ GT          S P   ++ D   D  
Sbjct  2    SASQIDPHDKMRSRDMSKVARGEQAPRPAHEYGTVSKPPPPSSSSVPSAQTNLDGNDDDR  61

Query  423  KKASAN---------AIG-----------ERIRHCYIQFLEYKRCIQEKGKDDNECEKIA  304
            ++ S +          +G            + RHCY ++LEY RC+Q+KG+   EC+K A
Sbjct  62   RRGSEDRDNKVVMDEGVGTAPSDIRFPFTNQTRHCYARYLEYHRCVQKKGEHAPECKKFA  121

Query  303  KEYTSSCPSQWIEKWHEDRE  244
            K Y S CP +W+EKW+E RE
Sbjct  122  KYYRSLCPGEWVEKWNEQRE  141



>gb|KFK45002.1| hypothetical protein AALP_AA1G331400 [Arabis alpina]
Length=138

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 69/121 (57%), Gaps = 14/121 (12%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDSKLDAGK--------  421
            ++A +DPHDKMR R ++KVARGEQAPRP H PGTVS PP       K  A +        
Sbjct  2    SSAQMDPHDKMRSRGISKVARGEQAPRPAHTPGTVSPPP---ENKPKFRAKRGENNGDGG  58

Query  420  ---KASANAIGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHED  250
                   ++     RHC+ ++++Y +CI++KG D N+C  +     S CP + +EKW E 
Sbjct  59   GGGGRERDSTANETRHCFNRYMQYNKCIEKKGSDANDCNNLRDYVRSLCPEELVEKWEEQ  118

Query  249  R  247
            R
Sbjct  119  R  119



>ref|XP_008229512.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like [Prunus mume]
Length=117

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 73/112 (65%), Gaps = 4/112 (4%)
 Frame = -2

Query  582  MSAAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDSKLDAGKKASANA  403
            MSAA+ +DPH++MR RDVNKVARGEQAPRP H+ G++++ PP         A  K   N 
Sbjct  1    MSAASQIDPHNEMRARDVNKVARGEQAPRPAHEYGSINSAPPKPKPKDPAAAEIKVEDNP  60

Query  402  IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
                 RHCY  +++Y +CI+E+GK   +CE+  K Y   CP +WIE+W E++
Sbjct  61   PA---RHCYASYVQYYKCIKEEGKVP-KCERFEKNYRLLCPVEWIERWDEEQ  108



>ref|XP_008465918.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Cucumis 
melo]
Length=147

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 84/138 (61%), Gaps = 27/138 (20%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPP----------------SST  445
            +A+ +DPHDKMR RDV+KVARGEQAPRP H+ GTVS PPPP                S +
Sbjct  2    SASQIDPHDKMRSRDVSKVARGEQAPRPAHEYGTVSKPPPPSSTSVPSAQTNDDHRRSGS  61

Query  444  DSK-------LDAGKKASANAI----GERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKE  298
            + K       +D G + + + +      + RHCY ++LEY RC+Q+KG+   EC+K A  
Sbjct  62   EDKDKDNKVVMDEGVETAPSDLRFPFTNQTRHCYARYLEYHRCVQKKGEHAPECKKFANY  121

Query  297  YTSSCPSQWIEKWHEDRE  244
            Y S CP +W+EKW+E RE
Sbjct  122  YRSLCPGEWVEKWNEQRE  139



>ref|XP_003559516.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like [Brachypodium 
distachyon]
Length=127

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 69/119 (58%), Gaps = 7/119 (6%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTV-------SAPPPPSSTDSKLDAGKK  418
            A+  ++PHDKMR RDV +VARGEQAPRP H+PG+V               T  +L     
Sbjct  2    ASTVVNPHDKMRARDVGRVARGEQAPRPPHEPGSVDDSPPPPPPAEAEGGTTVELRTAPC  61

Query  417  ASANAIGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
                    + RHCY+++LEY RC++ K  D +EC+K  + Y S CP+ W+ +W+  RE+
Sbjct  62   DFRFPTQNQTRHCYVRYLEYHRCMKAKEGDKSECDKFQRYYRSLCPTDWVVEWNRQREE  120



>gb|AAF25969.1|AC017118_6 F6N18.10 [Arabidopsis thaliana]
Length=304

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 72/109 (66%), Gaps = 9/109 (8%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSST--DSKLDAGKKASANA  403
            ++A +DPHDKMR RD++KVARG+QAPRP H PGTVS PP   +T    + D+G++  A A
Sbjct  2    SSAQMDPHDKMRSRDISKVARGQQAPRPAHTPGTVSPPPENEATFRAKRGDSGRETDA-A  60

Query  402  IGERI------RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQ  274
            + ER       RHC+ +F++Y +CI++ G+D N+C  +     S CP +
Sbjct  61   VEERFPVTNETRHCFNRFMQYHKCIEKNGRDANDCNNLRDYVRSICPEE  109



>ref|XP_007210023.1| hypothetical protein PRUPE_ppa016849mg [Prunus persica]
 gb|EMJ11222.1| hypothetical protein PRUPE_ppa016849mg [Prunus persica]
Length=117

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 72/112 (64%), Gaps = 4/112 (4%)
 Frame = -2

Query  582  MSAAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDSKLDAGKKASANA  403
            MSAA+ +DPH++MR RDVNKVARGEQAPRP H+ G++++ PP         A  K   N 
Sbjct  1    MSAASQVDPHNEMRARDVNKVARGEQAPRPAHEYGSINSAPPKPKPKDPAAAEIKVEDNP  60

Query  402  IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
                 RHCY  +++Y +CI+E+ K   +CE+  K Y   CP +WIE+W E++
Sbjct  61   PA---RHCYASYVQYYKCIKEEDKVP-KCERFEKNYRLLCPVEWIERWDEEQ  108



>ref|XP_010478695.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like isoform 
X2 [Camelina sativa]
Length=140

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 70/113 (62%), Gaps = 8/113 (7%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSST---DSKLDAGKKASAN  406
            ++A +DPHDKMR RD++KVARG+QAPRP H PGTVS PP   +T       + G++  + 
Sbjct  2    SSAQMDPHDKMRSRDLSKVARGQQAPRPAHAPGTVSPPPQNEATFQAKRGEEGGQEKDSE  61

Query  405  A-----IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEK  262
            A     +    RHC+ ++++Y +CI++ G+D N+C  +     S CP + + K
Sbjct  62   ADERSPVTNETRHCFNRYMQYHKCIEKNGRDANDCNNLRDYVRSMCPEELVSK  114



>ref|XP_006415157.1| hypothetical protein EUTSA_v10009443mg [Eutrema salsugineum]
 gb|ESQ33510.1| hypothetical protein EUTSA_v10009443mg [Eutrema salsugineum]
Length=152

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 67/111 (60%), Gaps = 8/111 (7%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSST---DSKLDAGKKASAN  406
            ++A +DP DKMR RD++KVARGEQAPRP H PGTVS PP   +T       D G +   +
Sbjct  2    SSAQMDPRDKMRSRDLSKVARGEQAPRPAHAPGTVSPPPENEATFRAKRGEDGGGETGLS  61

Query  405  A-----IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWI  268
                  +    RHC+ ++++Y  C+++KG+D N+C  + +   S CP + +
Sbjct  62   TDEQFPVNSETRHCFNRYMQYHNCLEDKGRDANDCNHLREYVRSMCPEKLL  112



>ref|XP_010501741.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Camelina 
sativa]
Length=168

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 59/104 (57%), Gaps = 8/104 (8%)
 Frame = -2

Query  531  VNKVARGEQAPRPVHQPGTVSAPPPPSST---DSKLDAGKKASANA-----IGERIRHCY  376
              +VARG+QAPRP H PGTVS PP   +T       D G++  + A     +    RHC+
Sbjct  47   TTQVARGQQAPRPAHAPGTVSPPPQNEATFRAKRGEDGGQEKDSEADERSPVTNETRHCF  106

Query  375  IQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
             ++++Y +CI++ G+D N+C  +     S CP + +E W E R+
Sbjct  107  NRYMQYHKCIEKNGRDANDCNNLRDYVRSMCPKELVETWEEQRK  150



>ref|XP_006304557.1| hypothetical protein CARUB_v10011555mg, partial [Capsella rubella]
 gb|EOA37455.1| hypothetical protein CARUB_v10011555mg, partial [Capsella rubella]
Length=84

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = -2

Query  576  AAAPLDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSST----DSKLDAGKKASA  409
            ++A +DPHDKMR RD++KVARG+QAPRP H PGTVS PP   +T      + D GK+  +
Sbjct  2    SSAQMDPHDKMRSRDLSKVARGQQAPRPAHAPGTVSPPPQNEATFRAKRGEDDGGKEKDS  61

Query  408  NA-----IGERIRHCYIQFLEY  358
             A     +    RHC+ ++++Y
Sbjct  62   EADEMFPVTNETRHCFNRYMQY  83



>ref|XP_011084122.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like isoform 
X1 [Sesamum indicum]
Length=119

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = -2

Query  564  LDPHDKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDSKLDAGKKASANA----IG  397
            ++PHDKMRGRDV+KVARGEQAPRP  Q   VS  PPPSST  K++     S       + 
Sbjct  6    VEPHDKMRGRDVSKVARGEQAPRPPQQSPQVSRAPPPSSTTPKVETETTRSLQLKKENLS  65

Query  396  ERIRHCYIQFLEYKRCIQEKGKD  328
             ++R CY  + +Y +  +++ K+
Sbjct  66   NQMRRCYDSYYDYHKKREQRHKN  88



>ref|XP_009402008.1| PREDICTED: LOW QUALITY PROTEIN: putative cytochrome c oxidase 
subunit 6b-like [Musa acuminata subsp. malaccensis]
Length=91

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -2

Query  564  LDPHDKMRGRDVNKVARGEQAPRPVHQPGTVS-APPPPSSTDSKLDAGKKASANAIGERI  388
            +DPHDKMR RDV +V RG+Q+PRP  + GTVS APPPP +   K+             + 
Sbjct  21   VDPHDKMRSRDVXRVTRGQQSPRPARELGTVSDAPPPPETDVLKIGTAPNDFRFPYTNQT  80

Query  387  RHCYIQFLEYK  355
            RHCY ++LEY+
Sbjct  81   RHCYARYLEYQ  91



>ref|XP_006658829.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Oryza brachyantha]
Length=159

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+D  ECEK AK Y S CPS+WIE+W+E RE 
Sbjct  102  QTRHCFTRYIEYHRCVAAKGEDAPECEKFAKYYRSLCPSEWIERWNEQREN  152



>ref|XP_010534085.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X1 
[Tarenaya hassleriana]
Length=167

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC++ KG+D  EC+K AK Y S CPS+WIE+W+E RE 
Sbjct  110  QTRHCFTRYIEYHRCVEAKGEDAQECDKFAKYYRSLCPSEWIERWNEQREN  160



>ref|XP_010534086.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X2 
[Tarenaya hassleriana]
Length=154

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC++ KG+D  EC+K AK Y S CPS+WIE+W+E RE 
Sbjct  97   QTRHCFTRYIEYHRCVEAKGEDAQECDKFAKYYRSLCPSEWIERWNEQREN  147



>ref|XP_003562686.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Brachypodium 
distachyon]
Length=153

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+D  ECEK AK Y S CPS+W+E+W+E RE 
Sbjct  96   QTRHCFTRYVEYHRCVAAKGEDAPECEKFAKYYRSLCPSEWVERWNEQREN  146



>ref|XP_010521174.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Tarenaya hassleriana]
Length=182

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CPS+W+E+W+E RE 
Sbjct  125  QTRHCFTRYIEYHRCVAAKGEDAQECDKFAKYYRSLCPSEWVERWNEQREN  175



>gb|EMT25976.1| Cytochrome c oxidase subunit 6B [Aegilops tauschii]
Length=162

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG D  ECEK AK Y S CPS+W+E+W+E RE 
Sbjct  105  QTRHCFTRYVEYHRCVAAKGDDAPECEKFAKYYRSLCPSEWVERWNEQREN  155



>dbj|BAJ94958.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG D  ECEK AK Y S CPS+W+E+W+E RE 
Sbjct  110  QTRHCFTRYVEYHRCVAAKGDDAPECEKFAKYYRSLCPSEWVERWNEQREN  160



>gb|KCW71840.1| hypothetical protein EUGRSUZ_E00322 [Eucalyptus grandis]
Length=75

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQHG  235
            RHCY ++LE+ RCIQEKG++  ECEK A+ Y S CPS+WIE+W +D+ +HG
Sbjct  20   RHCYARYLEHIRCIQEKGENAPECEKFARYYRSICPSEWIERW-DDQRKHG  69



>ref|XP_006453502.1| hypothetical protein CICLE_v10010074mg [Citrus clementina]
 ref|XP_006474088.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Citrus sinensis]
 gb|ESR66742.1| hypothetical protein CICLE_v10010074mg [Citrus clementina]
 gb|KDO62351.1| hypothetical protein CISIN_1g034905mg [Citrus sinensis]
Length=79

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG++ NECE+ AK Y S CP  WIEKW+E RE 
Sbjct  22   QTRHCFTRYIEFHRCLAAKGEESNECERFAKYYRSLCPGDWIEKWNEQREN  72



>ref|XP_002454158.1| hypothetical protein SORBIDRAFT_04g025700 [Sorghum bicolor]
 gb|EES07134.1| hypothetical protein SORBIDRAFT_04g025700 [Sorghum bicolor]
Length=77

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG D  +CEK AK Y S CP +W+EKW+E RE
Sbjct  20   QTRHCFTRYVEYHRCVNAKGDDAGDCEKFAKYYRSLCPGEWVEKWNEQRE  69



>gb|AAM92706.1| putative cytochrome c oxidase subunit [Triticum aestivum]
Length=157

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            + RHC+ +++EY RC+  KG D  ECEK AK Y S CPS+W+E+W+E R
Sbjct  100  QTRHCFTRYVEYHRCVAAKGDDAPECEKFAKYYRSLCPSEWVERWNEQR  148



>ref|XP_010274628.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like, partial [Nelumbo 
nucifera]
Length=80

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            RHC+ +++EY RCI+EKG +  ECEK A+ Y S CPS+WI+KW+E RE
Sbjct  25   RHCFARYVEYHRCIREKGDEAPECEKFARYYRSLCPSEWIDKWNEQRE  72



>ref|XP_009349099.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Pyrus x bretschneideri]
Length=77

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            + RHC+ +++E+ RC+  KG++ NECEK AK Y S CP +WIEKW E R
Sbjct  20   QTRHCFTRYIEFHRCVSAKGEESNECEKFAKYYRSLCPGEWIEKWDEQR  68



>ref|XP_011009575.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Populus euphratica]
Length=189

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            + RHC+ +++EY RC+  KG+D +EC+K AK Y S CPS+W+E+W+E R
Sbjct  132  QTRHCFTRYIEYHRCVAAKGEDASECDKFAKYYRSLCPSEWVERWNEQR  180



>ref|XP_010914058.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Elaeis guineensis]
Length=77

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +F+EY +C+  KG+D  EC+K A+ Y S CP +WIEKW+E RE 
Sbjct  20   QTRHCFTRFIEYHKCLNAKGEDAAECQKFARYYRSLCPGEWIEKWNEQREN  70



>ref|XP_010545443.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Tarenaya hassleriana]
Length=78

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RCI  KG++ N+CEK AK Y + CP +W+EKW+E RE 
Sbjct  21   QTRHCFTRYIEFHRCIAAKGEESNDCEKFAKFYRALCPGEWVEKWNEQREN  71



>ref|XP_008444857.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Cucumis melo]
Length=190

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC Q KG+   ECEK AK Y S CPS+W+EKW+E RE
Sbjct  133  QTRHCFTRYIEYHRCTQAKGEGAPECEKFAKYYRSLCPSEWVEKWNEQRE  182



>gb|KHG12789.1| Cytochrome c oxidase subunit 6b-2 -like protein [Gossypium arboreum]
Length=78

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG++ N+CEK AK Y S CP +WI+KW+E RE 
Sbjct  21   QTRHCFTRYIEFHRCLAAKGEESNQCEKFAKYYRSLCPGEWIDKWNEQREN  71



>emb|CDP02891.1| unnamed protein product [Coffea canephora]
Length=77

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG D  ECEK AK Y S CP +W+E+W+E RE 
Sbjct  20   QTRHCFTRYIEFHRCLAAKGDDSGECEKFAKYYRSLCPGEWVERWNEQREN  70



>gb|ABK96664.1| unknown [Populus trichocarpa x Populus deltoides]
Length=189

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            + RHC+ +++EY RC+  KG+D +EC+K AK Y S CPS+W+E+W+E R
Sbjct  132  QTRHCFTRYIEYHRCVAAKGEDASECDKFAKYYRSLCPSEWVERWNEQR  180



>ref|XP_007013954.1| Cytochrome c oxidase subunit 6b [Theobroma cacao]
 gb|EOY31573.1| Cytochrome c oxidase subunit 6b [Theobroma cacao]
Length=80

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG++ NECE+ AK Y S CP +W+E+W+E RE 
Sbjct  23   QTRHCFTRYIEFHRCLAAKGEESNECERFAKYYRSLCPGEWVERWNEQREN  73



>ref|XP_002307362.1| cytochrome c oxidase 6b family protein [Populus trichocarpa]
 gb|EEE94358.1| cytochrome c oxidase 6b family protein [Populus trichocarpa]
Length=189

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            + RHC+ +++EY RC+  KG+D +EC+K AK Y S CPS+W+E+W+E R
Sbjct  132  QTRHCFTRYIEYHRCVAAKGEDASECDKFAKYYRSLCPSEWVERWNEQR  180



>ref|XP_008360325.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Malus domestica]
Length=77

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            + RHC+ +++E+ RC+  KG++ NECEK AK Y S CP +WIEKW E R
Sbjct  20   QTRHCFSRYIEFHRCVSAKGEESNECEKFAKYYRSLCPGEWIEKWEEQR  68



>gb|ABK92629.1| unknown [Populus trichocarpa]
Length=189

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            + RHC+ +++EY RC+  KG+D +EC+K AK Y S CPS+W+E+W+E R
Sbjct  132  QTRHCFTRYIEYHRCVAAKGEDASECDKFAKYYRSLCPSEWVERWNEQR  180



>ref|XP_002325099.1| hypothetical protein POPTR_0018s10890g [Populus trichocarpa]
 ref|XP_011018099.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Populus euphratica]
 ref|XP_011015150.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Populus euphratica]
 gb|ABK93801.1| unknown [Populus trichocarpa]
 gb|EEF03664.1| hypothetical protein POPTR_0018s10890g [Populus trichocarpa]
Length=78

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG + N+CE+ AK Y S CPS+W+E+W+E RE 
Sbjct  21   QTRHCFTRYIEFHRCVAAKGDEGNDCERFAKYYRSLCPSEWVERWNEQREN  71



>ref|XP_004958350.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Setaria italica]
Length=178

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG+   ECEK AK Y S CPS+WIE+W+E RE
Sbjct  121  QTRHCFTRYIEYHRCVAAKGEGAPECEKFAKYYRSLCPSEWIERWNEQRE  170



>ref|XP_008223569.1| PREDICTED: cytochrome c oxidase subunit 6b-2 isoform X2 [Prunus 
mume]
Length=77

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+  KG++ NECE+ AK Y S CP +WIE+W E RE 
Sbjct  22   RHCFTRYIEFHRCVAAKGEESNECERFAKYYRSLCPGEWIERWDEQREN  70



>ref|XP_008223568.1| PREDICTED: cytochrome c oxidase subunit 6b-2 isoform X1 [Prunus 
mume]
Length=78

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+  KG++ NECE+ AK Y S CP +WIE+W E RE 
Sbjct  23   RHCFTRYIEFHRCVAAKGEESNECERFAKYYRSLCPGEWIERWDEQREN  71



>ref|XP_007225925.1| hypothetical protein PRUPE_ppa012107mg [Prunus persica]
 gb|EMJ27124.1| hypothetical protein PRUPE_ppa012107mg [Prunus persica]
Length=183

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CP +WIE+W+E RE 
Sbjct  126  QTRHCFTRYVEYHRCVAAKGEDAPECDKFAKFYRSLCPGEWIERWNEQREN  176



>ref|XP_007226359.1| hypothetical protein PRUPE_ppa022392mg, partial [Prunus persica]
 gb|EMJ27558.1| hypothetical protein PRUPE_ppa022392mg, partial [Prunus persica]
Length=119

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+  KG++ NECE+ AK Y S CP +WIE+W E RE 
Sbjct  64   RHCFTRYIEFHRCVAAKGEESNECERFAKYYRSLCPGEWIERWAEQREN  112



>ref|XP_004953063.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Setaria italica]
Length=77

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG D  +C+K AK Y S CP +W+EKW+E RE 
Sbjct  20   QTRHCFTRYVEYHRCVNAKGDDAGDCDKFAKYYRSLCPGEWVEKWNEQREN  70



>ref|XP_009413575.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Musa acuminata 
subsp. malaccensis]
Length=175

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RCI  KG+D +EC K AK Y S CP +W+E+W+E RE
Sbjct  118  QTRHCFTRYIEYHRCIAAKGEDASECNKFAKYYRSLCPGEWVERWNEQRE  167



>dbj|BAC10187.1| putative cytochrome c oxidase subunit 6b-1 [Oryza sativa Japonica 
Group]
Length=174

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   ECEK AK Y S CPS+WIE+W+E RE 
Sbjct  117  QTRHCFTRYIEYHRCVAAKGEGAPECEKFAKYYRSLCPSEWIERWNEQREN  167



>ref|XP_004976105.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like [Setaria italica]
Length=77

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG    ECEK AK Y S CP +W+EKW+E RE
Sbjct  20   QTRHCFTRYIEYHRCVNAKGDGTAECEKFAKYYRSLCPGEWVEKWNEQRE  69



>ref|XP_010268397.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Nelumbo nucifera]
Length=78

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+Q KG++  ECE+ A+ Y S CP +WIE+W+E RE 
Sbjct  23   RHCFTRYIEFHRCLQAKGEESGECERFARYYRSLCPGEWIERWNEQREN  71



>ref|XP_006284746.1| hypothetical protein CARUB_v10006010mg [Capsella rubella]
 gb|EOA17644.1| hypothetical protein CARUB_v10006010mg [Capsella rubella]
Length=133

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++E+ RC   KG+D NECE+ AK Y + CP +W++KW+E RE
Sbjct  76   QTRHCFTRYIEFHRCTTAKGEDSNECERFAKYYRALCPGEWVDKWNEQRE  125



>ref|XP_008678787.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Zea mays]
 gb|ACG28095.1| cytochrome c oxidase polypeptide VIb [Zea mays]
 gb|ACG30732.1| cytochrome c oxidase polypeptide VIb [Zea mays]
 gb|ACG30819.1| cytochrome c oxidase polypeptide VIb [Zea mays]
 gb|ACG30838.1| cytochrome c oxidase polypeptide VIb [Zea mays]
 gb|ACG32533.1| cytochrome c oxidase polypeptide VIb [Zea mays]
 gb|ACG45178.1| cytochrome c oxidase polypeptide VIb [Zea mays]
 gb|AFW62925.1| cytochrome c oxidase polypeptide VIb isoform 1 [Zea mays]
 gb|AFW62926.1| cytochrome c oxidase polypeptide VIb isoform 2 [Zea mays]
Length=77

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQHG  235
            + RHC+ +++EY RC+  KG D   CEK AK Y S CP +W+EKW+E RE HG
Sbjct  20   QTRHCFTRYVEYHRCLNAKGDDAGVCEKFAKYYRSLCPGEWVEKWNEQRE-HG  71



>ref|XP_002463195.1| hypothetical protein SORBIDRAFT_02g039590 [Sorghum bicolor]
 gb|EER99716.1| hypothetical protein SORBIDRAFT_02g039590 [Sorghum bicolor]
Length=216

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   ECEK AK Y S CPS+WIE+W+E RE 
Sbjct  159  QTRHCFTRYIEYHRCVAAKGEGAPECEKFAKYYRSLCPSEWIERWNEQREN  209



>ref|XP_002867470.1| hypothetical protein ARALYDRAFT_913717 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010433266.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Camelina sativa]
 ref|XP_010438509.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Camelina sativa]
 ref|XP_010448036.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Camelina sativa]
 gb|EFH43729.1| hypothetical protein ARALYDRAFT_913717 [Arabidopsis lyrata subsp. 
lyrata]
Length=78

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++E+ RC   KG+D NECE+ AK Y + CP +W++KW+E RE
Sbjct  21   QTRHCFTRYIEFHRCTTAKGEDSNECERFAKYYRALCPGEWVDKWNEQRE  70



>ref|XP_004152624.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Cucumis sativus]
 ref|XP_004162224.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Cucumis sativus]
 gb|KGN62709.1| hypothetical protein Csa_2G369100 [Cucumis sativus]
Length=195

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++E+ RC Q KG+   ECEK AK Y S CPS+W+EKW+E RE
Sbjct  138  QTRHCFTRYIEFHRCTQAKGEGAPECEKFAKYYRSLCPSEWVEKWNEQRE  187



>ref|XP_009110136.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like [Brassica rapa]
Length=118

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQHG  235
            + RHC+ +++EY RC+  KG D  EC+K AK Y S CPS+W+++W+E RE HG
Sbjct  61   QTRHCFTRYIEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVDRWNEQRE-HG  112



>ref|XP_008386123.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Malus domestica]
Length=179

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RCI  KG+D  EC+K AK Y S CP +W+E+W+E RE 
Sbjct  122  QTRHCFTRYIEYHRCIAAKGEDAPECDKFAKFYRSLCPGEWVERWNEQREN  172



>ref|XP_006412997.1| hypothetical protein EUTSA_v10026527mg [Eutrema salsugineum]
 gb|ESQ54450.1| hypothetical protein EUTSA_v10026527mg [Eutrema salsugineum]
Length=138

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            RHC+ +++E+ RC   KG+D NECE+ AK Y + CP +W++KW+E RE
Sbjct  83   RHCFTRYIEFHRCTTAKGEDSNECERFAKYYRALCPGEWVDKWNEQRE  130



>gb|EYU34304.1| hypothetical protein MIMGU_mgv1a025239mg, partial [Erythranthe 
guttata]
Length=74

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++E+ RC+  KG+D  +C+K AK Y S CP +W+EKW+E RE
Sbjct  17   QTRHCFTRYIEFHRCVTAKGEDSGDCDKFAKYYRSLCPGEWVEKWNEQRE  66



>ref|XP_007141211.1| hypothetical protein PHAVU_008G176600g [Phaseolus vulgaris]
 gb|ESW13205.1| hypothetical protein PHAVU_008G176600g [Phaseolus vulgaris]
Length=177

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG+D +EC+K AK Y S CP +WI++W+E RE
Sbjct  120  QTRHCFTRYIEYHRCVAAKGEDASECDKFAKYYRSLCPGEWIDRWNEQRE  169



>ref|XP_011016796.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Populus euphratica]
Length=183

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+  +EC+K AK Y S CPS+W+E+W+E RE 
Sbjct  126  QTRHCFTRYIEYHRCVAAKGEGASECDKFAKYYRSLCPSEWVERWNEQREN  176



>ref|NP_001053212.1| Os04g0498200 [Oryza sativa Japonica Group]
 ref|XP_006652475.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Oryza brachyantha]
 dbj|BAB12275.1| cytochrome c oxidase subunit 6b [Oryza sativa Japonica Group]
 dbj|BAB12339.1| cytochrome c oxidase subunit 6b [Oryza sativa Japonica Group]
 emb|CAD41243.2| OSJNBa0067K08.22 [Oryza sativa Japonica Group]
 emb|CAC09495.2| H0711G06.1 [Oryza sativa Indica Group]
 dbj|BAF15126.1| Os04g0498200 [Oryza sativa Japonica Group]
 emb|CAH67519.1| OSIGBa0092E01.14 [Oryza sativa Indica Group]
 dbj|BAG99190.1| unnamed protein product [Oryza sativa Japonica Group]
Length=77

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   +CEK AK Y S CP++W+EKW+E RE 
Sbjct  20   QTRHCFTRYIEYHRCVNAKGEATADCEKFAKYYRSLCPAEWVEKWNEQREN  70



>ref|XP_010278031.1| PREDICTED: cytochrome c oxidase subunit 6b-2 isoform X2 [Nelumbo 
nucifera]
Length=78

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+Q KG++  EC+K A+ Y S CP +WIE+W+E RE 
Sbjct  23   RHCFTRYIEFHRCLQAKGEESGECDKFARYYRSLCPGEWIERWNEQREN  71



>gb|ACG47964.1| cytochrome c oxidase subunit [Zea mays]
Length=166

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CP +W+E+W+E RE 
Sbjct  109  QTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVERWNEQREN  159



>ref|XP_010535301.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome c oxidase subunit 
6b-1 [Tarenaya hassleriana]
Length=178

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG+   EC+K AK Y S CPS+W+E+W+E RE
Sbjct  121  QTRHCFTRYIEYHRCVAAKGEGAEECDKFAKYYRSLCPSEWVERWNEQRE  170



>gb|EEC82467.1| hypothetical protein OsI_26908 [Oryza sativa Indica Group]
Length=190

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   ECEK AK Y S CPS+WIE+W+E RE 
Sbjct  133  QTRHCFTRYIEYHRCVAAKGEGAPECEKFAKYYRSLCPSEWIERWNEQREN  183



>ref|NP_001140389.1| uncharacterized protein LOC100272443 [Zea mays]
 gb|ACF83724.1| unknown [Zea mays]
Length=166

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CP +W+E+W+E RE 
Sbjct  109  QTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVERWNEQREN  159



>ref|NP_194535.2| cytochrome c oxidase, subunit 6b [Arabidopsis thaliana]
 sp|Q9SUD3.2|CX6B3_ARATH RecName: Full=Cytochrome c oxidase subunit 6b-3; Short=AtCOX6b-3 
[Arabidopsis thaliana]
 gb|AEE85432.1| cytochrome c oxidase, subunit 6b [Arabidopsis thaliana]
Length=78

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++E+ RC   KG+D NECE+ AK Y + CP +W++KW+E RE
Sbjct  21   QTRHCFTRYIEFHRCTTAKGEDANECERFAKYYRALCPGEWVDKWNEQRE  70



>gb|KHG12868.1| Cytochrome c oxidase subunit 6b-1 -like protein [Gossypium arboreum]
Length=184

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+D +EC+K AK Y + CP +WI++W+E RE 
Sbjct  127  QTRHCFTRYIEYHRCVAAKGEDASECDKFAKYYRALCPGEWIDRWNEQREN  177



>ref|XP_010929208.1| PREDICTED: cytochrome c oxidase subunit 6b-3 isoform X1 [Elaeis 
guineensis]
Length=77

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY +C+  KG+D +EC+K A+ Y S CP +W+EKW+E RE 
Sbjct  20   QTRHCFTRYIEYHKCLNAKGEDASECQKFARYYRSLCPMEWVEKWNEQREN  70



>emb|CDX91679.1| BnaC08g05980D [Brassica napus]
Length=114

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG D  EC+K AK Y S CPS+W+++W+E RE 
Sbjct  57   QTRHCFTRYIEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVDRWNEQREN  107



>ref|XP_010278032.1| PREDICTED: cytochrome c oxidase subunit 6b-2 isoform X3 [Nelumbo 
nucifera]
Length=78

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+Q KG++  EC+K A+ Y S CP +WIE+W+E RE 
Sbjct  23   RHCFTRYIEFHRCLQAKGEESGECDKFARYYRSLCPGEWIERWNEQREN  71



>ref|XP_006650155.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Oryza brachyantha]
Length=166

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CP +W+E+W+E RE 
Sbjct  109  QTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVERWNEQREN  159



>ref|XP_010498713.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Camelina sativa]
Length=191

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG D  EC+K AK Y S CPS+W+++W+E RE 
Sbjct  134  QTRHCFTRYIEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVDRWNEQREN  184



>ref|NP_001050275.1| Os03g0390400 [Oryza sativa Japonica Group]
 dbj|BAA76393.1| cytochrome c oxidase subunit 6b-1 [Oryza sativa Japonica Group]
 dbj|BAB12338.1| cytochrome c oxidase subunit 6b [Oryza sativa Japonica Group]
 gb|AAR06368.1| cytochrome c oxidase subunit 6b-1 [Oryza sativa Japonica Group]
 gb|ABF96356.1| Cytochrome c oxidase subunit, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12189.1| Os03g0390400 [Oryza sativa Japonica Group]
 gb|EAZ27178.1| hypothetical protein OsJ_11115 [Oryza sativa Japonica Group]
 dbj|BAG99900.1| unnamed protein product [Oryza sativa Japonica Group]
Length=169

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CP +W+E+W+E RE
Sbjct  112  QTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVERWNEQRE  161



>ref|XP_003557780.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Brachypodium 
distachyon]
Length=172

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            RHC+ +++EY RC+  KG+D +EC+K AK Y S CP +W+++W+E RE
Sbjct  117  RHCFTRYVEYHRCVAAKGEDASECDKFAKYYRSLCPGEWVDRWNEQRE  164



>ref|XP_010459999.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Camelina sativa]
Length=191

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG D  EC+K AK Y S CPS+W+++W+E RE
Sbjct  134  QTRHCFTRYIEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVDRWNEQRE  183



>ref|XP_010025934.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Eucalyptus grandis]
 gb|KCW83080.1| hypothetical protein EUGRSUZ_B00038 [Eucalyptus grandis]
Length=195

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RCI  KG+D  EC+K +K Y S CP +WI++W+E RE 
Sbjct  138  QTRHCFTRYVEYHRCIAAKGEDAQECQKFSKYYRSLCPGEWIDRWNEQREN  188



>emb|CDY41480.1| BnaA08g20820D [Brassica napus]
Length=118

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG D  EC+K AK Y S CPS+W+++W+E RE 
Sbjct  61   QTRHCFTRYIEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVDRWNEQREN  111



>gb|EEC75393.1| hypothetical protein OsI_11877 [Oryza sativa Indica Group]
Length=185

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CP +W+E+W+E RE
Sbjct  128  QTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVERWNEQRE  177



>ref|XP_003580071.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Brachypodium distachyon]
Length=77

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG++  +CEK AK Y S CP++W++KW+E RE 
Sbjct  20   QTRHCFTRYVEYHRCVNAKGEETADCEKFAKYYRSLCPAEWVDKWNEQREN  70



>gb|AAM63485.1| cytochrome c oxidase subunit, putative [Arabidopsis thaliana]
Length=191

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG D  EC+K AK Y S CPS+W+++W+E RE
Sbjct  133  QTRHCFTRYVEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVDRWNEQRE  182



>gb|KHN17535.1| Cytochrome c oxidase subunit 6b-1 [Glycine soja]
Length=77

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+  KG++  ECE+ AK Y S CP +W+E+W+E RE 
Sbjct  22   RHCFTRYIEFHRCLAAKGENSGECERFAKYYRSLCPGEWVERWNEQREN  70



>ref|XP_003542317.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Glycine max]
Length=77

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            RHC+ +++E+ RC+  KG++  ECE+ AK Y S CP +W+E+W+E RE
Sbjct  22   RHCFTRYIEFHRCLAAKGENSGECERFAKYYRSLCPGEWVERWNEQRE  69



>gb|ACG48101.1| cytochrome c oxidase subunit [Zea mays]
Length=162

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CP +W+E+W+E RE 
Sbjct  105  QTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVERWNEQREN  155



>ref|NP_173661.1| cytochrome C oxidase 6B [Arabidopsis thaliana]
 sp|Q9S7L9.1|CX6B1_ARATH RecName: Full=Cytochrome c oxidase subunit 6b-1; Short=AtCOX6b-1 
[Arabidopsis thaliana]
 gb|AAF18532.1|AC006551_18 Subunit 6b of cytochrome c oxidase [Arabidopsis thaliana]
 dbj|BAA87883.1| subunit 6b of cytochrome c oxidase [Arabidopsis thaliana]
 gb|AAL36353.1| putative cytochrome c oxidase subunit [Arabidopsis thaliana]
 gb|AAM20330.1| putative cytochrome c oxidase subunit [Arabidopsis thaliana]
 gb|AEE30243.1| cytochrome C oxidase 6B [Arabidopsis thaliana]
Length=191

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG D  EC+K AK Y S CPS+W+++W+E RE
Sbjct  133  QTRHCFTRYVEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVDRWNEQRE  182



>ref|XP_002890515.1| hypothetical protein ARALYDRAFT_889753 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66774.1| hypothetical protein ARALYDRAFT_889753 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG D  EC+K AK Y S CPS+W+++W+E RE
Sbjct  134  QTRHCFTRYIEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVDRWNEQRE  183



>ref|XP_008658230.1| PREDICTED: uncharacterized protein LOC100272443 isoform X4 [Zea 
mays]
Length=162

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CP +W+E+W+E RE 
Sbjct  105  QTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVERWNEQREN  155



>ref|XP_003549519.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Glycine max]
Length=77

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+  KG++  ECE+ AK Y S CP +W+E+W+E RE 
Sbjct  22   RHCFTRYIEFHRCLAAKGENSGECERFAKYYRSLCPGEWVERWNEQREN  70



>gb|EAZ40696.1| hypothetical protein OsJ_25165 [Oryza sativa Japonica Group]
Length=255

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   ECEK AK Y S CPS+WIE+W+E RE 
Sbjct  198  QTRHCFTRYIEYHRCVAAKGEGAPECEKFAKYYRSLCPSEWIERWNEQREN  248



>gb|ACF79897.1| unknown [Zea mays]
 gb|ACG26229.1| cytochrome c oxidase subunit [Zea mays]
 gb|ACG36966.1| cytochrome c oxidase subunit [Zea mays]
 tpg|DAA45623.1| TPA: cytochrome c oxidase subunit [Zea mays]
Length=172

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CP +W+++W+E RE 
Sbjct  115  QTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVDRWNEQREN  165



>ref|XP_010483320.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483321.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483322.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483323.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483324.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483325.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483326.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483327.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483328.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
Length=83

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++E+ RC   KG++ N+CE+ AK Y + CP +W+EKW+E RE
Sbjct  26   QTRHCFTRYIEFHRCTTAKGEESNDCERFAKYYRALCPGEWVEKWNEQRE  75



>ref|NP_001131473.1| hypothetical protein [Zea mays]
 gb|ACG26280.1| cytochrome c oxidase subunit [Zea mays]
Length=172

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CP +W+++W+E RE 
Sbjct  115  QTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVDRWNEQREN  165



>ref|XP_002271982.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Vitis vinifera]
 emb|CBI36604.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG++  +CEK AK Y S CP +WIEKW+E RE 
Sbjct  20   QTRHCFTRYIEFHRCLAAKGEESGDCEKFAKYYRSLCPVEWIEKWNEQREN  70



>ref|XP_006433933.1| hypothetical protein CICLE_v10002573mg [Citrus clementina]
 gb|ESR47173.1| hypothetical protein CICLE_v10002573mg [Citrus clementina]
Length=192

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   EC+K AK Y + CPS WIEKW+E RE 
Sbjct  135  QTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRALCPSDWIEKWNEQREN  185



>gb|KFM23023.1| Cytochrome c oxidase subunit 6B [Auxenochlorella protothecoides]
Length=117

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -2

Query  402  IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            I  + RHCY+ + E  RC Q+KG++D+EC+++AK Y S CP +W+E+W+E RE
Sbjct  61   ITNQSRHCYVAYCEAHRCFQQKGEEDSECQRLAKVYRSICPVEWLEQWNEARE  113



>emb|CDP01101.1| unnamed protein product [Coffea canephora]
Length=194

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RCI  KG+  +EC+K AK Y S CP +WI++W+E RE 
Sbjct  137  QTRHCFTRYIEYHRCIAAKGEGASECQKFAKYYRSLCPGEWIDRWNEQREN  187



>gb|ACU17340.1| unknown [Glycine max]
Length=77

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+  KG++  ECE+ AK Y S CP +W+E+W+E RE 
Sbjct  22   RHCFTRYIEFHRCLVAKGENSGECERFAKYYRSLCPGEWVERWNEQREN  70



>ref|XP_006472562.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Citrus sinensis]
 gb|KDO81039.1| hypothetical protein CISIN_1g029538mg [Citrus sinensis]
Length=192

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   EC+K AK Y + CPS WIEKW+E RE 
Sbjct  135  QTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRALCPSDWIEKWNEQREN  185



>ref|XP_008658229.1| PREDICTED: uncharacterized protein LOC100272443 isoform X3 [Zea 
mays]
Length=187

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CP +W+E+W+E RE 
Sbjct  130  QTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVERWNEQREN  180



>ref|XP_010916711.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X2 
[Elaeis guineensis]
Length=159

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY +C+  KG+   ECEK AK Y S CPS+WIE+W+E RE
Sbjct  102  QTRHCFTRYIEYHKCVAAKGEGAPECEKFAKYYRSLCPSEWIERWNEQRE  151



>emb|CDY19008.1| BnaC01g20600D [Brassica napus]
Length=98

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            RHC+ +++E+ RC   KG+D N+CE+ AK Y + CP +W++KW+E RE
Sbjct  43   RHCFTRYIEFHRCTTAKGEDSNDCERFAKYYRALCPGEWVDKWNEQRE  90



>ref|XP_004984149.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X2 
[Setaria italica]
Length=167

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CP +W+++W+E RE 
Sbjct  110  QTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVDRWNEQREN  160



>ref|XP_010047036.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Eucalyptus grandis]
 gb|KCW78786.1| hypothetical protein EUGRSUZ_C00220 [Eucalyptus grandis]
Length=77

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++E+ RCI  KG++  +CEK AK Y S CP +W++KW+E RE
Sbjct  20   QTRHCFTRYIEFHRCIAAKGEESGDCEKFAKYYRSLCPGEWVDKWNEQRE  69



>gb|ABK95863.1| unknown [Populus trichocarpa]
Length=183

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            + RHC+ +++EY RC+  KG+  +EC+K AK Y S CPS+W+E+W+E R
Sbjct  126  QTRHCFTRYIEYHRCVAAKGEGASECDKFAKYYRSLCPSEWVERWNEQR  174



>emb|CDX92861.1| BnaC07g41190D [Brassica napus]
Length=175

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            RHC+ +++E+ RC   KG+D N+CE+ AK Y + CP +W++KW+E RE
Sbjct  120  RHCFTRYIEFHRCTTAKGEDSNDCERFAKYYRALCPGEWVDKWNEQRE  167



>ref|XP_010916710.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X1 
[Elaeis guineensis]
Length=164

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY +C+  KG+   ECEK AK Y S CPS+WIE+W+E RE
Sbjct  107  QTRHCFTRYIEYHKCVAAKGEGAPECEKFAKYYRSLCPSEWIERWNEQRE  156



>ref|XP_004490381.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Cicer arietinum]
Length=176

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CP +WI++W+E RE
Sbjct  119  QTRHCFTRYIEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWIDRWNEQRE  168



>ref|XP_010278029.1| PREDICTED: cytochrome c oxidase subunit 6b-2 isoform X1 [Nelumbo 
nucifera]
Length=137

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+Q KG++  EC+K A+ Y S CP +WIE+W+E RE 
Sbjct  82   RHCFTRYIEFHRCLQAKGEESGECDKFARYYRSLCPGEWIERWNEQREN  130



>ref|XP_007154837.1| hypothetical protein PHAVU_003G151900g [Phaseolus vulgaris]
 gb|ESW26831.1| hypothetical protein PHAVU_003G151900g [Phaseolus vulgaris]
Length=77

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++E+ RC+  KG +  EC+K AK Y S CP +W++KW+E RE
Sbjct  20   QTRHCFTRYIEFHRCLAAKGDNSGECQKFAKYYRSLCPGEWVDKWNEQRE  69



>gb|EPS59241.1| hypothetical protein M569_15568, partial [Genlisea aurea]
Length=139

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG +  EC+K AK Y S CP +W+EKW+E RE
Sbjct  82   QTRHCFTRYIEYHRCVAAKGDEAPECQKFAKYYRSLCPGEWVEKWNEQRE  131



>ref|XP_007018715.1| Cytochrome C oxidase polypeptide vib, putative [Theobroma cacao]
 gb|EOY15940.1| Cytochrome C oxidase polypeptide vib, putative [Theobroma cacao]
Length=187

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   EC+K AK Y S CP +WI++W+E RE 
Sbjct  130  QTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRSLCPGEWIDRWNEQREN  180



>ref|XP_008219336.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Prunus mume]
Length=183

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   EC+K AK Y S CP +WIE+W+E RE 
Sbjct  126  QTRHCFTRYVEYHRCVAAKGEGAPECDKFAKFYRSLCPGEWIERWNEQREN  176



>ref|XP_010539459.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform X1 
[Tarenaya hassleriana]
Length=78

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RCI  KG++ N+C K AK Y + CP +W+E+W+E RE 
Sbjct  21   QTRHCFTRYIEFHRCIAAKGEESNDCGKFAKFYRALCPGEWVERWNEQREN  71



>ref|XP_009409166.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409167.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409168.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Musa acuminata 
subsp. malaccensis]
Length=168

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            + RHC+ +++EY RCI  KG+   EC+K AK Y S CPS+WIE+W+E R
Sbjct  111  QTRHCFTRYIEYHRCIAAKGEGAPECDKFAKYYRSLCPSEWIERWNEQR  159



>ref|XP_010675986.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Beta vulgaris subsp. 
vulgaris]
Length=180

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC   KG+D  EC+K AK Y S CP +W+++W+E RE 
Sbjct  123  QTRHCFTRYIEYHRCTAAKGEDAPECDKFAKFYRSLCPGEWVDRWNEQREN  173



>ref|XP_009103236.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Brassica rapa]
Length=175

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG D  EC+K +K Y S CP +W++KW+E RE 
Sbjct  118  QTRHCFTRYIEYHRCVAAKGDDAPECDKFSKFYRSLCPGEWVDKWNEQREN  168



>ref|XP_010539460.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform X2 
[Tarenaya hassleriana]
Length=77

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RCI  KG++ N+C K AK Y + CP +W+E+W+E RE 
Sbjct  22   RHCFTRYIEFHRCIAAKGEESNDCGKFAKFYRALCPGEWVERWNEQREN  70



>ref|XP_004309856.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Fragaria vesca 
subsp. vesca]
Length=77

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++E+ RC+  KG++  ECE+ +K Y S CP +W+EKW+E RE
Sbjct  20   QTRHCFTRYIEFHRCLAAKGEESAECERFSKYYRSLCPGEWVEKWNEQRE  69



>gb|KEH32587.1| cytochrome C oxidase, subunit VIb family protein [Medicago truncatula]
Length=82

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+  KG++  ECEK AK Y S CP +W++KW+E R+ 
Sbjct  27   RHCFTRYIEFHRCMTVKGENSGECEKFAKYYRSLCPGEWVDKWNEQRDN  75



>ref|XP_008794399.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like [Phoenix dactylifera]
Length=77

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY +C+  KG+D  EC+K A+ Y S CP +W+E+W+E RE 
Sbjct  20   QTRHCFTRYIEYHKCLNAKGEDAAECQKFARYYRSLCPVEWVERWNEQREN  70



>emb|CDY46649.1| BnaA07g10470D [Brassica napus]
Length=185

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG D  EC+K +K Y S CP +W++KW+E RE 
Sbjct  128  QTRHCFTRYIEYHRCVAAKGDDAPECDKFSKFYRSLCPGEWVDKWNEQREN  178



>gb|AFK38546.1| unknown [Lotus japonicus]
Length=77

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+  KG++  ECE+ AK Y S CP +W+EKW+E R+ 
Sbjct  22   RHCFTRYIEFHRCLAVKGEESGECERFAKYYRSLCPGEWVEKWNEQRDN  70



>ref|XP_010103131.1| Cytochrome c oxidase subunit 6b-1 [Morus notabilis]
 gb|EXB94896.1| Cytochrome c oxidase subunit 6b-1 [Morus notabilis]
Length=129

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+  KG++  ECEK A+ Y S CP +W+EKW+E RE 
Sbjct  22   RHCFTRYIEFHRCLAAKGEESGECEKFARYYRSLCPGEWVEKWNEQREN  70



>ref|XP_010477504.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Camelina sativa]
Length=191

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG +  EC+K AK Y S CPS+W+++W+E RE 
Sbjct  134  QTRHCFTRYIEYHRCVAAKGDEAPECDKFAKFYRSLCPSEWVDRWNEQREN  184



>emb|CDY00453.1| BnaC07g13730D [Brassica napus]
Length=185

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG D  EC+K +K Y S CP +W++KW+E RE 
Sbjct  128  QTRHCFTRYIEYHRCVAAKGDDAPECDKFSKFYRSLCPGEWVDKWNEQREN  178



>gb|KFK44340.1| hypothetical protein AALP_AA1G245300 [Arabis alpina]
Length=186

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG +  EC+K AK Y S CPS+W+++W+E RE
Sbjct  129  QTRHCFTRYIEYHRCVAAKGDEAPECDKFAKFYRSLCPSEWVDRWNEQRE  178



>ref|XP_002282064.1| PREDICTED: cytochrome c oxidase subunit 6b-1 isoform X4 [Vitis 
vinifera]
Length=175

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC   KG+   EC+K AK Y S CP++W+E+W+E RE 
Sbjct  118  QTRHCFTRYIEYHRCTAAKGEGATECDKFAKFYRSLCPAEWVERWNEQREN  168



>ref|XP_009373077.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X2 
[Pyrus x bretschneideri]
Length=151

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RCI  KG+   EC+K AK Y S CP +W+E+W+E RE 
Sbjct  94   QTRHCFTRYIEYHRCIAAKGEGAPECDKFAKFYRSLCPGEWVERWNEQREN  144



>gb|KFK27323.1| hypothetical protein AALP_AA8G367900 [Arabis alpina]
Length=78

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC   KG++ N+CE+ AK Y + CP +W+EKW+E RE 
Sbjct  21   QTRHCFTRYIEFHRCTIAKGEESNDCERFAKYYRALCPGEWVEKWNEQREN  71



>ref|XP_004507784.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like [Cicer arietinum]
Length=77

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC   KG++ +ECEK AK Y S CP +W++KW+E R+ 
Sbjct  20   QTRHCFTRYIEFHRCTAAKGENSSECEKFAKYYRSLCPGEWVDKWNEQRDN  70



>dbj|BAJ88586.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=77

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG +  EC+K AK Y S CP++W++KW+E RE 
Sbjct  20   QTRHCFTRYVEFHRCVSAKGDEAAECDKFAKYYRSLCPAEWVDKWNEQREN  70



>ref|XP_009373072.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X1 
[Pyrus x bretschneideri]
Length=174

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RCI  KG+   EC+K AK Y S CP +W+E+W+E RE 
Sbjct  117  QTRHCFTRYIEYHRCIAAKGEGAPECDKFAKFYRSLCPGEWVERWNEQREN  167



>ref|XP_002864529.1| hypothetical protein ARALYDRAFT_918963 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40788.1| hypothetical protein ARALYDRAFT_918963 [Arabidopsis lyrata subsp. 
lyrata]
Length=78

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++E+ RC   KG+  N+CE+ AK Y + CP +W+EKW+E RE
Sbjct  21   QTRHCFTRYIEFHRCTTAKGEASNDCERFAKYYRALCPGEWVEKWNEQRE  70



>ref|XP_002282033.1| PREDICTED: cytochrome c oxidase subunit 6b-1 isoform X1 [Vitis 
vinifera]
 emb|CBI25308.3| unnamed protein product [Vitis vinifera]
Length=191

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC   KG+   EC+K AK Y S CP++W+E+W+E RE 
Sbjct  134  QTRHCFTRYIEYHRCTAAKGEGATECDKFAKFYRSLCPAEWVERWNEQREN  184



>ref|XP_008804786.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Phoenix dactylifera]
Length=164

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY +C   KG+   ECEK AK Y S CPS+WIE+W+E RE
Sbjct  107  QTRHCFTRYIEYHKCTAVKGEGAPECEKFAKYYRSLCPSEWIERWNEQRE  156



>ref|XP_010658140.1| PREDICTED: cytochrome c oxidase subunit 6b-1 isoform X3 [Vitis 
vinifera]
Length=191

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC   KG+   EC+K AK Y S CP++W+E+W+E RE 
Sbjct  134  QTRHCFTRYIEYHRCTAAKGEGATECDKFAKFYRSLCPAEWVERWNEQREN  184



>ref|XP_006305630.1| hypothetical protein CARUB_v10010326mg [Capsella rubella]
 gb|EOA38528.1| hypothetical protein CARUB_v10010326mg [Capsella rubella]
Length=187

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG +  EC+K AK Y S CPS+W+++W+E RE
Sbjct  130  QTRHCFTRYIEYHRCVAAKGDEAPECDKFAKFYRSLCPSEWVDRWNEQRE  179



>ref|XP_008452371.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Cucumis melo]
Length=77

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG++  ECE+ AK Y + CP +W++KW+E RE 
Sbjct  20   QTRHCFTRYIEFHRCLTAKGEESGECERFAKYYRALCPGEWVDKWNEQREN  70



>ref|XP_011079340.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Sesamum indicum]
Length=77

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG++  +C K AK Y S CP +WI+KW+E RE 
Sbjct  20   QTRHCFTRYIEFHRCVAAKGEESGDCNKFAKYYRSLCPGEWIDKWNEQREN  70



>ref|XP_009799940.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Nicotiana 
sylvestris]
Length=182

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   EC+K AK Y S CP +WI++W+E RE 
Sbjct  125  QTRHCFTRYVEYHRCVAAKGEGAPECDKFAKYYRSLCPGEWIDRWNEQREN  175



>ref|NP_568867.1| cytochrome c oxidase subunit 6b-2 [Arabidopsis thaliana]
 sp|Q945L0.1|CX6B2_ARATH RecName: Full=Cytochrome c oxidase subunit 6b-2; Short=AtCOX6b-2 
[Arabidopsis thaliana]
 gb|AAL06549.1|AF412096_1 AT4g28060/T13J8_170 [Arabidopsis thaliana]
 gb|AAM47369.1| AT4g28060/T13J8_170 [Arabidopsis thaliana]
 dbj|BAC42309.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00303.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96955.1| cytochrome c oxidase subunit 6b-2 [Arabidopsis thaliana]
Length=78

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++E+ RC   KG++ N+CE+ AK Y + CP +W++KW+E RE
Sbjct  21   QTRHCFTRYIEFHRCTTAKGEESNDCERFAKYYRALCPGEWVDKWNEQRE  70



>ref|XP_009777811.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Nicotiana 
sylvestris]
Length=192

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RCI  KG+   EC+K AK Y S CP +WI++W+E RE 
Sbjct  135  QTRHCFTRYVEYHRCIAAKGEGAPECDKFAKYYRSLCPGEWIDRWNEQREN  185



>ref|XP_008356355.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Malus domestica]
Length=152

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RCI  KG+   EC+K AK Y S CP +W+E+W+E RE 
Sbjct  95   QTRHCFTRYIEYHRCIAAKGEGAPECDKFAKFYRSLCPGEWVERWNEQREN  145



>ref|XP_009632005.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Nicotiana 
tomentosiformis]
Length=192

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RCI  KG+   EC+K AK Y S CP +WI++W+E RE 
Sbjct  135  QTRHCFTRYVEYHRCIAAKGEGAPECDKFAKYYRSLCPGEWIDRWNEQREN  185



>ref|XP_010272991.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Nelumbo nucifera]
Length=188

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RCI  KG+   EC+K AK Y S CP +WIE+W+E RE
Sbjct  131  QTRHCFTRYIEYHRCIAAKGEGAPECDKFAKYYRSLCPGEWIERWNEQRE  180



>ref|XP_006305631.1| hypothetical protein CARUB_v10010326mg [Capsella rubella]
 gb|EOA38529.1| hypothetical protein CARUB_v10010326mg [Capsella rubella]
Length=202

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG +  EC+K AK Y S CPS+W+++W+E RE
Sbjct  145  QTRHCFTRYIEYHRCVAAKGDEAPECDKFAKFYRSLCPSEWVDRWNEQRE  194



>ref|XP_004252528.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Solanum lycopersicum]
Length=178

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RCI  KG+   EC+K AK Y S CP +WI++W+E RE 
Sbjct  121  QTRHCFTRYVEYHRCIAAKGEGAPECDKFAKYYRSLCPGEWIDRWNEQREN  171



>ref|XP_011074207.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Sesamum indicum]
Length=191

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RCI  KG+   EC+K AK Y S CP +WI++W+E RE 
Sbjct  134  QTRHCFTRYIEYHRCIAAKGEGAPECDKFAKYYRSLCPGEWIDRWNEQREN  184



>ref|XP_004144708.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform 1 [Cucumis 
sativus]
Length=102

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+  KG++  ECE+ AK Y + CP +W++KW+E RE 
Sbjct  47   RHCFTRYIEFHRCLTVKGEESGECERFAKYYRALCPGEWVDKWNEQREN  95



>ref|XP_004144709.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004144710.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform 3 [Cucumis 
sativus]
 ref|XP_004162693.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004162694.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform 3 [Cucumis 
sativus]
 gb|KGN61078.1| hypothetical protein Csa_2G037250 [Cucumis sativus]
Length=77

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG++  ECE+ AK Y + CP +W++KW+E RE 
Sbjct  20   QTRHCFTRYIEFHRCLTVKGEESGECERFAKYYRALCPGEWVDKWNEQREN  70



>gb|KDP41415.1| hypothetical protein JCGZ_15822 [Jatropha curcas]
Length=188

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   EC+K AK Y S CP +WIE+W+E RE 
Sbjct  131  QTRHCFARYIEYHRCVAAKGEGAPECDKFAKYYRSLCPGEWIERWNEQREN  181



>ref|XP_002989279.1| hypothetical protein SELMODRAFT_129448, partial [Selaginella 
moellendorffii]
 gb|EFJ09717.1| hypothetical protein SELMODRAFT_129448, partial [Selaginella 
moellendorffii]
Length=78

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            +HCY +++EY +C +E+G D  EC+K A+ Y S CPS+WIE+W+E RE 
Sbjct  23   KHCYTRYIEYHKCRKERGPDAPECDKYARYYRSLCPSEWIERWNEQREM  71



>ref|XP_002281992.1| PREDICTED: cytochrome c oxidase subunit 6b-1 isoform X2 [Vitis 
vinifera]
Length=191

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC   KG+  +EC+K AK Y S CP++W+E+W+E RE 
Sbjct  134  QTRHCFTRYIEYHRCTAVKGEGASECDKFAKFYRSLCPAEWVERWNEQREN  184



>gb|EYU36481.1| hypothetical protein MIMGU_mgv1a015237mg [Erythranthe guttata]
Length=164

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG +  EC+K AK Y S CP +W++KW+E RE 
Sbjct  107  QTRHCFTRYIEYHRCVAAKGDEAPECDKFAKYYRSLCPGEWVDKWNEQREN  157



>ref|XP_003615162.1| Subunit 6b of cytochrome c oxidase [Medicago truncatula]
 gb|AES98120.1| cytochrome C oxidase, subunit VIb family protein [Medicago truncatula]
 gb|AFK34896.1| unknown [Medicago truncatula]
Length=183

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG D  EC+K AK Y + CP +W+++W+E RE
Sbjct  126  QTRHCFTRYIEYHRCVAAKGDDAPECDKFAKYYRALCPGEWVDRWNEQRE  175



>gb|KHG00496.1| Cytochrome c oxidase subunit 6b-1 -like protein [Gossypium arboreum]
Length=177

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 54/107 (50%), Gaps = 27/107 (25%)
 Frame = -2

Query  480  GTVSAPPP---------PSSTDSKLDAGKKASANA------------------IGERIRH  382
            G+  APPP         P++ +S  DA ++ S ++                     + RH
Sbjct  64   GSTEAPPPAAEESTEANPATGNSGEDAAEENSGDSEETPEIKLETAPADFRFPTTNQTRH  123

Query  381  CYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            C+ +++EY RC+  KG+   EC+K AK Y + CP +WI++W+E RE 
Sbjct  124  CFTRYIEYHRCVAAKGEGAPECDKFAKYYRALCPGEWIDRWNEQREN  170



>ref|XP_006360302.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Solanum tuberosum]
Length=196

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RCI  KG+   EC+K AK Y S CP +WI++W+E RE 
Sbjct  139  QTRHCFTRYIEYHRCIAAKGEGAPECDKFAKYYRSLCPGEWIDRWNEQREN  189



>ref|XP_009145340.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Brassica rapa]
 emb|CDY71646.1| BnaAnng38290D [Brassica napus]
Length=162

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG D  EC+K +K Y S CP +W+++W+E RE 
Sbjct  105  QTRHCFTRYIEYHRCVSAKGDDAPECDKFSKFYRSLCPGEWVDRWNEQREN  155



>gb|ABK23944.1| unknown [Picea sitchensis]
 gb|ABR16543.1| unknown [Picea sitchensis]
Length=85

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -2

Query  438  KLDAGKKASANA---IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWI  268
            ++D  K A A+       + RHC+ +++EY +C+  KG+   EC+K AK Y S CP +WI
Sbjct  10   QIDTLKTAPADFRFPTTNQTRHCFTRYIEYHKCLAAKGEGATECDKFAKYYRSLCPGEWI  69

Query  267  EKWHEDRE  244
            ++W+E RE
Sbjct  70   DRWNEQRE  77



>ref|XP_004299671.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Fragaria vesca 
subsp. vesca]
Length=180

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RCI  KG++  EC+K  K Y S CP +W+E+W+E RE
Sbjct  123  QTRHCFTRYVEYHRCIAAKGEEAPECDKFKKYYRSLCPGEWVERWNEQRE  172



>ref|XP_004162692.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform 1 [Cucumis 
sativus]
Length=102

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+ RC+  KG++  ECE+ AK Y + CP +W++KW+E RE 
Sbjct  47   RHCFTRYIEFHRCLTVKGEESGECERFAKYYRALCPGEWVDKWNEQREN  95



>ref|XP_011069843.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Sesamum indicum]
Length=77

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC   KG+  ++C+K A+ Y S CP +WIEKW+E RE 
Sbjct  20   QTRHCFTRYIEFHRCTAAKGEGSSDCDKFARYYRSLCPGEWIEKWNEQREN  70



>ref|XP_003544809.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Glycine max]
Length=175

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG+   EC+K AK Y S CP +WI++W+E RE
Sbjct  118  QTRHCFTRYVEYHRCVAAKGEGAPECDKFAKYYRSLCPGEWIDRWNEQRE  167



>gb|KHN35491.1| Cytochrome c oxidase subunit 6b-1 [Glycine soja]
Length=175

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   EC+K AK Y S CP +WI++W+E RE 
Sbjct  118  QTRHCFTRYVEYHRCVAAKGEGAPECDKFAKYYRSLCPGEWIDRWNEQREN  168



>ref|XP_009623905.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Nicotiana 
tomentosiformis]
Length=185

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   EC+K AK Y S CP +WI++W+E RE 
Sbjct  128  QTRHCFTRYVEYHRCVAAKGEGAPECDKFAKYYRSLCPGEWIDRWNEQREN  178



>emb|CBI25309.3| unnamed protein product [Vitis vinifera]
Length=224

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC   KG+  +EC+K AK Y S CP++W+E+W+E RE 
Sbjct  167  QTRHCFTRYIEYHRCTAVKGEGASECDKFAKFYRSLCPAEWVERWNEQREN  217



>gb|ABK23476.1| unknown [Picea sitchensis]
Length=165

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY +CI  KG+  +ECEK A+ Y S CP +WI+ W+E RE
Sbjct  108  QTRHCFTRYIEYHKCIAAKGEGASECEKFARHYRSLCPGEWIDSWNEQRE  157



>gb|KHN26096.1| Cytochrome c oxidase subunit 6b-1 [Glycine soja]
Length=174

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   EC+K AK Y S CP +W+++W+E RE 
Sbjct  117  QTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRSLCPGEWVDRWNEQREN  167



>ref|NP_001236320.1| uncharacterized protein LOC100306272 [Glycine max]
 gb|ACU14377.1| unknown [Glycine max]
Length=174

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC+  KG+   EC+K AK Y S CP +W+++W+E RE 
Sbjct  117  QTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRSLCPGEWVDRWNEQREN  167



>ref|XP_009137757.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like [Brassica rapa]
 emb|CDY29877.1| BnaA03g48980D [Brassica napus]
Length=78

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++E+ RC   KG+D  +CE+ AK Y + CP +W++KW+E RE
Sbjct  21   QTRHCFTRYIEFHRCTTAKGEDSVDCERFAKYYRALCPGEWVDKWNEQRE  70



>gb|AAM64280.1| cytochrome c oxidase subunit 6b [Arabidopsis thaliana]
Length=78

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++++ RC   KG++ N+CE+ AK Y + CP +W++KW+E RE
Sbjct  21   QTRHCFTRYIKFHRCTTAKGEESNDCERFAKYYRALCPGEWVDKWNEQRE  70



>ref|XP_002528213.1| cytochrome C oxidase polypeptide vib, putative [Ricinus communis]
 gb|EEF34170.1| cytochrome C oxidase polypeptide vib, putative [Ricinus communis]
Length=78

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG++  EC++ AK Y + CP +W+E+W+E RE 
Sbjct  21   QTRHCFTRYIEFHRCLAAKGEEPKECDRFAKYYRALCPGEWVERWNEQREN  71



>gb|KHG23610.1| Cytochrome c oxidase subunit 6b-1 -like protein [Gossypium arboreum]
Length=88

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = -2

Query  447  TDSKLDAGKKASANA---IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPS  277
            T+S   A K A A+       + RHC+ +++E+ RC+  KG + NECE+ AK Y S CP 
Sbjct  11   TNSHQIALKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKG-ESNECERFAKYYRSLCPG  69

Query  276  QWIEKWHEDREQ  241
            +W+E+W+E R+ 
Sbjct  70   EWVERWNEQRKN  81



>ref|XP_009144153.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Brassica rapa]
 emb|CDX89207.1| BnaA01g16860D [Brassica napus]
Length=78

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++E+ RC   KG++ ++CE+ AK Y + CP +W++KW+E RE
Sbjct  21   QTRHCFTRYIEFHRCTTAKGENSSDCERFAKYYRALCPGEWVDKWNEQRE  70



>gb|EYU37118.1| hypothetical protein MIMGU_mgv1a022157mg, partial [Erythranthe 
guttata]
Length=113

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            RHC+ +++E+ RC+  KG +  +C K A+ Y S CP +W+EKW+E RE
Sbjct  58   RHCFTRYIEFHRCVAAKGDESGDCGKFAQYYRSLCPGEWVEKWNEQRE  105



>ref|XP_002513958.1| cytochrome C oxidase polypeptide vib, putative [Ricinus communis]
 gb|EEF48541.1| cytochrome C oxidase polypeptide vib, putative [Ricinus communis]
Length=191

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC   KG+   EC+K AK Y S CP +WI++W+E RE 
Sbjct  134  QTRHCFTRYVEYHRCTAAKGEGAPECDKFAKFYRSLCPGEWIDRWNEQREN  184



>ref|XP_009600161.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Nicotiana tomentosiformis]
 ref|XP_009790994.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Nicotiana sylvestris]
Length=78

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG +  EC K AK Y + CP +W+E+W+E RE 
Sbjct  21   QTRHCFTRYVEFHRCVAAKGDEAAECGKFAKYYRALCPGEWVERWNEQREN  71



>ref|XP_006343565.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Solanum tuberosum]
Length=77

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG +  +CE+ AK Y + CP +W++KW+E RE 
Sbjct  20   QTRHCFTRYVEFHRCVAAKGDEAADCERFAKYYRALCPGEWVDKWNEQREN  70



>gb|EPS74026.1| hypothetical protein M569_00726 [Genlisea aurea]
Length=533

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            RHC+ +++E+ RC+  KG+D  EC K A  Y + CP +WIEKW+E RE
Sbjct  478  RHCFTRYIEFHRCVAAKGEDSGECAKFANYYRALCPGEWIEKWNEQRE  525



>ref|XP_009390533.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Musa acuminata 
subsp. malaccensis]
Length=77

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            + RHC+ +++EY +C+  KG++  +C K AK Y S CP +W+EKW+E R
Sbjct  20   QTRHCFTRYIEYHKCVAAKGEETPDCHKFAKYYRSLCPGEWVEKWNEQR  68



>ref|XP_010267072.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Nelumbo nucifera]
Length=155

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC   KG+   EC+K AK Y S CP +WI++W+E RE
Sbjct  98   QTRHCFTRYIEYHRCTAAKGEGAPECDKFAKYYRSLCPGEWIDRWNEQRE  147



>ref|XP_008782171.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Phoenix dactylifera]
Length=221

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            + RHC+ +++EY +CI  KG+   +C+K AK Y S CPS+WIE+W+E R
Sbjct  164  QTRHCFTRYIEYHKCIAAKGEGAPDCDKFAKYYRSLCPSEWIERWNEQR  212



>ref|XP_006363287.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Solanum tuberosum]
Length=185

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++EY RC   KG+   EC+K AK Y S CP +W+++W+E RE 
Sbjct  128  QTRHCFTRYVEYHRCTAAKGEGAPECDKFAKYYRSLCPGEWVDRWNEQREN  178



>ref|XP_004237938.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Solanum lycopersicum]
Length=185

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++EY RC   KG+   EC+K AK Y S CP +W+++W+E RE 
Sbjct  130  RHCFTRYVEYHRCTAAKGEGAPECDKFAKYYRSLCPGEWVDRWNEQREN  178



>ref|XP_008781379.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Phoenix dactylifera]
Length=77

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -2

Query  399  GERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
              +  HC+ +++EY +C++ KG+D  +C+K A+ Y S CP +WIEKW+E +E
Sbjct  18   ANQTSHCFTRYIEYHKCLKAKGEDAADCQKFARYYRSLCPLEWIEKWNEQKE  69



>emb|CDY04815.1| BnaC05g17740D [Brassica napus]
Length=163

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG +  EC+K +K Y S CP +W+++W+E RE
Sbjct  106  QTRHCFTRYIEYHRCVAAKGDEAPECDKFSKFYRSLCPGEWVDRWNEQRE  155



>gb|AFK42242.1| unknown [Lotus japonicus]
Length=177

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+ +++EY RC+  KG    EC+K AK Y + CP +W+++W+E RE
Sbjct  120  QTRHCFTRYIEYHRCVAAKGDGAPECDKFAKYYRALCPGEWVDRWNEQRE  169



>ref|XP_005646865.1| cytochrome c oxidase subunit H, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22321.1| cytochrome c oxidase subunit H, partial [Coccomyxa subellipsoidea 
C-169]
Length=74

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHCY ++ EY RC+ +KG++D EC    + Y S CP +W+E+W+E RE 
Sbjct  19   RHCYTRYNEYHRCVAQKGEEDPECSVFQRAYRSICPGEWLERWNEAREN  67



>ref|XP_010687691.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Beta vulgaris subsp. 
vulgaris]
Length=77

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG++ + C K A+ Y + CP +W+E+W+E RE 
Sbjct  20   QTRHCFTRYIEFHRCLAAKGEESDACGKFAQYYRALCPGEWVERWNEQREN  70



>ref|XP_001784031.1| predicted protein [Physcomitrella patens]
 gb|EDQ51137.1| predicted protein [Physcomitrella patens]
Length=73

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            +HC+ ++ E+ +C  EKG+D  EC+K A+ Y S CP +WI+KW+E+RE 
Sbjct  18   KHCFTRYNEFHKCAAEKGEDAKECQKYARYYRSLCPGEWIDKWNEEREN  66



>dbj|BAJ88460.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=85

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+ +++E+  C+  KG +  EC+K AK Y S CP++W++KW+E RE 
Sbjct  30   RHCFTRYVEFHGCVGAKGDEAVECDKFAKYYRSLCPAEWVDKWNEQREN  78



>ref|XP_004242645.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Solanum lycopersicum]
Length=77

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+ +++E+ RC+  KG +  +C + AK Y + CP +W++KW+E RE 
Sbjct  20   QTRHCFTRYVEFHRCVAAKGDEAADCARFAKYYRALCPGEWVDKWNEQREN  70



>ref|XP_002947475.1| hypothetical protein VOLCADRAFT_48974 [Volvox carteri f. nagariensis]
 gb|EFJ51523.1| hypothetical protein VOLCADRAFT_48974 [Volvox carteri f. nagariensis]
Length=72

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+++F EY +CI E+G+D   C+   K Y S CPS+W+E W E RE+
Sbjct  19   RHCFVRFNEYYKCIYERGEDHPRCQFYQKAYQSLCPSEWLESWQELREK  67



>ref|XP_010926331.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Elaeis guineensis]
 ref|XP_010926332.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Elaeis guineensis]
Length=226

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            + RHC+ ++ EY +CI  KG+   +C+K AK Y S CPS+WIE+W+E R
Sbjct  169  QTRHCFTRYCEYHKCIAAKGEGAPDCDKFAKYYRSLCPSEWIERWNEQR  217



>gb|ABD64590.1| mitochondrial cytochrome c oxidase subunit 6b [Chlamydomonas 
sp. ICE-L]
Length=138

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            RHC+++F EY +CI E+G+D   C+     Y S CPS W+E W E REQ
Sbjct  83   RHCFVRFNEYYKCIHERGEDHARCQFYQSAYQSLCPSDWLENWTELREQ  131



>emb|CAB36775.1| putative protein [Arabidopsis thaliana]
 emb|CAB79608.1| putative protein [Arabidopsis thaliana]
Length=164

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 6/54 (11%)
 Frame = -2

Query  387  RHCYIQFLEYKR------CIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            RHC+ +++E+ R      C   KG+D NECE+ AK Y + CP +W++KW+E RE
Sbjct  103  RHCFTRYIEFHRYSCVIECTTAKGEDANECERFAKYYRALCPGEWVDKWNEQRE  156



>ref|XP_001691399.1| mitochondrial cytochrome c oxidase subunit [Chlamydomonas reinhardtii]
 gb|EDP05132.1| mitochondrial cytochrome c oxidase subunit [Chlamydomonas reinhardtii]
Length=148

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 51/104 (49%), Gaps = 21/104 (20%)
 Frame = -2

Query  552  DKMRGRDVNKVARGEQAPRPVHQPGTVSAPPPPSSTDSKLDAGKKASANAIGERIRHCYI  373
            DK+ G D  K+A          +P  ++AP  P   +                + RHC++
Sbjct  59   DKIAGEDGTKLA-------DFLEPELITAPYDPRFPNRN--------------QARHCFV  97

Query  372  QFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            +F EY +C+ E+G++   C+   K Y S CPS+W+E W E RE+
Sbjct  98   RFNEYYKCLYERGEEHPRCQFYQKAYQSLCPSEWVESWQELREK  141



>ref|XP_001763315.1| predicted protein [Physcomitrella patens]
 gb|EDQ71845.1| predicted protein [Physcomitrella patens]
Length=71

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            +HCY  + E+ +C  EKG+ D +C K A+ Y S CP  WIEKW+E+R
Sbjct  18   KHCYYSYNEFHKCAAEKGEHDKDCRKYARYYRSLCPGHWIEKWNEER  64



>ref|XP_002965431.1| hypothetical protein SELMODRAFT_84137, partial [Selaginella moellendorffii]
 ref|XP_002994166.1| hypothetical protein SELMODRAFT_138288, partial [Selaginella 
moellendorffii]
 gb|EFJ04756.1| hypothetical protein SELMODRAFT_138288, partial [Selaginella 
moellendorffii]
 gb|EFJ32851.1| hypothetical protein SELMODRAFT_84137, partial [Selaginella moellendorffii]
Length=72

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            +HCY +++E+ +C +E+G+   EC+K A+ Y S CPS+WIE+W+E R
Sbjct  17   KHCYTRYIEFHKCQKERGEGAPECQKYARYYRSLCPSEWIERWNEQR  63



>ref|XP_005707710.1| cytochrome c oxidase subunit VIb [Galdieria sulphuraria]
 gb|EME31190.1| cytochrome c oxidase subunit VIb [Galdieria sulphuraria]
Length=85

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            +HC+ +++EY  C+++KG++D+EC+K  + Y S CP++W+E W E R
Sbjct  30   KHCWSRYIEYHACVKQKGEEDSECQKFKRWYKSLCPNEWLENWDEQR  76



>ref|XP_003064158.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51780.1| predicted protein [Micromonas pusilla CCMP1545]
Length=110

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            +HCY ++ E+ +C  ++G+D  ECE  AK Y S CP++W+EKW E+RE
Sbjct  55   KHCYTRYNEFHKCKAQQGEDAEECETYAKYYRSLCPTEWVEKWDEERE  102



>ref|XP_001421861.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP00155.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=73

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            +HCY ++ E+ +C  E G+   ECE +AK Y S CP++W EKW+E+RE+
Sbjct  18   KHCYTRYNEFHKCQAENGEGAEECEPLAKFYRSICPTEWTEKWNEEREE  66



>ref|NP_001048358.1| Os02g0791400 [Oryza sativa Japonica Group]
 dbj|BAD19121.1| putative cytochrome c oxidase subunit 6b-1 [Oryza sativa Japonica 
Group]
 dbj|BAF10272.1| Os02g0791400 [Oryza sativa Japonica Group]
Length=86

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            + + C+  ++EY +CI+ KG+  +EC K AK Y S CP +WIE+W E R
Sbjct  29   QTKRCFTCYIEYNKCIEAKGEGSDECTKYAKCYRSLCPGEWIERWKEQR  77



>ref|XP_002978684.1| hypothetical protein SELMODRAFT_59940, partial [Selaginella moellendorffii]
 gb|EFJ20131.1| hypothetical protein SELMODRAFT_59940, partial [Selaginella moellendorffii]
Length=72

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  402  IGERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            +  + ++C+ +++EY +CIQE G+ D+ CEK  + Y S CP +W+E W E R
Sbjct  13   VTNQTKNCFTKYVEYHKCIQENGEGDSRCEKYRRAYKSLCPIEWVEAWDERR  64



>gb|EEC74151.1| hypothetical protein OsI_09238 [Oryza sativa Indica Group]
 gb|EEE57950.1| hypothetical protein OsJ_08678 [Oryza sativa Japonica Group]
Length=80

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDR  247
            + + C+  ++EY +CI+ KG+  +EC K AK Y S CP +WIE+W E R
Sbjct  23   QTKRCFTCYIEYNKCIEAKGEGSDECTKYAKCYRSLCPGEWIERWKEQR  71



>ref|XP_002493850.1| Subunit VIb of cytochrome c oxidase [Komagataella pastoris GS115]
 emb|CAY71671.1| Subunit VIb of cytochrome c oxidase [Komagataella pastoris GS115]
 emb|CCA40725.1| cytochrome c oxidase subunit VIb [Komagataella pastoris CBS 7435]
Length=80

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + +HCY  +L+Y +CI  KG+D   C+   K Y S CPS W+E+W E RE+
Sbjct  21   QTKHCYQSYLDYHKCITVKGEDFAPCKVFWKTYNSLCPSAWVEEWDEQREK  71



>ref|XP_007262758.1| cytochrome c oxidase, subunit VIb [Fomitiporia mediterranea MF3/22]
 gb|EJD06494.1| cytochrome c oxidase, subunit VIb [Fomitiporia mediterranea MF3/22]
Length=88

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+  + +Y +CI  KG+D   C++  + Y S CP++WI KW E RE 
Sbjct  29   QTRHCFQNYTDYFKCITAKGEDFAPCKQFKRAYNSLCPNEWISKWDEQREN  79



>ref|XP_005841976.1| hypothetical protein GUITHDRAFT_149927, partial [Guillardia theta 
CCMP2712]
 gb|EKX54996.1| hypothetical protein GUITHDRAFT_149927, partial [Guillardia theta 
CCMP2712]
Length=92

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + +HCY ++ E+ RC    G+D  EC+KI   + S CP +WIEKW++ RE
Sbjct  35   QTKHCYAKYNEFFRCAGVHGEDAKECKKIKHHFISLCPVEWIEKWNDQRE  84



>gb|AAP80832.1| cytochrome c oxidase subunit 6b-1 [Griffithsia japonica]
Length=85

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + +HC+ ++LE+  C + KG+DD EC+K  + Y S CP +W+EKW   +E+
Sbjct  28   QTKHCWARYLEFHACAKAKGQDDPECDKFKRWYISLCPIEWVEKWDTLKEE  78



>ref|XP_004986287.1| PREDICTED: uncharacterized protein LOC101775406 [Setaria italica]
Length=241

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = -2

Query  390  IRHCYIQFLEYKRCIQEK-GKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
             RHCY+++ EY RC++ K G D  EC+K  + Y S CP+ W+ +W+  RE+
Sbjct  184  TRHCYVRYPEYHRCVKAKDGDDRTECDKFQRYYGSLCPTDWVVEWNRQREE  234



>gb|ACW82405.1| cytochrome c oxidase subunit 6b [Larix kaempferi]
Length=180

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 11/61 (18%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEK-----------IAKEYTSSCPSQWIEKWHEDR  247
            + RHC+ +++EY +CI  KG+  +ECEK           +A+ Y S CP +WI++W+E R
Sbjct  112  QTRHCFTRYIEYHKCIAAKGEGASECEKFARHYRSLCPGVARHYRSLCPGEWIDRWNEQR  171

Query  246  E  244
            E
Sbjct  172  E  172



>gb|KHN34761.1| Cytochrome c oxidase subunit 6b-2 [Glycine soja]
Length=77

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = -2

Query  387  RHCYIQFL-EYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            RHC+   + +  RC+  KG++  ECE+ AK Y S CP +W+E+W+E RE
Sbjct  21   RHCFTGGIPDIGRCLAAKGENSGECERFAKYYRSLCPGEWVERWNEQRE  69



>gb|KDP38756.1| hypothetical protein JCGZ_04109 [Jatropha curcas]
Length=84

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWI  268
            RHC+ +++E+ RC+  KG++ NECE+ AK Y + CP +W+
Sbjct  23   RHCFTRYIEFHRCLAAKGEESNECERFAKYYRALCPGEWV  62



>ref|XP_006453501.1| hypothetical protein CICLE_v10010074mg [Citrus clementina]
 gb|ESR66741.1| hypothetical protein CICLE_v10010074mg [Citrus clementina]
 gb|KDO62352.1| hypothetical protein CISIN_1g034905mg [Citrus sinensis]
Length=72

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWI  268
            RHC+ +++E+ RC+  KG++ NECE+ AK Y S CP  W+
Sbjct  24   RHCFTRYIEFHRCLAAKGEESNECERFAKYYRSLCPGDWV  63



>emb|CDI53501.1| probable COX12-cytochrome-c oxidase, subunit VIB [Melanopsichium 
pennsylvanicum 4]
Length=85

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQHG  235
            + +HC+  +++Y RC+  KG+D   C++  + Y S CP++WI KW E RE + 
Sbjct  26   QTKHCWQNYVDYFRCVNAKGEDFVPCKQFFRAYNSLCPNEWIAKWDEQRENNS  78



>ref|XP_008039169.1| cytochrome c oxidase subunit VIb [Trametes versicolor FP-101664 
SS1]
 gb|EIW57802.1| cytochrome c oxidase subunit VIb [Trametes versicolor FP-101664 
SS1]
Length=85

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+  + +Y +CI  KG+D   C++  + Y S CP++WI KW E RE 
Sbjct  26   QTRHCFQNYTDYFKCIAAKGEDYAPCKQFKRAYNSLCPNEWINKWDEQREN  76



>ref|XP_007387899.1| cytochrome c oxidase subunit VIb [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN04976.1| cytochrome c oxidase subunit VIb [Punctularia strigosozonata 
HHB-11173 SS5]
Length=84

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+  + +Y +CI  KG+D   C++  + Y S CP++WI KW E RE 
Sbjct  25   QTRHCFQNYTDYFKCIAAKGEDFAPCKQFKRAYNSLCPNEWITKWDEQREN  75



>ref|XP_006386412.1| hypothetical protein POPTR_0002s10020g [Populus trichocarpa]
 gb|ERP64209.1| hypothetical protein POPTR_0002s10020g [Populus trichocarpa]
Length=194

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWI  268
            + RHC+ +++EY RC+  KG+  +EC+K AK Y S CPS+W+
Sbjct  126  QTRHCFTRYIEYHRCVAAKGEGASECDKFAKYYRSLCPSEWV  167



>ref|XP_006828021.1| hypothetical protein AMTR_s00008p00250560 [Amborella trichopoda]
 gb|ERM95437.1| hypothetical protein AMTR_s00008p00250560 [Amborella trichopoda]
Length=132

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQW  271
            + RHC+ +++EY RCI  KG+  NEC+K AK Y S CP +W
Sbjct  87   QTRHCFTRYIEYHRCIAAKGEGANECDKFAKYYRSLCPGEW  127



>gb|EMS18372.1| cytochrome c oxidase subunit VIb [Rhodosporidium toruloides NP11]
 emb|CDR49645.1| RHTO0S29e00606g1_1 [Rhodosporidium toruloides]
Length=83

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQH  238
            RHC+  +++Y RC+  KG+D   C+   + Y S CP++WI KW E RE++
Sbjct  27   RHCFQAYVDYFRCVNAKGEDFPACKTFWRTYHSLCPNEWIAKWDEQREEN  76



>ref|XP_004984148.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X1 
[Setaria italica]
Length=178

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWI  268
            + RHC+ +++EY RC+  KG+D  EC+K AK Y S CP +W+
Sbjct  110  QTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWV  151



>gb|EPS93615.1| cytochrome c oxidase subunit VIb [Fomitopsis pinicola FP-58527 
SS1]
Length=83

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+  + +Y +CI  KG+D   C++  + Y S CP++WI KW E RE
Sbjct  24   QTRHCFQNYTDYFKCIAAKGEDYAPCKQFKRAYNSLCPNEWISKWDEQRE  73



>ref|XP_007371404.1| cytochrome c oxidase subunit VIb [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF55839.1| cytochrome c oxidase subunit VIb [Dichomitus squalens LYAD-421 
SS1]
Length=83

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
            + RHC+  + +Y +CI  KG+D   C++  + Y S CP++WI KW E RE
Sbjct  24   QTRHCFQNYTDYFKCIAAKGEDYAPCKQFKRAYNSLCPNEWIAKWDEQRE  73



>gb|AFK39313.1| unknown [Medicago truncatula]
Length=87

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEK  262
            RHC+ +++E+ RC+  KG++  ECEK AK Y S CP +W++ 
Sbjct  22   RHCFTRYIEFHRCMTVKGENSGECEKFAKYYRSLCPGEWMQN  63



>dbj|GAC71816.1| cytochrome c oxidase, subunit VIb/COX12 [Pseudozyma antarctica 
T-34]
Length=137

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQHG  235
            + +HC+  +++Y RC+  KG+D   C++  + Y S CP++WI +W E RE + 
Sbjct  78   QTKHCWQNYVDYYRCVNAKGEDFVPCKQFFRAYNSLCPNEWIARWDEQRENNN  130



>ref|XP_444921.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG57814.1| unnamed protein product [Candida glabrata]
Length=83

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + RHC+  +++Y +CI  KG+D   C+   K Y+S CP +W+EKW + RE+
Sbjct  20   QTRHCWQAYVDYHKCINLKGEDFAPCKVFWKTYSSLCPVEWVEKWDDQREK  70



>gb|EEC77562.1| hypothetical protein OsI_16493 [Oryza sativa Indica Group]
Length=73

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIE  265
            RHC+ +++EY RC+  KG+   +CEK AK Y S CP++W +
Sbjct  22   RHCFTRYIEYHRCVNAKGEATADCEKFAKYYRSLCPAEWFD  62



>ref|XP_003083867.1| putative cytochrome c oxidase subunit 6b-1 (ISS) [Ostreococcus 
tauri]
 emb|CAL57834.1| Cytochrome c oxidase, subunit VIb [Ostreococcus tauri]
Length=99

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -2

Query  387  RHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            +HCY ++ E+ +C  E G+   ECE + K Y + CP +W+EKW+E RE+
Sbjct  44   KHCYTRYNEFHKCQAENGEGAEECEPLGKFYRAICPQEWVEKWNEQREE  92



>ref|XP_005715645.1| Cytochrome c oxidase subunit 6b-1 [Chondrus crispus]
 emb|CDF35826.1| Cytochrome c oxidase subunit 6b-1 [Chondrus crispus]
Length=79

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + +HC+ ++LE+  C + KG DD ECEK  + Y S CP +W+E W   +E+
Sbjct  22   QTKHCWARYLEFHACSKVKGDDDPECEKFKRWYLSLCPEEWVENWDTLKEE  72



>gb|KDQ53110.1| hypothetical protein JAAARDRAFT_39484 [Jaapia argillacea MUCL 
33604]
Length=83

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  396  ERIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDRE  244
             + RHC+  + +Y +CI  KG+D   C++  + YTS CP++W+ KW + R+
Sbjct  23   NQTRHCFQNYTDYFKCIAAKGEDFAPCKQFKRAYTSLCPNEWVGKWDDQRD  73



>ref|XP_455857.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAG98565.1| KLLA0F17281p [Kluyveromyces lactis]
Length=82

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + +HC+  +++Y +CI  KG+D   C+   K Y+S CP  W+EKW E R Q
Sbjct  23   QTKHCWQSYVDYHKCINAKGEDFAPCKVFWKTYSSLCPVDWVEKWDEQRSQ  73



>ref|XP_006416198.1| hypothetical protein EUTSA_v10008804mg [Eutrema salsugineum]
 gb|ESQ34551.1| hypothetical protein EUTSA_v10008804mg [Eutrema salsugineum]
Length=202

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWI  268
            + RHC+ +++EY RC+  KG +  EC+K AK Y S CPS+W+
Sbjct  134  QTRHCFTRYIEYHRCVAAKGDEAPECDKFAKFYRSLCPSEWV  175



>ref|XP_001644818.1| hypothetical protein Kpol_1041p18 [Vanderwaltozyma polyspora 
DSM 70294]
 gb|EDO16960.1| hypothetical protein Kpol_1041p18 [Vanderwaltozyma polyspora 
DSM 70294]
Length=84

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  393  RIRHCYIQFLEYKRCIQEKGKDDNECEKIAKEYTSSCPSQWIEKWHEDREQ  241
            + +HC+  +++Y +CI  KG+D   C+   K Y+S CP  WIEKW E RE+
Sbjct  24   QTKHCWQSYVDYHKCINLKGEDFAPCKVFWKTYSSLCPVDWIEKWDEQREK  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1067213240424