BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8529_g1_i1 len=1552 path=[1:0-193 195:194-1551]

Length=1552
                                                                      Score     E

emb|CDP14941.1|  unnamed protein product                                560   0.0      
emb|CDP14942.1|  unnamed protein product                                556   0.0      
ref|XP_010053627.1|  PREDICTED: uncharacterized protein LOC104442037    549   0.0      
ref|XP_009615972.1|  PREDICTED: uncharacterized protein LOC104108601    549   0.0      
ref|XP_009797417.1|  PREDICTED: uncharacterized protein LOC104243...    545   0.0      
ref|XP_006364462.1|  PREDICTED: uncharacterized protein LOC102578745    542   0.0      
gb|KDP32272.1|  hypothetical protein JCGZ_13197                         540   0.0      
ref|XP_008375114.1|  PREDICTED: uncharacterized protein LOC103438346    538   0.0      
ref|XP_002269745.2|  PREDICTED: uncharacterized protein LOC100242...    532   2e-180   Vitis vinifera
ref|XP_004245944.2|  PREDICTED: uncharacterized protein LOC101257692    531   7e-180   
ref|XP_009354660.1|  PREDICTED: uncharacterized protein LOC103945804    529   1e-179   
ref|XP_002523580.1|  conserved hypothetical protein                     528   1e-179   Ricinus communis
ref|XP_011008815.1|  PREDICTED: uncharacterized protein LOC105114095    528   3e-179   
ref|XP_011009639.1|  PREDICTED: uncharacterized protein LOC105114698    527   5e-179   
ref|XP_007022584.1|  Uncharacterized protein TCM_033363                 527   5e-179   
ref|XP_006369488.1|  hypothetical protein POPTR_0001s23900g             526   1e-178   
ref|XP_006483670.1|  PREDICTED: uncharacterized protein LOC102607172    523   1e-177   
ref|XP_010276359.1|  PREDICTED: uncharacterized protein LOC104611127    523   1e-177   
ref|XP_002325025.1|  hypothetical protein POPTR_0018s09440g             523   2e-177   Populus trichocarpa [western balsam poplar]
ref|XP_006482794.1|  PREDICTED: uncharacterized protein LOC102620179    523   3e-177   
ref|XP_011007114.1|  PREDICTED: uncharacterized protein LOC105112912    522   4e-177   
ref|XP_008461748.1|  PREDICTED: uncharacterized protein LOC103500280    522   5e-177   
gb|KDO46021.1|  hypothetical protein CISIN_1g008353mg                   523   5e-177   
ref|XP_010111946.1|  hypothetical protein L484_004609                   522   8e-177   
ref|XP_009589347.1|  PREDICTED: uncharacterized protein LOC104086727    521   1e-176   
ref|XP_004172675.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    519   1e-175   
ref|XP_011092632.1|  PREDICTED: uncharacterized protein LOC105172754    520   2e-175   
ref|XP_011041980.1|  PREDICTED: uncharacterized protein LOC105137797    518   2e-175   
ref|XP_009793524.1|  PREDICTED: uncharacterized protein LOC104240380    518   4e-175   
ref|XP_008235570.1|  PREDICTED: uncharacterized protein LOC103334389    516   2e-174   
gb|KCW71746.1|  hypothetical protein EUGRSUZ_E00249                     516   3e-174   
ref|XP_010055279.1|  PREDICTED: uncharacterized protein LOC104443...    516   4e-174   
emb|CDP14946.1|  unnamed protein product                                514   7e-174   
ref|XP_007201170.1|  hypothetical protein PRUPE_ppa003618mg             514   8e-174   
ref|XP_010055278.1|  PREDICTED: uncharacterized protein LOC104443...    516   1e-173   
ref|XP_007218959.1|  hypothetical protein PRUPE_ppa003559mg             514   1e-173   
ref|XP_010055277.1|  PREDICTED: uncharacterized protein LOC104443...    516   1e-173   
gb|KHG05345.1|  Vacuolar sorting-associated protein 62                  513   2e-173   
ref|XP_004303088.1|  PREDICTED: uncharacterized protein LOC101300074    511   8e-173   
ref|XP_008231390.1|  PREDICTED: uncharacterized protein LOC103330573    511   9e-173   
ref|XP_011086788.1|  PREDICTED: uncharacterized protein LOC105168414    511   1e-172   
ref|XP_004229552.1|  PREDICTED: uncharacterized protein LOC101265960    508   1e-171   
emb|CDY23425.1|  BnaC04g49530D                                          508   4e-171   
ref|XP_010544519.1|  PREDICTED: uncharacterized protein LOC104817144    505   1e-170   
ref|XP_010512857.1|  PREDICTED: uncharacterized protein LOC104788773    507   1e-170   
ref|XP_004488551.1|  PREDICTED: uncharacterized protein LOC101507229    505   1e-170   
ref|XP_004151267.1|  PREDICTED: uncharacterized protein LOC101218097    506   2e-170   
gb|KDP32271.1|  hypothetical protein JCGZ_13196                         504   2e-170   
ref|XP_009142253.1|  PREDICTED: uncharacterized protein LOC103866129    505   2e-170   
emb|CDY30462.1|  BnaA04g25630D                                          505   4e-170   
ref|XP_008461747.1|  PREDICTED: uncharacterized protein LOC103500279    505   7e-170   
ref|XP_006397604.1|  hypothetical protein EUTSA_v10001386mg             502   4e-169   
ref|XP_007149177.1|  hypothetical protein PHAVU_005G047900g             501   9e-169   
ref|XP_006359130.1|  PREDICTED: uncharacterized protein LOC102589484    501   1e-168   
ref|XP_010506342.1|  PREDICTED: uncharacterized protein LOC104782970    501   1e-168   
ref|XP_009596811.1|  PREDICTED: uncharacterized protein LOC104092840    502   1e-168   
ref|XP_003546829.1|  PREDICTED: uncharacterized protein LOC100806731    500   1e-168   
ref|XP_010518022.1|  PREDICTED: uncharacterized protein LOC104793366    499   6e-168   
ref|XP_006438992.1|  hypothetical protein CICLE_v10031170mg             498   7e-168   
emb|CDP07655.1|  unnamed protein product                                498   2e-167   
ref|XP_006379002.1|  hypothetical protein POPTR_0009s03000g             497   2e-167   
ref|XP_004151268.1|  PREDICTED: uncharacterized protein LOC101218337    497   4e-167   
ref|XP_003532908.1|  PREDICTED: uncharacterized protein LOC100792266    496   5e-167   
ref|XP_006295574.1|  hypothetical protein CARUB_v10024679mg             496   6e-167   
gb|EYU37528.1|  hypothetical protein MIMGU_mgv1a003548mg                497   8e-167   
ref|XP_004248824.1|  PREDICTED: uncharacterized protein LOC101253331    498   1e-166   
gb|KGN58638.1|  hypothetical protein Csa_3G708680                       495   1e-166   
ref|XP_009776767.1|  PREDICTED: uncharacterized protein LOC104226450    496   2e-166   
ref|XP_006341329.1|  PREDICTED: uncharacterized protein LOC102584466    495   4e-166   
ref|XP_006397602.1|  hypothetical protein EUTSA_v10001390mg             493   5e-166   
ref|XP_006293958.1|  hypothetical protein CARUB_v10022948mg             493   1e-165   
ref|XP_004161418.1|  PREDICTED: uncharacterized protein LOC101228858    491   6e-165   
gb|KEH38307.1|  DUF946 family protein                                   490   1e-164   
emb|CDX83433.1|  BnaA03g20730D                                          490   2e-164   
ref|XP_002880101.1|  hypothetical protein ARALYDRAFT_483550             490   3e-164   
ref|NP_030964.1|  uncharacterized protein                               488   9e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009143004.1|  PREDICTED: uncharacterized protein LOC103866778    488   1e-163   
ref|NP_850414.1|  uncharacterized protein                               488   2e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010518017.1|  PREDICTED: uncharacterized protein LOC104793362    487   2e-163   
ref|XP_010506336.1|  PREDICTED: uncharacterized protein LOC104782963    486   4e-163   
ref|XP_010508320.1|  PREDICTED: uncharacterized protein LOC104784914    485   9e-163   
ref|XP_008804360.1|  PREDICTED: uncharacterized protein LOC103717662    484   3e-162   
ref|XP_002880097.1|  hypothetical protein ARALYDRAFT_483546             483   8e-162   
ref|NP_030961.1|  uncharacterized protein                               482   1e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548708.2|  PREDICTED: uncharacterized protein LOC100808166    481   5e-161   
gb|AES66093.2|  DUF946 family protein                                   481   5e-161   
ref|XP_003595842.1|  hypothetical protein MTR_2g062430                  481   6e-161   
gb|KHM99442.1|  hypothetical protein glysoja_045356                     481   8e-161   
gb|KFK37236.1|  hypothetical protein AALP_AA4G231600                    480   1e-160   
ref|XP_010675110.1|  PREDICTED: uncharacterized protein LOC104891...    479   2e-160   
ref|XP_010923372.1|  PREDICTED: uncharacterized protein LOC105046482    479   4e-160   
ref|XP_010675107.1|  PREDICTED: uncharacterized protein LOC104891...    481   4e-160   
ref|XP_010675108.1|  PREDICTED: uncharacterized protein LOC104891...    479   5e-160   
gb|EYU27168.1|  hypothetical protein MIMGU_mgv1a019297mg                478   7e-160   
ref|XP_009388451.1|  PREDICTED: uncharacterized protein LOC103975261    476   3e-159   
gb|EPS59601.1|  hypothetical protein M569_15204                         476   5e-159   
ref|XP_007156321.1|  hypothetical protein PHAVU_003G276600g             474   2e-158   
ref|XP_009385972.1|  PREDICTED: uncharacterized protein LOC103973196    469   2e-156   
ref|XP_008813096.1|  PREDICTED: uncharacterized protein LOC103723822    468   5e-156   
ref|XP_010099772.1|  hypothetical protein L484_010959                   466   2e-155   
ref|XP_009385974.1|  PREDICTED: uncharacterized protein LOC103973198    466   2e-155   
gb|KHN49064.1|  hypothetical protein glysoja_031275                     467   4e-155   
ref|XP_003545952.1|  PREDICTED: uncharacterized protein LOC100820073    466   7e-155   
ref|XP_009354799.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    466   1e-154   
gb|ABN08110.1|  Protein of unknown function DUF946, plant               465   1e-154   Medicago truncatula
ref|XP_003595840.1|  hypothetical protein MTR_2g062410                  465   3e-154   
gb|AES66087.2|  DUF946 family protein                                   463   2e-153   
ref|XP_003595836.1|  Vacuolar protein sorting-associated protein        462   8e-153   
ref|XP_010934618.1|  PREDICTED: uncharacterized protein LOC105054732    459   1e-152   
emb|CDY00059.1|  BnaC09g02420D                                          454   3e-150   
ref|XP_006858981.1|  hypothetical protein AMTR_s00068p00125530          451   2e-149   
emb|CDY19950.1|  BnaA09g03010D                                          450   9e-149   
ref|XP_009111945.1|  PREDICTED: uncharacterized protein LOC103837336    449   2e-148   
emb|CDX86305.1|  BnaA06g30220D                                          448   4e-148   
gb|KHN21340.1|  hypothetical protein glysoja_026541                     447   1e-147   
ref|XP_006585380.1|  PREDICTED: uncharacterized protein LOC100783773    448   1e-147   
ref|XP_006395185.1|  hypothetical protein EUTSA_v10005422mg             445   8e-147   
ref|XP_010030212.1|  PREDICTED: uncharacterized protein LOC104420...    450   1e-146   
ref|XP_010030210.1|  PREDICTED: uncharacterized protein LOC104420...    450   1e-146   
ref|XP_010236503.1|  PREDICTED: uncharacterized protein LOC104584083    443   3e-146   
emb|CDX77088.1|  BnaC04g38830D                                          436   2e-144   
emb|CDY37499.1|  BnaA05g33640D                                          435   5e-144   
dbj|BAJ94819.1|  predicted protein                                      437   6e-144   
emb|CAN82512.1|  hypothetical protein VITISV_002153                     449   6e-144   Vitis vinifera
ref|XP_002884255.1|  hypothetical protein ARALYDRAFT_896056             438   7e-144   
ref|XP_006299211.1|  hypothetical protein CARUB_v10015358mg             437   3e-143   
ref|XP_010485352.1|  PREDICTED: uncharacterized protein LOC104763705    436   5e-143   
emb|CDX85337.1|  BnaC07g26480D                                          448   7e-143   
ref|XP_009124050.1|  PREDICTED: uncharacterized protein LOC103848966    435   2e-142   
ref|NP_186837.1|  uncharacterized protein                               434   3e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496432.1|  PREDICTED: uncharacterized protein LOC104773502    433   9e-142   
ref|XP_003595837.1|  hypothetical protein MTR_2g062380                  432   1e-141   
ref|XP_004958121.1|  PREDICTED: uncharacterized protein LOC101758191    431   2e-141   
emb|CDX91920.1|  BnaC03g32220D                                          427   4e-141   
gb|AAF14848.1|AC011664_30  hypothetical protein, 5' partial             428   2e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658730.1|  PREDICTED: uncharacterized protein LOC102705931    428   3e-140   
ref|NP_186836.1|  uncharacterized protein                               429   4e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004958115.1|  PREDICTED: vacuolar protein sorting-associat...    426   3e-139   
gb|EEC82315.1|  hypothetical protein OsI_26592                          425   3e-139   Oryza sativa Indica Group [Indian rice]
ref|XP_007149125.1|  hypothetical protein PHAVU_005G043100g             426   6e-139   
ref|XP_002884254.1|  hypothetical protein ARALYDRAFT_340259             425   9e-139   
tpg|DAA63291.1|  TPA: hypothetical protein ZEAMMB73_737791              424   2e-138   
ref|XP_010496430.1|  PREDICTED: uncharacterized protein LOC104773501    424   2e-138   
ref|XP_009134576.1|  PREDICTED: uncharacterized protein LOC103858883    424   3e-138   
ref|NP_001060082.1|  Os07g0575900                                       421   8e-138   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001145101.1|  uncharacterized protein LOC100278316               422   9e-138   Zea mays [maize]
gb|EEE67462.1|  hypothetical protein OsJ_24853                          421   1e-137   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002460910.1|  hypothetical protein SORBIDRAFT_02g037340          421   2e-137   Sorghum bicolor [broomcorn]
ref|XP_010485351.1|  PREDICTED: uncharacterized protein LOC104763704    422   2e-137   
emb|CDX74324.1|  BnaA03g27230D                                          422   2e-137   
ref|XP_003610391.1|  hypothetical protein MTR_4g131710                  420   1e-136   
gb|KFK37645.1|  hypothetical protein AALP_AA3G010100                    432   1e-136   
ref|XP_006408555.1|  hypothetical protein EUTSA_v10020344mg             420   1e-136   
ref|XP_002863623.1|  hypothetical protein ARALYDRAFT_494605             416   2e-135   
ref|NP_199208.1|  uncharacterized protein                               414   8e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420612.1|  PREDICTED: uncharacterized protein LOC104706157    414   1e-134   
ref|XP_006281615.1|  hypothetical protein CARUB_v10027740mg             412   7e-134   
ref|XP_010454091.1|  PREDICTED: uncharacterized protein LOC104735910    410   2e-133   
ref|XP_006287419.1|  hypothetical protein CARUB_v10000625mg             410   3e-133   
ref|XP_010481793.1|  PREDICTED: uncharacterized protein LOC104760554    409   7e-133   
ref|XP_010492853.1|  PREDICTED: uncharacterized protein LOC104770176    409   1e-132   
ref|XP_004511442.1|  PREDICTED: uncharacterized protein LOC101506...    407   2e-132   
ref|XP_006403160.1|  hypothetical protein EUTSA_v10003172mg             408   3e-132   
ref|XP_007147204.1|  hypothetical protein PHAVU_006G104300g             406   3e-132   
ref|XP_009802615.1|  PREDICTED: uncharacterized protein LOC104248123    407   6e-132   
gb|KHN49063.1|  hypothetical protein glysoja_031274                     405   1e-131   
ref|XP_010441929.1|  PREDICTED: uncharacterized protein LOC104725034    406   1e-131   
ref|XP_002873898.1|  hypothetical protein ARALYDRAFT_909860             405   1e-131   
ref|XP_004511441.1|  PREDICTED: uncharacterized protein LOC101506...    407   2e-131   
ref|XP_007147203.1|  hypothetical protein PHAVU_006G104300g             405   2e-131   
ref|XP_003538932.1|  PREDICTED: uncharacterized protein LOC100793026    405   2e-131   
ref|XP_006598236.1|  PREDICTED: uncharacterized protein LOC102669203    403   3e-131   
ref|XP_010102201.1|  hypothetical protein L484_024482                   404   7e-131   
ref|XP_009120969.1|  PREDICTED: uncharacterized protein LOC103845831    403   2e-130   
gb|KDP23733.1|  hypothetical protein JCGZ_23566                         404   2e-130   
gb|AAM64724.1|  unknown                                                 402   2e-130   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92605.1|  BnaA10g16440D                                          402   3e-130   
gb|KHG15512.1|  Vacuolar sorting-associated protein 62                  403   3e-130   
ref|NP_197350.1|  uncharacterized protein                               402   3e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004239684.1|  PREDICTED: uncharacterized protein LOC101256489    402   3e-130   
ref|XP_002263468.1|  PREDICTED: uncharacterized protein LOC100263054    402   4e-130   Vitis vinifera
emb|CBI18663.3|  unnamed protein product                                398   4e-130   
ref|XP_006299082.1|  hypothetical protein CARUB_v10015223mg             402   6e-130   
ref|XP_006585381.1|  PREDICTED: uncharacterized protein LOC100783235    400   6e-130   
gb|KFK26090.1|  hypothetical protein AALP_AA8G201500                    401   6e-130   
emb|CDY29997.1|  BnaC01g40110D                                          402   7e-130   
ref|XP_009621765.1|  PREDICTED: uncharacterized protein LOC104113342    402   7e-130   
ref|XP_010542907.1|  PREDICTED: vacuolar protein sorting-associat...    402   1e-129   
ref|XP_008796406.1|  PREDICTED: uncharacterized protein LOC103711872    401   1e-129   
ref|XP_003590981.1|  hypothetical protein MTR_1g080370                  401   1e-129   
ref|XP_010494389.1|  PREDICTED: uncharacterized protein LOC104771...    402   1e-129   
ref|XP_010024939.1|  PREDICTED: uncharacterized protein LOC104415357    401   2e-129   
ref|XP_009395601.1|  PREDICTED: uncharacterized protein LOC103980787    400   2e-129   
ref|XP_002521999.1|  conserved hypothetical protein                     400   2e-129   Ricinus communis
ref|XP_010414155.1|  PREDICTED: uncharacterized protein LOC104700315    400   2e-129   
ref|XP_011038467.1|  PREDICTED: uncharacterized protein LOC105135340    400   2e-129   
ref|XP_009598580.1|  PREDICTED: uncharacterized protein LOC104094361    400   4e-129   
ref|XP_002319114.1|  hypothetical protein POPTR_0013s04580g             400   4e-129   Populus trichocarpa [western balsam poplar]
ref|XP_010463914.1|  PREDICTED: uncharacterized protein LOC104744543    399   5e-129   
ref|XP_007131534.1|  hypothetical protein PHAVU_011G021100g             400   6e-129   
ref|XP_006408193.1|  hypothetical protein EUTSA_v10020390mg             399   7e-129   
ref|XP_010674262.1|  PREDICTED: uncharacterized protein LOC104890460    398   1e-128   
gb|AFK13836.1|  putative pre-mRNA processing protein PRP39              399   1e-128   
gb|AES89598.2|  pre-mRNA processing protein PRP39, putative             398   2e-128   
gb|KFK37858.1|  hypothetical protein AALP_AA3G038300                    398   2e-128   
gb|EYU46397.1|  hypothetical protein MIMGU_mgv1a003803mg                398   2e-128   
ref|XP_007149123.1|  hypothetical protein PHAVU_005G043000g             394   2e-128   
gb|EYU39520.1|  hypothetical protein MIMGU_mgv1a003717mg                398   2e-128   
ref|NP_171905.1|  uncharacterized protein                               398   2e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006345810.1|  PREDICTED: uncharacterized protein LOC102590400    398   2e-128   
ref|XP_003607401.1|  hypothetical protein MTR_4g077620                  400   2e-128   
ref|XP_009370479.1|  PREDICTED: uncharacterized protein LOC103959833    397   3e-128   
ref|XP_009772277.1|  PREDICTED: uncharacterized protein LOC104222703    397   3e-128   
ref|XP_009123923.1|  PREDICTED: uncharacterized protein LOC103848849    397   4e-128   
gb|KHN21339.1|  hypothetical protein glysoja_026540                     396   5e-128   
ref|XP_004495588.1|  PREDICTED: uncharacterized protein LOC101489287    397   5e-128   
ref|XP_006400398.1|  hypothetical protein EUTSA_v10013152mg             396   5e-128   
ref|XP_004155688.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    396   5e-128   
ref|XP_006400397.1|  hypothetical protein EUTSA_v10013152mg             396   6e-128   
ref|XP_004142542.1|  PREDICTED: uncharacterized protein LOC101216081    396   6e-128   
emb|CDY14902.1|  BnaA02g22440D                                          397   7e-128   
ref|XP_006355887.1|  PREDICTED: uncharacterized protein LOC102585636    397   8e-128   
ref|XP_010262454.1|  PREDICTED: uncharacterized protein LOC104600975    396   9e-128   
ref|XP_009379740.1|  PREDICTED: uncharacterized protein LOC103968124    396   9e-128   
ref|XP_004505614.1|  PREDICTED: uncharacterized protein LOC101493338    396   1e-127   
ref|XP_009124997.1|  PREDICTED: uncharacterized protein LOC103850048    395   2e-127   
ref|XP_008388738.1|  PREDICTED: uncharacterized protein LOC103451082    395   2e-127   
gb|KDO60351.1|  hypothetical protein CISIN_1g045952mg                   395   2e-127   
ref|XP_006437467.1|  hypothetical protein CICLE_v10031092mg             395   2e-127   
ref|XP_006340465.1|  PREDICTED: uncharacterized protein LOC102604240    395   2e-127   
ref|XP_006484620.1|  PREDICTED: uncharacterized protein LOC102609992    395   3e-127   
gb|KDO53065.1|  hypothetical protein CISIN_1g008314mg                   395   3e-127   
ref|XP_010936079.1|  PREDICTED: vacuolar protein sorting-associat...    394   4e-127   
ref|XP_010264864.1|  PREDICTED: uncharacterized protein LOC104602762    394   5e-127   
ref|XP_010485809.1|  PREDICTED: uncharacterized protein LOC104764063    394   5e-127   
ref|XP_003556481.1|  PREDICTED: uncharacterized protein LOC100814522    394   6e-127   
ref|XP_008218355.1|  PREDICTED: vacuolar protein sorting-associat...    393   6e-127   
emb|CDX89845.1|  BnaA10g02370D                                          394   7e-127   
emb|CDY21128.1|  BnaA01g33590D                                          393   1e-126   
ref|XP_009757101.1|  PREDICTED: uncharacterized protein LOC104210010    394   1e-126   
ref|XP_010326346.1|  PREDICTED: uncharacterized protein LOC101247062    394   1e-126   
gb|EAY88495.1|  hypothetical protein OsI_09966                          392   1e-126   Oryza sativa Indica Group [Indian rice]
ref|XP_007149124.1|  hypothetical protein PHAVU_005G043000g             391   1e-126   
ref|XP_011077064.1|  PREDICTED: uncharacterized protein LOC105161158    393   2e-126   
ref|XP_007204992.1|  hypothetical protein PRUPE_ppa003496mg             393   2e-126   
gb|KHN14825.1|  hypothetical protein glysoja_020998                     392   2e-126   
ref|XP_006854359.1|  hypothetical protein AMTR_s00039p00159460          393   2e-126   
ref|XP_003536134.1|  PREDICTED: uncharacterized protein LOC100788778    392   2e-126   
gb|KHG12486.1|  Vacuolar sorting-associated protein 62                  392   3e-126   
gb|KHN25608.1|  hypothetical protein glysoja_018182                     392   5e-126   
ref|NP_001048935.1|  Os03g0142900                                       391   5e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009591728.1|  PREDICTED: uncharacterized protein LOC104088707    392   5e-126   
ref|XP_003610864.1|  hypothetical protein MTR_5g007860                  393   5e-126   
gb|ABF93921.1|  pre-mRNA processing protein PRP39, putative, expr...    391   5e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008218354.1|  PREDICTED: uncharacterized protein LOC103318...    392   6e-126   
gb|KFK31677.1|  hypothetical protein AALP_AA6G144800                    392   7e-126   
ref|XP_008443774.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    391   8e-126   
ref|XP_010483068.1|  PREDICTED: uncharacterized protein LOC104761646    391   8e-126   
ref|XP_006443731.1|  hypothetical protein CICLE_v10019502mg             391   9e-126   
ref|XP_004237516.1|  PREDICTED: uncharacterized protein LOC101249631    390   1e-125   
emb|CDX95597.1|  BnaC03g24780D                                          388   1e-125   
ref|XP_011080117.1|  PREDICTED: uncharacterized protein LOC105163463    392   1e-125   
ref|XP_007143957.1|  hypothetical protein PHAVU_007G116800g             390   1e-125   
ref|XP_002272156.1|  PREDICTED: uncharacterized protein LOC100259944    390   3e-125   Vitis vinifera
emb|CBI37192.3|  unnamed protein product                                391   5e-125   
gb|KFK42751.1|  hypothetical protein AALP_AA1G034900                    387   5e-125   
ref|XP_010691359.1|  PREDICTED: vacuolar protein sorting-associat...    386   5e-125   
ref|XP_002526543.1|  conserved hypothetical protein                     389   7e-125   Ricinus communis
emb|CDY18204.1|  BnaC05g02270D                                          388   8e-125   
ref|XP_002465876.1|  hypothetical protein SORBIDRAFT_01g047420          388   1e-124   Sorghum bicolor [broomcorn]
gb|EMT32036.1|  hypothetical protein F775_07429                         388   1e-124   
ref|XP_004985743.1|  PREDICTED: uncharacterized protein LOC101775810    388   1e-124   
emb|CDP03796.1|  unnamed protein product                                389   1e-124   
emb|CDX96930.1|  BnaC02g30680D                                          388   2e-124   
ref|XP_006651028.1|  PREDICTED: uncharacterized protein LOC102705992    387   2e-124   
emb|CAN77840.1|  hypothetical protein VITISV_015561                     388   2e-124   Vitis vinifera
emb|CDP04277.1|  unnamed protein product                                387   2e-124   
ref|XP_007157037.1|  hypothetical protein PHAVU_002G038300g             388   3e-124   
ref|XP_002889490.1|  hypothetical protein ARALYDRAFT_333729             405   4e-124   
ref|XP_009119330.1|  PREDICTED: uncharacterized protein LOC103844286    386   5e-124   
ref|NP_566224.1|  uncharacterized protein                               386   6e-124   
ref|XP_003538659.2|  PREDICTED: uncharacterized protein LOC100811439    387   8e-124   
ref|XP_009343782.1|  PREDICTED: vacuolar protein sorting-associat...    385   1e-123   
dbj|BAJ86107.1|  predicted protein                                      385   1e-123   
ref|XP_010691350.1|  PREDICTED: uncharacterized protein LOC104904...    385   2e-123   
gb|ACN26628.1|  unknown                                                 385   2e-123   
ref|XP_008370756.1|  PREDICTED: uncharacterized protein LOC103434218    385   3e-123   
ref|XP_008382713.1|  PREDICTED: uncharacterized protein LOC103445...    384   3e-123   
ref|XP_002884442.1|  hypothetical protein ARALYDRAFT_477694             385   3e-123   
ref|XP_003558835.1|  PREDICTED: uncharacterized protein LOC100834654    384   5e-123   
ref|XP_010549647.1|  PREDICTED: uncharacterized protein LOC104820762    384   5e-123   
gb|AAC16751.1|  Contains similarity to pre-mRNA processing protei...    403   5e-123   
ref|XP_006304926.1|  hypothetical protein CARUB_v10012003mg             384   7e-123   
ref|NP_001145283.1|  uncharacterized protein LOC100278579               383   1e-122   
ref|XP_008235593.1|  PREDICTED: uncharacterized protein LOC103334410    383   1e-122   
ref|XP_008382712.1|  PREDICTED: uncharacterized protein LOC103445...    383   2e-122   
gb|EMS62765.1|  hypothetical protein TRIUR3_20195                       381   2e-122   
gb|KHN43170.1|  Glycogenin-1                                            400   2e-122   
gb|KDP26464.1|  hypothetical protein JCGZ_17622                         382   3e-122   
ref|XP_007030349.1|  Vacuolar protein sorting-associated protein 62     383   4e-122   
ref|XP_003559488.1|  PREDICTED: uncharacterized protein LOC100822588    382   6e-122   
ref|XP_003595833.1|  hypothetical protein MTR_2g062340                  379   8e-122   
ref|XP_010475050.1|  PREDICTED: uncharacterized protein LOC104754534    381   8e-122   
ref|XP_004302106.1|  PREDICTED: uncharacterized protein LOC101296875    381   9e-122   
ref|XP_007199743.1|  hypothetical protein PRUPE_ppa003532mg             381   1e-121   
ref|XP_009335224.1|  PREDICTED: vacuolar protein sorting-associat...    379   3e-121   
gb|EYU40301.1|  hypothetical protein MIMGU_mgv1a018219mg                375   4e-121   
ref|XP_010457440.1|  PREDICTED: uncharacterized protein LOC104738921    379   5e-121   
ref|XP_010918943.1|  PREDICTED: uncharacterized protein LOC105043187    378   1e-120   
ref|XP_002320610.1|  hypothetical protein POPTR_0014s18710g             377   2e-120   
ref|XP_009335223.1|  PREDICTED: uncharacterized protein LOC103927...    377   2e-120   
ref|XP_002970679.1|  hypothetical protein SELMODRAFT_94162              375   3e-120   
ref|XP_004157618.1|  PREDICTED: uncharacterized protein LOC101230031    377   3e-120   
ref|XP_001782049.1|  predicted protein                                  376   4e-120   
ref|XP_008459966.1|  PREDICTED: uncharacterized protein LOC103498924    377   4e-120   
ref|XP_009397900.1|  PREDICTED: uncharacterized protein LOC103982643    376   4e-120   
ref|XP_007050164.1|  Vacuolar protein sorting-associated protein ...    376   5e-120   
ref|XP_010684871.1|  PREDICTED: uncharacterized protein LOC104899394    376   6e-120   
gb|KGN66742.1|  hypothetical protein Csa_1G668000                       370   6e-120   
ref|XP_004289989.1|  PREDICTED: uncharacterized protein LOC101301919    376   8e-120   
gb|KGN46372.1|  hypothetical protein Csa_6G088000                       377   8e-120   
ref|XP_011014100.1|  PREDICTED: uncharacterized protein LOC105117...    375   1e-119   
ref|XP_011014095.1|  PREDICTED: uncharacterized protein LOC105117...    375   1e-119   
ref|XP_004140668.1|  PREDICTED: uncharacterized protein LOC101209282    375   1e-119   
dbj|BAJ96649.1|  predicted protein                                      375   3e-119   
ref|XP_011102311.1|  PREDICTED: uncharacterized protein LOC105180351    373   8e-119   
ref|XP_001776039.1|  predicted protein                                  372   1e-118   
gb|KHG08645.1|  Vacuolar sorting-associated protein 62                  373   4e-118   
ref|NP_001183917.1|  hypothetical protein                               371   5e-118   
ref|XP_004963802.1|  PREDICTED: uncharacterized protein LOC101761210    381   7e-118   
ref|XP_010659612.1|  PREDICTED: uncharacterized protein LOC100242...    369   9e-118   
ref|XP_004488585.1|  PREDICTED: uncharacterized protein LOC101493362    366   1e-117   
ref|XP_002463969.1|  hypothetical protein SORBIDRAFT_01g009850          369   4e-117   
ref|XP_002969346.1|  hypothetical protein SELMODRAFT_231324             366   8e-117   
ref|XP_010036155.1|  PREDICTED: uncharacterized protein LOC104425227    367   1e-116   
ref|NP_001051103.1|  Os03g0721300                                       367   3e-116   
ref|XP_004981952.1|  PREDICTED: uncharacterized protein LOC101772813    367   3e-116   
gb|EAY91685.1|  hypothetical protein OsI_13324                          367   3e-116   
gb|KHG05685.1|  Vacuolar sorting-associated protein 62                  366   4e-116   
ref|XP_010091803.1|  hypothetical protein L484_015871                   365   2e-115   
emb|CDP20933.1|  unnamed protein product                                342   2e-107   
gb|KHN46446.1|  hypothetical protein glysoja_035122                     329   2e-104   
ref|XP_006651759.1|  PREDICTED: uncharacterized protein LOC102718729    310   4e-96    
ref|XP_011102188.1|  PREDICTED: uncharacterized protein LOC105180219    309   4e-94    
gb|EMT06465.1|  hypothetical protein F775_20569                         288   6e-88    
gb|AFK34680.1|  unknown                                                 249   8e-75    
emb|CDY17873.1|  BnaC04g03460D                                          228   5e-66    
emb|CDX79771.1|  BnaA05g03850D                                          223   4e-64    
gb|EMS50099.1|  hypothetical protein TRIUR3_09038                       209   2e-58    
ref|XP_010435678.1|  PREDICTED: uncharacterized protein LOC104719438    196   2e-53    
ref|XP_011069465.1|  PREDICTED: uncharacterized protein LOC105155289    161   3e-41    
gb|EMT10845.1|  hypothetical protein F775_21218                         160   1e-40    
gb|EMS61200.1|  hypothetical protein TRIUR3_15102                       156   2e-39    
gb|AFG46742.1|  hypothetical protein 2_8324_01                          128   2e-31    
gb|AFG46743.1|  hypothetical protein 2_8324_01                          128   2e-31    
ref|WP_027708770.1|  hypothetical protein                               135   4e-31    
gb|AEW08399.1|  hypothetical protein 2_8324_01                          125   1e-30    
ref|XP_007749619.1|  hypothetical protein A1O5_10855                    131   2e-30    
ref|XP_008730619.1|  hypothetical protein G647_08085                    130   4e-30    
ref|XP_007761306.1|  hypothetical protein A1O7_09127                    129   1e-29    
ref|XP_008078932.1|  hypothetical protein GLAREA_06793                  123   1e-27    
gb|AEW07906.1|  hypothetical protein 0_14113_01                         116   3e-27    
emb|CDX79770.1|  BnaA05g03860D                                          113   4e-26    
gb|KFY25369.1|  hypothetical protein V491_01781                         119   2e-25    
gb|KFY65196.1|  hypothetical protein V496_02737                         117   4e-25    
gb|KFY83123.1|  hypothetical protein V498_08288                         117   4e-25    
emb|CDY17872.1|  BnaC04g03470D                                          107   3e-24    
emb|CBI22319.3|  unnamed protein product                                111   1e-23    
gb|EHK99473.1|  hypothetical protein M7I_4630                           110   7e-23    
ref|XP_006605254.1|  PREDICTED: uncharacterized protein LOC102664486  94.4    4e-18    
ref|WP_002632696.1|  hypothetical protein                             97.8    6e-18    
ref|XP_006580739.1|  PREDICTED: uncharacterized protein LOC102670058  92.4    2e-17    
ref|XP_006386907.1|  hypothetical protein POPTR_0002s25860g           89.7    6e-17    
ref|WP_014395918.1|  hypothetical protein                             94.0    7e-17    
ref|WP_034582056.1|  hypothetical protein                             83.6    3e-14    
ref|WP_014263281.1|  hypothetical protein                             84.0    3e-14    
gb|KFA92156.1|  hypothetical protein Q664_17835                       84.7    5e-14    
gb|KHN31487.1|  hypothetical protein glysoja_035594                   82.0    8e-14    
ref|WP_010964111.1|  hypothetical protein                             79.3    1e-12    
ref|WP_002613656.1|  hypothetical protein                             80.1    1e-12    
ref|WP_020602901.1|  hypothetical protein                             77.4    4e-12    
gb|KFE70734.1|  hypothetical protein DB31_5776                        77.8    8e-12    
gb|KFM22940.1|  2-Cys peroxiredoxin BAS1, chloroplastic               72.4    4e-10    
emb|CDX79766.1|  BnaA05g03900D                                        65.9    8e-10    
ref|XP_005852159.1|  hypothetical protein CHLNCDRAFT_133315           70.5    1e-09    
gb|KDD77060.1|  hypothetical protein H632_c29p0                       70.1    2e-09    
ref|XP_005644421.1|  hypothetical protein COCSUDRAFT_48717            70.1    2e-09    
ref|XP_001690387.1|  hypothetical protein CHLREDRAFT_144253           69.3    3e-09    
ref|WP_039149676.1|  hypothetical protein                             68.9    6e-09    
ref|WP_028157638.1|  hypothetical protein                             68.6    7e-09    
ref|XP_001761724.1|  predicted protein                                67.8    8e-09    
ref|WP_038955235.1|  hypothetical protein                             68.2    1e-08    
ref|WP_014495896.1|  hypothetical protein                             67.8    1e-08    
ref|WP_038931916.1|  hypothetical protein                             66.6    3e-08    
gb|KIM28454.1|  hypothetical protein M408DRAFT_329508                 65.9    4e-08    
gb|KIM28455.1|  hypothetical protein M408DRAFT_141510                 65.5    4e-08    
ref|XP_007346065.1|  hypothetical protein AURDEDRAFT_184584           63.9    2e-07    
gb|KDN45374.1|  hypothetical protein RSAG8_04961                      63.2    3e-07    
ref|XP_011112367.1|  hypothetical protein H072_6583                   62.0    4e-07    
ref|WP_006974661.1|  Uncharacterized conserved protein of probabl...  62.0    5e-07    
gb|KEP54303.1|  putative vacuolar targeting-like protein              61.6    8e-07    
ref|XP_001937456.1|  conserved hypothetical protein                   60.5    2e-06    
ref|WP_040504193.1|  hypothetical protein                             58.2    2e-06    
ref|XP_003298040.1|  hypothetical protein PTT_08621                   59.3    3e-06    
gb|ENH83811.1|  vacuolar protein sorting-associated protein 62        59.7    3e-06    
ref|XP_007006660.1|  hypothetical protein TREMEDRAFT_33600            59.3    5e-06    
gb|AFR95712.2|  hypothetical protein CNAG_02107                       58.5    9e-06    
ref|XP_003958544.1|  hypothetical protein KAFR_0G03760                58.2    9e-06    
gb|KHD07230.1|  hypothetical protein OT06_36755                       56.2    1e-05    
emb|CEL53891.1|  Putative vacuolar protein sorting-associated pro...  57.0    2e-05    
ref|XP_011107608.1|  hypothetical protein H072_1616                   57.4    2e-05    
emb|CCA75387.1|  hypothetical protein PIIN_09371                      57.4    2e-05    
gb|EWC47694.1|  hypothetical protein DRE_02894                        57.0    2e-05    
ref|XP_002613786.1|  hypothetical protein BRAFLDRAFT_85327            57.4    2e-05    
gb|KID85386.1|  vacuolar protein sorting-associated protein 62        56.2    2e-05    
ref|WP_013000104.1|  hypothetical protein                             56.6    2e-05    
ref|WP_037724098.1|  hypothetical protein                             55.8    3e-05    
ref|XP_003334382.2|  hypothetical protein PGTG_16251                  56.2    4e-05    
ref|XP_008030717.1|  hypothetical protein SETTUDRAFT_44312            55.8    4e-05    
gb|KEF59457.1|  hypothetical protein A1O9_04301                       55.8    5e-05    
gb|KIG17653.1|  Multiple EGF-like-domain protein 3 precursor          55.8    5e-05    
ref|XP_003851536.1|  hypothetical protein MYCGRDRAFT_22198            55.8    6e-05    
gb|KIH94009.1|  hypothetical protein SPBR_05971                       55.5    7e-05    
gb|EZP28789.1|  hypothetical protein BW33_04146                       55.5    7e-05    
gb|KDN71289.1|  putative vacuolar protein sorting-associated prot...  55.5    7e-05    
ref|XP_007822274.1|  hypothetical protein MAA_06085                   54.3    8e-05    
ref|XP_007360685.1|  hypothetical protein DICSQDRAFT_142837           55.1    8e-05    
ref|XP_002837732.1|  hypothetical protein                             55.1    1e-04    
gb|EQB55524.1|  vacuolar protein sorting-associated protein 62        55.1    1e-04    
ref|XP_007924043.1|  hypothetical protein MYCFIDRAFT_151930           54.7    1e-04    
ref|XP_011122670.1|  hypothetical protein AOL_s00079g493              54.3    1e-04    
ref|XP_007388160.1|  hypothetical protein PUNSTDRAFT_92710            54.3    2e-04    
ref|XP_008722638.1|  hypothetical protein G647_01014                  53.9    2e-04    
ref|XP_002629551.1|  conserved hypothetical protein                   53.9    2e-04    
gb|EGZ76011.1|  hypothetical protein NEUTE2DRAFT_84996                54.3    2e-04    
ref|WP_027611258.1|  hypothetical protein                             54.3    2e-04    
ref|XP_009847415.1|  hypothetical protein NEUTE1DRAFT_74789           54.3    2e-04    
ref|XP_957383.1|  hypothetical protein NCU07158                       54.3    2e-04    
gb|KID79757.1|  vacuolar protein sorting-associated protein 62        53.9    2e-04    
gb|EUC63420.1|  vacuolar targeting-like protein, putative             53.9    2e-04    
emb|CCA75388.1|  hypothetical protein PIIN_09372                      53.9    3e-04    
ref|XP_002585521.1|  hypothetical protein BRAFLDRAFT_111924           54.3    3e-04    
gb|KIE02752.1|  vacuolar protein sorting-associated protein 62        53.5    3e-04    
gb|KFY69996.1|  hypothetical protein V499_09567                       53.1    3e-04    
ref|XP_007730545.1|  hypothetical protein A1O3_02212                  53.1    3e-04    
gb|EMD90021.1|  hypothetical protein COCHEDRAFT_1031382               53.5    3e-04    
ref|XP_007685598.1|  hypothetical protein COCMIDRAFT_88913            53.1    3e-04    
gb|ERS98968.1|  hypothetical protein HMPREF1624_04163                 53.1    3e-04    
ref|XP_003344625.1|  hypothetical protein SMAC_06933                  53.5    3e-04    
emb|CEL62565.1|  Putative vacuolar protein sorting-associated pro...  53.1    4e-04    
ref|XP_007677197.1|  hypothetical protein BAUCODRAFT_109511           53.5    4e-04    
gb|KHN96685.1|  vacuolar protein sorting-associated protein 62        53.1    4e-04    
emb|CDM31873.1|  Vacuolar protein sorting-associated protein 62       53.1    4e-04    
ref|XP_007832154.1|  hypothetical protein PFICI_05382                 53.5    4e-04    
gb|ELR10750.1|  hypothetical protein GMDG_05005                       53.1    4e-04    
ref|XP_002600077.1|  hypothetical protein BRAFLDRAFT_79665            52.8    4e-04    
dbj|GAA99938.1|  hypothetical protein E5Q_06641                       53.5    5e-04    
gb|KEI40907.1|  hypothetical protein L969DRAFT_59975                  53.5    5e-04    
ref|WP_017254024.1|  hypothetical protein                             52.8    5e-04    
gb|EQB45583.1|  vacuolar protein sorting-associated protein           53.1    5e-04    
ref|XP_007276536.1|  vacuolar protein sorting protein 62              53.1    5e-04    
gb|ENH82056.1|  vacuolar protein sorting protein 62                   52.8    5e-04    
gb|KFG79761.1|  vacuolar protein sorting-associated protein 62        52.4    6e-04    
ref|XP_007698568.1|  hypothetical protein COCSADRAFT_139336           52.4    6e-04    
ref|XP_007713497.1|  hypothetical protein COCCADRAFT_99265            52.4    7e-04    
gb|KFH47504.1|  putative vacuolar protein sorting-associated prot...  52.8    7e-04    
ref|WP_011332022.1|  hypothetical protein                             52.4    7e-04    
gb|KID68225.1|  vacuolar protein sorting-associated protein 62        52.4    7e-04    
ref|XP_008088273.1|  hypothetical protein GLAREA_08035                52.0    8e-04    
ref|XP_008718523.1|  hypothetical protein HMPREF1541_05964            52.0    8e-04    
gb|EUN31586.1|  hypothetical protein COCVIDRAFT_12251                 52.0    9e-04    
ref|XP_007745185.1|  hypothetical protein A1O5_06401                  51.6    9e-04    
emb|CCF45029.1|  vacuolar protein sorting-associated protein 62       51.6    0.001    
ref|XP_001585955.1|  hypothetical protein SS1G_13047                  51.6    0.001    
ref|XP_009651211.1|  vacuolar protein sorting-associated protein      52.4    0.001    



>emb|CDP14941.1| unnamed protein product [Coffea canephora]
Length=563

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/440 (61%), Positives = 337/440 (77%), Gaps = 10/440 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y L+WSS+SL  +Q G  Y+WLPV P GY AVG+VVT + +KPS D++RCV S  TD CE
Sbjct  126   YALIWSSESLKTSQDGHGYIWLPVAPDGYRAVGYVVTATPDKPSLDKVRCVISELTDECE  185

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL----GSFSGNVGTFACLKN  1204
              E+W+WG G +++D + FN+Y+ RP  RG QA+GV V TF+       + +  T ACLKN
Sbjct  186   AENWIWGEGKTSSDSD-FNVYSSRPSVRGIQAQGVGVNTFIVENESDDNSSSTTIACLKN  244

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
             NN + + S+MPN+ Q+EALF+ YSP ++LHP + Y PSSVNW+F NGALLYTKGDE+NPV
Sbjct  245   NNFS-TFSSMPNMQQVEALFQAYSPWIFLHPKENYFPSSVNWYFENGALLYTKGDESNPV  303

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I  +G+NLPQG +NDG YW++LPVD N KE+VK+GDLQS+E Y+ IKPM G TFTDI+I
Sbjct  304   AIQNNGANLPQGESNDGAYWLDLPVDENAKEKVKKGDLQSAEAYIQIKPMLGATFTDISI  363

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIFYPFNGP TAKLG I+ IPLG  GEHIGDWEHLTLRISNFNG+L KVYFSEHS G WV
Sbjct  364   WIFYPFNGPGTAKLGLID-IPLGRTGEHIGDWEHLTLRISNFNGILYKVYFSEHSKGIWV  422

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
             DAP LEF +G+NK VAYS+L+GH+NY KPGLVLQG GD+GIRND AKS   LDTG +YS+
Sbjct  423   DAPLLEFHDGTNKPVAYSALSGHSNYPKPGLVLQGAGDVGIRNDAAKSDKFLDTGAKYSI  482

Query  483   VAGLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             V+      GIVEPPW+ Y R+WGP I Y +  ++++VE  LP   +  F  L+++LP E 
Sbjct  483   VSAENLGLGIVEPPWLNYLRKWGPDIVYETGVEVQKVEGSLPENLKSAFARLVNILPKEV  542

Query  312   FGEEGPTGPNMKASWSGDEK  253
             +GEEGPTGP +K SWSGDE+
Sbjct  543   YGEEGPTGPKVKGSWSGDER  562



>emb|CDP14942.1| unnamed protein product [Coffea canephora]
Length=563

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/439 (63%), Positives = 335/439 (76%), Gaps = 10/439 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y L+WSS+SL  +Q G  Y+WLPV P GY AVG+VVT + +KPS D++RCV S  TD CE
Sbjct  126   YALIWSSESLKTSQDGHGYIWLPVAPDGYRAVGYVVTATPDKPSLDKVRCVISELTDKCE  185

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL---GSFSGNVGT-FACLKN  1204
              E+W+WG G +++D + FN+Y+ RP  RG QA+GV V TF+   GS   +  T  ACLKN
Sbjct  186   SENWIWGHGKTSSDSD-FNVYSSRPSGRGIQAQGVGVNTFIVKNGSDDNSTSTTIACLKN  244

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
             NN + + S+MPNL QIEALF+ YSP ++ HP +TY PSSVNW+F NGALLYTKG E+NPV
Sbjct  245   NNFS-TFSSMPNLQQIEALFQAYSPWVFFHPKETYFPSSVNWYFENGALLYTKGAESNPV  303

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I  +G+NLPQG +ND  YW++LPVD N KERVK+G LQS+EVYL IKPM G TFTDIAI
Sbjct  304   AIQYNGANLPQGESNDEAYWLDLPVDKNAKERVKKGFLQSAEVYLQIKPMLGATFTDIAI  363

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIFYPFNGP TAKLG ++ IPLG IGEHIGDWEHLTLRISNFNG+L KVYFSEHS G WV
Sbjct  364   WIFYPFNGPGTAKLGLVD-IPLGRIGEHIGDWEHLTLRISNFNGILYKVYFSEHSKGIWV  422

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
             DAP LEF +G+NK VAYS+L+GH NY KPGLVLQG GD+GIRND AKS   LDTG +YS+
Sbjct  423   DAPLLEFHDGTNKPVAYSALSGHPNYPKPGLVLQGAGDVGIRNDAAKSDKFLDTGAKYSI  482

Query  483   VAGLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             V+      GIVEPPW+ Y R+WGP I Y    + ++VE LLP   +  F  L+ +LPNEF
Sbjct  483   VSAENLGLGIVEPPWLNYLRKWGPNIVYEPGVEAQKVERLLPQNLKPAFARLVKILPNEF  542

Query  312   FGEEGPTGPNMKASWSGDE  256
             +GE+GPTGP +K +WSGDE
Sbjct  543   YGEDGPTGPKVKGTWSGDE  561



>ref|XP_010053627.1| PREDICTED: uncharacterized protein LOC104442037 [Eucalyptus grandis]
 gb|KCW77971.1| hypothetical protein EUGRSUZ_D02217 [Eucalyptus grandis]
Length=554

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/437 (62%), Positives = 335/437 (77%), Gaps = 9/437 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G  Y+WLPVPP+GY AVGHVVT+S EKPS D+IRCV   FTD CE
Sbjct  121   YTLVWSSESLKIKQDGYGYIWLPVPPEGYKAVGHVVTSSPEKPSLDKIRCVRLDFTDQCE  180

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT--FACLKNNN  1198
              + W+WG   S+ D +GFN+Y+LRP NRG QA GV VGTFL     N  +   +CLKNNN
Sbjct  181   TDSWIWGPDKSS-DTSGFNVYSLRPANRGIQALGVSVGTFLAQNGANDTSPALSCLKNNN  239

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               ++SS MPN+SQ++ALF+ YSP +Y HP +TY PSSVNWFFSNGALLY KGDE+NPV +
Sbjct  240   PNYTSS-MPNISQLQALFQAYSPFVYFHPDETYLPSSVNWFFSNGALLYKKGDESNPVAV  298

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
               +GSNLP GG+NDG YW++LP D   KERVK+GDLQS + Y ++KPM+G TFTDIA+W+
Sbjct  299   ELNGSNLPLGGSNDGAYWLDLPKDQAAKERVKKGDLQSFQAYAHVKPMYGATFTDIALWL  358

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+ AKL ++  IPLG IGEH+GDWEH+TLRISNF G L +VYFS+HS G+WV+A
Sbjct  359   FYPFNGPARAKL-ELITIPLGKIGEHVGDWEHVTLRISNFTGELWEVYFSQHSSGTWVNA  417

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               LEF +G N+ VAY+SLNGHA YSKPGLVLQG G IGIRNDTAKS  V+DT + +S++A
Sbjct  418   SELEFQSG-NRFVAYASLNGHALYSKPGLVLQGSGGIGIRNDTAKSKMVVDTQVAHSLIA  476

Query  477   G---LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                    I   PWV Y REWGPKITY + E++K+VE +LP + +  F++++  LP+E  G
Sbjct  477   ADYPSTSISSLPWVNYLREWGPKITYDTAEELKKVEQVLPAKLKSAFDSVVKSLPSELLG  536

Query  306   EEGPTGPNMKASWSGDE  256
             EEGPTGP  K +WSGDE
Sbjct  537   EEGPTGPKAKNNWSGDE  553



>ref|XP_009615972.1| PREDICTED: uncharacterized protein LOC104108601 [Nicotiana tomentosiformis]
Length=573

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/442 (62%), Positives = 335/442 (76%), Gaps = 14/442 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPI---TQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTD  1381
             YTLVWSS+S  +     +   Y+WLP+PP+GY A+GHVVTTS EKPS D+I+CV S  TD
Sbjct  135   YTLVWSSESSKLKNKNSTDDGYIWLPIPPEGYKALGHVVTTSPEKPSLDKIQCVQSNLTD  194

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSG------NVGTF  1219
               EVE W+WG GT++N  NG N+++ RP  RG +A+GV VGTFL           N  + 
Sbjct  195   KLEVESWIWGEGTTSN-ANGINVHSTRPRERGIKAQGVSVGTFLARIKSDQNDDSNTLSL  253

Query  1218  ACLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGD  1039
             ACLKNN    + S+MP+L QI+ALF +YSP++Y HP + Y PSSV W+F+NGALLY KG 
Sbjct  254   ACLKNNKFG-TFSSMPSLGQIQALFEQYSPLVYFHPKEKYLPSSVKWYFANGALLYQKGQ  312

Query  1038  ETNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTF  859
             E+NP  I P+GSNLPQGG NDG YW++LP+D  +KE+  +GDL SSEVYL+IKPM G TF
Sbjct  313   ESNPSSIEPNGSNLPQGGPNDGAYWLDLPIDAKDKEKAIKGDLLSSEVYLHIKPMLGATF  372

Query  858   TDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHS  679
             TDIA+WIF+PFNGP TAKLG I+ +PLG IGEHIGDWEH+TLRISNFNGVL+KVY SEHS
Sbjct  373   TDIAVWIFHPFNGPGTAKLGLID-VPLGKIGEHIGDWEHVTLRISNFNGVLHKVYLSEHS  431

Query  678   GGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTG  499
             GG+W++AP +EF NG NK VAYSSLNGHA Y KPGLVLQG GDIGIRNDTAKS  VLD G
Sbjct  432   GGTWLNAPLVEFQNG-NKVVAYSSLNGHAIYPKPGLVLQGTGDIGIRNDTAKSNLVLDCG  490

Query  498   LRYSVVAGLQ-GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
               YSVVA     I+EPPW+ Y REWGPK++Y   +++KR+ESLL    +  FE L+ +LP
Sbjct  491   ENYSVVAAENLEIIEPPWLNYTREWGPKLSYALGDEVKRIESLLKGNLKAAFEKLVKVLP  550

Query  321   NEFFGEEGPTGPNMKASWSGDE  256
             NE +GEEGPTGP MK +W+G E
Sbjct  551   NEVYGEEGPTGPKMKGNWNGHE  572



>ref|XP_009797417.1| PREDICTED: uncharacterized protein LOC104243853 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797418.1| PREDICTED: uncharacterized protein LOC104243853 isoform X2 [Nicotiana 
sylvestris]
Length=556

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/442 (62%), Positives = 332/442 (75%), Gaps = 14/442 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGP---AYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTD  1381
             YTLVWSS+S  +         Y+WLP+PP+GY A+GHVVTTS EKPS D+I+CV S FTD
Sbjct  118   YTLVWSSESSKLKNKNSIDDGYIWLPIPPEGYKALGHVVTTSPEKPSFDKIQCVQSDFTD  177

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSG------NVGTF  1219
               EVE W+WG G ++N   G N++++RP  RG +A+GV VGTFL           N  + 
Sbjct  178   KLEVESWIWGEGITSN-AYGINVHSIRPQERGIKAQGVSVGTFLARIKSDQDDDSNTLSL  236

Query  1218  ACLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGD  1039
             ACLKNN    + S+MP+L QI+ALF +YSP++Y HP + Y PSSVNW+F+NGALLY KG 
Sbjct  237   ACLKNNKFG-TFSSMPSLGQIQALFEQYSPLIYFHPKEKYLPSSVNWYFANGALLYQKGQ  295

Query  1038  ETNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTF  859
             E+NP  I P+GSNLPQGG NDG YW++LP D  +KE+  +GDL +SEVYL+IKPM G TF
Sbjct  296   ESNPSCIEPNGSNLPQGGPNDGAYWLDLPTDAKDKEKAIKGDLLNSEVYLHIKPMLGATF  355

Query  858   TDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHS  679
             TDIA+WIF+PFNGP TAKLG I+ +PLG IGEHIGDWEH+TLRISNFNGVL+KVY SEHS
Sbjct  356   TDIAVWIFHPFNGPGTAKLGLID-VPLGKIGEHIGDWEHVTLRISNFNGVLHKVYLSEHS  414

Query  678   GGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTG  499
             GG+W++AP +EF  G NK VAYSSLNGHA Y KPGLVLQG GDIGIRND AKS  VLD G
Sbjct  415   GGTWLNAPLVEFQTG-NKVVAYSSLNGHAIYPKPGLVLQGTGDIGIRNDAAKSNLVLDCG  473

Query  498   LRYSVVAGLQ-GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
               YSVVA     I+EPPW+ Y REWGPKI+Y    ++KR+ESLL    +  FE L+ +LP
Sbjct  474   ENYSVVAAENLEIIEPPWLNYTREWGPKISYTLGNEVKRIESLLKGNLKAAFEKLVKVLP  533

Query  321   NEFFGEEGPTGPNMKASWSGDE  256
             NE +GEEGPTGP MK +W+GDE
Sbjct  534   NEVYGEEGPTGPKMKGNWNGDE  555



>ref|XP_006364462.1| PREDICTED: uncharacterized protein LOC102578745 [Solanum tuberosum]
Length=558

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/443 (60%), Positives = 331/443 (75%), Gaps = 14/443 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGP---AYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTD  1381
             YTLVWSS+S     +      Y+WLP+PP+GY A+GH VTTS EKP+ D+I+CV S  TD
Sbjct  118   YTLVWSSESSKFKNTSTNDHGYIWLPIPPEGYKALGHGVTTSPEKPALDKIQCVRSDLTD  177

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF-------SGNVGT  1222
               EVE WVWG+GT++   NG N++++RP  RG +A+GV VGTFL          S    +
Sbjct  178   DLEVESWVWGQGTTSK-VNGINVHSVRPRERGVKAQGVSVGTFLARITSDKDDDSNKTLS  236

Query  1221  FACLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKG  1042
              ACLKNN    + S+MPNLSQI+ALF +YSPI+Y HP + Y PSSVNW+F+NGALLY KG
Sbjct  237   LACLKNNKFD-TFSSMPNLSQIQALFEQYSPIIYFHPKEKYLPSSVNWYFANGALLYQKG  295

Query  1041  DETNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGT  862
              E+NP  I P+GSNLPQ G NDG YW++LP+D  +KE+  +GDL +SEVYL+IKPM G T
Sbjct  296   QESNPSSIEPNGSNLPQDGPNDGAYWLDLPIDEKDKEKAIKGDLLNSEVYLHIKPMLGAT  355

Query  861   FTDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEH  682
             FTDIA+WIFYPFNGP TAKLG ++ +P G IGEH+GDWEH+TLRISNFNGVL KVY S+H
Sbjct  356   FTDIAVWIFYPFNGPGTAKLGLVD-VPFGKIGEHVGDWEHVTLRISNFNGVLYKVYVSQH  414

Query  681   SGGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDT  502
             SGG+W+DAP +EF NGSNK V YSSLNGHA Y KPGLVLQG GDIGIRNDT KS  VLD 
Sbjct  415   SGGTWIDAPQVEFQNGSNKVVVYSSLNGHAIYHKPGLVLQGGGDIGIRNDTTKSNLVLDC  474

Query  501   GLRYSVVAGLQ-GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
             G  YS+VA     I+ P W+ Y REWGPK++Y   +++K++ES L    +G FE L+ +L
Sbjct  475   GKNYSIVAAENLEIIAPAWLNYTREWGPKLSYTLGDEVKKIESSLKGNLKGAFEKLVKVL  534

Query  324   PNEFFGEEGPTGPNMKASWSGDE  256
             PNE +GEEGPTGP MK +W+GDE
Sbjct  535   PNEVYGEEGPTGPKMKGNWNGDE  557



>gb|KDP32272.1| hypothetical protein JCGZ_13197 [Jatropha curcas]
Length=554

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/438 (61%), Positives = 332/438 (76%), Gaps = 11/438 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G  Y+WLP  P GY++VG VVT   EKPS +++RCV S  TD CE
Sbjct  121   YTLVWSSESLKIKQDGLGYIWLPTAPDGYTSVGLVVTNVPEKPSLEKVRCVQSDLTDQCE  180

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGN---VGTFACLKNN  1201
             ++ W+WG G   +DPN FN+++LRP NRGTQA GV VGTF    +GN   +   ACLKN 
Sbjct  181   IDSWIWGIG-KQSDPNAFNVFSLRPSNRGTQAMGVSVGTFAAQ-NGNATSISVVACLKNV  238

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             + + + S MPNL+QI+A+F  YSP +Y HP + Y  SSV+W+F+NGALLY KG+E+NPV 
Sbjct  239   S-SHNLSCMPNLNQIQAIFNAYSPRIYFHPDEEYLSSSVSWYFNNGALLYKKGEESNPVP  297

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I   GSNLPQGG+NDG YW++LPVD   KERVK+GDLQ +EVYL+IKPM G TFTDIA+W
Sbjct  298   IEATGSNLPQGGSNDGSYWLDLPVDEGAKERVKKGDLQETEVYLHIKPMLGATFTDIAVW  357

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             IF PFNGP+ AK+  I  +PLG IGEH+GDWEH+TLR+SNFNG L +V+FS+HSGGSW D
Sbjct  358   IFCPFNGPAKAKVEFI-NLPLGRIGEHVGDWEHVTLRVSNFNGELRRVFFSQHSGGSWFD  416

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVV  481
             A  LEF NG NKS+ Y+SL+GHA YSKPGLVLQG   IGIRNDTAKS  VLDTG R+S+V
Sbjct  417   ASELEFDNG-NKSIGYASLHGHAMYSKPGLVLQGSNGIGIRNDTAKSKMVLDTGTRFSIV  475

Query  480   AGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
             A       +VEPPW+ Y REWGPKITY  E+++K+VE +LP + +  F  +I+ LP+E F
Sbjct  476   AAEYLGTAVVEPPWLNYLREWGPKITYDIEDELKKVEKVLPGKLKSAFRKIINSLPDEVF  535

Query  309   GEEGPTGPNMKASWSGDE  256
             GEEGPTGP +K +W GDE
Sbjct  536   GEEGPTGPKLKRNWIGDE  553



>ref|XP_008375114.1| PREDICTED: uncharacterized protein LOC103438346 [Malus domestica]
Length=566

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/439 (60%), Positives = 322/439 (73%), Gaps = 8/439 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             +TLVWSS+ L I + G  YVWLP    GY A+G VVT+S EKPS D+IRCV S+ TD CE
Sbjct  130   FTLVWSSEFLNIKKDGNGYVWLPTASDGYKAIGLVVTSSPEKPSLDKIRCVRSSLTDECE  189

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF-SGNVGTFACLKNNNV  1195
              + W+WG GT++ D NGFN+++LRP NRGTQA GV  GTF+ +  +G + T ACLKN  +
Sbjct  190   ADSWIWGPGTAS-DANGFNVFSLRPSNRGTQAMGVSAGTFIAALQNGGLSTVACLKNAAI  248

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
             +    +MPNL+QIEAL   YSP +Y HP   Y PSSV WFF+NGALLY K D+ NP+ I 
Sbjct  249   SNPQVSMPNLTQIEALLEAYSPFIYFHPEXVYLPSSVGWFFTNGALLYKKDDDLNPIAIE  308

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
               GSNLPQGG+NDG YW++LPVD +  ERVK+GDL SS+VY +IKPM G TFTDIAIW+F
Sbjct  309   ATGSNLPQGGSNDGSYWLDLPVDKSANERVKKGDLPSSQVYAHIKPMLGSTFTDIAIWVF  368

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+ +   I LG IGEH+GDWEH+TLRISNF G L KVYFS+HSGG WVDA 
Sbjct  369   YPFNGPARAKV-EFLNISLGKIGEHVGDWEHVTLRISNFTGELWKVYFSQHSGGIWVDAS  427

Query  654   NLEFIN-GSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
              LEF N G NK+V Y+SL+GHA Y+KPGLVLQG G IGIRND AKS  VLDTG    ++ 
Sbjct  428   ELEFQNGGGNKAVTYASLHGHAFYAKPGLVLQGTGGIGIRNDAAKSKMVLDTGRSQPIII  487

Query  477   GLQ----GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
                     I EPPW+ YCREWGPK++Y   +++K+VE LLP + +  FE  +  LPNE  
Sbjct  488   AADYLGSAISEPPWLNYCREWGPKLSYDITDELKKVEKLLPGKLKSAFEKFVENLPNEVL  547

Query  309   GEEGPTGPNMKASWSGDEK  253
             GEEGPTGP MK +W+GDEK
Sbjct  548   GEEGPTGPKMKNNWTGDEK  566



>ref|XP_002269745.2| PREDICTED: uncharacterized protein LOC100242579 isoform X1 [Vitis 
vinifera]
Length=590

 Score =   532 bits (1371),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 266/437 (61%), Positives = 319/437 (73%), Gaps = 10/437 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G  YVWLP PP GY AVGHV+T   EKPS D+IRCV S  TD CE
Sbjct  158   YTLVWSSESLKIKQDGNGYVWLPTPPDGYKAVGHVITNLPEKPSLDKIRCVRSDLTDLCE  217

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTF--ACLKNNN  1198
              + W+WG     N  NGFN+Y L+P +RG QA  V VGTF+    G   +   ACLKN  
Sbjct  218   ADTWIWGLDKVAN-ANGFNVYDLQPSDRGAQALAVSVGTFVAQNGGAASSLSLACLKN--  274

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
             ++ +  AMPNL+Q++AL + YSP +YLHP + Y PSSV+WFF NGALLY +G+E+ PV I
Sbjct  275   ISSNLYAMPNLAQVDALVQAYSPWVYLHPDEQYLPSSVSWFFQNGALLYQQGEESKPVNI  334

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P GSNLPQGG+NDG YW++LPVD   KE VK+GDLQ S  Y++IKPM G TFTDIAIWI
Sbjct  335   DPTGSNLPQGGSNDGAYWLDLPVDAKAKETVKKGDLQDSMTYMHIKPMLGATFTDIAIWI  394

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+ AK+ ++  I LG IGEH+GDWEH+TLR+SNFNG L  V+FSEHS G+WV+A
Sbjct  395   FYPFNGPARAKV-ELINISLGKIGEHVGDWEHVTLRVSNFNGKLMNVFFSEHSSGTWVNA  453

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               LEF NG NK V+Y+SL+GHA Y KPGLVLQG G +GIRNDTAKS  V+DTG RY VVA
Sbjct  454   SELEFQNG-NKVVSYASLHGHAFYPKPGLVLQGSGAMGIRNDTAKSKMVMDTGTRYIVVA  512

Query  477   GL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                    +VEPPW+ Y R+WGPKI+Y    +IK VE LLP + +  FE L+  LPNE  G
Sbjct  513   AEYLGSAVVEPPWLNYYRKWGPKISYDLAAEIKEVEKLLPGKLKSAFEKLVKSLPNEILG  572

Query  306   EEGPTGPNMKASWSGDE  256
             EEGPTGP MK +W GDE
Sbjct  573   EEGPTGPKMKKNWDGDE  589



>ref|XP_004245944.2| PREDICTED: uncharacterized protein LOC101257692 [Solanum lycopersicum]
Length=591

 Score =   531 bits (1367),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 263/443 (59%), Positives = 329/443 (74%), Gaps = 14/443 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSG---PAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTD  1381
             YTLVWSS+S            Y+WLP+PP+GY A+GHVVTTS EKP+ D+I+CV S  TD
Sbjct  151   YTLVWSSESSKFKNKNINDHGYIWLPIPPEGYKALGHVVTTSPEKPALDKIQCVRSDLTD  210

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF-------SGNVGT  1222
               EVE WVWG+GT++   NG N++++RP  RG +A+GV VGTFL          S    +
Sbjct  211   ELEVESWVWGQGTTSK-VNGINVHSVRPRERGVKAQGVSVGTFLARITSDKDDESNKTLS  269

Query  1221  FACLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKG  1042
              ACLKN   + + S+MPNLSQI+ALF +YSPI++ HP + Y PSSVNW+F+NGALLY KG
Sbjct  270   LACLKNTKFS-TFSSMPNLSQIQALFDQYSPIIHFHPKEKYLPSSVNWYFANGALLYQKG  328

Query  1041  DETNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGT  862
              E+NP  I P+GSNLPQ G NDG YW++LP+D   +E+  +GDL +SEVYL+IKPM G T
Sbjct  329   QESNPSTIEPNGSNLPQDGPNDGAYWLDLPIDEKGREKAIKGDLLNSEVYLHIKPMLGAT  388

Query  861   FTDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEH  682
             FTDIA+WIFYPFNGP TAKLG ++ +P G IGEH+GDWEH+TLRISNFNGVL KVY S+H
Sbjct  389   FTDIAVWIFYPFNGPGTAKLGLVD-VPFGKIGEHVGDWEHVTLRISNFNGVLYKVYVSQH  447

Query  681   SGGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDT  502
             SGG+W+DAP +EF NGSNK V YSSLNGHA Y KPGLVLQG GDIGIRNDTAKS  VLD 
Sbjct  448   SGGTWLDAPQVEFQNGSNKVVVYSSLNGHAIYHKPGLVLQGGGDIGIRNDTAKSNLVLDC  507

Query  501   GLRYSVVAGLQ-GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
                YS+VA     I+ P W+ Y R+WGPK++Y   +++K++ES      +G FE L+ +L
Sbjct  508   RKNYSIVAAENLEIIAPAWLNYTRQWGPKLSYRLGDEVKKIESSSKGNSKGAFEKLVKVL  567

Query  324   PNEFFGEEGPTGPNMKASWSGDE  256
             PNE +GEEGPTGP +K +W+GDE
Sbjct  568   PNEVYGEEGPTGPKLKGNWNGDE  590



>ref|XP_009354660.1| PREDICTED: uncharacterized protein LOC103945804 [Pyrus x bretschneideri]
Length=566

 Score =   529 bits (1362),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 258/439 (59%), Positives = 321/439 (73%), Gaps = 8/439 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             +TL+WSS+ L I + G  YVWLP    GY A+G VVT+S EKPS D+IRCV S+ TD CE
Sbjct  130   FTLIWSSEFLNIKKDGNGYVWLPTASDGYKAIGLVVTSSPEKPSLDKIRCVRSSLTDECE  189

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF-SGNVGTFACLKNNNV  1195
              + W+WG GT++ D NGFN++++RP NRGTQA GV  GTF+ +  +G + T ACLKN  +
Sbjct  190   ADSWIWGPGTAS-DANGFNVFSVRPSNRGTQAMGVSAGTFIAAQQNGGLSTVACLKNAAI  248

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
             +    +MPNL+QIEAL   YSP +Y HP + Y PSSV WFF+NGALLY K ++   + I 
Sbjct  249   SNPQVSMPNLTQIEALLEAYSPFIYFHPDEVYLPSSVGWFFTNGALLYKKDNDLKSIAIE  308

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
               GSNLPQGG+NDG YW++LPVD +  ERVK+GDL SS+VY +IKPM G TFTDIAIW+F
Sbjct  309   ATGSNLPQGGSNDGSYWLDLPVDKSANERVKKGDLPSSQVYAHIKPMLGSTFTDIAIWVF  368

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+ +   I LG IGEH+GDWEH+TLR+SNF G L KVYFS+HSGG WVDA 
Sbjct  369   YPFNGPARAKV-EFLNISLGKIGEHVGDWEHMTLRVSNFTGELWKVYFSQHSGGIWVDAS  427

Query  654   NLEFIN-GSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
              LEF N G NK+V Y+SL+GHA Y+KPGLVLQG G IGIRND AKS  VLDTG    ++ 
Sbjct  428   ELEFQNGGGNKAVTYASLHGHAFYAKPGLVLQGTGGIGIRNDAAKSKMVLDTGRSQPIII  487

Query  477   GLQ----GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
                     I EPPW+ YCREWGPK++Y   +++K+VE LLP + +  FE  +  LPNE  
Sbjct  488   AADYLGSAISEPPWLNYCREWGPKLSYDITDELKKVEKLLPGKLKSAFEKFVKSLPNEVL  547

Query  309   GEEGPTGPNMKASWSGDEK  253
             GEEGPTGP MK +W+GDEK
Sbjct  548   GEEGPTGPKMKNNWTGDEK  566



>ref|XP_002523580.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38775.1| conserved hypothetical protein [Ricinus communis]
Length=551

 Score =   528 bits (1361),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 261/437 (60%), Positives = 330/437 (76%), Gaps = 10/437 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q    Y+WLP  P GY AVG VVT+S EKPS D++RCV S  TD CE
Sbjct  119   YTLVWSSESLKIKQDSIGYIWLPTAPDGYRAVGLVVTSSPEKPSLDKMRCVRSDLTDQCE  178

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF--SGNVGTFACLKNNN  1198
              + WVWG     +DPNGFN+++LRP NRGTQA GV VGTF+       N  +  CLKN  
Sbjct  179   KDIWVWGP-EKQSDPNGFNVFSLRPSNRGTQAMGVCVGTFVAQNGNDNNPASLVCLKN--  235

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
             V+ + S MPN +QI+A+F+ YSP +Y HP + Y PSSV+W+F+NGALLY +G+E+NPV++
Sbjct  236   VSNNLSCMPNENQIQAIFQAYSPWIYFHPDEEYLPSSVSWYFNNGALLYKQGEESNPVKV  295

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
               +GSNLPQGG NDGVYW++LPVD   K+RVK+GDLQ +EVYL+IKPMFG TFTDI IW+
Sbjct  296   ETNGSNLPQGGANDGVYWLDLPVDEKAKDRVKKGDLQETEVYLHIKPMFGATFTDIVIWV  355

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             F PFNGP+ AK+ +   +PLG IGEH+GDWEH+TLR+SNFN  L  VYFSEHSGGSW++A
Sbjct  356   FCPFNGPAKAKI-EFLNVPLGKIGEHVGDWEHVTLRVSNFNSELWSVYFSEHSGGSWINA  414

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               LEF +G NK V YSSL+GHA YSKPGLVLQG   IGIRNDTAKS  +LDTG ++SVVA
Sbjct  415   SQLEFQSG-NKFVGYSSLHGHAMYSKPGLVLQGNNGIGIRNDTAKSGKILDTGAKFSVVA  473

Query  477   GL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                    I+EPPW+ + R+WGPKI+Y   ++IK++E +LP + +  FE +++ LP+E  G
Sbjct  474   AEYLGMTIIEPPWINFFRKWGPKISYNIADEIKKIEKILPGKLKSAFEKVVNGLPSEVLG  533

Query  306   EEGPTGPNMKASWSGDE  256
             EEGPTGP +K +W+GDE
Sbjct  534   EEGPTGPKVKGNWTGDE  550



>ref|XP_011008815.1| PREDICTED: uncharacterized protein LOC105114095 [Populus euphratica]
Length=558

 Score =   528 bits (1360),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 265/436 (61%), Positives = 321/436 (74%), Gaps = 9/436 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G  Y+WLP PP GY A+GHVVT S +KP   +IRCV S  TD CE
Sbjct  127   YTLVWSSESLQIKQDGVGYIWLPTPPDGYKALGHVVTNSPQKPPLGKIRCVRSDLTDQCE  186

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG-TFACLKNNNV  1195
              + WVWG G   +D NGFN+++L P NRGTQA GV VGTF+   +     + +CLKN   
Sbjct  187   FDSWVWGLG-KESDLNGFNVFSLFPSNRGTQAMGVCVGTFVAQKTTTAPVSLSCLKN--A  243

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
               + S MPNL QI+A+F+ YSP +Y HP + Y PSSV W+F NGALLY +G+E+ PV I 
Sbjct  244   VSNLSCMPNLDQIKAIFQAYSPWIYFHPDEEYLPSSVEWYFVNGALLYERGEESKPVPIE  303

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +GSNLPQGG+NDG YW++LPV+   K+RVK+GDLQ S VYL+IKPMFG TFTDIA+W+F
Sbjct  304   SNGSNLPQGGSNDGAYWLDLPVEEGAKDRVKKGDLQDSRVYLHIKPMFGATFTDIAVWVF  363

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGPS AK+  I  IPLG IGEH+GDWEHLTLRISNFNG L  +YFSEHSGG WV++ 
Sbjct  364   YPFNGPSKAKVEFI-NIPLGKIGEHVGDWEHLTLRISNFNGELLSIYFSEHSGGIWVNSS  422

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
              LEF NG NK+V YSSL+GHA Y+KPGLVLQG G+IGIRNDTAKS   +DTG    VVA 
Sbjct  423   ELEFQNG-NKAVTYSSLHGHAMYAKPGLVLQGSGNIGIRNDTAKSKKFIDTGTNSLVVAA  481

Query  474   L---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
                   I EPPW+ Y R+WGPK+TY   E+IK+VE LLP + +  F+  +  LPNE  GE
Sbjct  482   EYLGMAITEPPWLNYFRKWGPKLTYDIAEEIKKVEKLLPGKLKSAFDKFVRSLPNEVLGE  541

Query  303   EGPTGPNMKASWSGDE  256
             EGPTGP +K +W+GDE
Sbjct  542   EGPTGPKLKRNWTGDE  557



>ref|XP_011009639.1| PREDICTED: uncharacterized protein LOC105114698 [Populus euphratica]
Length=558

 Score =   527 bits (1358),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 264/436 (61%), Positives = 321/436 (74%), Gaps = 9/436 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G  Y+WLP PP GY A+GHVVT S +KP   ++RCV S  TD CE
Sbjct  127   YTLVWSSESLQIKQDGVGYIWLPTPPDGYKALGHVVTNSPQKPPLGKVRCVRSDLTDQCE  186

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG-TFACLKNNNV  1195
              + WVWG G   +D NGFN+++L P NRGTQA GV VGTF+   +     + +CLKN   
Sbjct  187   FDSWVWGLG-KESDLNGFNVFSLFPSNRGTQAMGVCVGTFVAQKTTTAPVSLSCLKN--A  243

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
               + S MPNL QI+A+F+ YSP +Y HP + Y PSSV W+F NGALLY +G+E+ PV I 
Sbjct  244   VSNLSCMPNLDQIKAIFQAYSPWIYFHPDEEYLPSSVEWYFVNGALLYERGEESKPVPIE  303

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +GSNLPQGG+NDG YW++LPV+   K+RVK+GDLQ S VYL+IKPMFG TFTDIA+W+F
Sbjct  304   SNGSNLPQGGSNDGAYWLDLPVEEGAKDRVKKGDLQDSRVYLHIKPMFGATFTDIAVWVF  363

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGPS AK+  I  IPLG IGEH+GDWEHLTLRISNFNG L  +YFSEHSGG WV++ 
Sbjct  364   YPFNGPSKAKVEFI-NIPLGKIGEHVGDWEHLTLRISNFNGELLSIYFSEHSGGIWVNSS  422

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
              LEF NG NK+V YSSL+GHA Y+KPGLVLQG G+IGIRNDTAKS   +DTG    VVA 
Sbjct  423   ELEFQNG-NKAVTYSSLHGHAMYAKPGLVLQGSGNIGIRNDTAKSKKFIDTGTNSLVVAA  481

Query  474   L---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
                   I EPPW+ Y R+WGPK+TY   E+IK+VE LLP + +  F+  +  LPNE  GE
Sbjct  482   EYLGMAITEPPWLNYFRKWGPKLTYDIAEEIKKVEKLLPGKLKSAFDKFVRSLPNEVLGE  541

Query  303   EGPTGPNMKASWSGDE  256
             EGPTGP +K +W+GDE
Sbjct  542   EGPTGPKLKRNWTGDE  557



>ref|XP_007022584.1| Uncharacterized protein TCM_033363 [Theobroma cacao]
 gb|EOY14109.1| Uncharacterized protein TCM_033363 [Theobroma cacao]
Length=555

 Score =   527 bits (1358),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 261/437 (60%), Positives = 324/437 (74%), Gaps = 10/437 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G  Y+WLP+ P GY AVGHVVT + +KPS +++RCV S FTD  E
Sbjct  123   YTLVWSSESLKIKQDGNGYIWLPIAPDGYQAVGHVVTNTQDKPSLEKVRCVRSDFTDRSE  182

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF--SGNVGTFACLKNNN  1198
              + W+WG      D   FN++   PI+RG+Q  GV VGTF+     +G+    ACLKN  
Sbjct  183   NDTWIWGP-DKGIDTKEFNVFGSTPISRGSQYMGVSVGTFVAQNPNAGSTAPLACLKN--  239

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
             V  + S MPNL QIE LF+ YSP +Y HP + Y PS+VNWFF NGALLYTKG+E+ PV I
Sbjct  240   VKSNLSCMPNLRQIETLFQAYSPWIYFHPDEVYLPSTVNWFFVNGALLYTKGEESKPVSI  299

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P GSNLPQGG+NDG+YW++LP+D   KERVK+GDLQ+S+VYL++KPM G T+TDIAIW+
Sbjct  300   QPTGSNLPQGGSNDGIYWLDLPMDEATKERVKKGDLQNSQVYLHVKPMLGATYTDIAIWV  359

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+ AK+ +   I LG IGEH+GDWEH+TLR+SNFNG L+ +YFSEHSGGSW++A
Sbjct  360   FYPFNGPARAKV-EFINISLGRIGEHVGDWEHVTLRVSNFNGELHSMYFSEHSGGSWLNA  418

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               LEF  G NK   Y+SLNGHA YSKPGLVLQG G +GIRNDTAKS  +LDTGL++S+VA
Sbjct  419   SQLEF-QGGNKPCTYASLNGHAMYSKPGLVLQGSGGMGIRNDTAKSKMLLDTGLQFSLVA  477

Query  477   GL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                    + EPPW+ Y REWGPKI+Y   ++IK+VE LLP + +  FE  I  LPNE  G
Sbjct  478   AEYLGSTLTEPPWLNYFREWGPKISYDLADEIKKVEKLLPGKLKSAFEKFIKGLPNEVLG  537

Query  306   EEGPTGPNMKASWSGDE  256
             +EGPTGP MK +W+GDE
Sbjct  538   QEGPTGPKMKGNWTGDE  554



>ref|XP_006369488.1| hypothetical protein POPTR_0001s23900g [Populus trichocarpa]
 gb|ERP66057.1| hypothetical protein POPTR_0001s23900g [Populus trichocarpa]
Length=530

 Score =   526 bits (1354),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 263/436 (60%), Positives = 320/436 (73%), Gaps = 9/436 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G  Y+WLP PP GY A+GHVVT S +KP   +IRCV S  T+ CE
Sbjct  99    YTLVWSSESLQIKQDGVGYIWLPTPPDGYKALGHVVTKSPQKPPLGKIRCVRSDLTEQCE  158

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG-TFACLKNNNV  1195
              + WVWG G   +D NGFN+++L P NRGTQA GV VGTF+   +     + +CLKN  V
Sbjct  159   FDSWVWGLG-KESDLNGFNVFSLFPSNRGTQAMGVCVGTFVAQKTTTAPVSLSCLKN--V  215

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
               + S MPNL QI+A+F+ YSP +Y HP + Y PSSV W+F NGALLY +G+E+ PV I 
Sbjct  216   VSNLSCMPNLDQIKAIFQAYSPWIYFHPDEEYLPSSVEWYFVNGALLYERGEESKPVPIE  275

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +GSNLPQGG+NDG YW++LPV+   K+RVK+GDLQ S VYL+IKPMFG  FTDI +W+F
Sbjct  276   SNGSNLPQGGSNDGAYWLDLPVEEGAKDRVKKGDLQDSRVYLHIKPMFGAAFTDIVVWVF  335

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGPS AK+  I  IPLG IGEH+GDWEHLTLRISNFNG L  +YFSEHSGG+WV++ 
Sbjct  336   YPFNGPSKAKVEFI-NIPLGKIGEHVGDWEHLTLRISNFNGELLSIYFSEHSGGTWVNSS  394

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
              LEF NG NK+V YSSL+GHA Y+KPGLVLQG G IGIRNDTAKS   +DTG    VVA 
Sbjct  395   ELEFQNG-NKAVTYSSLHGHAMYAKPGLVLQGSGSIGIRNDTAKSKKFIDTGTNSLVVAA  453

Query  474   L---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
                   I EPPW+ Y R+WGPK+TY   E+IK+VE LLP + +  F+  +  LPNE  GE
Sbjct  454   EYLGMAITEPPWLNYFRKWGPKLTYDIAEEIKKVEKLLPGKLKSAFDKFVRSLPNEVLGE  513

Query  303   EGPTGPNMKASWSGDE  256
             EGPTGP +K +W+GDE
Sbjct  514   EGPTGPKLKRNWTGDE  529



>ref|XP_006483670.1| PREDICTED: uncharacterized protein LOC102607172 [Citrus sinensis]
Length=536

 Score =   523 bits (1347),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 262/448 (58%), Positives = 327/448 (73%), Gaps = 23/448 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G AYVWLP PP GY  VGH +T   EKP+ D++RCV S FTD C+
Sbjct  95    YTLVWSSESLKIKQDGVAYVWLPTPPDGYKNVGHAITNFPEKPALDKMRCVRSDFTDQCQ  154

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGN------VGTFACL  1210
              + W+WG      +  G N++++RP  RGT+  GV VGTF    +GN        T ACL
Sbjct  155   TDTWIWGA-----NKYGLNVFSVRPSVRGTEEMGVSVGTFAAQINGNDNSPTTSTTLACL  209

Query  1209  KN----NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKG  1042
             KN    +N++ S + MPNL QIE + + YSP +YLHP + Y PSSV+W+F NGALLY KG
Sbjct  210   KNIMAKSNLS-SYNYMPNLQQIETMVQAYSPYIYLHPDEKYLPSSVSWYFDNGALLYRKG  268

Query  1041  DETNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGT  862
             +E+ P+ I P GSNLPQGG+NDG YW++LPV++  KERVK+GDLQ+S+VYL+IKPM G T
Sbjct  269   EESKPIPIEPMGSNLPQGGSNDGAYWLDLPVNDKAKERVKKGDLQNSQVYLHIKPMLGAT  328

Query  861   FTDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEH  682
             +TDIAIWIFYPFNGP+ AK+  I  IPLG IGEH+GDWEH+TLRISNFNG L +V+ S+H
Sbjct  329   YTDIAIWIFYPFNGPARAKVKFINNIPLGKIGEHVGDWEHVTLRISNFNGELWRVFLSQH  388

Query  681   SGGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDT  502
             SGG+WV+A  LEF +G NK V Y+SLNGHA Y+KPGLVLQG G IGIRNDTAKS  +LDT
Sbjct  389   SGGTWVNASELEFQSG-NKPVTYASLNGHAMYAKPGLVLQGSGGIGIRNDTAKSRMLLDT  447

Query  501   GLRYSVVAG--LQG----IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFET  340
             G  +S+VA   L G    I EPPW+ Y REWGPKI+Y    +IK +E LLP + +  F+ 
Sbjct  448   GRHFSIVAADYLSGSASVITEPPWLNYFREWGPKISYDISHEIKEIEKLLPGKLKPAFQK  507

Query  339   LIHLLPNEFFGEEGPTGPNMKASWSGDE  256
              ++ LPNE  GEEGPTGP  K++W+GDE
Sbjct  508   FVNSLPNEVLGEEGPTGPKAKSNWNGDE  535



>ref|XP_010276359.1| PREDICTED: uncharacterized protein LOC104611127 [Nelumbo nucifera]
Length=545

 Score =   523 bits (1348),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 258/436 (59%), Positives = 323/436 (74%), Gaps = 15/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVW+S+SL I + G  Y+WLP PP GY AVG+VVTTS EKP  D++RCV S  TD CE
Sbjct  120   YTLVWNSESLQIKKDGNGYIWLPTPPDGYKAVGYVVTTSPEKPPLDKVRCVRSDLTDQCE  179

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
              E W+WG        NG N+Y+LRP  RG QA GV VGTF+    G     + ACLKNN 
Sbjct  180   RETWIWGS-------NGLNVYSLRPTLRGAQAPGVCVGTFVAEAQGAASPSSLACLKNNK  232

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
              + SS  MPNL+QIEAL + YSP +Y HP ++Y PSSV WFF+NGALLY KGDE+NPV I
Sbjct  233   SSLSS--MPNLNQIEALLQAYSPWIYFHPDESYLPSSVTWFFNNGALLYKKGDESNPVPI  290

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P GSNLP GG+NDG YW++LP++  +K +VK+G+LQSS+ Y+++KPM G TFTD+ IW+
Sbjct  291   DPTGSNLPLGGSNDGSYWLDLPINETDKGKVKKGELQSSQAYIHVKPMLGATFTDVGIWV  350

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+ AK+ +   + LG IGEH+GDWEHLTLRISNF G L +VYFS+HS G+W++A
Sbjct  351   FYPFNGPARAKI-EFINVSLGKIGEHVGDWEHLTLRISNFTGELWRVYFSQHSKGTWMNA  409

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               LEF  G NK VAYSSL+GHA Y KPGLVLQG   +GIRNDTAKS A++DTG++  +V+
Sbjct  410   SELEF-QGGNKLVAYSSLHGHAFYPKPGLVLQGSNGVGIRNDTAKSKALMDTGVKPVIVS  468

Query  477   G--LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
                L  +VEPPW+ Y REWGPKI+Y +  +IK+VE LLP + +  F+ L+  LP+E  GE
Sbjct  469   AEHLGTVVEPPWLNYAREWGPKISYDTAAEIKKVEKLLPGKLKAAFKNLVKSLPSEVLGE  528

Query  303   EGPTGPNMKASWSGDE  256
             EGPTGP MK +WSGDE
Sbjct  529   EGPTGPKMKNNWSGDE  544



>ref|XP_002325025.1| hypothetical protein POPTR_0018s09440g [Populus trichocarpa]
 gb|EEF03590.1| hypothetical protein POPTR_0018s09440g [Populus trichocarpa]
Length=546

 Score =   523 bits (1346),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 254/436 (58%), Positives = 319/436 (73%), Gaps = 9/436 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G  Y+WLP P  GY A+G VVTTS EKPS +++RCV S  TD C+
Sbjct  115   YTLVWSSESLQIKQEGVGYIWLPTPLDGYKALGCVVTTSPEKPSLEKVRCVRSDLTDDCQ  174

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG-TFACLKNNNV  1195
             ++ W+WG+G   +DPNGFN+++LRP NRGTQA GV VGTF+   + +   + ACLKN  +
Sbjct  175   IDKWIWGQG-KESDPNGFNVFSLRPSNRGTQAMGVSVGTFVAQNTTSASISLACLKN--I  231

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
               + S MP L Q++A+F+ YSP +Y HP + Y PSS  W+F+NGALLY K +E+ PV I 
Sbjct  232   ESNLSCMPTLDQVQAIFQAYSPRIYFHPDEEYLPSSARWYFTNGALLYKKDEESKPVPIE  291

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
               GSNLPQGG+NDG YW++LPV+   +ERVKRGDLQ  +VYL+IKPM G TFTDI  W+F
Sbjct  292   STGSNLPQGGSNDGSYWLDLPVEEAARERVKRGDLQDCQVYLHIKPMLGATFTDIVAWLF  351

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP  AK+  I  +PLG  G+H+GDWEH+TLRISNFNG L  +Y S HSGG+W DA 
Sbjct  352   YPFNGPGRAKVDLI-TVPLGKTGQHVGDWEHVTLRISNFNGQLCGIYLSAHSGGTWYDAS  410

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
              LEF +G NK+V YSSLNGHA Y+KPGLVLQG G+IGIRNDTAKS   +DTG R+SVV+ 
Sbjct  411   ELEFQDG-NKAVIYSSLNGHAMYAKPGLVLQGSGNIGIRNDTAKSNKFIDTGARFSVVSA  469

Query  474   L---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
                   +VEPPW+ Y R+WGP ITY   E+ + VE LLP + +  F+  +  LP E FGE
Sbjct  470   EYMGSSVVEPPWLNYLRKWGPNITYDLAEEAETVEKLLPGKLKSAFDKFVKSLPKEIFGE  529

Query  303   EGPTGPNMKASWSGDE  256
             EGPTGP +K +W+GDE
Sbjct  530   EGPTGPKLKRNWTGDE  545



>ref|XP_006482794.1| PREDICTED: uncharacterized protein LOC102620179 [Citrus sinensis]
Length=569

 Score =   523 bits (1347),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 262/448 (58%), Positives = 327/448 (73%), Gaps = 23/448 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G AYVWLP PP GY  VGH +T   EKP+ D++RCV S FTD C+
Sbjct  128   YTLVWSSESLKIKQDGVAYVWLPTPPDGYKNVGHAITNFPEKPALDKMRCVRSDFTDQCQ  187

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGN------VGTFACL  1210
              + W+WG      +  G N++++RP  RGT+  GV VGTF    +GN        T ACL
Sbjct  188   TDTWIWGA-----NKYGLNVFSVRPSVRGTEEMGVSVGTFAAQINGNDNSPTTSTTLACL  242

Query  1209  KN----NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKG  1042
             KN    +N++ S + MPNL QIE + + YSP +YLHP + Y PSSV+W+F NGALLY KG
Sbjct  243   KNIMAKSNLS-SYNYMPNLQQIETMVQAYSPYIYLHPDEKYLPSSVSWYFDNGALLYRKG  301

Query  1041  DETNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGT  862
             +E+ P+ I P GSNLPQGG+NDG YW++LPV++  KERVK+GDLQ+S+VYL+IKPM G T
Sbjct  302   EESKPIPIEPMGSNLPQGGSNDGAYWLDLPVNDKAKERVKKGDLQNSQVYLHIKPMLGAT  361

Query  861   FTDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEH  682
             +TDIAIWIFYPFNGP+ AK+  I  IPLG IGEH+GDWEH+TLRISNFNG L +V+ S+H
Sbjct  362   YTDIAIWIFYPFNGPARAKVKFINNIPLGKIGEHVGDWEHVTLRISNFNGELWRVFLSQH  421

Query  681   SGGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDT  502
             SGG+WV+A  LEF +G NK V Y+SLNGHA Y+KPGLVLQG G IGIRNDTAKS  +LDT
Sbjct  422   SGGTWVNASELEFQSG-NKPVTYASLNGHAMYAKPGLVLQGSGGIGIRNDTAKSRMLLDT  480

Query  501   GLRYSVVAG--LQG----IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFET  340
             G  +S+VA   L G    I EPPW+ Y REWGPKI+Y    +IK +E LLP + +  F+ 
Sbjct  481   GRHFSIVAADYLSGSASVITEPPWLNYFREWGPKISYDISHEIKEIEKLLPGKLKPAFQK  540

Query  339   LIHLLPNEFFGEEGPTGPNMKASWSGDE  256
              ++ LPNE  GEEGPTGP  K++W+GDE
Sbjct  541   FVNSLPNEVLGEEGPTGPKAKSNWNGDE  568



>ref|XP_011007114.1| PREDICTED: uncharacterized protein LOC105112912 [Populus euphratica]
Length=546

 Score =   522 bits (1344),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 252/436 (58%), Positives = 320/436 (73%), Gaps = 9/436 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G  Y+WLP P  GY A+G VVTTS EKPS +++RCV S  TD C+
Sbjct  115   YTLVWSSESLQIKQDGVGYIWLPAPLDGYKALGCVVTTSPEKPSLEKVRCVRSDLTDDCQ  174

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG-TFACLKNNNV  1195
             ++ W+WG+G   +DPNGFN+++LRP NRGTQA GV VGTF+   + +   + ACLKN  +
Sbjct  175   IDKWIWGQG-KESDPNGFNVFSLRPSNRGTQAMGVSVGTFVAQNTTSASISLACLKN--I  231

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
               + S MP L Q++A+F+ YSP +Y HP + Y PSS  W+F+NGALLY K +E+ PV I 
Sbjct  232   ESNLSCMPTLDQVQAIFQAYSPRIYFHPDEEYLPSSARWYFTNGALLYKKDEESKPVPIE  291

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
               GSNLPQGG+NDG YW++LPV+   +ERVK+GDLQ  +VYL+IKPM G TFTDI  W+F
Sbjct  292   STGSNLPQGGSNDGSYWLDLPVEEAARERVKKGDLQDCQVYLHIKPMLGATFTDIVAWLF  351

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP  AK+ ++  +PLG  G+H+GDWEH+TLRISNFNG L  +Y S HSGG+W DA 
Sbjct  352   YPFNGPGRAKV-ELITVPLGKTGQHVGDWEHVTLRISNFNGQLCGIYLSAHSGGAWYDAS  410

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
              LEF +G NK+V YSSLNGHA Y+KPGLVLQG G+IGIRNDTAKS   +DTG R+SVV+ 
Sbjct  411   ELEFQDG-NKAVIYSSLNGHAMYAKPGLVLQGSGNIGIRNDTAKSNKFIDTGARFSVVSA  469

Query  474   L---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
                   +VEPPW+ Y R+WGP ITY   ED + VE LLP + +  F+  +  LP E FGE
Sbjct  470   EYMGSSVVEPPWLNYLRKWGPNITYDLAEDAETVEKLLPGKLKSAFDKFVKSLPKEIFGE  529

Query  303   EGPTGPNMKASWSGDE  256
             +GPTGP +K +W+GDE
Sbjct  530   DGPTGPKLKRNWTGDE  545



>ref|XP_008461748.1| PREDICTED: uncharacterized protein LOC103500280 [Cucumis melo]
Length=560

 Score =   522 bits (1345),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 266/440 (60%), Positives = 322/440 (73%), Gaps = 13/440 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWS++S  I + G  Y+W P PP GY AVGHVVT S EKPS D+IRCV S  T+ CE
Sbjct  125   YTLVWSTESSKIKRDGNGYIWSPTPPDGYRAVGHVVTASREKPSVDKIRCVRSDLTEECE  184

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-----FACLK  1207
              E W+WG   S  D NGFN+Y+ RP NRG    GV  G F+   +   G        CLK
Sbjct  185   KEAWIWGPMKSG-DENGFNIYSSRPKNRGITETGVSTGAFVALPAPTTGNSPLPQLFCLK  243

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N N    S+AMP+LSQI++L++ YSP++Y HP + Y PSSV+WFFS GALLY K +E+N 
Sbjct  244   NLNSI--SAAMPDLSQIDSLYQAYSPVIYYHPKEKYLPSSVDWFFSGGALLYDKSNESNS  301

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             V I PDGSNLPQGG+NDG +W+NLP D   KE++K+GDLQS +VYL++KPM GGTFTDIA
Sbjct  302   VPINPDGSNLPQGGSNDGQFWLNLPTDEEGKEKLKKGDLQSCKVYLHVKPMIGGTFTDIA  361

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
              WIF+PFNGP+TAK+G I+ IP   IGEHIGDWEH+TLRISNF G L +VYF++HS G W
Sbjct  362   TWIFFPFNGPATAKVGIID-IPFTKIGEHIGDWEHITLRISNFTGELGRVYFAQHSKGEW  420

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
             VD P+LEF  G NK VAYSSLNGHA+YSKPGLVLQG  +IGIRN+TAKS  VLDTG  Y 
Sbjct  421   VDPPSLEFEKG-NKVVAYSSLNGHASYSKPGLVLQGAAEIGIRNETAKSGLVLDTGTNYL  479

Query  486   VVAG--LQGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
             V+A   L+G+V EP WV Y REWGPKI Y   E+I++VE+LLP   +  F   ++ LP+E
Sbjct  480   VIAAEYLEGVVEEPAWVNYTREWGPKIEYPIVEEIEKVENLLPGRLKEGFRGFVNKLPDE  539

Query  315   FFGEEGPTGPNMKASWSGDE  256
               GEEGPTGP MK SW+GDE
Sbjct  540   IRGEEGPTGPKMKNSWNGDE  559



>gb|KDO46021.1| hypothetical protein CISIN_1g008353mg [Citrus sinensis]
Length=569

 Score =   523 bits (1346),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 262/448 (58%), Positives = 327/448 (73%), Gaps = 23/448 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G AYVWLP PP GY  VGH +T   EKP+ D++RCV S FTD C+
Sbjct  128   YTLVWSSESLKIKQDGVAYVWLPTPPDGYKNVGHAITNFPEKPALDKMRCVRSDFTDQCQ  187

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGN------VGTFACL  1210
              + W+WG      +  G N++++RP  RGT+  GV VGTF    +GN        T ACL
Sbjct  188   TDTWIWGA-----NKYGLNVFSVRPSVRGTEEMGVSVGTFAAQINGNDNSPSTSTTLACL  242

Query  1209  KN----NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKG  1042
             KN    +N++ S + MPNL QIE + + YSP +YLHP + Y PSSV+W+F NGALLY KG
Sbjct  243   KNIMAKSNLS-SYNYMPNLQQIETMVQAYSPYIYLHPDEKYLPSSVSWYFDNGALLYRKG  301

Query  1041  DETNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGT  862
             +E+ P+ I P GSNLPQGG+NDG YW++LPV++  KERVK+GDLQ+S+VYL+IKPM G T
Sbjct  302   EESKPIPIEPMGSNLPQGGSNDGAYWLDLPVNDKAKERVKKGDLQNSQVYLHIKPMLGAT  361

Query  861   FTDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEH  682
             +TDIAIWIFYPFNGP+ AK+  I  IPLG IGEH+GDWEH+TLRISNFNG L +V+ S+H
Sbjct  362   YTDIAIWIFYPFNGPARAKVKFINNIPLGKIGEHVGDWEHVTLRISNFNGELWRVFLSQH  421

Query  681   SGGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDT  502
             SGG+WV+A  LEF +G NK V Y+SLNGHA Y+KPGLVLQG G IGIRNDTAKS  +LDT
Sbjct  422   SGGTWVNASELEFQSG-NKPVTYASLNGHAMYAKPGLVLQGSGGIGIRNDTAKSRMLLDT  480

Query  501   GLRYSVVAG--LQG----IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFET  340
             G  +S+VA   L G    I EPPW+ Y REWGPKI+Y    +IK +E LLP + +  F+ 
Sbjct  481   GRHFSIVAADYLSGSASVITEPPWLNYFREWGPKISYDISHEIKEIEKLLPGKLKPAFQK  540

Query  339   LIHLLPNEFFGEEGPTGPNMKASWSGDE  256
              ++ LPNE  GEEGPTGP  K++W+GDE
Sbjct  541   FVNSLPNEVLGEEGPTGPKAKSNWNGDE  568



>ref|XP_010111946.1| hypothetical protein L484_004609 [Morus notabilis]
 gb|EXC32127.1| hypothetical protein L484_004609 [Morus notabilis]
Length=573

 Score =   522 bits (1345),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 257/445 (58%), Positives = 325/445 (73%), Gaps = 14/445 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWSS+SL I Q   AYVWLP PP GY AVG ++T S +KP  +++RCV +  T+PCE
Sbjct  130   YSLVWSSESLKIKQDNNAYVWLPTPPDGYKAVGVIITESPQKPPLEKVRCVRTDLTEPCE  189

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG---TFACLKN-  1204
             +E W+WG G   +D NGFN+YTLRP NRGTQA GV VGTF     G      + ACL+N 
Sbjct  190   MESWIWGPG-KESDANGFNVYTLRPTNRGTQALGVAVGTFSAQIGGTNALPPSMACLRNA  248

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
             NN     S+MPNL+QIEA+FR Y+P++Y HP + Y PSSV W+F+NGALLY +G+E+NP 
Sbjct  249   NNSNKVHSSMPNLAQIEAIFRAYAPLVYFHPDEKYLPSSVTWYFTNGALLYKRGEESNPT  308

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              + P GSNLPQGG NDG YW++LP D  EK+RVKRGDL S++VYL+ KPMFG TFTDIA+
Sbjct  309   AVAPTGSNLPQGGANDGEYWLDLPKDEKEKDRVKRGDLSSAQVYLHAKPMFGSTFTDIAV  368

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+FYPFNGP+ AK+G +  + LG IGEHIGDWEH+TLR+SNFNG L K+Y SEHS G+WV
Sbjct  369   WVFYPFNGPARAKVG-VFTVGLGKIGEHIGDWEHMTLRVSNFNGELWKLYLSEHSKGTWV  427

Query  663   DAPNLEFINGS-------NKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLD  505
             +A  LEF   +        + VAY+SL+GHA Y+KPG V+QG G IGIRNDTAKS  V+D
Sbjct  428   EASELEFSENNGGSGGGGKRPVAYASLSGHALYAKPGTVMQGNGVIGIRNDTAKSKIVMD  487

Query  504   TGLRY-SVVAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             TG ++    A      EPPWV Y R+WGPKI Y ++E+ ++VE +LP   +  F+  I  
Sbjct  488   TGAKFEVAAAEYLAAAEPPWVNYLRKWGPKIDYDTKEEAEKVEKMLPGRLKTAFKKFIDG  547

Query  327   LPNEFFGEEGPTGPNMKASWSGDEK  253
             LPNEFFGE+GPTGP +KA+W GDE+
Sbjct  548   LPNEFFGEDGPTGPKVKANWIGDEE  572



>ref|XP_009589347.1| PREDICTED: uncharacterized protein LOC104086727 [Nicotiana tomentosiformis]
Length=540

 Score =   521 bits (1341),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 253/434 (58%), Positives = 320/434 (74%), Gaps = 13/434 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS++L I Q    Y+WLP+PP+GY AVGHVVTTS +KPS D+IRCV S  TD  E
Sbjct  118   YTLVWSSENLNIKQDSVGYIWLPIPPEGYKAVGHVVTTSPQKPSLDKIRCVRSDLTDVSE  177

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNVA  1192
              +DW+WG        NG N+Y+ RP +RG  A GV  G F+ S +G   + ACLKN N  
Sbjct  178   SDDWIWGN-------NGLNVYSSRPRDRGINALGVSTGAFVASNNGTADSLACLKNVNAN  230

Query  1191  FSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIGP  1012
              S  AMPNL+Q++ALF+ YSP+ Y HP + Y+PSSV WFF NGALLYTKG E+ PV I  
Sbjct  231   LS--AMPNLNQVKALFQAYSPLYYFHPDEQYYPSSVTWFFQNGALLYTKGQESAPVAIES  288

Query  1011  DGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIFY  832
             +GSNLPQGG+NDG +W++LP D++ K++VK+GDLQ++  YL+IKPMFG T+TDIA+W+FY
Sbjct  289   NGSNLPQGGSNDGAFWLDLPTDDSAKDQVKKGDLQAATAYLHIKPMFGATYTDIALWLFY  348

Query  831   PFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAPN  652
             PFNGP+ AK+ +   IPLG IG+H+GDWEH+TLRISNFNG L  VYFS+HSGG+WV A  
Sbjct  349   PFNGPARAKI-EFMTIPLGKIGQHVGDWEHVTLRISNFNGELQGVYFSQHSGGNWVSASQ  407

Query  651   LEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG-  475
             LEF NG NK VAYSSL+GHA+Y++PG  LQG  +IG+RNDTAK   ++DTG  YS+VA  
Sbjct  408   LEFQNG-NKPVAYSSLHGHASYAQPGKNLQGNNNIGLRNDTAK-GQMMDTGANYSIVAAE  465

Query  474   LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEEGP  295
                IVEP W+ Y REWGPKI+Y    ++++VE  LP + +   E L+  LPNE  GEEGP
Sbjct  466   YLTIVEPAWLNYAREWGPKISYDIANELQKVERFLPGKLKNAVEKLVKSLPNEVLGEEGP  525

Query  294   TGPNMKASWSGDEK  253
             TGP  K  W+GDE+
Sbjct  526   TGPKFKDMWNGDER  539



>ref|XP_004172675.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101218097 
[Cucumis sativus]
Length=560

 Score =   519 bits (1336),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 265/440 (60%), Positives = 319/440 (73%), Gaps = 13/440 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWS++S  I + G  Y+W P PP GY AVGHVVT S EKPS D+IRCV S  T+ CE
Sbjct  125   YTLVWSTESSKIKRDGNGYIWSPTPPDGYRAVGHVVTASPEKPSVDKIRCVRSELTEECE  184

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-----FACLK  1207
              E W+WG   S  D NGFN+Y+ RP NRG    GV  G FL   +   G        CLK
Sbjct  185   NEAWIWGPMKSR-DENGFNIYSSRPKNRGIPGTGVSTGGFLALPAPTTGNSPLPQLFCLK  243

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N N    S+AMP+LSQI++L++ YSPI+Y HP + Y PSSV+WFFSNGALLY K +E+NP
Sbjct  244   NLNSI--SAAMPDLSQIDSLYQAYSPIIYFHPKEKYLPSSVDWFFSNGALLYDKSNESNP  301

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             V I PDG NLPQGG+NDG +W+NLP D   KE++K+GDLQS   YL++KPM GGTFTDIA
Sbjct  302   VPINPDGLNLPQGGSNDGQFWLNLPTDEEGKEKLKKGDLQSCRGYLHVKPMIGGTFTDIA  361

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
              WIF+PFNGP+TAK+G I+ IP   IGEHIGDWEH+TLRISNF G L +VYF++HS G W
Sbjct  362   TWIFFPFNGPATAKVGIID-IPFTKIGEHIGDWEHITLRISNFTGELRRVYFAQHSKGEW  420

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
             VD P+LEF  G NK VAYSSLNGHA+YSKPGLVLQG  +IGIRN+TAKS  V+DTG  Y 
Sbjct  421   VDPPSLEFEKG-NKVVAYSSLNGHASYSKPGLVLQGAAEIGIRNETAKSGLVVDTGTNYL  479

Query  486   VVAG--LQG-IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
             V+    L+G +VEP WV Y REWGP+I Y   E+I++VE+LLP   +  F   +  LP+E
Sbjct  480   VIGAEYLEGXVVEPAWVNYTREWGPRIEYPIVEEIEKVENLLPGRLKEGFRGFVKKLPDE  539

Query  315   FFGEEGPTGPNMKASWSGDE  256
               GEEGPTGP MK SW+GDE
Sbjct  540   IRGEEGPTGPKMKNSWNGDE  559



>ref|XP_011092632.1| PREDICTED: uncharacterized protein LOC105172754 [Sesamum indicum]
Length=600

 Score =   520 bits (1338),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 262/440 (60%), Positives = 324/440 (74%), Gaps = 15/440 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVW+++S   TQ  PAY WLP PP GY  VGHV+TTS +KPS D+IRCV + FTD  E
Sbjct  169   YNLVWANNS---TQD-PAYFWLPTPPDGYKPVGHVITTSPDKPSLDKIRCVRTDFTDEPE  224

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-----GSFSGNVGTFACLK  1207
              ++ +W  G + +  NG N+Y LRP +RG  A+ + VGTF+      S   +  + +CLK
Sbjct  225   TDNLIWAGGAAKSSGNGLNVYGLRPKSRGINAQPLSVGTFIIQNTTTSDGKSDLSLSCLK  284

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N N + S+S  PNL Q+EALF+ YSP +Y HP + Y PSSVNW+FSNGALLY KG+E++P
Sbjct  285   NKNPSLSTS--PNLRQVEALFQTYSPYIYFHPKEIYLPSSVNWYFSNGALLYKKGEESSP  342

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             + I P+GSNLPQGG+NDG YW++LPVD   KE+VK+GDLQS+E YL++KP+ G TFTDI 
Sbjct  343   IPIDPNGSNLPQGGSNDGSYWLDLPVDEQAKEKVKKGDLQSAEAYLHVKPILGATFTDIQ  402

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +W+FYPFNG +  KLG I+ IPLG IGEH+GDWEH+TLRISNF+GVL KVYF+EHSGG W
Sbjct  403   VWLFYPFNGHAVLKLGVIDEIPLGKIGEHVGDWEHVTLRISNFDGVLYKVYFAEHSGGKW  462

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
             VD+  LEF NG NK V YSSLNGHA Y + GL LQG  DIGIRNDTAKS  V+DTG RYS
Sbjct  463   VDSCLLEFQNG-NKFVGYSSLNGHATYYQAGLFLQGASDIGIRNDTAKSDNVMDTGARYS  521

Query  486   VVAGLQGI--VEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             VVAG  G+   EPPW+ Y REWGPK TY   +++K+VE  LP   +  FE L+  LP E 
Sbjct  522   VVAG-DGLSTAEPPWLNYDREWGPKKTYEFGDEVKKVEKWLPGNLKSAFERLVKTLPAEV  580

Query  312   FGEEGPTGPNMKASWSGDEK  253
             +GEEGPTGP MK +W GDEK
Sbjct  581   YGEEGPTGPKMKNNWDGDEK  600



>ref|XP_011041980.1| PREDICTED: uncharacterized protein LOC105137797 [Populus euphratica]
Length=558

 Score =   518 bits (1334),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 260/436 (60%), Positives = 316/436 (72%), Gaps = 9/436 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSSDSL I Q G  Y WLP PP GY AVGHVVT S +KP   +I CV S  TD CE
Sbjct  127   YTLVWSSDSLRIKQDGVGYFWLPTPPDGYKAVGHVVTNSPQKPPLGKIHCVRSDLTDQCE  186

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG-TFACLKNNNV  1195
              + W+WG G   +DPNGFN+Y+L P NRGTQA GV VGTF+   +     + +C+KN  V
Sbjct  187   FDSWIWGPG-KESDPNGFNVYSLLPSNRGTQAMGVCVGTFVAQNTITAPVSLSCVKN--V  243

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
               + S MPN +QI+ +F+ YSP +Y HP + Y PSSV+W+F NGALLY KGDE+ P+ I 
Sbjct  244   VSNLSCMPNRNQIQTIFQAYSPWMYFHPDEQYLPSSVDWYFKNGALLYKKGDESKPMPIE  303

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +GSNLPQGG +D  YW++LPVD   K+RVK+G+LQ S+VYL+IKPM G TFTDIA+W+ 
Sbjct  304   SNGSNLPQGGADDDTYWLDLPVDEGAKDRVKKGNLQDSQVYLHIKPMLGATFTDIAVWVC  363

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGPS AK+ +   IPLG IGEH+GDWEH+TLRISNFNG L  VYFSEHSGG+W+ A 
Sbjct  364   YPFNGPSKAKV-EFINIPLGKIGEHVGDWEHVTLRISNFNGELWSVYFSEHSGGTWLKAS  422

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
              LEF NG NK+V YSSL+GHA Y+KPGLVLQG G IGIRNDTAKS   +DTG    VVA 
Sbjct  423   ELEFQNG-NKAVTYSSLHGHAMYAKPGLVLQGSGGIGIRNDTAKSKKFMDTGTNSLVVAA  481

Query  474   L---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
                   I EPPW+ Y R+WGPK+TY    +IK+V+ LLP + +  F+  I  LPNE  GE
Sbjct  482   EYLGTAINEPPWLNYFRKWGPKVTYDISAEIKKVDKLLPGKLKSAFDKFIRSLPNEVLGE  541

Query  303   EGPTGPNMKASWSGDE  256
             +GPTGP MK +W+GDE
Sbjct  542   QGPTGPKMKRNWTGDE  557



>ref|XP_009793524.1| PREDICTED: uncharacterized protein LOC104240380 [Nicotiana sylvestris]
Length=581

 Score =   518 bits (1334),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 251/434 (58%), Positives = 321/434 (74%), Gaps = 13/434 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS++L I Q    Y+WLP+PP+GY AVGHVVTTS +KPS D+I CV S  TD  E
Sbjct  159   YTLVWSSENLNIKQDSVGYIWLPIPPEGYKAVGHVVTTSPQKPSLDKIHCVRSDLTDVSE  218

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNVA  1192
              +DW+WG        NG N+Y+ RP +RG  A GV  G F+ S +G   + ACLKN  V 
Sbjct  219   SDDWIWGN-------NGLNVYSSRPRDRGINALGVSTGAFVASNNGTADSLACLKN--VK  269

Query  1191  FSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIGP  1012
              + SAMPNL+Q++ALF+ YSP+ Y HP + Y+PSS+ WFF NGALLYTKG E+ PV I P
Sbjct  270   ANLSAMPNLNQVQALFQAYSPLYYFHPDEQYYPSSITWFFQNGALLYTKGQESAPVAIEP  329

Query  1011  DGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIFY  832
             +GSNLPQGG+NDG +W++LP D++ K++VK+GDLQ++  YL+IKPMFG T+TDIA+W+FY
Sbjct  330   NGSNLPQGGSNDGAFWLDLPTDDSAKDQVKKGDLQAATAYLHIKPMFGATYTDIALWLFY  389

Query  831   PFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAPN  652
             PFNGP+ AK+ +   IPLG IG+H+GDWEH+TLRISNFNG L  VYFS+HSGG+WV A  
Sbjct  390   PFNGPARAKI-EFMTIPLGKIGQHVGDWEHVTLRISNFNGELQGVYFSQHSGGNWVIASQ  448

Query  651   LEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG-  475
             LEF NG NK VAYSSL+GHA+Y++PG  +QG  +IG+RNDTAK   ++DTG  YS+VA  
Sbjct  449   LEFQNG-NKPVAYSSLHGHASYAQPGKNMQGNSNIGLRNDTAK-GQMMDTGANYSIVAAE  506

Query  474   LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEEGP  295
                IVEP W+ Y REWGPKI+Y    ++++VE  LP + +   E L+  LPNE  GEEGP
Sbjct  507   YLTIVEPAWLNYAREWGPKISYDIANELQKVERFLPGKLKKAVEKLVKSLPNEVLGEEGP  566

Query  294   TGPNMKASWSGDEK  253
             TGP  K  W+GDE+
Sbjct  567   TGPKFKDMWNGDER  580



>ref|XP_008235570.1| PREDICTED: uncharacterized protein LOC103334389 [Prunus mume]
Length=569

 Score =   516 bits (1329),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 263/439 (60%), Positives = 322/439 (73%), Gaps = 12/439 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLP-ITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             YTLVW+S+SL  + + G  YVWLP PP GY A+GHVVT+S EKPS D+IRCV S  TD C
Sbjct  135   YTLVWNSESLKNLKKDGDGYVWLPTPPHGYEAIGHVVTSSPEKPSLDQIRCVRSDLTDHC  194

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF--LGSFSGNVGTFACLKNN  1201
             E + W+WG GT+  D NGFN+++LRP NRGTQA GV  GTF  L     +  T ACLKN 
Sbjct  195   EADSWIWGPGTAG-DANGFNVFSLRPSNRGTQAIGVPAGTFVALNGLPSSTITIACLKNT  253

Query  1200  -NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              +++ S   MPNL+QI+AL   YSP++YLHP + Y PSSV WFFSNGALLY K  + + V
Sbjct  254   LSLSNSHIYMPNLTQIKALLEVYSPLIYLHPDEVYLPSSVGWFFSNGALLYKK--QGDAV  311

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I P GSNLPQGG+NDG YW++LPVD +  ERVK+GDL   +VYL+IKPM G TFTDIAI
Sbjct  312   AIEPTGSNLPQGGSNDGSYWLDLPVDKSASERVKKGDLLHYQVYLHIKPMMGSTFTDIAI  371

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+FYPFNGP+TAK+ +   I LG IGEH+GDWEH+TLR+SNF G L +V+FS+HSGG+WV
Sbjct  372   WVFYPFNGPATAKV-EFFNISLGKIGEHVGDWEHMTLRVSNFTGELWRVFFSQHSGGTWV  430

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
             DA  LEF NG NK+V Y+SL+GHA Y K GLVLQG G IGIRNDTAKS  VLDTG    +
Sbjct  431   DASQLEFENG-NKAVGYASLHGHALYPKAGLVLQGSGGIGIRNDTAKSKKVLDTGQSSLL  489

Query  483   VAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             V+       + EPPW+ Y R+WGP I+Y   ++IK+VE LLP + +  F+  +  LPNE 
Sbjct  490   VSAEYLGSAVTEPPWLNYSRKWGPNISYDIADEIKKVEKLLPGKLKSAFDKFVKSLPNEV  549

Query  312   FGEEGPTGPNMKASWSGDE  256
              GEEGPTGP MK SW+GDE
Sbjct  550   LGEEGPTGPKMKNSWTGDE  568



>gb|KCW71746.1| hypothetical protein EUGRSUZ_E00249 [Eucalyptus grandis]
 gb|KCW71747.1| hypothetical protein EUGRSUZ_E00249 [Eucalyptus grandis]
Length=591

 Score =   516 bits (1329),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 255/437 (58%), Positives = 321/437 (73%), Gaps = 9/437 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y   W+S+S  I + G  Y+W P+PP+GY+AVGHVVTTS EKPS D+IRCV S FTD CE
Sbjct  158   YAPTWNSESSQIKKDGNGYIWCPIPPEGYAAVGHVVTTSPEKPSTDKIRCVRSDFTDQCE  217

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
                W+WG G +  DPNG N++T RP +RGTQA+G  +GTF+    G     +  CLKNNN
Sbjct  218   SNMWIWGPGKAI-DPNGINMFTTRPKSRGTQARGACLGTFVAKNGGKDSPHSLTCLKNNN  276

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               ++   +PNLSQIEALF+ Y+P++Y HP ++Y PSSV+WFFSNGALLY KG+E+NP++I
Sbjct  277   PDYAH-FLPNLSQIEALFQAYAPVIYFHPEESYFPSSVDWFFSNGALLYHKGEESNPIKI  335

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P GSNLPQG +NDG YW++LP +  EK  VKRGDLQSS+ YL++KPM G TF+DIAIW+
Sbjct  336   EPTGSNLPQGSSNDGEYWLDLPGNGREKNTVKRGDLQSSQAYLHVKPMNGATFSDIAIWL  395

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+TAK+ +   + LG IG+H+GDWEH+TLR+SNF G L +VYFS+HS G WV A
Sbjct  396   FYPFNGPATAKV-KFFDVSLGQIGQHVGDWEHVTLRVSNFTGELWRVYFSQHSKGVWVSA  454

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               LEF +G NK V YSS +GHA YSKPG VLQG G IGIRNDT KS   +DTG+ YSVVA
Sbjct  455   SELEFHSG-NKIVVYSSQHGHATYSKPGSVLQGNGGIGIRNDTKKSKNFMDTGVNYSVVA  513

Query  477   ---GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                    + EPPW+ Y R+WGP+I+Y  E +IK+VE L P + +  FE  +  LP E  G
Sbjct  514   VDYPNAPVTEPPWLNYFRKWGPRISYNLEREIKKVEKLFPRKLKSAFEKFVRGLPGEILG  573

Query  306   EEGPTGPNMKASWSGDE  256
             EEGPTGP +K+ WSGDE
Sbjct  574   EEGPTGPKVKSYWSGDE  590



>ref|XP_010055279.1| PREDICTED: uncharacterized protein LOC104443521 isoform X3 [Eucalyptus 
grandis]
Length=592

 Score =   516 bits (1329),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 255/437 (58%), Positives = 321/437 (73%), Gaps = 9/437 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y   W+S+S  I + G  Y+W P+PP+GY+AVGHVVTTS EKPS D+IRCV S FTD CE
Sbjct  159   YAPTWNSESSQIKKDGNGYIWCPIPPEGYAAVGHVVTTSPEKPSTDKIRCVRSDFTDQCE  218

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
                W+WG G +  DPNG N++T RP +RGTQA+G  +GTF+    G     +  CLKNNN
Sbjct  219   SNMWIWGPGKAI-DPNGINMFTTRPKSRGTQARGACLGTFVAKNGGKDSPHSLTCLKNNN  277

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               ++   +PNLSQIEALF+ Y+P++Y HP ++Y PSSV+WFFSNGALLY KG+E+NP++I
Sbjct  278   PDYAH-FLPNLSQIEALFQAYAPVIYFHPEESYFPSSVDWFFSNGALLYHKGEESNPIKI  336

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P GSNLPQG +NDG YW++LP +  EK  VKRGDLQSS+ YL++KPM G TF+DIAIW+
Sbjct  337   EPTGSNLPQGSSNDGEYWLDLPGNGREKNTVKRGDLQSSQAYLHVKPMNGATFSDIAIWL  396

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+TAK+ +   + LG IG+H+GDWEH+TLR+SNF G L +VYFS+HS G WV A
Sbjct  397   FYPFNGPATAKV-KFFDVSLGQIGQHVGDWEHVTLRVSNFTGELWRVYFSQHSKGVWVSA  455

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               LEF +G NK V YSS +GHA YSKPG VLQG G IGIRNDT KS   +DTG+ YSVVA
Sbjct  456   SELEFHSG-NKIVVYSSQHGHATYSKPGSVLQGNGGIGIRNDTKKSKNFMDTGVNYSVVA  514

Query  477   ---GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                    + EPPW+ Y R+WGP+I+Y  E +IK+VE L P + +  FE  +  LP E  G
Sbjct  515   VDYPNAPVTEPPWLNYFRKWGPRISYNLEREIKKVEKLFPRKLKSAFEKFVRGLPGEILG  574

Query  306   EEGPTGPNMKASWSGDE  256
             EEGPTGP +K+ WSGDE
Sbjct  575   EEGPTGPKVKSYWSGDE  591



>emb|CDP14946.1| unnamed protein product [Coffea canephora]
Length=550

 Score =   514 bits (1323),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 254/439 (58%), Positives = 322/439 (73%), Gaps = 9/439 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+   I QSGP Y+W P+PP GY AVG+VVT++ EKPS D+IRCV S FTD CE
Sbjct  113   YTLVWSSELSKIRQSGPGYIWYPIPPDGYEAVGYVVTSTSEKPSLDKIRCVRSDFTDDCE  172

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF---SGNVGTFACLKNN  1201
             +E W+WG G+S+   +GF+ Y+LRP  RGT  +GV VG+F+      +  + + +CLKNN
Sbjct  173   IEKWIWG-GSSSISADGFSAYSLRPSARGTLDQGVPVGSFIFMKYWDADALTSVSCLKNN  231

Query  1200  NVA-FSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
             N + FS  +MPNL QI ALF+ YSP++Y HP +TY PSSVNWFFSNGALLYT+G E+ P 
Sbjct  232   NFSSFSIESMPNLRQIHALFQTYSPLIYFHPQETYLPSSVNWFFSNGALLYTEGQESTPS  291

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I   G NLPQGG +DG YW++LP D   KE++K+G+  SSE YL++K MFGGT++DI I
Sbjct  292   PIKFQGENLPQGGLDDGRYWLDLPADETSKEKLKKGNFPSSEAYLHVKSMFGGTYSDIVI  351

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP   K G I+ I L  +GEH+GDWEH+TLRISNFNG+L KV+FS+HS G+W+
Sbjct  352   WIFCPFNGPGMLKFGPID-ISLSKLGEHVGDWEHMTLRISNFNGMLQKVFFSQHSSGTWI  410

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
             DA  LEF NGSNK VAYSSL+GHA YSKPGL LQG    GIRND AKS  +LDTG RY +
Sbjct  411   DASFLEFQNGSNKFVAYSSLHGHAFYSKPGLDLQGAAGFGIRNDMAKSNLILDTGDRYVI  470

Query  483   VAG---LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             V+       IV+PPW+ Y REWG ++TY     +K VE++L   ++ +F++L++L PNE 
Sbjct  471   VSADYLSPPIVQPPWLHYAREWGTRVTYSLGLLVKFVENILIGVYKSIFQSLVNLFPNEL  530

Query  312   FGEEGPTGPNMKASWSGDE  256
             FGEEGP GP MK +W  DE
Sbjct  531   FGEEGPIGPKMKRNWKKDE  549



>ref|XP_007201170.1| hypothetical protein PRUPE_ppa003618mg [Prunus persica]
 gb|EMJ02369.1| hypothetical protein PRUPE_ppa003618mg [Prunus persica]
Length=561

 Score =   514 bits (1324),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 263/439 (60%), Positives = 318/439 (72%), Gaps = 12/439 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLP-ITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             YTLVW+S+SL  + + G  YVWLP PP GY A+GHVVT+S EKPS D+IRCV S  TD C
Sbjct  127   YTLVWNSESLKNLKKDGDGYVWLPTPPHGYEAIGHVVTSSPEKPSLDKIRCVRSDLTDHC  186

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF--LGSFSGNVGTFACLKNN  1201
             E + W+WG GT+  D NGFN+++LRP NRGTQA GV  GTF  L     +    ACLKN 
Sbjct  187   EADSWIWGPGTAG-DANGFNVFSLRPSNRGTQAMGVPAGTFVALNGLPSSTIAIACLKNT  245

Query  1200  -NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              +++ S   MPNL+QIEAL   YSP++YLHP + Y PSSV WFFSNGALLY K  + + V
Sbjct  246   LSLSNSHIYMPNLTQIEALLEVYSPLIYLHPDEVYLPSSVGWFFSNGALLYKK--QGDAV  303

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I P GSNLPQGG+NDG YW++LPVD +   RVK+GDL   +VYL+IKPM G TFTDIAI
Sbjct  304   AIEPTGSNLPQGGSNDGSYWLDLPVDKSASARVKKGDLLHYQVYLHIKPMMGSTFTDIAI  363

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+FYPFNGP+TAK+ +   I LG IGEH+GDWEHLTLR+SNF G L +V+FS+HSGG+WV
Sbjct  364   WVFYPFNGPATAKV-EFFNISLGKIGEHVGDWEHLTLRVSNFTGELWRVFFSQHSGGTWV  422

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
             DA  LEF NG NK+V Y+SL GHA Y K GLVLQG G IGIRNDTAKS  VLDTG    +
Sbjct  423   DASQLEFENG-NKAVGYASLQGHALYPKAGLVLQGSGGIGIRNDTAKSKKVLDTGQSSLL  481

Query  483   VAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             V+       + EPPW+ Y R+WGP I+Y   ++IK VE LLP + +  F+  +  LPNE 
Sbjct  482   VSAEYLGSAVTEPPWLNYSRKWGPNISYDIADEIKTVEKLLPGKLKSAFDKFVKSLPNEV  541

Query  312   FGEEGPTGPNMKASWSGDE  256
              GEEGPTGP MK SW+GDE
Sbjct  542   LGEEGPTGPKMKNSWTGDE  560



>ref|XP_010055278.1| PREDICTED: uncharacterized protein LOC104443521 isoform X2 [Eucalyptus 
grandis]
Length=624

 Score =   516 bits (1329),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 255/437 (58%), Positives = 321/437 (73%), Gaps = 9/437 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y   W+S+S  I + G  Y+W P+PP+GY+AVGHVVTTS EKPS D+IRCV S FTD CE
Sbjct  191   YAPTWNSESSQIKKDGNGYIWCPIPPEGYAAVGHVVTTSPEKPSTDKIRCVRSDFTDQCE  250

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
                W+WG G +  DPNG N++T RP +RGTQA+G  +GTF+    G     +  CLKNNN
Sbjct  251   SNMWIWGPGKAI-DPNGINMFTTRPKSRGTQARGACLGTFVAKNGGKDSPHSLTCLKNNN  309

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               ++   +PNLSQIEALF+ Y+P++Y HP ++Y PSSV+WFFSNGALLY KG+E+NP++I
Sbjct  310   PDYAH-FLPNLSQIEALFQAYAPVIYFHPEESYFPSSVDWFFSNGALLYHKGEESNPIKI  368

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P GSNLPQG +NDG YW++LP +  EK  VKRGDLQSS+ YL++KPM G TF+DIAIW+
Sbjct  369   EPTGSNLPQGSSNDGEYWLDLPGNGREKNTVKRGDLQSSQAYLHVKPMNGATFSDIAIWL  428

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+TAK+ +   + LG IG+H+GDWEH+TLR+SNF G L +VYFS+HS G WV A
Sbjct  429   FYPFNGPATAKV-KFFDVSLGQIGQHVGDWEHVTLRVSNFTGELWRVYFSQHSKGVWVSA  487

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               LEF +G NK V YSS +GHA YSKPG VLQG G IGIRNDT KS   +DTG+ YSVVA
Sbjct  488   SELEFHSG-NKIVVYSSQHGHATYSKPGSVLQGNGGIGIRNDTKKSKNFMDTGVNYSVVA  546

Query  477   ---GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                    + EPPW+ Y R+WGP+I+Y  E +IK+VE L P + +  FE  +  LP E  G
Sbjct  547   VDYPNAPVTEPPWLNYFRKWGPRISYNLEREIKKVEKLFPRKLKSAFEKFVRGLPGEILG  606

Query  306   EEGPTGPNMKASWSGDE  256
             EEGPTGP +K+ WSGDE
Sbjct  607   EEGPTGPKVKSYWSGDE  623



>ref|XP_007218959.1| hypothetical protein PRUPE_ppa003559mg [Prunus persica]
 gb|EMJ20158.1| hypothetical protein PRUPE_ppa003559mg [Prunus persica]
Length=565

 Score =   514 bits (1324),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 264/440 (60%), Positives = 321/440 (73%), Gaps = 14/440 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLP-ITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             YTLVW+S+SL  + + G  YVWLP PP GY A+GHVVT+S EKPS D+IRCV S  TD C
Sbjct  131   YTLVWNSESLKNLKKDGDGYVWLPTPPHGYEAIGHVVTSSPEKPSLDQIRCVRSDLTDHC  190

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL---GSFSGNVGTFACLKN  1204
             E + W+WG GT+  D NGFN+++LRP NRGTQA GV  GTF+   G+ S  +   ACLKN
Sbjct  191   EADSWIWGPGTAG-DANGFNVFSLRPSNRGTQAMGVPAGTFVALNGTPSSTI-AMACLKN  248

Query  1203  N-NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
               +++ S   MPNL+QIEAL   YSP++YLHP + Y PSSV WFFSNGALLY K  + + 
Sbjct  249   TLSLSNSHIYMPNLTQIEALLEVYSPLIYLHPDEVYLPSSVGWFFSNGALLYKK--QGDA  306

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             V I P GSNLPQGG+NDG YW++LPVD    ERVK+GDL   +VYL+IKPM G TFTDIA
Sbjct  307   VAIEPTGSNLPQGGSNDGSYWLDLPVDKGASERVKKGDLPDCQVYLHIKPMMGSTFTDIA  366

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             IW+FYPFNGP+ AK+ +   I LG IGEH+GDWEHLTLR+SNF G L +V+FS+HSGG+W
Sbjct  367   IWVFYPFNGPARAKV-EFFNISLGKIGEHVGDWEHLTLRVSNFTGELWRVFFSQHSGGTW  425

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
             VDA  LEF NG NK+V Y+SL+GHA Y K GLVLQG G IGIRNDTAKS  VLDTG    
Sbjct  426   VDASQLEFENG-NKAVGYASLHGHALYPKAGLVLQGSGGIGIRNDTAKSKKVLDTGRSLL  484

Query  486   VVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
             +V+       + EPPW+ Y R+WGP I+Y   ++IK VE LLP + +  F+  +  LPNE
Sbjct  485   LVSAEYLGSAVTEPPWLNYSRKWGPNISYDIADEIKTVEKLLPGKLKSAFDKFVKSLPNE  544

Query  315   FFGEEGPTGPNMKASWSGDE  256
               GEEGPTGP MK SW+GDE
Sbjct  545   VLGEEGPTGPKMKNSWTGDE  564



>ref|XP_010055277.1| PREDICTED: uncharacterized protein LOC104443521 isoform X1 [Eucalyptus 
grandis]
Length=625

 Score =   516 bits (1329),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 255/437 (58%), Positives = 321/437 (73%), Gaps = 9/437 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y   W+S+S  I + G  Y+W P+PP+GY+AVGHVVTTS EKPS D+IRCV S FTD CE
Sbjct  192   YAPTWNSESSQIKKDGNGYIWCPIPPEGYAAVGHVVTTSPEKPSTDKIRCVRSDFTDQCE  251

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
                W+WG G +  DPNG N++T RP +RGTQA+G  +GTF+    G     +  CLKNNN
Sbjct  252   SNMWIWGPGKAI-DPNGINMFTTRPKSRGTQARGACLGTFVAKNGGKDSPHSLTCLKNNN  310

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               ++   +PNLSQIEALF+ Y+P++Y HP ++Y PSSV+WFFSNGALLY KG+E+NP++I
Sbjct  311   PDYAH-FLPNLSQIEALFQAYAPVIYFHPEESYFPSSVDWFFSNGALLYHKGEESNPIKI  369

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P GSNLPQG +NDG YW++LP +  EK  VKRGDLQSS+ YL++KPM G TF+DIAIW+
Sbjct  370   EPTGSNLPQGSSNDGEYWLDLPGNGREKNTVKRGDLQSSQAYLHVKPMNGATFSDIAIWL  429

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+TAK+ +   + LG IG+H+GDWEH+TLR+SNF G L +VYFS+HS G WV A
Sbjct  430   FYPFNGPATAKV-KFFDVSLGQIGQHVGDWEHVTLRVSNFTGELWRVYFSQHSKGVWVSA  488

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               LEF +G NK V YSS +GHA YSKPG VLQG G IGIRNDT KS   +DTG+ YSVVA
Sbjct  489   SELEFHSG-NKIVVYSSQHGHATYSKPGSVLQGNGGIGIRNDTKKSKNFMDTGVNYSVVA  547

Query  477   ---GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                    + EPPW+ Y R+WGP+I+Y  E +IK+VE L P + +  FE  +  LP E  G
Sbjct  548   VDYPNAPVTEPPWLNYFRKWGPRISYNLEREIKKVEKLFPRKLKSAFEKFVRGLPGEILG  607

Query  306   EEGPTGPNMKASWSGDE  256
             EEGPTGP +K+ WSGDE
Sbjct  608   EEGPTGPKVKSYWSGDE  624



>gb|KHG05345.1| Vacuolar sorting-associated protein 62 [Gossypium arboreum]
Length=554

 Score =   513 bits (1321),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 261/436 (60%), Positives = 319/436 (73%), Gaps = 13/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G  Y+WLP+ PQGY AVGHV+T + +KPS  +IRCV S FTD  E
Sbjct  127   YTLVWSSESLKIKQDGNGYIWLPIAPQGYKAVGHVITNTKDKPSLQKIRCVRSDFTDETE  186

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNVA  1192
              E W+WG G    D    N ++ RP NRGTQ  GV+VGTF+           CLKN  V 
Sbjct  187   NETWIWGPG-KEVDAKEINFFSSRPKNRGTQYMGVRVGTFVAQNP----PLPCLKN--VK  239

Query  1191  FSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIGP  1012
              + S MPNL QIE LF+ YSP +Y HP + Y PSSV+WFF NGALLY KG+E+ PV I  
Sbjct  240   ANLSYMPNLRQIETLFQAYSPWIYFHPNEAYLPSSVSWFFVNGALLYMKGEESKPVPIQV  299

Query  1011  DGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIFY  832
              GSNLPQGG NDG YW++LP+D   KERVK+GDLQ+S+VYL++KPM G T++DIAIW+FY
Sbjct  300   TGSNLPQGGANDGNYWLDLPIDEATKERVKKGDLQNSKVYLHVKPMLGATYSDIAIWVFY  359

Query  831   PFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAPN  652
             PFNG + AK+  I  I LG IGEH+GDWEH+TLR+SNFNG L+ +YFSEHSGGSWV+A  
Sbjct  360   PFNGAAKAKVEFI-NISLGRIGEHVGDWEHVTLRVSNFNGELHSMYFSEHSGGSWVNASE  418

Query  651   LEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA--  478
             LEF  G NK   YSSL+GHA YSKPGLVLQG G+IGIRNDTAKS  V+DTGL++S+VA  
Sbjct  419   LEF-QGGNKPCTYSSLHGHAMYSKPGLVLQGSGEIGIRNDTAKSKIVMDTGLQFSLVAAE  477

Query  477   --GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
               G   IVEPPW+ Y REWGPKI+Y   ++IK+VE +LP + +  FE  I+ LP+E  G+
Sbjct  478   YLGSTTIVEPPWLNYFREWGPKISYNLADEIKKVEKVLPGKLKTAFEKFINGLPDEVLGQ  537

Query  303   EGPTGPNMKASWSGDE  256
             EGPTGP +K +W+ DE
Sbjct  538   EGPTGPKVKRNWNRDE  553



>ref|XP_004303088.1| PREDICTED: uncharacterized protein LOC101300074 [Fragaria vesca 
subsp. vesca]
Length=556

 Score =   511 bits (1317),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 253/438 (58%), Positives = 319/438 (73%), Gaps = 11/438 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YT VWSS+S+ + + G  YVWLP  P+GY+A+GHVVT+S EKP  D+IRCV +  TD C+
Sbjct  122   YTRVWSSESVKMKKDGDGYVWLPTAPEGYAAMGHVVTSSPEKPPLDKIRCVRTDLTDQCQ  181

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL---GSFSGNVGTFACLKNN  1201
              + W+WG   + +D  GFN+Y+L PI+RG QA+GV VGTFL   G  S N    ACLKN 
Sbjct  182   ADSWIWGPPGAASD--GFNVYSLTPIDRGIQARGVPVGTFLARNGKASPNDNNIACLKNT  239

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             N    ++ MPN SQI+AL + Y+P +Y HP + Y PSSV WFF+NGALLY K  E NPV 
Sbjct  240   NTQ-PNTYMPNQSQIDALLQAYAPFIYFHPDEVYLPSSVGWFFTNGALLYNKDQEQNPVP  298

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I P G+NLPQGG+NDG YW++LPVD   K+RVK+GDL  +E  L+IKPM G TFTDIAIW
Sbjct  299   IEPTGANLPQGGSNDGAYWLDLPVDQGGKDRVKKGDLPDAEANLHIKPMLGSTFTDIAIW  358

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             IFYPFNGP+ AK+ Q   + LG IGEH+GDWEH+TLR+SNF G L  VYFS+HS G WVD
Sbjct  359   IFYPFNGPARAKV-QFFNVSLGKIGEHVGDWEHVTLRVSNFTGQLWSVYFSQHSKGIWVD  417

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVV  481
             +  LEF +G NK V Y+SL+GHA Y K GLVLQG G IGIRNDTAKS  V+D+GLR S++
Sbjct  418   SSALEFQDG-NKPVTYASLHGHAFYPKAGLVLQGSGGIGIRNDTAKSKMVMDSGLRPSIM  476

Query  480   AGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
             A     + I+EPPW+ YCR+WGPK++Y   ++IK+VE LLP   +  F+  I  +P+E  
Sbjct  477   AAEYLGKAIIEPPWLNYCRKWGPKLSYQIADEIKKVEKLLPGPLKSAFDKFIRSIPDEVL  536

Query  309   GEEGPTGPNMKASWSGDE  256
             GEEGPTGP +K +W+GDE
Sbjct  537   GEEGPTGPKIKNNWNGDE  554



>ref|XP_008231390.1| PREDICTED: uncharacterized protein LOC103330573 [Prunus mume]
 ref|XP_008231391.1| PREDICTED: uncharacterized protein LOC103330573 [Prunus mume]
 ref|XP_008231392.1| PREDICTED: uncharacterized protein LOC103330573 [Prunus mume]
Length=565

 Score =   511 bits (1317),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 266/440 (60%), Positives = 319/440 (73%), Gaps = 14/440 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLP-ITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             YTLVW+S+SL  + + G  YVWLP PP GY A+GHVVT+S EKPS D+IRCV S FTD C
Sbjct  131   YTLVWNSESLKNLKKDGDGYVWLPTPPLGYEAIGHVVTSSPEKPSLDQIRCVRSDFTDHC  190

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL---GSFSGNVGTFACLKN  1204
             E + W+WG GT+  D NGFN+++LRP NRGTQA GV  GTF+   G  S N+   ACLKN
Sbjct  191   EADSWIWGPGTAG-DANGFNVFSLRPSNRGTQAIGVPAGTFVALNGIPSSNI-AMACLKN  248

Query  1203  N-NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
               +++ S   MPNL+QIEAL   YSP++YLHP + Y PSSV WFFSNGALLY K  + + 
Sbjct  249   TLSLSNSHIYMPNLTQIEALLEVYSPLIYLHPDEVYLPSSVGWFFSNGALLYKK--QGDA  306

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             V I P GSNLPQGG+ND  YW++LPVD    ERVK+GDL   +VYL+IKPM G TFTDIA
Sbjct  307   VAIEPTGSNLPQGGSNDNSYWLDLPVDKGSSERVKKGDLLDCQVYLHIKPMLGSTFTDIA  366

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             IWIFYPFNGP+ AK+     I LG IGEH+GDWEHLTLR+SNF G L +V+FS+HSGG+W
Sbjct  367   IWIFYPFNGPAMAKV-DFFNISLGKIGEHVGDWEHLTLRVSNFTGELWRVFFSQHSGGTW  425

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
             VDA  LEF NG NK+V Y+SL+GHA Y K GLVLQG G IGIRNDTAKS  VLD G    
Sbjct  426   VDASQLEFENG-NKAVGYASLHGHALYPKAGLVLQGSGGIGIRNDTAKSKKVLDIGRSLL  484

Query  486   VVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
             +V+       + EPPW+ Y R+WGP I+Y   E+IK VE LLP + +  F+  +  LPNE
Sbjct  485   LVSAEYLGSTVTEPPWLNYSRKWGPNISYDIAEEIKTVEKLLPGKLKSAFDKFVKSLPNE  544

Query  315   FFGEEGPTGPNMKASWSGDE  256
               GEEGPTGP MK SW+GDE
Sbjct  545   VLGEEGPTGPKMKNSWTGDE  564



>ref|XP_011086788.1| PREDICTED: uncharacterized protein LOC105168414 [Sesamum indicum]
Length=559

 Score =   511 bits (1316),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 257/436 (59%), Positives = 317/436 (73%), Gaps = 8/436 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWSS+SL I Q G AY+WLP PP GY A+GHV+T+S EKP+ D+IRCV   FTD  E
Sbjct  128   YSLVWSSESLKIKQDGVAYIWLPTPPDGYKAIGHVITSSPEKPALDKIRCVRLDFTDSNE  187

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNVA  1192
                W+WG G  +   NG ++Y+ RP NRG QA GV  GTF+   +G      CLKN N  
Sbjct  188   NNTWIWGLG-KDVSTNGISIYSSRPRNRGIQAVGVPTGTFVAEKNGTSLDLPCLKNANGN  246

Query  1191  FSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIGP  1012
              +S  MPN  QI+AL + YSP +Y HP + Y PSSV WFF NGALLYTKGDE+NPV I P
Sbjct  247   HNS--MPNQDQIKALVQAYSPHIYFHPDEEYFPSSVAWFFENGALLYTKGDESNPVPIDP  304

Query  1011  DGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIFY  832
              GSNLPQGG ND  YW++LP+D+  KERVK+GDL  +  YL++KPMFGGTFTD+AIW+FY
Sbjct  305   AGSNLPQGGPNDDAYWIDLPIDSAAKERVKKGDLADAYAYLHVKPMFGGTFTDVAIWLFY  364

Query  831   PFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAPN  652
             PFNGP+ AK+ +   I LG IGEH+GDWEH+TLRISNFNG L  +YFS+HS G W DA +
Sbjct  365   PFNGPARAKV-EFFNISLGKIGEHVGDWEHVTLRISNFNGELKSMYFSQHSKGLWADAVD  423

Query  651   LEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVV-AG  475
             LEF NG NK VAYSSL+GHA+Y   GLVLQG G IGIRND+AK  + +DTG ++ VV A 
Sbjct  424   LEFENG-NKPVAYSSLHGHASYPNQGLVLQGNGSIGIRNDSAKGKSFMDTGAKFLVVDAE  482

Query  474   LQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEE  301
               G   VEPPW+ Y R+WGPKI+Y  E++I++VE +LP + +  FE +++ LP E  GEE
Sbjct  483   YLGPVYVEPPWLSYARKWGPKISYSIEDEIRKVEKVLPGKLKSAFEKVVNSLPREVLGEE  542

Query  300   GPTGPNMKASWSGDEK  253
             GPTGP MK SW GDE+
Sbjct  543   GPTGPKMKDSWIGDER  558



>ref|XP_004229552.1| PREDICTED: uncharacterized protein LOC101265960 [Solanum lycopersicum]
Length=540

 Score =   508 bits (1307),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 252/435 (58%), Positives = 314/435 (72%), Gaps = 14/435 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS++L I Q G  Y+WLP+PP+GY +VGHVVTTS +KPS D+IRCV +  TD  E
Sbjct  117   YTLVWSSENLKIKQDGVCYMWLPIPPEGYKSVGHVVTTSPQKPSLDKIRCVRADLTDVSE  176

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG-TFACLKNNNV  1195
              +DW+WG        +GFN+Y+ RP +RG +  GV  G F+ S +G    + ACLKN  V
Sbjct  177   TDDWIWGN-------DGFNVYSSRPKDRGIKGLGVSTGAFMASNNGAAADSLACLKN--V  227

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
                 + MPNL+QI+ALF+ YSP+ Y HP + Y+PSSV WFF NGALLY KG E+ PV + 
Sbjct  228   VEKFTCMPNLNQIQALFQAYSPLYYFHPDEEYYPSSVTWFFQNGALLYAKGQESTPVVVQ  287

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             PDGSNLP+ G+NDG YW++LP D++ K RVK GD  ++  YL++KPMFG T TDIA+W+F
Sbjct  288   PDGSNLPRDGSNDGAYWLDLPTDDSAKNRVKSGDFHAATSYLHVKPMFGATHTDIALWLF  347

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+  I  IPLG IG+H+GDWEH+TLRISNFNG L  VYFS+HSGG+WV  P
Sbjct  348   YPFNGPARAKIEFI-TIPLGKIGQHVGDWEHITLRISNFNGELQSVYFSQHSGGNWVSTP  406

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
              LEF NG NK VAYSSL+GHA YSK G  +QG G+IGIRNDTAK   V+DTG  Y VVAG
Sbjct  407   QLEFENG-NKPVAYSSLHGHACYSKTGQNMQGNGNIGIRNDTAK-GQVMDTGANYEVVAG  464

Query  474   -LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEEG  298
                 IVEP W+ Y REWGPKI+Y    ++K++E  LP + +   E L+  LPNE  GEEG
Sbjct  465   DYLEIVEPIWLNYAREWGPKISYDIANELKKIERFLPGKLKRAVEKLVKSLPNEVLGEEG  524

Query  297   PTGPNMKASWSGDEK  253
             PTGP  K  W+GDE+
Sbjct  525   PTGPKFKDMWNGDER  539



>emb|CDY23425.1| BnaC04g49530D [Brassica napus]
Length=571

 Score =   508 bits (1307),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 256/438 (58%), Positives = 319/438 (73%), Gaps = 15/438 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV +++SL I Q GP Y+WLPVPP GY AVG +VTT+ +KP  D++RCV S  T+ CE
Sbjct  144   YTLVANTESLKIKQDGPGYIWLPVPPDGYQAVGLLVTTTSQKPPLDKLRCVRSDLTEQCE  203

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSFSGNVGTFACLKNNNV  1195
              + W+WG        NG N+  LRP  RGTQA GV VGTF     + +  + +CLKN   
Sbjct  204   ADTWIWGT-------NGVNVSNLRPNIRGTQATGVCVGTFTWQPQNSSPPSLSCLKNTKQ  256

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              FS+  MPN SQI  LF  YSP++YLHP + Y PSSVNW+FSNGALLY +G E+NP  I 
Sbjct  257   NFST--MPNRSQIGVLFNTYSPLIYLHPDEEYLPSSVNWYFSNGALLYKQGQESNPNPIE  314

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +G+NLPQGG+NDG YW++LP D   KERVK+GDLQ+++ YL+IKPM G TFTDIAIW+F
Sbjct  315   SNGTNLPQGGSNDGSYWLDLPRDKKAKERVKKGDLQNTKAYLHIKPMLGATFTDIAIWLF  374

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+  I  +PLG IGEHIGDWEH+TLRISNF G L +V+ S+HSGG W+DA 
Sbjct  375   YPFNGPARAKVKFI-NLPLGRIGEHIGDWEHVTLRISNFTGELWRVFLSQHSGGVWIDAC  433

Query  654   NLEFI-NGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
             +LEF   GSNK VAY+SL+GHA Y+KPGLVLQG  D+GIRNDTAKS  V+DTGL Y VVA
Sbjct  434   DLEFEGGGSNKPVAYASLHGHAMYAKPGLVLQGDDDVGIRNDTAKSKKVVDTGLGYEVVA  493

Query  477   GLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                   G+VEPPW+ Y R+WGPKI Y  ++D+KRV  LLP   +  F      +P+E +G
Sbjct  494   AEYEGGGVVEPPWLNYYRKWGPKIDYSVDDDVKRVARLLPGALKKAFVNFAKKIPDEVYG  553

Query  306   EEGPTGPNMKASWSGDEK  253
             E+GPTGP +K +W+GDEK
Sbjct  554   EDGPTGPKLKGNWAGDEK  571



>ref|XP_010544519.1| PREDICTED: uncharacterized protein LOC104817144 [Tarenaya hassleriana]
Length=539

 Score =   505 bits (1301),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 256/433 (59%), Positives = 315/433 (73%), Gaps = 16/433 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LV S++SL I Q G  YVW PVPP GY+AVG VVT S +KP  D IRCV S  T+ CE
Sbjct  122   YSLVGSTESLKIKQDGAGYVWQPVPPDGYTAVGLVVTNSPQKPPLDNIRCVRSDLTEQCE  181

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF-LGSFSGNVGTFACLKNNNV  1195
              + W+WG        NG ++ +LRP NRGTQA GV VG+F   + +    + +CLKN  +
Sbjct  182   ADKWIWGT-------NGVSISSLRPRNRGTQATGVSVGSFSWQTQNATPPSLSCLKN--M  232

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              F  S MPN SQ+ ALF+ YSP +Y HP + Y PSSVNW+FSNGALLY +G+E+ P  I 
Sbjct  233   KFDFSCMPNESQVVALFQTYSPWIYFHPDEEYLPSSVNWYFSNGALLYKQGEESRPNPIQ  292

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             P+GSNLPQGG+NDG+YW++LPVD  EKERVK+GDLQ+++VYL++KPMFG TFTDIAIW+F
Sbjct  293   PNGSNLPQGGSNDGLYWLDLPVDKKEKERVKKGDLQNTKVYLHVKPMFGATFTDIAIWVF  352

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+ +I  I LG IGEHIGDWEHLTLRISNF+G L +VYFS+HSGG+WV+A 
Sbjct  353   YPFNGPARAKV-KIINISLGKIGEHIGDWEHLTLRISNFDGALRRVYFSQHSGGTWVEAC  411

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
             +LEF  G NK V YSSL+GHA Y KPGLVLQG  D+GIRNDTAK   V+DTG  Y VVA 
Sbjct  412   DLEF-QGGNKPVTYSSLHGHAMYPKPGLVLQGDNDVGIRNDTAKGKQVIDTGTAYEVVAE  470

Query  474   LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEEGP  295
                  EPPWV Y R+WG KI Y    + K +E +LP   +  F   +  +PNE FGE+GP
Sbjct  471   ----EEPPWVNYMRKWGAKIDYDINGEAKDIEKILPGFLKKAFANFVRKIPNEVFGEDGP  526

Query  294   TGPNMKASWSGDE  256
             TGP +K SW+GDE
Sbjct  527   TGPKVKGSWAGDE  539



>ref|XP_010512857.1| PREDICTED: uncharacterized protein LOC104788773, partial [Camelina 
sativa]
Length=591

 Score =   507 bits (1306),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 253/438 (58%), Positives = 318/438 (73%), Gaps = 16/438 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV +++SL I Q GP+Y W PVPP+GY AVG +VT S +KP  D++RCV S  T+ CE
Sbjct  163   YTLVGNTESLKIQQDGPSYFWQPVPPEGYQAVGLIVTNSSQKPPLDKLRCVRSDLTEQCE  222

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-FACLKNNNV  1195
              + W+WG        NG N+  LRP  RGTQA GV VGTF      +     +CLKN N 
Sbjct  223   ADTWIWGT-------NGVNISNLRPTTRGTQATGVSVGTFTWQTQNSPPLPLSCLKNTNF  275

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              FS+  MPN SQI+ LF+ YSP +Y HP + Y PSSVNW+F+NGALLY +G+E+ P+ I 
Sbjct  276   DFST--MPNESQIKELFQTYSPTVYFHPDEDYLPSSVNWYFNNGALLYKRGEESKPIPIE  333

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +GSNLPQGG+NDG YW++LP+D N KERVK+GDLQS++VYL+IKPM G TFTDI+IWIF
Sbjct  334   SNGSNLPQGGSNDGSYWLDLPIDKNGKERVKKGDLQSTKVYLHIKPMLGATFTDISIWIF  393

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+ +   +PLG IGEHIGDWEH TLRISNF G L +V+ S+HSGG W++A 
Sbjct  394   YPFNGPARAKV-KFVNLPLGRIGEHIGDWEHATLRISNFTGELWRVFLSQHSGGVWIEAC  452

Query  654   NLEFI--NGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVV  481
             +LEF    GSNK VAY+SL+GHA YSKPGLVLQG   +GIRNDTAKS  V+DTGL Y V+
Sbjct  453   DLEFQGGGGSNKPVAYASLHGHAMYSKPGLVLQGDDGVGIRNDTAKSKKVIDTGLGYEVI  512

Query  480   AGLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
             A      G+VEPPWV Y R+WGPKI Y  ++ +K VE +LP   +  F   +  +PNE +
Sbjct  513   AAEYDGGGVVEPPWVNYLRKWGPKIDYNVDDQVKSVERILPGFLKKAFVNFVRKIPNEVY  572

Query  309   GEEGPTGPNMKASWSGDE  256
             GE+GPTGP +K +W+GDE
Sbjct  573   GEDGPTGPKLKGNWAGDE  590



>ref|XP_004488551.1| PREDICTED: uncharacterized protein LOC101507229 [Cicer arietinum]
Length=539

 Score =   505 bits (1300),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 250/438 (57%), Positives = 313/438 (71%), Gaps = 20/438 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVW+S S  I Q    Y+WLP+ P GY+ +GH+VTT+ +KPS DRI CV S FTD CE
Sbjct  115   YTLVWTSKSQKIKQDQDGYIWLPIAPNGYNPLGHIVTTTPQKPSLDRIYCVRSDFTDQCE  174

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL---GSFSGNVGTFACLKNN  1201
             +  W+WG  +   D   FN+  +RPINRG QA GV VGTFL   G  + N    +CLKN 
Sbjct  175   LSSWIWGP-SKKFDEKEFNVQNVRPINRGVQALGVVVGTFLAQIGEKTSNPLPISCLKNQ  233

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             N+ FSS  MPNL QI+AL + YSPI+YLHP + + P S  W+F+NGALLY KG+E+NP+ 
Sbjct  234   NLKFSS--MPNLPQIKALAQAYSPIMYLHPNEKFQPCSTKWYFTNGALLYKKGEESNPIA  291

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I P GSNLPQGG NDG YW++LP D   KERVK+GD +S + Y+++KPMFGG FTD+A+W
Sbjct  292   IDPLGSNLPQGGNNDGAYWLDLPKDKENKERVKKGDYKSCQAYIHVKPMFGGIFTDLAMW  351

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             +FYPFNGP T K+G I+ I LG IG+HIGDWEH+TLR+SNFNG L KVYFS+HS G WVD
Sbjct  352   VFYPFNGPGTLKVGLIDNISLGKIGQHIGDWEHVTLRVSNFNGELKKVYFSQHSNGQWVD  411

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVV  481
             A  +EF NG NKS+AYSSLNGHA Y K GLVLQG+G+IGI+N+T KS  V+D G+ + +V
Sbjct  412   ASQVEFQNG-NKSIAYSSLNGHAIYPKAGLVLQGVGEIGIKNETKKSDMVIDFGVNFEIV  470

Query  480   AGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
             +G      IVEP W+ + REWGPKITY   E++  +E ++P             LPNE  
Sbjct  471   SGEYLGNEIVEPAWLNFFREWGPKITYDLGEELNNLEKVVPG----------FKLPNELL  520

Query  309   GEEGPTGPNMKASWSGDE  256
             GEEGPTGP  K +W+GDE
Sbjct  521   GEEGPTGPKQKRNWNGDE  538



>ref|XP_004151267.1| PREDICTED: uncharacterized protein LOC101218097 [Cucumis sativus]
 gb|KGN58636.1| hypothetical protein Csa_3G708170 [Cucumis sativus]
Length=560

 Score =   506 bits (1302),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 265/440 (60%), Positives = 319/440 (73%), Gaps = 13/440 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWS++S  I + G  Y+W P PP GY AVGHVVT S EKPS D+IRCV S  T+ CE
Sbjct  125   YTLVWSTESSKIKRDGNGYIWSPTPPDGYRAVGHVVTASPEKPSVDKIRCVRSELTEECE  184

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-----FACLK  1207
              E W+WG   S  D NGFN+Y+ RP NRG    GV  G FL   +   G        CLK
Sbjct  185   NEAWIWGPMKSR-DENGFNIYSSRPKNRGITGTGVSTGGFLALPAPTTGNSPLPQLFCLK  243

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N N    S+AMP+LSQI++L++ YSPI+Y HP + Y PSSV+WFFSNGALLY K +E+NP
Sbjct  244   NLNSI--SAAMPDLSQIDSLYQAYSPIIYFHPKEKYLPSSVDWFFSNGALLYDKSNESNP  301

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             V I PDG NLPQGG+NDG +W+NLP D  EKE++K+GDLQS   YL++KPM GGTFTDIA
Sbjct  302   VPINPDGLNLPQGGSNDGQFWLNLPTDEEEKEKLKKGDLQSCRGYLHVKPMIGGTFTDIA  361

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
              WIF+PFNGP+TAK+G I+ IP   IGEHIGDWEH+TLRISNF G L +VYF++HS G W
Sbjct  362   TWIFFPFNGPATAKVGIID-IPFTKIGEHIGDWEHITLRISNFTGELRRVYFAQHSKGEW  420

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
             VD P+L F  G NK VAYSSLNGHA+YSKPGLVLQG  +IGIRN+TAKS  V+DTG  Y 
Sbjct  421   VDPPSLGFEKG-NKVVAYSSLNGHASYSKPGLVLQGAAEIGIRNETAKSGLVVDTGTNYL  479

Query  486   VVAG--LQG-IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
             V+    L+G +VEP WV Y REWGP+I Y   E+I++VE+LLP   +  F   +  LP+E
Sbjct  480   VIGAEYLEGAVVEPAWVNYTREWGPRIEYPIVEEIEKVENLLPGRLKEGFRGFVKKLPDE  539

Query  315   FFGEEGPTGPNMKASWSGDE  256
               GEEGPTGP MK SW+GDE
Sbjct  540   IRGEEGPTGPKMKNSWNGDE  559



>gb|KDP32271.1| hypothetical protein JCGZ_13196 [Jatropha curcas]
Length=508

 Score =   504 bits (1297),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 257/438 (59%), Positives = 318/438 (73%), Gaps = 26/438 (6%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G  Y+WLP  P GY++VG VVT   EKPS +++RCV S  TD CE
Sbjct  90    YTLVWSSESLKIKQDGIGYIWLPTAPDGYTSVGLVVTNVPEKPSLEKLRCVRSDLTDQCE  149

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGN---VGTFACLKNN  1201
             ++ W+WG G   +DPNGFN+++LRP NRGTQA GV VGTF    +GN   +   ACLKN 
Sbjct  150   IDSWIWGIG-KQSDPNGFNVFSLRPSNRGTQAMGVSVGTFAAQ-NGNATSISVVACLKNV  207

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             + + + S MPNL+QI+A+   YSP +Y HP + Y  SSV+W+F+NGALLYTKG+E+NPV 
Sbjct  208   S-SHNLSCMPNLNQIQAILNAYSPRIYFHPDEEYLSSSVSWYFNNGALLYTKGEESNPVP  266

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             +   GSNLPQGG+NDG YW++LPVD   KERVK+GDLQ +EVYL+IKPM G TFTDIA+W
Sbjct  267   VEATGSNLPQGGSNDGSYWLDLPVDKGAKERVKKGDLQETEVYLHIKPMLGATFTDIAVW  326

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             IF PFNGP+ AK+ +   +PLG IGEH+GDWEH+TLR+SNFNG L  V+FS+HSGGSW D
Sbjct  327   IFCPFNGPAKAKV-EFINLPLGRIGEHVGDWEHVTLRVSNFNGELRGVFFSQHSGGSWFD  385

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVV  481
             A  LEF NG NK + Y+SL+GHA YSKPGLVLQG   IGIRNDTAKS  VLDTG R+S+V
Sbjct  386   ASELEFENG-NKPIGYASLHGHAMYSKPGLVLQGSNGIGIRNDTAKSKMVLDTGTRFSIV  444

Query  480   AGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
             A       +VEPPW+ +  +WGP ITY    DI              F  +I+ LP++ F
Sbjct  445   AAEYLGTAVVEPPWLNFFGKWGPNITY----DIA-----------AAFRKIINSLPDQVF  489

Query  309   GEEGPTGPNMKASWSGDE  256
             GEEGPTGP +K +W GDE
Sbjct  490   GEEGPTGPKLKRNWIGDE  507



>ref|XP_009142253.1| PREDICTED: uncharacterized protein LOC103866129 [Brassica rapa]
Length=552

 Score =   505 bits (1301),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 254/438 (58%), Positives = 320/438 (73%), Gaps = 15/438 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV +++SL   Q GP Y+W PVPP GY AVG +VTT+ +KP  D++RCV S  T+ CE
Sbjct  125   YTLVANTESLKTKQDGPGYIWQPVPPDGYQAVGLLVTTTSQKPPLDKLRCVRSDLTEQCE  184

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSFSGNVGTFACLKNNNV  1195
              + W+WG        NG N+  LRP  RGTQA GV VGTF     + +  + ACLKN  +
Sbjct  185   ADTWIWGT-------NGVNVSNLRPNIRGTQATGVCVGTFTWQPQNSSPPSLACLKNTKL  237

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              FS+  MPN SQI  LF  YSP+++LHP + Y PSSVNW+FSNGALLY +G E+NP  I 
Sbjct  238   NFST--MPNGSQIGVLFNTYSPLIHLHPDEEYLPSSVNWYFSNGALLYKQGQESNPNPIE  295

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +G+NLPQGG+NDG YW++LP D   KERVK+GDL++++ YL+IKPM G TFTDIAIW+F
Sbjct  296   SNGANLPQGGSNDGSYWLDLPRDKKAKERVKKGDLRNTKAYLHIKPMLGATFTDIAIWLF  355

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+  I  +PLG IGEHIGDWEH+TLRISNF G L +V+ S+HSGG W+DA 
Sbjct  356   YPFNGPARAKVKFI-NLPLGRIGEHIGDWEHVTLRISNFTGELWRVFLSQHSGGVWIDAC  414

Query  654   NLEFI-NGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
             +LEF   GSNK VAY+SL+GHA Y+KPGLVLQG GD+GIRNDTAKS  V+DTGL Y VVA
Sbjct  415   DLEFQGGGSNKPVAYASLHGHAMYAKPGLVLQGDGDVGIRNDTAKSKKVVDTGLGYEVVA  474

Query  477   GLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                   G+VEPPW+ Y R+WGPKI Y  ++D+KRV  LLP   +  F+     +P+E +G
Sbjct  475   AEYEGGGVVEPPWLNYYRKWGPKIDYSVDDDVKRVARLLPGALKKAFDNFAKKIPDEVYG  534

Query  306   EEGPTGPNMKASWSGDEK  253
             E+GPTGP +K +W+GDEK
Sbjct  535   EDGPTGPKLKGNWAGDEK  552



>emb|CDY30462.1| BnaA04g25630D [Brassica napus]
Length=572

 Score =   505 bits (1301),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 254/438 (58%), Positives = 320/438 (73%), Gaps = 15/438 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV +++SL   Q GP Y+W PVPP GY AVG +VTT+ +KP  D++RCV S  T+ CE
Sbjct  145   YTLVANTESLKTKQDGPGYIWQPVPPDGYQAVGLLVTTTSQKPPLDKLRCVRSDLTEQCE  204

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSFSGNVGTFACLKNNNV  1195
              + W+WG        NG N+  LRP  RGTQA GV VGTF     + +  + ACLKN  +
Sbjct  205   ADTWIWGT-------NGVNVSNLRPNIRGTQATGVCVGTFTWQPQNSSPPSLACLKNTKL  257

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              FS+  MPN SQI  LF  YSP+++LHP + Y PSSVNW+FSNGALLY +G E+NP  I 
Sbjct  258   NFST--MPNGSQIGVLFNTYSPLIHLHPDEEYLPSSVNWYFSNGALLYKQGQESNPNPIE  315

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +G+NLPQGG+NDG YW++LP D   KERVK+GDL++++ YL+IKPM G TFTDIAIW+F
Sbjct  316   SNGANLPQGGSNDGSYWLDLPRDKKAKERVKKGDLRNTKAYLHIKPMLGATFTDIAIWLF  375

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+  I  +PLG IGEHIGDWEH+TLRISNF G L +V+ S+HSGG W+DA 
Sbjct  376   YPFNGPARAKVKFI-NLPLGRIGEHIGDWEHVTLRISNFTGELWRVFLSQHSGGVWLDAC  434

Query  654   NLEFI-NGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
             +LEF   GSNK VAY+SL+GHA Y+KPGLVLQG GD+GIRNDTAKS  V+DTGL Y VVA
Sbjct  435   DLEFQGGGSNKPVAYASLHGHAMYAKPGLVLQGDGDVGIRNDTAKSKKVVDTGLGYEVVA  494

Query  477   GLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                   G+VEPPW+ Y R+WGPKI Y  ++D+KRV  LLP   +  F+     +P+E +G
Sbjct  495   AEYEGGGVVEPPWLNYYRKWGPKIDYSVDDDVKRVARLLPGALKKAFDNFAKKIPDEVYG  554

Query  306   EEGPTGPNMKASWSGDEK  253
             E+GPTGP +K +W+GDEK
Sbjct  555   EDGPTGPKLKGNWAGDEK  572



>ref|XP_008461747.1| PREDICTED: uncharacterized protein LOC103500279 [Cucumis melo]
Length=600

 Score =   505 bits (1301),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 248/438 (57%), Positives = 317/438 (72%), Gaps = 10/438 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             +TLVW+S+   I +    Y+W P PP GY AVGHVVTTS EKPS DR+RCV +  T+  E
Sbjct  167   FTLVWTSEKSNIKRDTDGYIWSPTPPDGYRAVGHVVTTSSEKPSVDRVRCVRADLTEQSE  226

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-FACLKNNNV  1195
              E W+WG   S +D NGFN+++ RP  R   A GV VGTF+   + N    F CL+N+  
Sbjct  227   KETWIWGLKDSVDD-NGFNIFSFRPTRRDVTAAGVSVGTFVALQATNSPLPFLCLRNSAS  285

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              F+  AMP++SQI  LFR Y+P++Y HP + + PSSVNW+FSNGALL+ K DE+ PV I 
Sbjct  286   IFA--AMPDVSQISTLFRTYAPLIYFHPKEKFLPSSVNWYFSNGALLFNKSDESKPVPID  343

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +G+NLPQGG NDG +W++LP+D   KE+VK GDLQS +VYL IKPM GGTFTDI IWIF
Sbjct  344   LNGTNLPQGGQNDGGFWLDLPIDGGAKEKVKHGDLQSCQVYLRIKPMIGGTFTDITIWIF  403

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             +PFNGP+TAK+G I+ IP   IGEH+GDWEH+TLRISNF G L KVYF++HS G W+DA 
Sbjct  404   FPFNGPATAKVGIID-IPFRKIGEHVGDWEHITLRISNFTGELWKVYFAQHSKGEWIDAS  462

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA-  478
             +LEF  G NK VAYSSLNGHA+YSKPGLV+QG G+IG++N+TAKS  VLDTG     +A 
Sbjct  463   SLEFEKG-NKVVAYSSLNGHASYSKPGLVMQGGGEIGLKNETAKSGMVLDTGASSIEIAA  521

Query  477   ---GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                G + + EP WV Y R+WGPKI Y   E++++VE LLP   +  F+  ++ LP+E  G
Sbjct  522   EYLGEEAVAEPAWVNYFRQWGPKIEYQIAEEMEKVEKLLPGRLKEAFKQFMNRLPDEILG  581

Query  306   EEGPTGPNMKASWSGDEK  253
             +EGPTGP +K SW+GDE+
Sbjct  582   QEGPTGPKLKDSWNGDER  599



>ref|XP_006397604.1| hypothetical protein EUTSA_v10001386mg [Eutrema salsugineum]
 gb|ESQ39057.1| hypothetical protein EUTSA_v10001386mg [Eutrema salsugineum]
Length=554

 Score =   502 bits (1292),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 252/439 (57%), Positives = 316/439 (72%), Gaps = 16/439 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV +++SL I Q  P Y+W PVPP GY AVG +VT S +KP  D++RCV S  T+ CE
Sbjct  126   YTLVGNTESLKIKQDRPGYIWQPVPPDGYQAVGLIVTDSSQKPPLDKLRCVRSDLTEQCE  185

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSFSGNVGTFACLKNNNV  1195
              + WVWG        NG N+ +LRP  RGTQAKGV VGTF     + +    +CLKN   
Sbjct  186   ADTWVWGS-------NGVNVSSLRPTIRGTQAKGVCVGTFTWQPQNSSPLALSCLKNTKF  238

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              FS+  MPN SQ   LF+ YSP +Y HP + Y PSSVNW+FSNGALLY +G+E+NPV I 
Sbjct  239   DFST--MPNGSQFGELFQIYSPSIYFHPDEEYLPSSVNWYFSNGALLYKRGEESNPVPIE  296

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +GSNLPQGG+NDG YW++LP+D   KERVK+GDLQS++VYL+IKPM G TFTDIAIW+F
Sbjct  297   SNGSNLPQGGSNDGSYWLDLPIDKKGKERVKKGDLQSNKVYLHIKPMLGATFTDIAIWVF  356

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+ +   +PLG IGEHIGDWEH TLRISNFNG L +++ S+HSGG W+DA 
Sbjct  357   YPFNGPARAKV-KFVNLPLGKIGEHIGDWEHATLRISNFNGELWRMFLSQHSGGVWIDAC  415

Query  654   NLEFI-NGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
              LEF   GSNK +AY+SL+GHA Y KPGLVLQG   +GIRNDTAKS  V+DTGL Y ++A
Sbjct  416   ELEFQGGGSNKPIAYASLHGHAMYPKPGLVLQGDDGVGIRNDTAKSKKVIDTGLGYELIA  475

Query  477   GLQG----IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
                G    + EPPWV Y R+WGPKI Y  ++D++R+E LLP   +  F      +P+E +
Sbjct  476   AEYGDGGVVAEPPWVNYLRKWGPKIDYNVDDDVRRIERLLPGALKKAFVNFARKIPDEVY  535

Query  309   GEEGPTGPNMKASWSGDEK  253
             GE+GPTGP +K +W+GDEK
Sbjct  536   GEDGPTGPKLKGNWAGDEK  554



>ref|XP_007149177.1| hypothetical protein PHAVU_005G047900g [Phaseolus vulgaris]
 gb|ESW21171.1| hypothetical protein PHAVU_005G047900g [Phaseolus vulgaris]
Length=546

 Score =   501 bits (1289),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 250/440 (57%), Positives = 313/440 (71%), Gaps = 21/440 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWSS+S  I Q    YVWLP  P GY A+GHVVTT+ EKPS D+IRCV S  TD CE
Sbjct  119   YSLVWSSNSRKIKQEKDGYVWLPTAPDGYKALGHVVTTTPEKPSLDKIRCVRSDLTDQCE  178

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-----FACLK  1207
                W+WG   SN D  GFN++ +RP NRG QA GV VGTF   F+ N  T      +CLK
Sbjct  179   TNSWIWGPEKSN-DGKGFNVHEVRPSNRGIQAPGVLVGTF---FAHNGETPSSLPISCLK  234

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N N+ FSS  MPNL QI+AL + YSP +YLH  + + P+SV W+F+NGALL+ KG+E+ P
Sbjct  235   NTNMNFSS--MPNLPQIKALVQSYSPFMYLHSKEKFQPASVKWYFTNGALLFKKGEESKP  292

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             V I P GSNLPQGG NDG YW++LP D   KERVK+GD +S + Y++ KPMFGGTFTD+A
Sbjct  293   VAIDPTGSNLPQGGNNDGQYWLDLPTDKANKERVKKGDFKSFQAYVHAKPMFGGTFTDLA  352

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +W+FYPFNGP TAK+G I+ IPLG IGEH+GDWEH+TLR+SNF+G L K+Y S+HS G W
Sbjct  353   MWVFYPFNGPGTAKVGLID-IPLGEIGEHVGDWEHVTLRVSNFSGELKKLYVSQHSNGQW  411

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
             V+ P LEF    NK V YSSLNGHA Y KPGLV+QG+  IG++N+T +S  V+D G+ + 
Sbjct  412   VEVPQLEF-QRDNKPVIYSSLNGHAIYPKPGLVMQGLDGIGLKNETERSDKVVDMGVGFE  470

Query  486   VVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
             +VAG      IVEPPW+ Y R WGPKI+Y   +++ +++ + P     V E L   LPNE
Sbjct  471   IVAGEYLGSAIVEPPWLNYFRHWGPKISYDISKELDKLQKVFP-----VLEDLEKSLPNE  525

Query  315   FFGEEGPTGPNMKASWSGDE  256
               GEEGPTGP +K +WSGDE
Sbjct  526   LLGEEGPTGPKLKRNWSGDE  545



>ref|XP_006359130.1| PREDICTED: uncharacterized protein LOC102589484 [Solanum tuberosum]
Length=543

 Score =   501 bits (1289),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 250/435 (57%), Positives = 311/435 (71%), Gaps = 14/435 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS++L I Q G  Y+WLP+PP+GY +VGHVVTTS +KPS D+IRCV +  TD  E
Sbjct  120   YTLVWSSENLKIKQDGVCYIWLPIPPEGYKSVGHVVTTSPQKPSLDKIRCVRADLTDVSE  179

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG-TFACLKNNNV  1195
              +DW+WG           N+Y+ RP +RG +  GV  G F+   +G    + ACLKN   
Sbjct  180   TDDWIWGNDV-------LNVYSSRPKDRGIKGLGVSTGAFMALNNGATADSLACLKNIVE  232

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              FSS  MP L+Q++ALF+ YSP+ Y HP + Y+PSSV WFF NG LLYTKG E+ PV + 
Sbjct  233   NFSS--MPILNQVQALFQTYSPLYYFHPDEEYYPSSVTWFFQNGVLLYTKGQESAPVLVQ  290

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             PDGSNLP  G+NDG YW++LP D++ K RVK GD  ++  YL+IKPMFG T TDIA+W+F
Sbjct  291   PDGSNLPLDGSNDGAYWLDLPTDDSAKNRVKNGDFHAATSYLHIKPMFGATHTDIALWLF  350

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+  I  IPLG IG+H+GDWEH+TLRISNFNG L  VYFS+HSGG+WV AP
Sbjct  351   YPFNGPARAKIEFI-NIPLGKIGQHVGDWEHITLRISNFNGELQSVYFSQHSGGNWVSAP  409

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
              LEF NG NK VAYSSL+GHA YSK G  +QG G+IG+RNDTAK   V+DTG  Y+VVAG
Sbjct  410   QLEFENG-NKPVAYSSLHGHACYSKTGQNMQGSGNIGLRNDTAK-GQVMDTGANYAVVAG  467

Query  474   -LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEEG  298
                 IVEP W+ Y REWGPKI+Y    ++K++E  LP + +   E L+  LPNE  GEEG
Sbjct  468   DYLKIVEPVWLNYAREWGPKISYDIANELKKIERFLPGKLKRAIEKLVKSLPNEVLGEEG  527

Query  297   PTGPNMKASWSGDEK  253
             PTGP  K  W+GDE+
Sbjct  528   PTGPKFKDMWNGDER  542



>ref|XP_010506342.1| PREDICTED: uncharacterized protein LOC104782970 [Camelina sativa]
Length=553

 Score =   501 bits (1289),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 250/437 (57%), Positives = 317/437 (73%), Gaps = 15/437 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV +++SL I Q GP+Y W PVPP GY AVG +VT + +KP  D++RCV S  T+ CE
Sbjct  126   YTLVGNTESLKIKQDGPSYFWQPVPPDGYQAVGLIVTNTSQKPPLDKLRCVRSDLTEQCE  185

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSFSGNVGTFACLKNNNV  1195
              + W+WG        NG N+  LRP  RGTQA GV VGTF   + +    +  CLKN N 
Sbjct  186   ADTWIWGT-------NGVNISNLRPTTRGTQATGVCVGTFTWQTQTPPPPSLTCLKNTNF  238

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              FS+  MPN SQI+ LF+ YSP +Y HP + Y PSSVNW+F+NGALLY +G+E+ P+ I 
Sbjct  239   DFST--MPNESQIKELFQTYSPTVYFHPDEDYLPSSVNWYFNNGALLYKRGEESKPIPIE  296

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +GSNLPQGG+NDG YW++LP+D N KERVK+GDLQS++VYL+IKPM G TFTDI+IWIF
Sbjct  297   SNGSNLPQGGSNDGSYWLDLPIDKNGKERVKKGDLQSTKVYLHIKPMLGATFTDISIWIF  356

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+ +   +PLG IGEHIGDWEH TLRISNF G L +V+ S+HSGG W++A 
Sbjct  357   YPFNGPARAKV-KFVNLPLGRIGEHIGDWEHATLRISNFTGELWRVFLSQHSGGVWIEAC  415

Query  654   NLEFI-NGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
             +LEF   GSNK VAY+SL+GHA Y KPGLVLQG   +GIRNDTAKS  V+DTGL Y V+A
Sbjct  416   DLEFQGGGSNKPVAYASLHGHAMYPKPGLVLQGDDGVGIRNDTAKSKKVIDTGLGYEVIA  475

Query  477   GLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                   G+VEPPWV Y R+WGPKI Y  ++ +K VE +LP   +  F   +  +P+E +G
Sbjct  476   AEYDGGGVVEPPWVNYLRKWGPKIDYNVDDQVKSVERILPGFLKKAFVKFVSKIPDEVYG  535

Query  306   EEGPTGPNMKASWSGDE  256
             E+GPTGP +K +W+GDE
Sbjct  536   EDGPTGPKLKGNWAGDE  552



>ref|XP_009596811.1| PREDICTED: uncharacterized protein LOC104092840 [Nicotiana tomentosiformis]
Length=599

 Score =   502 bits (1293),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 248/436 (57%), Positives = 305/436 (70%), Gaps = 15/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVWSS  L I Q G  Y+WLP+PP+GY A+GHVVTTS +KPS D++RCV +  TD  E
Sbjct  175   YALVWSSQKLKINQDGVGYIWLPIPPEGYKAIGHVVTTSPQKPSLDKVRCVRADLTDVSE  234

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNVA  1192
               DW+WG        NG N+Y+ RP +RGTQA GV  G F+   +G   + ACLKN  V 
Sbjct  235   SHDWIWGT-------NGLNVYSSRPRDRGTQALGVSTGAFMAQNNGAADSLACLKN--VK  285

Query  1191  FSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIGP  1012
              + SAMPNL+Q++AL + YSP++Y HP + ++PSSV WFF NGALLYTKG E++PV I P
Sbjct  286   ANLSAMPNLNQVKALVQAYSPLIYFHPNEEFYPSSVTWFFQNGALLYTKGQESSPVGIQP  345

Query  1011  DGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIFY  832
              GSNLPQGG+NDG YW++LP DN  K  VKRGDL  +  YL+IKPMFG T TDIA+W+FY
Sbjct  346   TGSNLPQGGSNDGAYWLDLPSDNAAKANVKRGDLLGATAYLHIKPMFGATCTDIAVWLFY  405

Query  831   PFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAPN  652
             PFNG + AKL +   I LG IGEH+GDWEH+TLRISNFNG L  VY SEHSGG WV    
Sbjct  406   PFNGAAKAKL-EFMTISLGKIGEHVGDWEHVTLRISNFNGELQGVYLSEHSGGIWVSTSQ  464

Query  651   LEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAGL  472
             LEF NG NK V YSSL+GHA Y KPG  LQG GD+GIRNDT K   ++DTG  + VV   
Sbjct  465   LEFQNG-NKPVVYSSLHGHAAYPKPGQNLQGSGDVGIRNDTGK-GKLMDTGGNFLVVGAE  522

Query  471   ---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEE  301
                  IVEPPW+ Y REWGPKI+Y   +++ +VE  +P + +   E ++  LPNE  GE+
Sbjct  523   YLGTTIVEPPWLNYAREWGPKISYDISKELNKVERFMPGKLKRAVEKIVRSLPNEVLGEQ  582

Query  300   GPTGPNMKASWSGDEK  253
             GPTGP  K  W+GDE+
Sbjct  583   GPTGPKFKDMWNGDER  598



>ref|XP_003546829.1| PREDICTED: uncharacterized protein LOC100806731 [Glycine max]
 gb|KHN48861.1| hypothetical protein glysoja_019370 [Glycine soja]
Length=548

 Score =   500 bits (1288),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 250/438 (57%), Positives = 311/438 (71%), Gaps = 16/438 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS S  I Q    Y+WLP  P GY  +GHVVTT+ EKPS D+IRCV S  TD CE
Sbjct  120   YTLVWSSKSQKIKQDKDGYIWLPTAPDGYKTLGHVVTTTPEKPSLDKIRCVRSDLTDQCE  179

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT---FACLKNN  1201
                W+WG   S+ D  GFN+Y +RP NRGTQA GV VGTF  + +G + +    ACLKN 
Sbjct  180   RSSWIWGPDKSS-DEKGFNVYEVRPSNRGTQAPGVLVGTFF-AHNGEIPSPLPIACLKNT  237

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             N+ FSSS MPNL Q++AL + YSP +YLHP + + P+S  W+F+NGALL  KG+E+ PV 
Sbjct  238   NMNFSSS-MPNLPQVKALVQAYSPFMYLHPDEEFQPASTKWYFTNGALLVKKGEESKPVP  296

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I P GSNLPQGG NDG YW++LP D   KERVK+GD +S + Y++ KPMFGGTFTD+ +W
Sbjct  297   IDPTGSNLPQGGNNDGEYWLDLPSDKANKERVKKGDFKSCQAYVHAKPMFGGTFTDLVMW  356

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             +FYPFNGP TAK+G I+ IPLG IGEHIGDWEH+TLR+SNF+G L KVY S+HS G WV+
Sbjct  357   VFYPFNGPGTAKVGLID-IPLGKIGEHIGDWEHVTLRVSNFDGELKKVYLSQHSNGQWVE  415

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVV  481
             A  LEF +G NKSV YSSLNGHA Y K GLV+QG+  IGI+N+T KS  V+D G+ + VV
Sbjct  416   ASQLEFQSG-NKSVCYSSLNGHAIYPKAGLVMQGLDGIGIKNETKKSEKVIDMGVGFEVV  474

Query  480   AGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
             +G      IVEPPW+ + R+WGPKITY   +++  +  + P       E L   LPNE  
Sbjct  475   SGEYLGSAIVEPPWLNFLRQWGPKITYDIAKELDNLAKVFP-----ALEALEDGLPNELL  529

Query  309   GEEGPTGPNMKASWSGDE  256
             G+EGPTGP +K +W GDE
Sbjct  530   GQEGPTGPKLKRNWQGDE  547



>ref|XP_010518022.1| PREDICTED: uncharacterized protein LOC104793366 [Camelina sativa]
Length=552

 Score =   499 bits (1284),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 249/436 (57%), Positives = 314/436 (72%), Gaps = 14/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV +++SL I Q GP Y W PVPP GY AVG +VT S +KP  D++ CV S  T+ CE
Sbjct  126   YTLVGNTESLKIKQDGPGYFWQPVPPDGYQAVGLIVTNSSQKPPLDKVGCVRSDLTEQCE  185

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG-TFACLKNNNV  1195
              + W+W       + NG N+  LRP  RGTQA GV VGTF      +   + +CLKN N 
Sbjct  186   ADTWIW-------ETNGVNISNLRPTTRGTQATGVSVGTFTWQTQNSPPPSLSCLKNTNF  238

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              FS+  MPN SQI+ LF+ YSP +Y HP + Y PSSVNW+F+NGALLY + +E+ P+ I 
Sbjct  239   DFST--MPNESQIKELFQTYSPWVYFHPDEDYLPSSVNWYFNNGALLYKRCEESKPIPIE  296

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +GSNLPQGG+NDG YW++LP+D N KERVK+GDLQS++VYL+IKPM G TFTDI+IWIF
Sbjct  297   SNGSNLPQGGSNDGSYWLDLPIDKNGKERVKKGDLQSTKVYLHIKPMLGATFTDISIWIF  356

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+ +   +PLG IGEHIGDWEH TLRISNF G L +V+ S+HSGG W++A 
Sbjct  357   YPFNGPARAKV-KFVNLPLGRIGEHIGDWEHATLRISNFTGELWRVFLSQHSGGVWIEAC  415

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
             +LEF  GSNK VAY+SL+GHA Y KPGLVLQG   +GIRNDTAKS  V+DTGL Y V+A 
Sbjct  416   DLEFQGGSNKPVAYASLHGHAMYPKPGLVLQGDDGVGIRNDTAKSKKVIDTGLGYEVIAA  475

Query  474   LQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
                  G+VEPPWV Y R+WGPKI Y  ++ +K VES+LP   +  F   +  +P+E +GE
Sbjct  476   EYDGGGVVEPPWVNYLRKWGPKIDYDVDDQVKGVESILPGLLKKAFVKFVSKIPDEVYGE  535

Query  303   EGPTGPNMKASWSGDE  256
             +GPTGP +K +W GDE
Sbjct  536   DGPTGPKLKGNWVGDE  551



>ref|XP_006438992.1| hypothetical protein CICLE_v10031170mg [Citrus clementina]
 gb|ESR52232.1| hypothetical protein CICLE_v10031170mg [Citrus clementina]
Length=541

 Score =   498 bits (1283),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 250/438 (57%), Positives = 312/438 (71%), Gaps = 31/438 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G AYVWLP PP GY  VGH +T   EKP+ D++RCV S FTD C+
Sbjct  128   YTLVWSSESLKIKQDGVAYVWLPTPPDGYKNVGHAITNFPEKPALDKMRCVRSDFTDQCQ  187

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNVA  1192
              + W+WG      +  G N++++RP  RGT+  GV VGTF    +GN         +N  
Sbjct  188   TDTWIWGA-----NKYGLNVFSVRPSVRGTEEMGVSVGTFAAQINGN---------DNSP  233

Query  1191  FSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIGP  1012
              +S+ +            YSP +YLHP + Y PSSV+W+F NGALLY KG+E+ P+ I P
Sbjct  234   TTSTTL----------ASYSPYIYLHPDEKYLPSSVSWYFDNGALLYRKGEESKPIPIEP  283

Query  1011  DGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIFY  832
              GSNLPQGG+NDG YW++LPVD+  KERVK+GDLQ+S+VYL+IKPM G T+TDIAIWIFY
Sbjct  284   MGSNLPQGGSNDGAYWLDLPVDDKAKERVKKGDLQNSQVYLHIKPMLGATYTDIAIWIFY  343

Query  831   PFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAPN  652
             PFNGP+ AK+  I  IPLG IGEH+GDWEH+TLRISNFNG L +V+ S+HSGG+WV+A  
Sbjct  344   PFNGPARAKVKFINNIPLGKIGEHVGDWEHVTLRISNFNGELWRVFLSQHSGGTWVNASE  403

Query  651   LEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG-  475
             LEF +G NK V Y+SLNGHA Y+KPGLVLQG G IGIRNDTAKS  +LDTG  +S+VA  
Sbjct  404   LEFQSG-NKPVTYASLNGHAMYAKPGLVLQGSGGIGIRNDTAKSRMLLDTGRHFSIVAAD  462

Query  474   -LQG----IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
              L G    I EPPW+ Y REWGPKI+Y    +IK +E LLP + +  F+  ++ LPNE  
Sbjct  463   YLSGSASVITEPPWLNYFREWGPKISYDISHEIKEIEKLLPGKLKPAFQKFVNSLPNEVL  522

Query  309   GEEGPTGPNMKASWSGDE  256
             GEEGPTGP  K++W+GDE
Sbjct  523   GEEGPTGPKAKSNWNGDE  540



>emb|CDP07655.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   498 bits (1281),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 250/438 (57%), Positives = 308/438 (70%), Gaps = 15/438 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTL+WSS+SL I Q G  Y+WLP PP GY A+GHVVT+S +KPS +++RCV S +TD  +
Sbjct  127   YTLIWSSESLNIKQDGVGYIWLPTPPDGYKAIGHVVTSSPDKPSVEKVRCVRSDYTDATD  186

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF-LGSFSGNVGTFACLKNNNV  1195
             ++ W+WG        NG N+Y  RP  RG Q  GV  GTF L   SG   + ACLKN   
Sbjct  187   LDSWIWGSS------NGINIYGSRPKVRGIQVLGVSTGTFILAQNSGAATSLACLKNLQG  240

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              F   AMP L+QI ALF EYSP++Y HP + + PSSVNWFF NGALLYT+G E+NPV I 
Sbjct  241   NFH--AMPTLNQIRALFAEYSPVIYFHPDEEFFPSSVNWFFQNGALLYTRGQESNPVAIT  298

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             P GSNLPQGGTNDG YW++LP DN  K+RVK+G+LQ + VY+++KPM G TFTD+A+W+F
Sbjct  299   PTGSNLPQGGTNDGAYWIDLPRDNAAKDRVKQGNLQDASVYIHVKPMLGATFTDLAVWVF  358

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNG + AK+ +   I LG IGEH+GDWEH+TLRISNFNG L  VYFSEHSGG+WV A 
Sbjct  359   YPFNGAARAKV-EFVTIKLGKIGEHVGDWEHVTLRISNFNGELKSVYFSEHSGGTWVSAS  417

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGI-GDIGIRNDTAKSAAVLDTGLRYSVVA  478
              LEF NG NK V YSSL+GHA Y K G  LQG   ++GIRNDT K    +D G  +SVV+
Sbjct  418   GLEFQNG-NKPVVYSSLHGHAAYPKTGDFLQGSNSNVGIRNDTGKGQIFMDAGANFSVVS  476

Query  477   GL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                    IVEPPW+ Y REWGPKI+Y   ++IK+VE  LP + +   E  +  LP+E  G
Sbjct  477   ADYLGSTIVEPPWLNYTREWGPKISYNINDEIKKVEKFLPGKLKRALEKAVSELPSEALG  536

Query  306   EEGPTGPNMKASWSGDEK  253
             EEGPTGP  K +WSGDE+
Sbjct  537   EEGPTGPISKDNWSGDER  554



>ref|XP_006379002.1| hypothetical protein POPTR_0009s03000g [Populus trichocarpa]
 gb|ERP56799.1| hypothetical protein POPTR_0009s03000g [Populus trichocarpa]
Length=540

 Score =   497 bits (1279),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 258/437 (59%), Positives = 309/437 (71%), Gaps = 29/437 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSSDSL I Q G  Y+WLP PP GY AVGHVVT S +KP   +I CV S  TD CE
Sbjct  127   YTLVWSSDSLRIKQDGVGYIWLPTPPDGYKAVGHVVTNSPQKPPLGKIHCVRSDLTDQCE  186

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLG--SFSGNVGTFACLKNNN  1198
              + W+WG G   +DPNGFN+Y+L P NRGTQA GV VGTF+   +F+  V + AC+K  N
Sbjct  187   FDSWIWGLG-KESDPNGFNVYSLLPSNRGTQAMGVCVGTFVAQNTFTAPV-SLACVK--N  242

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
             V  + S MPN +QI+ +F+ YSP +Y HP + Y PSSVNW+  NGALLY KGDE+ PV I
Sbjct  243   VVSNLSCMPNRNQIQTIFQAYSPWMYFHPDEQYLPSSVNWYLKNGALLYKKGDESKPVPI  302

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
               +GS LPQG                  ERVK+G+LQ S+VYL+IKPM G TFTDIA+W+
Sbjct  303   ESNGSKLPQG------------------ERVKKGNLQDSQVYLHIKPMLGATFTDIAVWV  344

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGPS AK+ +   IPLG IGEH+GDWEH+TLRISNFNG L  VYFSEHSGG+WV A
Sbjct  345   FYPFNGPSKAKV-EFINIPLGKIGEHVGDWEHVTLRISNFNGELWSVYFSEHSGGTWVKA  403

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               LEF NG NK+V YSSL+GHA Y+KPGLVLQG G IGIRNDTAKS  ++DTG    VVA
Sbjct  404   SELEFQNG-NKAVTYSSLHGHAMYAKPGLVLQGSGGIGIRNDTAKSKKLMDTGANSLVVA  462

Query  477   GL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                    I EPPW+ Y R+WGPK+TY   E+IK+V+ LLP + +  F+  I  LPNE  G
Sbjct  463   AEYLGTDINEPPWLNYFRKWGPKVTYDISEEIKKVDKLLPGKLKSAFDKFIRSLPNEVLG  522

Query  306   EEGPTGPNMKASWSGDE  256
             E+GPTGP MK +W+GDE
Sbjct  523   EQGPTGPKMKRNWTGDE  539



>ref|XP_004151268.1| PREDICTED: uncharacterized protein LOC101218337 [Cucumis sativus]
Length=553

 Score =   497 bits (1279),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 247/438 (56%), Positives = 314/438 (72%), Gaps = 10/438 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             +TLVW+S+   I +    Y+W P PP GY AVGHVVTTS  KPS DR+RCV +  T+  E
Sbjct  120   FTLVWTSEKSNIKRDTDGYIWSPTPPDGYRAVGHVVTTSSVKPSVDRVRCVRADLTEQSE  179

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-FACLKNNNV  1195
              E W+WG   S  D NGFN+++ RP  R   A GV VGTF+   + N      CL+N+  
Sbjct  180   KETWIWGLKDSI-DENGFNIFSFRPTRRDITAAGVSVGTFVALPATNSPLPLLCLRNS--  236

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
             A  S+AMP++SQI  LFR Y+P++Y HP + + PSSVNW+FSNGALLY K  E+ PV I 
Sbjct  237   ASISAAMPDVSQISTLFRAYAPLIYFHPKEKFLPSSVNWYFSNGALLYNKSVESKPVPID  296

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             P+G+NLPQGG NDG +W++LP+D   KERVK GDLQS +VYL IKPM GGTFTDI IWIF
Sbjct  297   PNGTNLPQGGQNDGGFWLDLPIDGGAKERVKHGDLQSCQVYLQIKPMIGGTFTDITIWIF  356

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             +PFNGP+TAK+G I+ IP   IGEH+GDWEH+TLRISNF G L KVYF++HS G W+DA 
Sbjct  357   FPFNGPATAKVGIID-IPFRKIGEHVGDWEHITLRISNFTGELWKVYFAQHSKGEWIDAS  415

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
             +LEF  G NK VAYSSLNGHA+YSKPGLV+QG G+IG++N+TAKS  VLDTG     +A 
Sbjct  416   SLEFEKG-NKVVAYSSLNGHASYSKPGLVMQGGGEIGLKNETAKSGLVLDTGASSVEIAT  474

Query  474   ----LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                  + + EP W+ Y R+WGPKI Y   E++++VE LLP   +  F+  ++ LP+E  G
Sbjct  475   EYLREEAVTEPAWLNYFRQWGPKIEYQIAEEMEKVEKLLPGRLKEAFKQFMNRLPDEILG  534

Query  306   EEGPTGPNMKASWSGDEK  253
             +EGPTGP +K SW+GDE+
Sbjct  535   QEGPTGPKLKDSWNGDER  552



>ref|XP_003532908.1| PREDICTED: uncharacterized protein LOC100792266 [Glycine max]
 gb|KHN21373.1| hypothetical protein glysoja_026574 [Glycine soja]
Length=549

 Score =   496 bits (1278),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 248/440 (56%), Positives = 310/440 (70%), Gaps = 20/440 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS S  I Q    Y+WLP  P GY  +GHVVTT+ EKPS D+IRCV S  TD CE
Sbjct  121   YTLVWSSKSQKIKQDKDGYIWLPTAPDGYKTLGHVVTTTPEKPSLDKIRCVRSDLTDQCE  180

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-----FACLK  1207
                W+WG   S+ D  GFN++ +RP NRGTQA GV VGTF   F+ N         ACLK
Sbjct  181   RNSWIWGPAKSS-DEKGFNVHEVRPSNRGTQAPGVLVGTF---FAHNCEAPSPLPIACLK  236

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N ++ FSSS MPNL Q+ AL + YSP +YLHP + + P+S  W+F+NGALL  KG+E+ P
Sbjct  237   NTSMNFSSS-MPNLPQVRALVQAYSPFMYLHPDEDFQPASTKWYFTNGALLVKKGEESKP  295

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             V I P GSNLPQGG NDG +W++LP D   KERVK+GD +S + Y++ KPMFGGTFTD+ 
Sbjct  296   VAIDPTGSNLPQGGNNDGEFWLDLPSDKANKERVKKGDFKSCQAYVHAKPMFGGTFTDLV  355

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +W+FYPFNGP TAK+G I+ IPLG IGEHIGDWEH+TLR+SNFNG L +VY S+HS G W
Sbjct  356   MWVFYPFNGPGTAKVGLID-IPLGKIGEHIGDWEHVTLRVSNFNGELKRVYLSQHSKGQW  414

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
             V+AP LEF +G NK+V YSSLNGHA Y K GLV+QG+  IGI+N+T +S  V+D G+ + 
Sbjct  415   VEAPQLEFQSG-NKAVCYSSLNGHAIYPKVGLVMQGLDGIGIKNETKRSEKVIDMGVGFE  473

Query  486   VVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
             VV+G      IVEPPW+ + R+WGPKITY   + + ++E + P       + L   LP E
Sbjct  474   VVSGEYLGSAIVEPPWLNFFRQWGPKITYDIAKVLDKLEKVFP-----ALQGLEDSLPKE  528

Query  315   FFGEEGPTGPNMKASWSGDE  256
               GEEGPTGP +K +WSGDE
Sbjct  529   LLGEEGPTGPKLKRNWSGDE  548



>ref|XP_006295574.1| hypothetical protein CARUB_v10024679mg [Capsella rubella]
 gb|EOA28472.1| hypothetical protein CARUB_v10024679mg [Capsella rubella]
Length=552

 Score =   496 bits (1278),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 247/436 (57%), Positives = 313/436 (72%), Gaps = 14/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTL+ +++SL I Q GP+Y W PVPP GY  VG +VT S +KP  +++RCV S  T+ CE
Sbjct  126   YTLIGNTESLKIKQDGPSYFWQPVPPDGYQVVGLIVTNSSQKPPLEKLRCVRSDLTEQCE  185

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSFSGNVGTFACLKNNNV  1195
              + W+WG        NG N+  LRP  RGTQA GV VGTF     + +  T +CLKN N+
Sbjct  186   ADTWIWGT-------NGVNISNLRPTTRGTQATGVSVGTFTWQPQNSSPPTLSCLKNTNL  238

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              FS+  MPN SQIE LF+ YSP +Y HP + Y PSSVNW+F+NGALLY +G+E+ P  I 
Sbjct  239   DFST--MPNGSQIEELFQSYSPWVYFHPDEEYLPSSVNWYFNNGALLYKRGEESKPTPIE  296

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +G+NLPQGG+NDG YW++LP+D N KERVK+GDLQS++VYL+IKPM G TFTDI+IWIF
Sbjct  297   LNGTNLPQGGSNDGSYWLDLPIDKNGKERVKKGDLQSTQVYLHIKPMLGATFTDISIWIF  356

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+ +   + LG IGEHIGDWEH TLRISNF G L +V+ S+HSGG W DA 
Sbjct  357   YPFNGPARAKV-KFVNLTLGRIGEHIGDWEHATLRISNFTGELWRVFLSQHSGGVWTDAC  415

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
             +LEF   SNK VAY+SL+GHA Y KPGLVLQG   +GIRNDTAK   V+DTGL Y V+A 
Sbjct  416   DLEFQGVSNKPVAYASLHGHAMYPKPGLVLQGDDGVGIRNDTAKGKKVIDTGLGYEVIAA  475

Query  474   LQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
                  G+VEPPWV Y R+WGPKI Y  ++ +K VE +LP   +  F   +  +P+E +GE
Sbjct  476   EYEGGGVVEPPWVNYFRKWGPKIDYNVDDQVKSVERILPGFLKKAFVKFVRKIPDEVYGE  535

Query  303   EGPTGPNMKASWSGDE  256
             +GPTGP +K +W+GDE
Sbjct  536   DGPTGPKLKGNWAGDE  551



>gb|EYU37528.1| hypothetical protein MIMGU_mgv1a003548mg [Erythranthe guttata]
Length=579

 Score =   497 bits (1279),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 250/440 (57%), Positives = 313/440 (71%), Gaps = 21/440 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWS  S   T+S  AY WLP+PP GY AVG V+TT+ +KPS D+IRCV S FTD  E
Sbjct  152   YTLVWSDTS--TTES--AYFWLPIPPDGYKAVGFVITTTADKPSLDKIRCVRSDFTDESE  207

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNVA  1192
             +E W+WG+G       G N+Y  RP  RGT+A+ + VG FL        T  CLKNNN  
Sbjct  208   IEAWIWGQG-------GMNVYGSRPKTRGTKAQQLSVGAFLVQTDNYTDTLPCLKNNNS-  259

Query  1191  FSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIGP  1012
              + SA PNLSQI+A+F  YSP +Y    + Y PSSVNWFFSNGALLY K DE+NPV I  
Sbjct  260   -TVSAAPNLSQIKAVFNTYSPYIYFFSKENYLPSSVNWFFSNGALLYKKDDESNPVGIEA  318

Query  1011  DGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIFY  832
             DGSNLPQGG+NDG YW++LP   NE+ RV+ GDLQ++E YL+ K + GG FTDI +WIFY
Sbjct  319   DGSNLPQGGSNDGEYWIDLPGGKNERRRVQGGDLQNAEAYLHSKAVLGGAFTDIQVWIFY  378

Query  831   PFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAPN  652
             PFNG +TAKLG I  I LG IGEH+GDWEH+TLRISNF+GVL +VYF+ H+GG+WVDA  
Sbjct  379   PFNGHATAKLGIIHEISLGKIGEHVGDWEHVTLRISNFDGVLYRVYFAAHAGGTWVDASL  438

Query  651   LEFING---SNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVV  481
             LE+  G   +NK V Y+S NGHA Y + G  +QG G++GIRNDT KS  V+DTG  ++VV
Sbjct  439   LEYAGGGGAANKFVGYASHNGHAAYFQAGEYVQGPGEVGIRNDTGKSDMVMDTGASFTVV  498

Query  480   A-----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
             A       +G+VEP W++Y REWGPKI+Y   +++KR+E  LP + + +F+ L+  LP E
Sbjct  499   AADGLSAAEGVVEPAWLEYAREWGPKISYDFGKEVKRLERWLPGKLKSLFKKLVEKLPEE  558

Query  315   FFGEEGPTGPNMKASWSGDE  256
              +GEEGPTGP MK+SW GDE
Sbjct  559   VYGEEGPTGPKMKSSWDGDE  578



>ref|XP_004248824.1| PREDICTED: uncharacterized protein LOC101253331 [Solanum lycopersicum]
Length=612

 Score =   498 bits (1282),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 245/436 (56%), Positives = 304/436 (70%), Gaps = 15/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS +L I Q G  Y+WLP+PPQGY A+ HVVT S +KPS D++RCV    TD CE
Sbjct  188   YTLVWSSHNLNIKQDGVGYIWLPIPPQGYKAISHVVTASPQKPSLDKVRCVRDDLTDACE  247

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNVA  1192
             + DW+WG        NGFN+Y+LRP +RG +A GV  G F+   SG   + ACLKN  V 
Sbjct  248   IHDWIWGT-------NGFNVYSLRPRDRGVRALGVPTGAFMVQNSGAAESLACLKN--VK  298

Query  1191  FSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIGP  1012
                SAMPNL+Q++ L + YSP++Y HP + Y+PSSV WFF NGALLYTKG E++PV I P
Sbjct  299   SDISAMPNLNQVKTLVQAYSPVIYFHPDEEYYPSSVTWFFQNGALLYTKGQESSPVGIHP  358

Query  1011  DGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIFY  832
              GSNLPQ G+NDG YW++LP D+  K  VK+GDLQ +  YL++KPMFG T TDIA+W+FY
Sbjct  359   TGSNLPQDGSNDGAYWLDLPTDDAAKTNVKKGDLQGATAYLHVKPMFGATHTDIAVWLFY  418

Query  831   PFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAPN  652
             PFNGP+ AKL +   I LG IGEH+GDWEH+TLRISNFNG L  +YFS+HSGG WV A  
Sbjct  419   PFNGPAKAKL-EFMTISLGKIGEHVGDWEHVTLRISNFNGELQSIYFSQHSGGIWVPASQ  477

Query  651   LEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAGL  472
             LEF NG NK V YSSL+GHA Y  PG  LQG GD+GIRNDT K   ++D G  + V A  
Sbjct  478   LEFQNG-NKPVVYSSLHGHAAYPGPGKNLQGRGDVGIRNDTGK-GKLMDIGTNFLVAAAE  535

Query  471   ---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEE  301
                  IVEP W+ Y REWGPKI+Y   +++++VE  +  + +   E ++  LPNE  GEE
Sbjct  536   YLGSTIVEPVWLNYGREWGPKISYDISKELRKVERFMIGKLKKAIEKIVRDLPNEVLGEE  595

Query  300   GPTGPNMKASWSGDEK  253
             GP GP  K  WSGDE+
Sbjct  596   GPIGPKFKDMWSGDER  611



>gb|KGN58638.1| hypothetical protein Csa_3G708680 [Cucumis sativus]
Length=553

 Score =   495 bits (1275),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 246/438 (56%), Positives = 314/438 (72%), Gaps = 10/438 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             +TLVW+S+   I +    Y+W P PP GY AVGHVVTTS  KPS DR+RCV +  T+  E
Sbjct  120   FTLVWTSEKSNIKRDTDGYIWSPTPPDGYRAVGHVVTTSSVKPSVDRVRCVRADLTEQSE  179

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-FACLKNNNV  1195
              E W+WG   S  D NGFN+++ RP  R   A GV VGTF+   + N      CL+N+  
Sbjct  180   KETWIWGLKDSI-DENGFNIFSFRPTRRDITAAGVSVGTFVALPATNSPLPLLCLRNS--  236

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
             A  S+AMP++SQI  LFR Y+P++Y HP + + PSSVNW+FSNGALLY K  E+ PV I 
Sbjct  237   ASISAAMPDVSQISTLFRAYAPLIYFHPKEKFLPSSVNWYFSNGALLYNKSVESKPVPID  296

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             P+G+NLPQGG NDG +W++LP+D   KE+VK GDLQS +VYL IKPM GGTFTDI IWIF
Sbjct  297   PNGTNLPQGGQNDGGFWLDLPIDGGAKEKVKHGDLQSCQVYLQIKPMIGGTFTDITIWIF  356

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             +PFNGP+TAK+G I+ IP   IGEH+GDWEH+TLRISNF G L KVYF++HS G W+DA 
Sbjct  357   FPFNGPATAKVGIID-IPFRKIGEHVGDWEHITLRISNFTGELWKVYFAQHSKGEWIDAS  415

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
             +LEF  G NK VAYSSLNGHA+YSKPGLV+QG G+IG++N+TAKS  VLDTG     +A 
Sbjct  416   SLEFEKG-NKVVAYSSLNGHASYSKPGLVMQGGGEIGLKNETAKSGLVLDTGASSVEIAT  474

Query  474   ----LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                  + + EP W+ Y R+WGPKI Y   E++++VE LLP   +  F+  ++ LP+E  G
Sbjct  475   EYLREEAVTEPAWLNYFRQWGPKIEYQIAEEMEKVEKLLPGRLKEAFKQFMNRLPDEILG  534

Query  306   EEGPTGPNMKASWSGDEK  253
             +EGPTGP +K SW+GDE+
Sbjct  535   QEGPTGPKLKDSWNGDER  552



>ref|XP_009776767.1| PREDICTED: uncharacterized protein LOC104226450 [Nicotiana sylvestris]
Length=596

 Score =   496 bits (1278),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 245/436 (56%), Positives = 305/436 (70%), Gaps = 15/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LV SS +L I Q G  Y+WLP+PP+GY A+GHVVTT+ +KPS D++RCV +  TD  E
Sbjct  172   YALVCSSQNLKINQDGVGYIWLPIPPEGYKAIGHVVTTAPQKPSLDKVRCVRADLTDVSE  231

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNVA  1192
               DW+WG        NG N+Y+ RP + GTQA GV  G F+   +G   + ACLKN  V 
Sbjct  232   SHDWIWGT-------NGLNVYSSRPRDSGTQALGVSTGAFMAQNNGAADSLACLKN--VK  282

Query  1191  FSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIGP  1012
                SAMPNL+Q++AL + YSP++Y HP + ++PSSV WFF NGALLYTKG E++PV I  
Sbjct  283   AKLSAMPNLNQVKALVQAYSPLIYFHPDEEFYPSSVTWFFQNGALLYTKGQESSPVGIQL  342

Query  1011  DGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIFY  832
              GSNLPQGG+NDG YW++LP DN  K  VKRGDL  +  YL+IKPMFG T+TDIA+W+FY
Sbjct  343   TGSNLPQGGSNDGAYWLDLPSDNAAKANVKRGDLLGATAYLHIKPMFGATYTDIAVWLFY  402

Query  831   PFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAPN  652
             PFNG + AKL +   I LG IGEH+GDWEH+TLRISNFNG L  VYFSEHSGG W+ A  
Sbjct  403   PFNGAAKAKL-EFMTISLGKIGEHVGDWEHVTLRISNFNGELQGVYFSEHSGGIWISASQ  461

Query  651   LEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAGL  472
             LEF NG NK V YSSL+GHA Y KPG  LQG GD+GIRNDT K   ++DTG  + VV   
Sbjct  462   LEFQNG-NKPVVYSSLHGHAAYPKPGQNLQGSGDVGIRNDTGK-GKLMDTGGNFLVVGAE  519

Query  471   ---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEE  301
                  IVEPPW+ Y REWGPKI Y   +++ ++E  +P + + V E ++  LPNE  GE+
Sbjct  520   YLGSTIVEPPWLNYAREWGPKINYDISKELNKIERFMPGKLKRVVEKIVRSLPNEVLGEQ  579

Query  300   GPTGPNMKASWSGDEK  253
             GPTGP  K  W+GDE+
Sbjct  580   GPTGPKFKDMWNGDER  595



>ref|XP_006341329.1| PREDICTED: uncharacterized protein LOC102584466 [Solanum tuberosum]
Length=579

 Score =   495 bits (1274),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 243/436 (56%), Positives = 307/436 (70%), Gaps = 15/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS +L I Q G  Y+WLP+PP+GY A+GHVVTTS +KPS D++RCV    TD CE
Sbjct  155   YTLVWSSHNLKIKQDGVGYIWLPIPPEGYKAIGHVVTTSPQKPSLDKVRCVRDDLTDVCE  214

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNVA  1192
               DW+WG        NG N+Y+ RP +RG +A GV  G F+   +G   + ACLKN  V 
Sbjct  215   SHDWIWGT-------NGLNVYSSRPRDRGVRALGVATGAFMVQNNGAAESLACLKN--VK  265

Query  1191  FSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIGP  1012
                SAMPNL+Q++AL + YSP++Y HP + Y+PSSV WFF NGALLYTKG E++PV I P
Sbjct  266   SDISAMPNLNQVKALVQAYSPLIYFHPDEEYYPSSVTWFFQNGALLYTKGQESSPVGIHP  325

Query  1011  DGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIFY  832
              GSNLPQ G+NDG YW++LP+D+  K  VK+GDLQ +  YL++KPMFG T+TDIA+W+FY
Sbjct  326   TGSNLPQDGSNDGAYWLDLPIDDAAKTNVKKGDLQGATAYLHVKPMFGATYTDIAVWLFY  385

Query  831   PFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAPN  652
             PFNGP+ AKL +   I LG IGEH+GDWEH+TLRISNFNG L  +YFS+HSGG WV A  
Sbjct  386   PFNGPAKAKL-EFMTISLGKIGEHVGDWEHVTLRISNFNGELQGIYFSQHSGGIWVRASQ  444

Query  651   LEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAGL  472
             LEF NG NK V YSSL+GHA Y + G  LQG GD+GIRNDT K   ++D G  + +VA  
Sbjct  445   LEFQNG-NKPVVYSSLHGHAAYPELGKNLQGSGDVGIRNDTGK-GKLMDIGANFLIVAAE  502

Query  471   ---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEE  301
                  IVEP W+ Y REWGPKI+Y   +++++VE  +  + +   E ++  LPNE  GEE
Sbjct  503   YLGSTIVEPVWLNYGREWGPKISYDISKELRKVERFMIGKLKKAIEKIVRDLPNEVLGEE  562

Query  300   GPTGPNMKASWSGDEK  253
             GP GP  K  WSGDE+
Sbjct  563   GPIGPKFKDMWSGDER  578



>ref|XP_006397602.1| hypothetical protein EUTSA_v10001390mg [Eutrema salsugineum]
 gb|ESQ39055.1| hypothetical protein EUTSA_v10001390mg [Eutrema salsugineum]
Length=541

 Score =   493 bits (1270),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 251/437 (57%), Positives = 317/437 (73%), Gaps = 17/437 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSG--PAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             Y L+WS  S  +  +G     +W PVPP+GY+AVG +VTTS EKP  D+IRCV S  TD 
Sbjct  116   YLLLWSGKSTKVENNGGETGSIWQPVPPEGYNAVGLIVTTSAEKPPLDKIRCVRSDLTDQ  175

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNN  1198
              E +  +W       + NGF++ + +PINRG QA  V VGTF+ + S    T ACLKNN 
Sbjct  176   SEPDALIW-------ETNGFSVSSSKPINRGIQASSVCVGTFVANSSNP--TLACLKNNK  226

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               F  S MP+  QI+ALF+ Y+P +Y H  + Y P+SVNWFFSNGALLY KG+E+NPV++
Sbjct  227   --FDYSCMPSKVQIDALFQAYAPWIYFHKDEKYLPASVNWFFSNGALLYKKGEESNPVQV  284

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P+GSNLPQG +NDG+YW++LPV ++ ++RVK GDLQS EVYL+IKP+FGGTFTDIA+W+
Sbjct  285   EPNGSNLPQGESNDGLYWLDLPVASDTRKRVKGGDLQSMEVYLHIKPVFGGTFTDIAVWM  344

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGPS AKL ++  IPLG IGEHIGDWEH TLRISNF+G L+++Y S+HS GSW+DA
Sbjct  345   FYPFNGPSRAKL-KLATIPLGKIGEHIGDWEHFTLRISNFSGKLHRMYLSQHSRGSWIDA  403

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               +EF  G NK VAY+SLNGHA YSKPGLVLQG  D+GIRNDT KS  V+DT  R+ VVA
Sbjct  404   SEIEFQGGGNKPVAYASLNGHAMYSKPGLVLQGKDDVGIRNDTGKSKQVIDTAARFRVVA  463

Query  477   G--LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVE-WRGVFETLIHLLPNEFFG  307
                ++ + EP W+ Y R WGPKI Y  E +I+ VE ++  E  + VF + I  LPNE FG
Sbjct  464   AEYMEDVEEPAWLNYMRHWGPKIDYGHENEIRGVEKIMVGESLKNVFRSAIKGLPNEVFG  523

Query  306   EEGPTGPNMKASWSGDE  256
             EEGPTGP +K +W GDE
Sbjct  524   EEGPTGPKLKRNWLGDE  540



>ref|XP_006293958.1| hypothetical protein CARUB_v10022948mg [Capsella rubella]
 gb|EOA26856.1| hypothetical protein CARUB_v10022948mg [Capsella rubella]
Length=543

 Score =   493 bits (1268),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 252/439 (57%), Positives = 316/439 (72%), Gaps = 19/439 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSG--PAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             Y L+WS  S  +  +G    YVW P+PP GY+AVG +VTTS EKP  D+IRCV S  TD 
Sbjct  116   YLLLWSGKSTKVENNGNETGYVWQPLPPAGYNAVGLIVTTSDEKPPLDKIRCVRSDLTDT  175

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNN  1198
              E +  +W       + NGF++ + RP+NRGTQA GV VGTF  + S    T  CLKNN 
Sbjct  176   AESDAQIW-------ETNGFSVSSSRPVNRGTQASGVSVGTFFANSSNP--TLPCLKNNK  226

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               FS   MP+  Q++ALF+ Y+P +Y H  + Y PSSVNWFFSNGALLY KGDE+NPV +
Sbjct  227   FDFS--CMPSKLQVDALFQAYAPWIYFHKDEKYLPSSVNWFFSNGALLYKKGDESNPVPV  284

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P+GSNLPQG +NDG+YW++LPV  + K+RV+ GDLQS EVYL++KP+FGGTFTD+A+W+
Sbjct  285   EPNGSNLPQGESNDGLYWLDLPVAPDAKKRVQGGDLQSMEVYLHVKPVFGGTFTDVAVWM  344

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGPS AKL +   IPLG IGEHIGDWEH TLRISNF+G L ++Y S+HS GSW+DA
Sbjct  345   FYPFNGPSRAKL-KAATIPLGRIGEHIGDWEHFTLRISNFSGKLQRMYLSQHSRGSWIDA  403

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
             P +EF    NK VAY+SLNGHA YSKPGLVLQG  ++GIRNDT KS  V+DT +R+ V+A
Sbjct  404   PEIEFQGRGNKPVAYASLNGHAMYSKPGLVLQGKDNVGIRNDTGKSEKVIDTAVRFRVIA  463

Query  477   G--LQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVE-WRGVFETLIHLLPNEF  313
                ++G  + EP W+ Y R WGPKI Y  E++I+ VE ++  E  + VF + I  LPNE 
Sbjct  464   AEYMRGEEVEEPAWLNYLRHWGPKIDYGHEDEIRGVEKIMVGESLKNVFRSAIKGLPNEV  523

Query  312   FGEEGPTGPNMKASWSGDE  256
             FGEEGPTGP +K SW GDE
Sbjct  524   FGEEGPTGPKLKRSWLGDE  542



>ref|XP_004161418.1| PREDICTED: uncharacterized protein LOC101228858 [Cucumis sativus]
Length=553

 Score =   491 bits (1264),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 245/438 (56%), Positives = 311/438 (71%), Gaps = 10/438 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             +TLVW+S+   I +    Y+W P PP GY AVG VVTTS  KPS DR+RCV +  T+  E
Sbjct  120   FTLVWTSEKSNIKRDTDGYIWSPTPPDGYRAVGQVVTTSSVKPSVDRVRCVRADLTEQSE  179

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-FACLKNNNV  1195
              E W+WG   S  D NGFN++  RP  R   A GV VGTF+   + N      CL+N+  
Sbjct  180   KETWIWGLKDSI-DENGFNIFNFRPTRRDITAAGVSVGTFVALPATNSPLPLLCLRNS--  236

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
             A  S+AMP++SQI  LFR Y+P++Y HP + + PSSVNW+FSNGALLY K  E+ PV I 
Sbjct  237   ASISAAMPDVSQISTLFRAYAPLIYFHPKEKFLPSSVNWYFSNGALLYNKSVESKPVPID  296

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             P+G+NLPQGG NDG +W++LP+D   KERVK GDLQS +VYL IKPM GGTFTDI IWIF
Sbjct  297   PNGTNLPQGGQNDGGFWLDLPIDGGAKERVKHGDLQSCQVYLQIKPMIGGTFTDITIWIF  356

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             +PFNGP+ AK+G I+ IP   IGEH+GDWEH+TLRISNF G L KVYF++HS G W+DA 
Sbjct  357   FPFNGPARAKVGIID-IPFRKIGEHVGDWEHITLRISNFTGELWKVYFAQHSKGEWIDAS  415

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
             +LEF  G NK VAYSSLNGHA+YSKPGLV+QG G+IG++N+TAKS  VLDTG     +A 
Sbjct  416   SLEFEKG-NKVVAYSSLNGHASYSKPGLVMQGGGEIGLKNETAKSGLVLDTGASSVEIAT  474

Query  474   ----LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                  + + EP W+ Y R+WGPKI Y   E++++VE LLP   +  F+  ++ LP+E  G
Sbjct  475   EYLREEAVAEPAWLNYFRQWGPKIEYQIAEEMEKVEKLLPGRLKEAFKQFMNRLPDEILG  534

Query  306   EEGPTGPNMKASWSGDEK  253
             +EGPTGP +K SW+GDE+
Sbjct  535   QEGPTGPKLKDSWNGDER  552



>gb|KEH38307.1| DUF946 family protein [Medicago truncatula]
Length=541

 Score =   490 bits (1261),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 244/438 (56%), Positives = 314/438 (72%), Gaps = 19/438 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS S  I Q    Y+WLP+ P GYS +GH+VTT+ EKPS DRI+CV S  TD CE
Sbjct  116   YTLVWSSKSEKIKQDKDGYIWLPIAPNGYSPLGHIVTTTPEKPSLDRIQCVRSDLTDQCE  175

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL---GSFSGNVGTFACLKNN  1201
             +  W+WG+     D  GFN++ +RPINRG +A  V VGTFL   G  +      +CLKN 
Sbjct  176   INSWIWGK-DKKIDEKGFNVHYVRPINRGIEAPSVLVGTFLAHVGEITNTPLPISCLKNI  234

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             N   + S+MPNL QI+AL + YSP +YLHP + + P S+ W+F+NGALLY KG+E+NP+ 
Sbjct  235   NF-MNFSSMPNLPQIKALAQAYSPFMYLHPNEKFQPCSIKWYFTNGALLYKKGEESNPME  293

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I P GSNLPQGG+NDG YW++LP D + +ERVK+GD ++ + Y ++KP+FGGTFTD+A+W
Sbjct  294   IDPLGSNLPQGGSNDGAYWLDLPKDKDNRERVKKGDFKNCQGYFHVKPIFGGTFTDLAMW  353

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             IFYPFNGP T K+G I+ I LG IGEHIGDWEH+TLR+SNFNG L +VYFS+HS G WVD
Sbjct  354   IFYPFNGPGTLKVGLIDNISLGKIGEHIGDWEHVTLRVSNFNGELKRVYFSQHSNGQWVD  413

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVV  481
             +  +EF +G NK VAYSSLNGHA Y K GLVLQG  DIGI+N+T KS  V+D G+ + +V
Sbjct  414   SSEVEFQSG-NKPVAYSSLNGHAIYPKAGLVLQGTSDIGIKNETKKSDLVIDFGVNFEIV  472

Query  480   AGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
             +G      IVEP WV + R+WGPKITY   ++++++E ++P    G+       LPNE  
Sbjct  473   SGEYLGNQIVEPGWVNFFRQWGPKITYNLGDELEKLEKVVP----GL------KLPNELI  522

Query  309   GEEGPTGPNMKASWSGDE  256
             GEEGPTGP  K +W GDE
Sbjct  523   GEEGPTGPKQKRNWVGDE  540



>emb|CDX83433.1| BnaA03g20730D [Brassica napus]
Length=551

 Score =   490 bits (1261),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 250/441 (57%), Positives = 312/441 (71%), Gaps = 18/441 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV +++SL   Q GP Y W PV P GY AVG +VT S +KP  D++RCV S  T+ CE
Sbjct  121   YTLVGNTESLVTKQDGPGYFWEPVAPDGYQAVGLIVTNSSQKPPLDKVRCVRSDLTEQCE  180

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSFSGNVGTFACLKNNNV  1195
              +  +W       + NG  + TLRP  RGTQA GV VGTF     + +    +CLKN  +
Sbjct  181   ADISIW-------ESNGVKVSTLRPTIRGTQATGVCVGTFTWQPQNTSPPALSCLKNKKL  233

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              FS+  MPN SQ E L   YSP++Y HP +   PSSVNW+FSNGALLY +G+E+NP  I 
Sbjct  234   DFST--MPNGSQTEVLSNTYSPLIYHHPDEESLPSSVNWYFSNGALLYKRGEESNPNPIE  291

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             P+G+NLPQGG NDG YW++LP+D   KERVK+GDLQS++ YL+IKPM G TFTDIAIW+F
Sbjct  292   PNGANLPQGGANDGSYWLDLPIDKKGKERVKKGDLQSTQAYLHIKPMLGATFTDIAIWVF  351

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+  I  +PLG IGEHIGDWEH+TLRISNFNG L +V+ S+HSGG W+DA 
Sbjct  352   YPFNGPARAKVKLI-TLPLGRIGEHIGDWEHVTLRISNFNGELWRVFLSQHSGGEWIDAC  410

Query  654   NLEFIN--GSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVV  481
             +LEF    GSNK+VAY+SL+GHA Y KPGLVLQG   +GIRNDTAKS  V DTGL Y V+
Sbjct  411   DLEFQEGGGSNKAVAYASLHGHAMYPKPGLVLQGNDGVGIRNDTAKSKKVFDTGLGYEVI  470

Query  480   AGLQ-----GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
             A        G+VEPPWV Y R+WGPKI Y  E+D+KR+E  L    +  F  L+  +P+E
Sbjct  471   AAEYSGEGGGVVEPPWVNYFRKWGPKIDYSVEDDVKRIERFLFGALKRAFVNLVKKIPDE  530

Query  315   FFGEEGPTGPNMKASWSGDEK  253
              +GE+GPTGP +K +W+GDEK
Sbjct  531   VYGEDGPTGPKLKGNWAGDEK  551



>ref|XP_002880101.1| hypothetical protein ARALYDRAFT_483550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56360.1| hypothetical protein ARALYDRAFT_483550 [Arabidopsis lyrata subsp. 
lyrata]
Length=564

 Score =   490 bits (1261),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 251/440 (57%), Positives = 314/440 (71%), Gaps = 18/440 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV +++SL I Q G  Y W PVPP GY AVG +VT S +KPS D++ CV S  T+ CE
Sbjct  134   YTLVGNTESLKIKQDGTGYFWQPVPPDGYQAVGLIVTNSSQKPSLDKLSCVRSDLTEQCE  193

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNV---GTFACLKNN  1201
              + W+WG        NG N+  LRP  RGTQA GV VGTF      +       +CLKN 
Sbjct  194   ADTWIWGT-------NGVNISNLRPTTRGTQATGVSVGTFTCQTQNSSLPPPALSCLKNT  246

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
              + FS+  MPN SQI  LF+ YSP +Y HP + Y PSSVNW+F+NGALLY KG+E+ P+ 
Sbjct  247   KLDFST--MPNGSQIGELFQTYSPWIYFHPDEEYLPSSVNWYFNNGALLYKKGEESKPIP  304

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I  +GSNLPQGG+NDG YW++LP+D N KERVK+GDLQS++VYL+IKPM G TFTDI+IW
Sbjct  305   IESNGSNLPQGGSNDGSYWLDLPIDKNGKERVKKGDLQSTKVYLHIKPMLGATFTDISIW  364

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             IFYPFNGP+ AK+ +   +PLG IGEHIGDWEH TLRISNF G L +V+ S+HSGG WVD
Sbjct  365   IFYPFNGPARAKV-KFVNLPLGRIGEHIGDWEHTTLRISNFTGELWRVFLSQHSGGVWVD  423

Query  660   APNLEFI--NGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
             A +LEF    GSNK VAY+SL+GHA Y KPGLVLQG   +GIRNDTAK   V+DTGL Y 
Sbjct  424   ACDLEFQGGGGSNKFVAYASLHGHAMYPKPGLVLQGDDGVGIRNDTAKGKKVIDTGLGYE  483

Query  486   VVAGLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
             V+A      G+VEPPWV Y R+WGPKI Y  ++++K VE +LP   +  F   +  +P+E
Sbjct  484   VIAAEYDGGGVVEPPWVNYFRKWGPKIDYNVDDEVKSVERILPGLLKKAFVKFVKKIPDE  543

Query  315   FFGEEGPTGPNMKASWSGDE  256
              +GE+GPTGP +K++W+GDE
Sbjct  544   VYGEDGPTGPKLKSNWAGDE  563



>ref|NP_030964.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK93630.1| unknown protein [Arabidopsis thaliana]
 gb|AAC16076.2| expressed protein [Arabidopsis thaliana]
 gb|AAM91718.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10397.1| uncharacterized protein AT2G44260 [Arabidopsis thaliana]
Length=553

 Score =   488 bits (1257),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 246/437 (56%), Positives = 317/437 (73%), Gaps = 15/437 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV +++SL I Q G  Y W PVPP GY AVG +VT   +KP  D++RC+ S  T+ CE
Sbjct  126   YTLVGNTESLKIKQDGTGYFWQPVPPDGYQAVGLIVTNYSQKPPLDKLRCIRSDLTEQCE  185

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSFSGNVGTFACLKNNNV  1195
              + W+WG        NG N+  L+P  RGTQA GV VGTF   + + +  + +CLKN  +
Sbjct  186   ADTWIWGT-------NGVNISNLKPTTRGTQATGVYVGTFTWQTQNSSPPSLSCLKNTKL  238

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              FS+  MPN SQIE LF+ +SP +Y HP + Y PSSV W+F+NGALLY KG+E+ P+ I 
Sbjct  239   DFST--MPNGSQIEELFQTFSPCIYFHPDEEYLPSSVTWYFNNGALLYKKGEESKPIPIE  296

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +GSNLPQGG+NDG YW++LP+D N KERVK+GDLQS++VYL+IKPM G TFTDI+IWIF
Sbjct  297   SNGSNLPQGGSNDGSYWLDLPIDKNGKERVKKGDLQSTKVYLHIKPMLGATFTDISIWIF  356

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+ +   +PLG IGEHIGDWEH TLRISNF G L +V+ S+HSGG W+DA 
Sbjct  357   YPFNGPAKAKV-KFVNLPLGRIGEHIGDWEHTTLRISNFTGELWRVFLSQHSGGIWIDAC  415

Query  654   NLEFIN-GSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
             +LEF + G+NK VAY+SL+GHA Y KPGLVLQG   +GIRNDT K   VLDTGL Y V+A
Sbjct  416   DLEFQDGGNNKFVAYASLHGHAMYPKPGLVLQGDDGVGIRNDTGKGKKVLDTGLGYEVIA  475

Query  477   GLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                   G+VEPPWVKY R+WGPKI Y  ++++K VE +LP   +  F   +  +P+E +G
Sbjct  476   AEYDGGGVVEPPWVKYFRKWGPKIDYNVDDEVKSVERILPGLLKKAFVKFVKKIPDEVYG  535

Query  306   EEGPTGPNMKASWSGDE  256
             E+GPTGP +K++W+GDE
Sbjct  536   EDGPTGPKLKSNWAGDE  552



>ref|XP_009143004.1| PREDICTED: uncharacterized protein LOC103866778 [Brassica rapa]
Length=538

 Score =   488 bits (1255),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 248/437 (57%), Positives = 311/437 (71%), Gaps = 20/437 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPI--TQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             Y L+WS  S  +   +    Y W PVPP GYSAVG +VTT+ EKP  D+IRCV S  TD 
Sbjct  116   YLLLWSGKSTKVENNKDQTGYFWQPVPPDGYSAVGLIVTTTAEKPPLDKIRCVRSDLTDQ  175

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNN  1198
              E +  +W       + NGF + + +P+NRGTQA  V VGTF  +        ACLKNN 
Sbjct  176   SEPDALIW-------ESNGFGVSSSKPVNRGTQASSVCVGTFTSN-----PALACLKNNK  223

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               FS   MP+  QI+ALF+ Y+P+++ H  + Y PSSVNWFFSNGALLY KG+E+NPV +
Sbjct  224   FNFS--CMPSKVQIDALFKTYAPLIHFHKDEKYLPSSVNWFFSNGALLYKKGEESNPVPV  281

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P+GSNLPQG  NDG+YW++LPV ++ ++RV+ GDLQS EVYL+IKP+FGGT TDIA+WI
Sbjct  282   EPNGSNLPQGEANDGLYWLDLPVASDARKRVQAGDLQSMEVYLHIKPVFGGTLTDIAVWI  341

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGPS AKL ++  IPLG IGEHIGDWEH TLRISNF+G L ++Y S+HS GSW+D 
Sbjct  342   FYPFNGPSRAKL-KLATIPLGRIGEHIGDWEHFTLRISNFSGKLLRMYLSQHSKGSWIDP  400

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
             P +EF +G NK VAY+SLNGHA YSKPGLVLQG  D+GIRNDT KS  V DT +R+ VV 
Sbjct  401   PEIEFQSGGNKPVAYASLNGHAMYSKPGLVLQGRDDVGIRNDTGKSEKVFDTAVRFRVVC  460

Query  477   G--LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVE-WRGVFETLIHLLPNEFFG  307
                L+ + EP W+ Y R WGPKI Y  E++IK VE ++  E  + VF + ++ LPNE FG
Sbjct  461   AEYLKEVEEPAWLNYMRHWGPKIDYGREDEIKGVEKIVVGESLKSVFRSAVNGLPNEVFG  520

Query  306   EEGPTGPNMKASWSGDE  256
             EEGPTGP +K +W GDE
Sbjct  521   EEGPTGPKLKRNWLGDE  537



>ref|NP_850414.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC10398.1| uncharacterized protein AT2G44260 [Arabidopsis thaliana]
Length=583

 Score =   488 bits (1257),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 246/437 (56%), Positives = 317/437 (73%), Gaps = 15/437 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV +++SL I Q G  Y W PVPP GY AVG +VT   +KP  D++RC+ S  T+ CE
Sbjct  156   YTLVGNTESLKIKQDGTGYFWQPVPPDGYQAVGLIVTNYSQKPPLDKLRCIRSDLTEQCE  215

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSFSGNVGTFACLKNNNV  1195
              + W+WG        NG N+  L+P  RGTQA GV VGTF   + + +  + +CLKN  +
Sbjct  216   ADTWIWGT-------NGVNISNLKPTTRGTQATGVYVGTFTWQTQNSSPPSLSCLKNTKL  268

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              FS+  MPN SQIE LF+ +SP +Y HP + Y PSSV W+F+NGALLY KG+E+ P+ I 
Sbjct  269   DFST--MPNGSQIEELFQTFSPCIYFHPDEEYLPSSVTWYFNNGALLYKKGEESKPIPIE  326

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +GSNLPQGG+NDG YW++LP+D N KERVK+GDLQS++VYL+IKPM G TFTDI+IWIF
Sbjct  327   SNGSNLPQGGSNDGSYWLDLPIDKNGKERVKKGDLQSTKVYLHIKPMLGATFTDISIWIF  386

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+ +   +PLG IGEHIGDWEH TLRISNF G L +V+ S+HSGG W+DA 
Sbjct  387   YPFNGPAKAKV-KFVNLPLGRIGEHIGDWEHTTLRISNFTGELWRVFLSQHSGGIWIDAC  445

Query  654   NLEFIN-GSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
             +LEF + G+NK VAY+SL+GHA Y KPGLVLQG   +GIRNDT K   VLDTGL Y V+A
Sbjct  446   DLEFQDGGNNKFVAYASLHGHAMYPKPGLVLQGDDGVGIRNDTGKGKKVLDTGLGYEVIA  505

Query  477   GLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                   G+VEPPWVKY R+WGPKI Y  ++++K VE +LP   +  F   +  +P+E +G
Sbjct  506   AEYDGGGVVEPPWVKYFRKWGPKIDYNVDDEVKSVERILPGLLKKAFVKFVKKIPDEVYG  565

Query  306   EEGPTGPNMKASWSGDE  256
             E+GPTGP +K++W+GDE
Sbjct  566   EDGPTGPKLKSNWAGDE  582



>ref|XP_010518017.1| PREDICTED: uncharacterized protein LOC104793362 [Camelina sativa]
Length=543

 Score =   487 bits (1253),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 249/439 (57%), Positives = 314/439 (72%), Gaps = 19/439 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGP--AYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             Y L+WS  S  +  +G    Y W PVPP GY+AVG +VTTS EKP  D+IRCV S  TD 
Sbjct  116   YLLLWSGKSTKVENNGAETGYFWQPVPPDGYNAVGLIVTTSDEKPPLDKIRCVRSDLTDQ  175

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNN  1198
              E +  +W       + NGF + + +P+NRGTQA GV VGTF  S +    T  CLKNN 
Sbjct  176   SESDAQIW-------ETNGFRVSSSKPVNRGTQASGVCVGTFFASSTNP--TLPCLKNNK  226

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               FS   MP+  Q++ALF+ Y+P +Y H  + Y P+SVNWFF+NGALLY K DE+NPV +
Sbjct  227   FDFS--CMPSKPQVDALFQAYAPWIYFHEDEKYLPASVNWFFNNGALLYKKDDESNPVPV  284

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P+G NLPQG +NDG+YW++LPV  + ++RV+ GDLQS EVYL+IKP++GGTFTD+A+W+
Sbjct  285   EPNGLNLPQGESNDGLYWLDLPVAPDARKRVQGGDLQSMEVYLHIKPVYGGTFTDVAVWM  344

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGPS AKL  I  IPLG IGEHIGDWEH TLRISNFNG L+++Y S+HSGG W+DA
Sbjct  345   FYPFNGPSRAKLKAI-TIPLGRIGEHIGDWEHFTLRISNFNGKLHRMYLSQHSGGKWIDA  403

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
             P +E+  G NK VAY+SLNGHA YSKPGLVLQG  ++GIRNDT KS  V+DT  R+SVVA
Sbjct  404   PEIEYQGGGNKPVAYASLNGHAMYSKPGLVLQGKDNVGIRNDTGKSEKVIDTAARFSVVA  463

Query  477   G--LQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVE-WRGVFETLIHLLPNEF  313
                ++G  + EP W+ Y R WGPKI Y  E++I+ VE ++  E  + VF + I  LPNE 
Sbjct  464   AEYMRGGEVEEPAWLNYMRHWGPKINYGHEDEIRGVEKIMVGEGLKNVFRSAIKGLPNEV  523

Query  312   FGEEGPTGPNMKASWSGDE  256
             FGEEGPTGP +K +W GDE
Sbjct  524   FGEEGPTGPKLKRNWLGDE  542



>ref|XP_010506336.1| PREDICTED: uncharacterized protein LOC104782963 [Camelina sativa]
Length=543

 Score =   486 bits (1251),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 249/439 (57%), Positives = 314/439 (72%), Gaps = 19/439 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSG--PAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             Y L+WS  S  +  +G    Y W PVPP GY+AVG +VTTS EKP  ++IRCV S  TD 
Sbjct  116   YLLLWSGKSTKVENNGVETGYFWQPVPPDGYNAVGLIVTTSDEKPPLEKIRCVRSDLTDQ  175

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNN  1198
              E +  +W       + NGF + + +P+NRGTQA GV VGTF  S +    T  CLKNN 
Sbjct  176   SESDAQIW-------ETNGFRVSSSKPVNRGTQASGVCVGTFFASSTNP--TLPCLKNNK  226

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               FS   MP   Q+++LF+ Y+P +Y H  + Y P+SVNWFFSNGALLY KGDE+NPV +
Sbjct  227   FDFS--CMPRKPQVDSLFQAYAPWIYFHEDEKYLPASVNWFFSNGALLYKKGDESNPVPV  284

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P+GSNLPQG +NDG+YW++LPV  + ++RV+ GDLQS EVYL+IK +FGGTFTD+A+W+
Sbjct  285   EPNGSNLPQGESNDGLYWLDLPVAPDARKRVQGGDLQSMEVYLHIKSVFGGTFTDVAVWM  344

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGPS AKL  I  IPLG IGEHIGDWEH TLRISNFNG L+++Y S+HSGG W+DA
Sbjct  345   FYPFNGPSRAKLKAI-TIPLGRIGEHIGDWEHFTLRISNFNGKLHRMYLSQHSGGKWIDA  403

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
             P +E+  G NK VAY+SL GHA YSKPGLVLQG  ++GIRNDT KS  V+DT +R+SVVA
Sbjct  404   PEIEYQGGGNKPVAYASLKGHAMYSKPGLVLQGKDNVGIRNDTGKSEKVIDTAVRFSVVA  463

Query  477   G--LQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVE-WRGVFETLIHLLPNEF  313
                ++G  + EP W+ Y R WGPKI Y  E++I+ VE ++  E  + VF + I  LPNE 
Sbjct  464   AEYMRGGEVEEPAWLNYMRHWGPKINYGHEDEIRGVEKIMVGESLKNVFRSAIKGLPNEV  523

Query  312   FGEEGPTGPNMKASWSGDE  256
             FGEEGPTGP +K +W GDE
Sbjct  524   FGEEGPTGPKLKRNWLGDE  542



>ref|XP_010508320.1| PREDICTED: uncharacterized protein LOC104784914 [Camelina sativa]
Length=543

 Score =   485 bits (1249),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 248/439 (56%), Positives = 313/439 (71%), Gaps = 19/439 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGP--AYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             Y L+WS  S  +  +G    Y W PVPP GY+AVG +VTTS EKP  D+IRCV S  TD 
Sbjct  116   YLLLWSGKSTKVENNGAENGYFWQPVPPDGYNAVGLIVTTSDEKPPLDKIRCVRSDLTDQ  175

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNN  1198
              E +  +W       + NGF + + +P+ RGTQA GV VGTF  S +       CLKNN 
Sbjct  176   SEPDAQLW-------ETNGFRVSSSKPVKRGTQASGVCVGTFFASSTNP--ALPCLKNNK  226

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               FS   MP++ Q++ALF+ Y+P +Y H  + Y P+SVNWFFSNGALLY KGDE+NPV +
Sbjct  227   FDFS--CMPSMPQVDALFQAYAPWIYFHEDEKYLPASVNWFFSNGALLYKKGDESNPVPV  284

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P+G NLPQG  NDG+YW++LPV  + ++RV+ GDLQS EVYL+IKP+FGGTFTD+A+W+
Sbjct  285   EPNGVNLPQGEANDGLYWLDLPVAPDARKRVQGGDLQSMEVYLHIKPVFGGTFTDVAVWM  344

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGPS AKL  I  IPLG IGEHIGDWEH TLRISNF+G L+++Y S+HSGG W+DA
Sbjct  345   FYPFNGPSRAKLKAI-TIPLGRIGEHIGDWEHFTLRISNFSGKLHRMYLSQHSGGKWIDA  403

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
             P +E+    NK VAY+SLNGHA YSKPGLVLQG  ++GIRNDT KS  V+DT +R+SVVA
Sbjct  404   PEIEYQGRGNKPVAYASLNGHAMYSKPGLVLQGKDNVGIRNDTGKSEKVIDTAVRFSVVA  463

Query  477   G--LQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVE-WRGVFETLIHLLPNEF  313
                ++G  + EP W+ Y R WGPKI Y  E++I+ VE ++  E  + VF + I  LPNE 
Sbjct  464   AEYMRGGEVEEPAWLNYMRHWGPKINYGHEDEIRGVEKIMVGESLKNVFRSAIKGLPNEV  523

Query  312   FGEEGPTGPNMKASWSGDE  256
             FGEEGPTGP +K +W GDE
Sbjct  524   FGEEGPTGPKLKRNWLGDE  542



>ref|XP_008804360.1| PREDICTED: uncharacterized protein LOC103717662 [Phoenix dactylifera]
Length=550

 Score =   484 bits (1246),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 249/441 (56%), Positives = 310/441 (70%), Gaps = 19/441 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTL+WSS+S  I Q G  Y WLP PP+GY AVG +VT S EKPS D +RCV +  TD CE
Sbjct  121   YTLLWSSESSNIKQDGNGYFWLPAPPEGYKAVGLLVTNSSEKPSLDEVRCVRADLTDACE  180

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
              E+ +W       D +GF +  LRP  RG QA GV VGTF    +G+ G  T ACLKN +
Sbjct  181   DEELIW-------DKDGFGVSGLRPAERGIQALGVWVGTFKAQANGSPGSSTVACLKNKD  233

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               F  S MPNL QI+A+ + YSP++YLHP + + PSSV+WFF NGALLY KG+  NP  I
Sbjct  234   SNFDYS-MPNLGQIQAIMQAYSPVIYLHPDEEFLPSSVSWFFDNGALLYEKGN-PNPAPI  291

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVD-NNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
               +GSNLPQGG+NDG YW++LP D + +K+ VK+GD+ SS+VYL++KPM G TFTDIAIW
Sbjct  292   ASNGSNLPQGGSNDGAYWMDLPADESRQKDEVKKGDIPSSKVYLHVKPMLGATFTDIAIW  351

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             IFYPFNGP+ AK+G I  + LG IGEH+ DWEH+TLR+SNF+G L +VYFSEHS G+WV+
Sbjct  352   IFYPFNGPAKAKVGPI-NLSLGRIGEHVSDWEHVTLRVSNFSGELWRVYFSEHSAGTWVE  410

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG--IGDIGIRNDTAKSAAVLDTGLRYS  487
             A  LEF  G NK V YSSL+GHANYSK GLVL+G     IGIRNDTAK    +DTG R+ 
Sbjct  411   ASQLEF-EGGNKPVVYSSLHGHANYSKAGLVLEGNSTSGIGIRNDTAKGKNRMDTGERFE  469

Query  486   VVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
             VVA       + EPPW+ Y REWGPKITY   ++I +V  LLP + +     ++  LP+E
Sbjct  470   VVAAEYMGSAVTEPPWLNYEREWGPKITYDVAKEINKVAKLLPGKLKAALRKMVERLPDE  529

Query  315   FFGEEGPTGPNMKASWSGDEK  253
               GEEGPTGP MK++W  DE+
Sbjct  530   VLGEEGPTGPKMKSNWYTDER  550



>ref|XP_002880097.1| hypothetical protein ARALYDRAFT_483546 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56356.1| hypothetical protein ARALYDRAFT_483546 [Arabidopsis lyrata subsp. 
lyrata]
Length=542

 Score =   483 bits (1243),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 250/438 (57%), Positives = 310/438 (71%), Gaps = 18/438 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSG--PAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             + L+WS  S  +  +G    + W PVPP GY+AVG VV TS EKP  D+IRCV S  TD 
Sbjct  116   FLLLWSGKSTKVENNGVETGFFWQPVPPDGYNAVGLVVATSGEKPPLDKIRCVRSDLTDQ  175

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNN  1198
              E +  +W       + NGF++ + +P+NRGTQA GV +GTF  +      T  CLKNN 
Sbjct  176   SESDALIW-------ETNGFSISSSKPVNRGTQASGVCIGTFFSN--SPTPTLHCLKNNK  226

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               FS   MP+  QI+ALF+ Y+P +Y H  + Y PSSVNWFFSNGALLY K DE+NPV +
Sbjct  227   FDFS--CMPSKPQIDALFQAYAPWIYFHKDEKYLPSSVNWFFSNGALLYKKDDESNPVPV  284

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P+G NLPQG +NDG+YW++LPV ++ ++RV+ GDLQS EVYL+IKP+FGGTFTDIA+WI
Sbjct  285   EPNGLNLPQGESNDGLYWLDLPVASDARKRVQGGDLQSMEVYLHIKPVFGGTFTDIAVWI  344

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGPS AKL +   IPLG IGEHIGDWEH TLRISNFNG L ++Y S+HSGGSW DA
Sbjct  345   FYPFNGPSRAKL-KAATIPLGKIGEHIGDWEHFTLRISNFNGKLYRMYLSQHSGGSWTDA  403

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               +EF  G NK VAY+SLNGHA YSKPGLVLQG  ++GIRNDT KS  V+DT +R+ VVA
Sbjct  404   SEIEFQGGRNKPVAYASLNGHAMYSKPGLVLQGKDNVGIRNDTGKSEKVIDTAVRFRVVA  463

Query  477   G--LQGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVE-WRGVFETLIHLLPNEFF  310
                ++G V EP W+ Y R WGPKI Y  E +I+ VE ++  E  +  F + I  LPNE F
Sbjct  464   AEYMRGEVEEPAWLNYMRHWGPKIDYGHENEIRGVEKIMVGESLKNTFRSAIKGLPNEVF  523

Query  309   GEEGPTGPNMKASWSGDE  256
             GEEGPTGP +K +W GDE
Sbjct  524   GEEGPTGPKLKRNWLGDE  541



>ref|NP_030961.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC16074.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96487.1| At2g44230/F4I1.4 [Arabidopsis thaliana]
 gb|AAM19976.1| At2g44230/F4I1.4 [Arabidopsis thaliana]
 dbj|BAE98671.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10394.1| uncharacterized protein AT2G44230 [Arabidopsis thaliana]
Length=542

 Score =   482 bits (1241),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 253/438 (58%), Positives = 313/438 (71%), Gaps = 18/438 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSG--PAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             Y L+WS  S  +  +     Y W PVPP GY+AVG +VTTS EKP  D+IRCV S  TD 
Sbjct  116   YLLLWSGKSTKVENNKVETGYFWQPVPPDGYNAVGLIVTTSDEKPPLDKIRCVRSDLTDQ  175

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNN  1198
              E +  +W       + NGF++ + +P+NRGTQA GV VGTF  S S N     CLKNNN
Sbjct  176   SEPDALIW-------ETNGFSVSSSKPVNRGTQASGVSVGTFF-SNSPNP-ALPCLKNNN  226

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               FS   MP+  QI+ALF+ Y+P +Y H  + Y PSSVNWFFSNGALLY KGDE+NPV +
Sbjct  227   FDFS--CMPSKPQIDALFQTYAPWIYFHKDEKYLPSSVNWFFSNGALLYKKGDESNPVPV  284

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P+G NLPQG  NDG+YW++LPV ++ ++RV+ GDLQS EVYL+IKP+FGGTFTDIA+W+
Sbjct  285   EPNGLNLPQGEFNDGLYWLDLPVASDARKRVQCGDLQSMEVYLHIKPVFGGTFTDIAVWM  344

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGPS AKL +   IPLG IGEHIGDWEH TLRISNF+G L+++Y S+HSGGSW DA
Sbjct  345   FYPFNGPSRAKL-KAASIPLGRIGEHIGDWEHFTLRISNFSGKLHRMYLSQHSGGSWADA  403

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               +EF  G NK VAY+SLNGHA YSKPGLVLQG  ++GIRNDT KS  V+DT +R+ VVA
Sbjct  404   SEIEFQGGGNKPVAYASLNGHAMYSKPGLVLQGKDNVGIRNDTGKSEKVIDTAVRFRVVA  463

Query  477   G--LQG-IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVE-WRGVFETLIHLLPNEFF  310
                ++G + EP W+ Y R WGPKI Y  E +I+ VE ++  E  +  F + I  LPNE F
Sbjct  464   AEYMRGELEEPAWLNYMRHWGPKIDYGHENEIRGVEKIMVGESLKTTFRSAIKGLPNEVF  523

Query  309   GEEGPTGPNMKASWSGDE  256
             GEEGPTGP +K +W GDE
Sbjct  524   GEEGPTGPKLKRNWLGDE  541



>ref|XP_003548708.2| PREDICTED: uncharacterized protein LOC100808166 [Glycine max]
Length=561

 Score =   481 bits (1239),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 243/436 (56%), Positives = 305/436 (70%), Gaps = 13/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVW+S S+ I Q GP YVWLP  P GY A+GHVVTT+  KPS D+IRCV    TD CE
Sbjct  134   YTLVWNSASMKINQDGPIYVWLPTAPDGYKALGHVVTTTPNKPSFDKIRCVRLDLTDQCE  193

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF-SGNVGTFACLKNNNV  1195
                 +W  G+       FN+Y +RP NRG QA GV+VGTF+    S    + ACLKNN  
Sbjct  194   TSLLIWESGS-------FNVYDVRPSNRGIQAPGVRVGTFVAQNGSTEPPSIACLKNNTN  246

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
             A     MPNL QI+A+ + YSP + LHP + Y PSSV+WFFSNGALLY KG E+NPV I 
Sbjct  247   AIPK-YMPNLQQIKAIMQVYSPTMCLHPDEEYLPSSVDWFFSNGALLYKKGQESNPVSIA  305

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             P+G+NLPQ   NDG YW++LP D   KERVK+GDLQS++ Y+++KPM GGTFTDIA+W+F
Sbjct  306   PNGTNLPQDHNNDGAYWLDLPSDAANKERVKKGDLQSAKSYVHVKPMLGGTFTDIAMWVF  365

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGPS AK+  I  + LG IGEH+GDWEH+TLR+SNFNG L +VYFS+HS G+WVD+ 
Sbjct  366   YPFNGPSRAKVEFI-NVKLGKIGEHVGDWEHVTLRVSNFNGELWQVYFSQHSKGAWVDSS  424

Query  654   NLEFIN-GSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
              +EF + G NK + YSSL+GHA+Y   GL LQG  +IGIRNDTAK   ++D G    V A
Sbjct  425   QIEFQSGGGNKPLYYSSLHGHASYPHAGLNLQGTDNIGIRNDTAKGDKMMDMGAFELVSA  484

Query  477   GLQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
                G  ++EPPW+ Y REWGPKI Y  + ++K++E  LP   +   E ++  LP+E  GE
Sbjct  485   EYLGYAVIEPPWLNYFREWGPKIDYSIDVELKKIEKFLPKNLKDALEKIMRSLPSEVLGE  544

Query  303   EGPTGPNMKASWSGDE  256
             EGPTGP +K +W GDE
Sbjct  545   EGPTGPKVKNNWIGDE  560



>gb|AES66093.2| DUF946 family protein [Medicago truncatula]
Length=553

 Score =   481 bits (1238),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 240/436 (55%), Positives = 308/436 (71%), Gaps = 16/436 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV ++ ++ + Q    Y+WLP+ P GY A+GHVVT + +KPS D+I CV S  TD CE
Sbjct  129   YTLVLNTSTIKVNQDTTCYIWLPIAPDGYKALGHVVTATQDKPSLDKIMCVRSDLTDQCE  188

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSG-NVG-TFACLKNNN  1198
                W+WG        N FN Y +RPINRGTQA GV VG F+    G N+  + +CLKN N
Sbjct  189   SSSWIWGS-------NDFNFYDVRPINRGTQAPGVHVGAFVAQNGGTNIPPSISCLKNLN  241

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
                 S  MPNL QI+A+ + YSP++YLHP + Y PSSVNWFFSNGALLY KG+E+NPV I
Sbjct  242   SI--SKIMPNLVQIDAILKVYSPLMYLHPDEEYLPSSVNWFFSNGALLYKKGEESNPVPI  299

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
               +G NLPQ   NDG+YW++LP D+  KERVK+G+LQS+E Y+++KPM GGTFTDIA+WI
Sbjct  300   AQNGINLPQDPNNDGIYWLDLPSDDANKERVKKGNLQSAESYVHVKPMLGGTFTDIAMWI  359

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP  AK+  I  + LG IGEHIGDWEH+TLR+SN +G L  +YFS+HS G W+D+
Sbjct  360   FYPFNGPGRAKVKFI-NVKLGKIGEHIGDWEHVTLRVSNLDGKLWHLYFSQHSKGEWIDS  418

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               LEF   SN+ V YSSL+GHA+Y   GLVLQG   IGIRND+AKS  +LD      + A
Sbjct  419   SQLEF--QSNRPVFYSSLHGHASYPHEGLVLQGKNGIGIRNDSAKSEMILDLTKFVLISA  476

Query  477   GLQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
                G  ++EPPW+ Y R+WGPKI Y  +E++++VE +LP + + +FE +I  LP E  GE
Sbjct  477   DYLGSFVIEPPWLHYFRKWGPKIDYNIDEELRKVEKILPGKLKDIFENIIRSLPEEVLGE  536

Query  303   EGPTGPNMKASWSGDE  256
             EGPTGP +K +WSGDE
Sbjct  537   EGPTGPKLKNNWSGDE  552



>ref|XP_003595842.1| hypothetical protein MTR_2g062430 [Medicago truncatula]
 gb|ABN08108.1| Protein of unknown function DUF946, plant [Medicago truncatula]
Length=561

 Score =   481 bits (1239),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 240/436 (55%), Positives = 308/436 (71%), Gaps = 16/436 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV ++ ++ + Q    Y+WLP+ P GY A+GHVVT + +KPS D+I CV S  TD CE
Sbjct  137   YTLVLNTSTIKVNQDTTCYIWLPIAPDGYKALGHVVTATQDKPSLDKIMCVRSDLTDQCE  196

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSG-NVG-TFACLKNNN  1198
                W+WG        N FN Y +RPINRGTQA GV VG F+    G N+  + +CLKN N
Sbjct  197   SSSWIWGS-------NDFNFYDVRPINRGTQAPGVHVGAFVAQNGGTNIPPSISCLKNLN  249

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
                 S  MPNL QI+A+ + YSP++YLHP + Y PSSVNWFFSNGALLY KG+E+NPV I
Sbjct  250   SI--SKIMPNLVQIDAILKVYSPLMYLHPDEEYLPSSVNWFFSNGALLYKKGEESNPVPI  307

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
               +G NLPQ   NDG+YW++LP D+  KERVK+G+LQS+E Y+++KPM GGTFTDIA+WI
Sbjct  308   AQNGINLPQDPNNDGIYWLDLPSDDANKERVKKGNLQSAESYVHVKPMLGGTFTDIAMWI  367

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP  AK+  I  + LG IGEHIGDWEH+TLR+SN +G L  +YFS+HS G W+D+
Sbjct  368   FYPFNGPGRAKVKFI-NVKLGKIGEHIGDWEHVTLRVSNLDGKLWHLYFSQHSKGEWIDS  426

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               LEF   SN+ V YSSL+GHA+Y   GLVLQG   IGIRND+AKS  +LD      + A
Sbjct  427   SQLEF--QSNRPVFYSSLHGHASYPHEGLVLQGKNGIGIRNDSAKSEMILDLTKFVLISA  484

Query  477   GLQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
                G  ++EPPW+ Y R+WGPKI Y  +E++++VE +LP + + +FE +I  LP E  GE
Sbjct  485   DYLGSFVIEPPWLHYFRKWGPKIDYNIDEELRKVEKILPGKLKDIFENIIRSLPEEVLGE  544

Query  303   EGPTGPNMKASWSGDE  256
             EGPTGP +K +WSGDE
Sbjct  545   EGPTGPKLKNNWSGDE  560



>gb|KHM99442.1| hypothetical protein glysoja_045356 [Glycine soja]
Length=556

 Score =   481 bits (1237),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 242/436 (56%), Positives = 305/436 (70%), Gaps = 13/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVW+S S+ I Q GP YVWLP  P GY A+GHVVTT+  KPS D+IRCV    TD CE
Sbjct  129   YTLVWNSASMKINQDGPIYVWLPTAPDGYKALGHVVTTTPNKPSFDKIRCVRLDLTDQCE  188

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF-SGNVGTFACLKNNNV  1195
                 +W  G+       FN+Y +RP NRG QA GV+VGTF+    S    + ACLKNN  
Sbjct  189   TSLLIWESGS-------FNVYDVRPSNRGIQAPGVRVGTFVAQNGSTEPPSIACLKNNTN  241

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
             A     MPNL QI+A+ + YSP + LHP + Y PSSV+WFFSNGALLY KG E+NPV I 
Sbjct  242   AIPK-YMPNLQQIKAIMQVYSPTMCLHPDEEYLPSSVDWFFSNGALLYEKGQESNPVSIA  300

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             P+G+NLPQ   NDG YW++LP D   KERVK+GDLQS++ Y+++KPM GGTFTDIA+W+F
Sbjct  301   PNGTNLPQDHNNDGAYWLDLPSDAANKERVKKGDLQSAKSYVHVKPMLGGTFTDIAMWVF  360

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGPS AK+  I  + LG IGEH+GDWEH+TLR+SNFNG L +VYFS+HS G+WVD+ 
Sbjct  361   YPFNGPSKAKVEFI-NVKLGKIGEHVGDWEHVTLRVSNFNGELWQVYFSQHSKGAWVDSS  419

Query  654   NLEFIN-GSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
              +EF + G NK + YSSL+GHA+Y   GL +QG  +IGIRNDTAK   ++D G    V A
Sbjct  420   QIEFQSGGGNKPLYYSSLHGHASYPHAGLNMQGTDNIGIRNDTAKGDKMMDMGAFELVSA  479

Query  477   GLQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
                G  ++EPPW+ Y REWGPKI Y  + ++K++E  LP   +   E ++  LP+E  GE
Sbjct  480   EYLGYAVIEPPWLNYFREWGPKIDYSIDVELKKIEKFLPKNLKDALEKIMRSLPSEVLGE  539

Query  303   EGPTGPNMKASWSGDE  256
             EGPTGP +K +W GDE
Sbjct  540   EGPTGPKVKNNWIGDE  555



>gb|KFK37236.1| hypothetical protein AALP_AA4G231600 [Arabis alpina]
Length=546

 Score =   480 bits (1236),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 247/441 (56%), Positives = 312/441 (71%), Gaps = 21/441 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSG--PAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             Y L+WS  S     +G    Y W PV P GY+AVG +VTTS EKP  D+IRCV S  T+ 
Sbjct  117   YLLLWSGKSTKGENNGVETGYFWQPVAPDGYNAVGLIVTTSNEKPPLDKIRCVRSDLTEQ  176

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNN  1198
              E +  +W       + NGF++ + +P+NRGTQ  GV VGTF  + S    T  CLKNN 
Sbjct  177   SESDTLIW-------ETNGFSVSSAKPVNRGTQGSGVCVGTFFANSSNP--TLTCLKNNK  227

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               FS   MP+  Q+ AL++ Y+P +Y H  + Y PSSVNWFF+NGALLY KG+E+NPV +
Sbjct  228   FDFS--CMPSKIQVNALYQAYAPWIYFHKDEKYLPSSVNWFFANGALLYKKGEESNPVAV  285

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P+GSNLPQG +NDG+YW++LPV ++ ++RVK GDLQS EVYL+IKP+FGGTFTDIA+W+
Sbjct  286   EPNGSNLPQGESNDGLYWLDLPVASDARKRVKAGDLQSMEVYLHIKPVFGGTFTDIAVWM  345

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGPS AKL ++  IPLG IGEHIGDWEH TLRISNF+G L+++Y S+HS GSW+DA
Sbjct  346   FYPFNGPSRAKL-KLATIPLGRIGEHIGDWEHFTLRISNFSGKLHRMYLSQHSKGSWIDA  404

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               +EF  G NK VAYSSLNGHA YSKPGLVLQG  D+GIRNDT KS  V+DT +R+ VV+
Sbjct  405   SEIEFQGGGNKPVAYSSLNGHAMYSKPGLVLQGKDDVGIRNDTGKSDKVIDTAVRFRVVS  464

Query  477   ------GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVE-WRGVFETLIHLLPN  319
                   G + + EP W+ Y R WGPKI Y  E +IK VE +L  E  + +F + I  LPN
Sbjct  465   AEYMRGGGEVVEEPAWLNYMRHWGPKIDYGHENEIKGVEKVLVGENLKNMFRSAIKGLPN  524

Query  318   EFFGEEGPTGPNMKASWSGDE  256
             E +G+EGPTGP +K +W GDE
Sbjct  525   EVYGQEGPTGPKLKRNWLGDE  545



>ref|XP_010675110.1| PREDICTED: uncharacterized protein LOC104891150 isoform X3 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010675111.1| PREDICTED: uncharacterized protein LOC104891150 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=551

 Score =   479 bits (1234),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 237/438 (54%), Positives = 299/438 (68%), Gaps = 11/438 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVWSS SL +    P Y+W P+P  GY AVG VVTT+ EKP  +++RCV S FT  CE
Sbjct  117   YALVWSSKSLKVKTDSPGYIWAPIPTDGYQAVGLVVTTTPEKPPLEKVRCVRSDFTTLCE  176

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL----GSFSGNVGTFACLKN  1204
              ++W+WGR     D + FN++  RP+ RG QA  V  GTFL    G  +G+     CLK 
Sbjct  177   PDEWIWGR-QGGVDSDEFNIFESRPVRRGKQASAVSAGTFLSRSGGGTTGDTPLLVCLKY  235

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
               V  +S+ MPNL QI  L   Y+P +Y HP + Y PSSV W+F NGALLY KGDE+NP+
Sbjct  236   --VKKNSTYMPNLEQIGTLINTYAPKIYSHPKEQYLPSSVEWYFENGALLYKKGDESNPI  293

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I P GSNLPQGG NDG YW++LP D  E+ERVK+G+++S+  Y +IKPM  G +TD+AI
Sbjct  294   PIDPSGSNLPQGGGNDGEYWIDLPSDKKERERVKKGNMESACAYYHIKPMLAGAYTDLAI  353

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+FYPFNGPS+AK+G +  IPLG IGEH+GDWEH+TLRISNFNG+L KVYFS+H+GG WV
Sbjct  354   WLFYPFNGPSSAKVGFLS-IPLGEIGEHVGDWEHITLRISNFNGMLRKVYFSQHAGGEWV  412

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
               PNLEF +G N+ V YSSL+GHA Y K G VLQG   +GIRNDTAKS  VLDTG+ Y +
Sbjct  413   YPPNLEFTDG-NRVVGYSSLHGHACYPKAGEVLQGTSYVGIRNDTAKSDKVLDTGVGYKI  471

Query  483   VAG--LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
             ++   L  + EP W+ Y R+WGPKI+Y    +I ++  LLP   +  F       P E  
Sbjct  472   ISADYLGVVTEPSWLNYARKWGPKISYDIANEINKIAKLLPGGLKDKFIKFTKSFPAELL  531

Query  309   GEEGPTGPNMKASWSGDE  256
             GE+GP GP MK SW G+E
Sbjct  532   GEQGPNGPKMKRSWDGEE  549



>ref|XP_010923372.1| PREDICTED: uncharacterized protein LOC105046482 [Elaeis guineensis]
Length=563

 Score =   479 bits (1233),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 251/440 (57%), Positives = 315/440 (72%), Gaps = 18/440 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTL+WSS+S  I Q G  Y WLP PP+GY AVG +VT S EKPS D IRCV    TD CE
Sbjct  135   YTLLWSSESSNIKQDGNGYFWLPTPPEGYKAVGLIVTNSSEKPSPDDIRCVRLDLTDACE  194

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
              ++ +W     NND  GF +  LRP NRG QA GV++GTF+   +G+ G  T ACLKNN+
Sbjct  195   NDESIW-----NND--GFGVNGLRPANRGIQALGVRLGTFIAQANGSPGSSTIACLKNND  247

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
                + S MPNLSQI+A+ + YSP +Y HP + + PSSV+WFF NGALLY KG+ + P  I
Sbjct  248   CNINYS-MPNLSQIQAMMQAYSPWIYFHPDEEFLPSSVSWFFDNGALLYEKGNPS-PAPI  305

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
               +GSNLPQGG+NDG YW++LPVD+ EK++VK+GD+ SS+VYL++KPM G TFTD+AIWI
Sbjct  306   TSNGSNLPQGGSNDGAYWIDLPVDDREKDKVKKGDIPSSKVYLHVKPMLGATFTDVAIWI  365

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+ AK+G    + LG IGEH+GDWEH+TLR+SNF+G L +VYFSEHS G+WV+A
Sbjct  366   FYPFNGPAKAKVGPF-NLSLGRIGEHVGDWEHVTLRVSNFSGELWRVYFSEHSAGTWVEA  424

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGI--GDIGIRNDTAKSAAVLDTGLRYSV  484
               LEF  G NK V YSSL+GHANYSK GLVL+G     IGIRNDTAK    +D+G R+ V
Sbjct  425   SQLEF-EGGNKPVVYSSLHGHANYSKAGLVLEGNSGSGIGIRNDTAKGKNRIDSGERFEV  483

Query  483   VAG--LQGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             V    L  +V EPPW+ Y REWGPKITY   ++I RV  LLP   +   + ++  LP+E 
Sbjct  484   VGAEYLGSVVTEPPWLNYEREWGPKITYDIGKEINRVARLLPGRLKTALKKVVERLPDEV  543

Query  312   FGEEGPTGPNMKASWSGDEK  253
              GEEGPTGP  K++W  DE+
Sbjct  544   LGEEGPTGPKEKSNWYMDER  563



>ref|XP_010675107.1| PREDICTED: uncharacterized protein LOC104891150 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=605

 Score =   481 bits (1237),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 237/438 (54%), Positives = 299/438 (68%), Gaps = 11/438 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVWSS SL +    P Y+W P+P  GY AVG VVTT+ EKP  +++RCV S FT  CE
Sbjct  171   YALVWSSKSLKVKTDSPGYIWAPIPTDGYQAVGLVVTTTPEKPPLEKVRCVRSDFTTLCE  230

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL----GSFSGNVGTFACLKN  1204
              ++W+WGR     D + FN++  RP+ RG QA  V  GTFL    G  +G+     CLK 
Sbjct  231   PDEWIWGR-QGGVDSDEFNIFESRPVRRGKQASAVSAGTFLSRSGGGTTGDTPLLVCLKY  289

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
               V  +S+ MPNL QI  L   Y+P +Y HP + Y PSSV W+F NGALLY KGDE+NP+
Sbjct  290   --VKKNSTYMPNLEQIGTLINTYAPKIYSHPKEQYLPSSVEWYFENGALLYKKGDESNPI  347

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I P GSNLPQGG NDG YW++LP D  E+ERVK+G+++S+  Y +IKPM  G +TD+AI
Sbjct  348   PIDPSGSNLPQGGGNDGEYWIDLPSDKKERERVKKGNMESACAYYHIKPMLAGAYTDLAI  407

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+FYPFNGPS+AK+G +  IPLG IGEH+GDWEH+TLRISNFNG+L KVYFS+H+GG WV
Sbjct  408   WLFYPFNGPSSAKVGFLS-IPLGEIGEHVGDWEHITLRISNFNGMLRKVYFSQHAGGEWV  466

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
               PNLEF +G N+ V YSSL+GHA Y K G VLQG   +GIRNDTAKS  VLDTG+ Y +
Sbjct  467   YPPNLEFTDG-NRVVGYSSLHGHACYPKAGEVLQGTSYVGIRNDTAKSDKVLDTGVGYKI  525

Query  483   VAG--LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
             ++   L  + EP W+ Y R+WGPKI+Y    +I ++  LLP   +  F       P E  
Sbjct  526   ISADYLGVVTEPSWLNYARKWGPKISYDIANEINKIAKLLPGGLKDKFIKFTKSFPAELL  585

Query  309   GEEGPTGPNMKASWSGDE  256
             GE+GP GP MK SW G+E
Sbjct  586   GEQGPNGPKMKRSWDGEE  603



>ref|XP_010675108.1| PREDICTED: uncharacterized protein LOC104891150 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010675109.1| PREDICTED: uncharacterized protein LOC104891150 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=567

 Score =   479 bits (1233),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 237/438 (54%), Positives = 299/438 (68%), Gaps = 11/438 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVWSS SL +    P Y+W P+P  GY AVG VVTT+ EKP  +++RCV S FT  CE
Sbjct  133   YALVWSSKSLKVKTDSPGYIWAPIPTDGYQAVGLVVTTTPEKPPLEKVRCVRSDFTTLCE  192

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL----GSFSGNVGTFACLKN  1204
              ++W+WGR     D + FN++  RP+ RG QA  V  GTFL    G  +G+     CLK 
Sbjct  193   PDEWIWGR-QGGVDSDEFNIFESRPVRRGKQASAVSAGTFLSRSGGGTTGDTPLLVCLKY  251

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
               V  +S+ MPNL QI  L   Y+P +Y HP + Y PSSV W+F NGALLY KGDE+NP+
Sbjct  252   --VKKNSTYMPNLEQIGTLINTYAPKIYSHPKEQYLPSSVEWYFENGALLYKKGDESNPI  309

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I P GSNLPQGG NDG YW++LP D  E+ERVK+G+++S+  Y +IKPM  G +TD+AI
Sbjct  310   PIDPSGSNLPQGGGNDGEYWIDLPSDKKERERVKKGNMESACAYYHIKPMLAGAYTDLAI  369

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+FYPFNGPS+AK+G +  IPLG IGEH+GDWEH+TLRISNFNG+L KVYFS+H+GG WV
Sbjct  370   WLFYPFNGPSSAKVGFLS-IPLGEIGEHVGDWEHITLRISNFNGMLRKVYFSQHAGGEWV  428

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
               PNLEF +G N+ V YSSL+GHA Y K G VLQG   +GIRNDTAKS  VLDTG+ Y +
Sbjct  429   YPPNLEFTDG-NRVVGYSSLHGHACYPKAGEVLQGTSYVGIRNDTAKSDKVLDTGVGYKI  487

Query  483   VAG--LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
             ++   L  + EP W+ Y R+WGPKI+Y    +I ++  LLP   +  F       P E  
Sbjct  488   ISADYLGVVTEPSWLNYARKWGPKISYDIANEINKIAKLLPGGLKDKFIKFTKSFPAELL  547

Query  309   GEEGPTGPNMKASWSGDE  256
             GE+GP GP MK SW G+E
Sbjct  548   GEQGPNGPKMKRSWDGEE  565



>gb|EYU27168.1| hypothetical protein MIMGU_mgv1a019297mg [Erythranthe guttata]
Length=558

 Score =   478 bits (1231),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 241/433 (56%), Positives = 301/433 (70%), Gaps = 10/433 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTD-PC  1375
             YTLVWSS+SL I Q G AY+WLP PP GY+ VG++VT S EKP  ++IRCV S FT+   
Sbjct  135   YTLVWSSESLKIKQDGAAYIWLPTPPDGYNPVGYLVTGSPEKPPVEKIRCVRSDFTEYTG  194

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNV  1195
             E E  +WG    + + NG ++Y  R  NRG Q   V  GTF    S        L  NN 
Sbjct  195   ENEAVIWG----DVNANGISVYRSRSRNRGIQGTAVPTGTFSAEISNRANLDLPLLKNNG  250

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
               +   MPN  QI AL + YSP +Y HP + Y PSSV WFF NGALLY KG+E+ PV I 
Sbjct  251   NANQDLMPNEDQINALIQTYSPYIYFHPNEQYFPSSVEWFFENGALLYKKGEESKPVNIS  310

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             P G NLP+GG ND  YW++LP+DN  KERVK+GDL S+  YL++KPMFGGTFTDIAIW+F
Sbjct  311   PTGLNLPEGGGNDDEYWIDLPIDNASKERVKKGDLASACAYLHVKPMFGGTFTDIAIWLF  370

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+ +   + LG IGEH+GDWEH+TLR+SN +G L  VYF +HS G WV+A 
Sbjct  371   YPFNGPARAKI-EFLNVSLGRIGEHVGDWEHVTLRVSNLSGELKSVYFGQHSNGVWVEAS  429

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
             +LEF NGSN+  A+SSL+GHA+Y K GLVLQG G++GIRND+AKS   +D G R  VV G
Sbjct  430   DLEFENGSNRPRAFSSLHGHASYPKEGLVLQGNGNVGIRNDSAKSKFSMDVGARCVVVDG  489

Query  474   LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEEGP  295
                 VEPPW+ Y R+WGPKI+Y  E++I++VE +LP + + VF+ ++  LPNE FGEEGP
Sbjct  490   ----VEPPWLNYARKWGPKISYNREDEIRKVEKVLPGKLKSVFDKIVRSLPNEVFGEEGP  545

Query  294   TGPNMKASWSGDE  256
              GP  K SW GDE
Sbjct  546   IGPKWKNSWIGDE  558



>ref|XP_009388451.1| PREDICTED: uncharacterized protein LOC103975261 [Musa acuminata 
subsp. malaccensis]
Length=542

 Score =   476 bits (1226),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 248/440 (56%), Positives = 302/440 (69%), Gaps = 20/440 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+S  I Q G  Y WLP PPQGY+AVG VVT S EKPS + IRCV S  TD  +
Sbjct  116   YTLVWSSESSTIKQDGRGYFWLPTPPQGYAAVGLVVTNSSEKPSVEEIRCVRSDLTDQSQ  175

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSG--NVGTFACLKNNN  1198
              + +VW         +GF++  LRP  RG +A GV VGTF+   +G     + ACLKN  
Sbjct  176   SDAYVWST-------DGFSVNGLRPSTRGIKALGVSVGTFIAQANGATTATSLACLKNRA  228

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               F+S  MPN+ Q EAL + YSP +Y HP + Y PSSV+W F NGALLY KG++ NP  I
Sbjct  229   SNFTS--MPNMMQAEALMKAYSPWIYYHPDEEYLPSSVSWLFDNGALLYQKGNQ-NPTPI  285

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
             G DGSNLPQGG+NDG YW++LPVD   +++VK+GDL S +VYL IKPM G TFTD+ IWI
Sbjct  286   GSDGSNLPQGGSNDGAYWIDLPVDGGRRDKVKKGDLSSMKVYLQIKPMLGATFTDVVIWI  345

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+ AK+ Q+  IPLG IG+H+GDWEH+TLRISNFNG L +VYFS+HS G+WVDA
Sbjct  346   FYPFNGPAKAKV-QLLNIPLGKIGQHVGDWEHMTLRISNFNGELWRVYFSQHSSGAWVDA  404

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRYSV  484
               LEF  G NK V YSSL+GHA Y+KPGLVLQG     IGIRNDTAK + + D+G  + V
Sbjct  405   SQLEFQEG-NKPVGYSSLHGHAMYAKPGLVLQGDSKLGIGIRNDTAKGSGI-DSGGSFEV  462

Query  483   VAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             VA       + EP W+ Y R+WGP ++Y    ++K VE LLP   R   E +I  LP E 
Sbjct  463   VAAEYMGSAVSEPSWLNYMRQWGPTVSYDIANELKNVEKLLPKNLRSKLENIIKSLPAEV  522

Query  312   FGEEGPTGPNMKASWSGDEK  253
              GEEGPTGP  K SW+ DEK
Sbjct  523   LGEEGPTGPKEKNSWAMDEK  542



>gb|EPS59601.1| hypothetical protein M569_15204 [Genlisea aurea]
Length=541

 Score =   476 bits (1224),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 244/435 (56%), Positives = 301/435 (69%), Gaps = 19/435 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTL+ +  +         + WLP PP+GY   G++VT S EKPS DRIRCV S FTD  E
Sbjct  121   YTLISTISTGSNNSEESIHFWLPKPPEGYKPAGYIVTVSPEKPSLDRIRCVRSDFTDESE  180

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL--GSFSGNVGTFACLKNNN  1198
             +   +WG            +Y  RP NRG+ A+ + VG+F+   S S N    +CLKNNN
Sbjct  181   IGSSIWG----------LKVYDSRPKNRGSGAEQLSVGSFIVITSDSNNQSWVSCLKNNN  230

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               FSSS  PN  Q++ALFR YSP +Y HP +TY P+SVNW+FSNGALLYTKG+E+NP  I
Sbjct  231   --FSSSPTPNSIQLDALFRTYSPYIYFHPKETYLPASVNWYFSNGALLYTKGNESNPSGI  288

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              PDGSNLPQGG NDG+YW++LP    +KERVKRGDLQ++E YL+ KPM GG FTDI +W+
Sbjct  289   DPDGSNLPQGGWNDGLYWIDLPASEGDKERVKRGDLQNAEAYLHSKPMLGGAFTDIQLWL  348

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGPS AKLG I  +PLG IG+H+GDWEH+TLRISNFNG+L++V+FS+HSGG W D+
Sbjct  349   FYPFNGPSIAKLGIIRELPLGRIGQHVGDWEHVTLRISNFNGILHRVFFSQHSGGKWTDS  408

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA  478
               LEF  G NK V YSS NGHA+YSK    LQG G IG+RNDTAKS  VL TG  +S VA
Sbjct  409   SLLEFYQG-NKFVGYSSRNGHASYSKENPNLQGNGVIGLRNDTAKSDKVLSTGSSFSFVA  467

Query  477   GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEEG  298
                    P W+ Y REWGP+ TY   +++K +E  LP   R   E L++ LP+E FGE G
Sbjct  468   S----DAPAWLNYAREWGPQKTYDLGKELKNLEKFLPKHLRSALEKLVNSLPSEVFGERG  523

Query  297   PTGPNMKASWSGDEK  253
             P GP MKA+W+GDEK
Sbjct  524   PVGPKMKANWNGDEK  538



>ref|XP_007156321.1| hypothetical protein PHAVU_003G276600g [Phaseolus vulgaris]
 gb|ESW28315.1| hypothetical protein PHAVU_003G276600g [Phaseolus vulgaris]
Length=553

 Score =   474 bits (1221),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 237/435 (54%), Positives = 306/435 (70%), Gaps = 13/435 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             +TLVW+S S+ I+Q GP YVWLP  P GY AVGHVVTT+ +KPS D+IRCV S  TD CE
Sbjct  128   FTLVWNSASMKISQDGPIYVWLPTAPDGYKAVGHVVTTTSDKPSLDKIRCVRSDLTDQCE  187

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSFSGNVGTFACLKNNNV  1195
                 +W  G+       F++Y +RP NRG QA GV+VGTF+  + S N  + ACLKN   
Sbjct  188   TNSLIWESGS-------FSIYDVRPSNRGIQAPGVRVGTFVVQNGSTNPLSIACLKNTKT  240

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
                   MPNL QI+A+ + YSP + LHP + Y PSSV+WFFSNGALLY KG E+NPV I 
Sbjct  241   I--PKYMPNLQQIKAILQVYSPTMCLHPSEEYLPSSVDWFFSNGALLYKKGQESNPVPIA  298

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              +G+NLPQ   NDG YW++LP D   KERVK+G+LQS++ Y+++KPM GGTFTDIA+W+F
Sbjct  299   TNGTNLPQDHNNDGAYWLDLPADAANKERVKKGNLQSAKSYVHVKPMLGGTFTDIAMWVF  358

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGPS AK+  I    LG IGEH+GDWEH+TLR+SNF+G L +VYFS+HS G+WVD+ 
Sbjct  359   YPFNGPSRAKVKLIS-FQLGKIGEHVGDWEHVTLRVSNFSGELWQVYFSQHSKGTWVDSS  417

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
              +EF +G NK + YSSL+GHA+Y   GL LQG  +IGIRNDTAK   V+D G+   V   
Sbjct  418   QIEFQSGGNKPLFYSSLHGHASYPHAGLNLQGEDNIGIRNDTAKGNNVMDLGIFELVCGE  477

Query  474   LQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEE  301
               G  ++EPPW+ Y  EWGPKI Y  + ++K+++  LP   +   E ++  LP+E  GEE
Sbjct  478   YLGSSVIEPPWLNYFWEWGPKIDYNIDVELKKIKKFLPKNLKSALEKILRSLPSEVLGEE  537

Query  300   GPTGPNMKASWSGDE  256
             GPTGP +K +W+GDE
Sbjct  538   GPTGPMVKNNWNGDE  552



>ref|XP_009385972.1| PREDICTED: uncharacterized protein LOC103973196 [Musa acuminata 
subsp. malaccensis]
Length=532

 Score =   469 bits (1206),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 243/439 (55%), Positives = 303/439 (69%), Gaps = 20/439 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+S  I Q G  Y WLP PP+GY AVG VVT S EKPS + +RCV S  TD  E
Sbjct  106   YTLVWSSESSNINQDGRGYFWLPTPPEGYHAVGLVVTNSSEKPSVEEVRCVRSDLTDEPE  165

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNV--GTFACLKNNN  1198
              + ++W         +GF++ +LRP  RG  A GV VGTF+   +G     T ACLKN  
Sbjct  166   SDAYIWST-------DGFSVDSLRPATRGINALGVPVGTFIARTNGAATSATLACLKNRE  218

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               FSS  MPNL Q+EAL + YSP +Y HP + Y PSSV+WFF NGALLY KG++ NP  I
Sbjct  219   ANFSS--MPNLRQVEALMQAYSPWIYFHPDEVYLPSSVSWFFDNGALLYQKGNQ-NPTPI  275

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
                GSNLPQG +NDG YW++LP D+ +K ++K+GD+ S+++YL+IKPM G TFTD+ IWI
Sbjct  276   DSGGSNLPQGDSNDGAYWIDLPADDGQKNKIKKGDISSTKLYLHIKPMLGATFTDVVIWI  335

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+ AKLG +  + LG IGEH+GDWE LTLRISNF G L ++YF+EHS G+WVDA
Sbjct  336   FYPFNGPAKAKLG-LFNVSLGKIGEHVGDWEQLTLRISNFTGELRRLYFAEHSSGTWVDA  394

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRYSV  484
               L+F  G NK V YSSL+GHA YSKPGLVLQG     IGIRNDTAK  +  D+G  + V
Sbjct  395   SQLDFPEG-NKPVGYSSLHGHAMYSKPGLVLQGNSKLGIGIRNDTAKGNS-FDSGRSFEV  452

Query  483   VAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             VA       + EP W+ Y REWGPKI+Y    ++K+VE LLP ++R   E++I+ LP+E 
Sbjct  453   VAAEYMGSAVTEPAWLNYMREWGPKISYDISNELKKVEKLLPGKFRSRLESIINSLPDEV  512

Query  312   FGEEGPTGPNMKASWSGDE  256
               EEGPTGP  K SW+ DE
Sbjct  513   LREEGPTGPKEKRSWAMDE  531



>ref|XP_008813096.1| PREDICTED: uncharacterized protein LOC103723822 [Phoenix dactylifera]
Length=547

 Score =   468 bits (1205),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 245/440 (56%), Positives = 311/440 (71%), Gaps = 19/440 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS++  + + G  Y WLP PPQGY A+G +VT+S EKPS D++RCV +  T+ CE
Sbjct  120   YTLVWSSEASKVEKDGDGYFWLPTPPQGYKAIGLLVTSSSEKPSLDQVRCVRADLTEQCE  179

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGN--VGTFACLKNNN  1198
              +  +W       D +GF++  LRP  RG QA GV VGTF+    G+    T ACLKN  
Sbjct  180   NDASIW-------DKDGFSVNGLRPAARGIQALGVWVGTFIAQADGSPSSSTIACLKNKA  232

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
              +F+S  MPNLSQI A+ + YSP++Y HP + Y PSSV+W+F +GALLY KG   NP  I
Sbjct  233   SSFAS--MPNLSQIRAVMQAYSPVIYFHPDEEYLPSSVSWYFDSGALLYEKG-SPNPTPI  289

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
               +GSNLPQGG+NDG YW++LPVD+ +KE+ K+GD+ +S+VYL++KPM G TFTD+AIWI
Sbjct  290   ASNGSNLPQGGSNDGAYWIDLPVDDEKKEKAKKGDIPTSKVYLHVKPMLGATFTDMAIWI  349

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+ AK+G I  +PLG IGEH+GDWEHLTLR+SN NG L +VYFSEHS G+WVDA
Sbjct  350   FYPFNGPAKAKVGII-NLPLGRIGEHVGDWEHLTLRVSNLNGELWRVYFSEHSSGTWVDA  408

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRYSV  484
               LEF  G NK VAYSSL+GHANY+KPGLVLQG     IGIRND AK    +D G R+ +
Sbjct  409   SQLEF-QGGNKPVAYSSLHGHANYAKPGLVLQGNSTLGIGIRNDAAKGTNSIDAGERFEI  467

Query  483   VAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             VA       +VEP W+ Y REWGPKITY   ++I +   LLP   +  F+ L+  LP+E 
Sbjct  468   VAAEYLGSAVVEPSWLNYEREWGPKITYDIAKEIDKAVKLLPGNLKTEFKHLVESLPDEV  527

Query  312   FGEEGPTGPNMKASWSGDEK  253
              GEEGPTGP +K+ W  DE+
Sbjct  528   LGEEGPTGPKVKSDWYMDER  547



>ref|XP_010099772.1| hypothetical protein L484_010959 [Morus notabilis]
 gb|EXB80390.1| hypothetical protein L484_010959 [Morus notabilis]
Length=536

 Score =   466 bits (1200),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 238/450 (53%), Positives = 294/450 (65%), Gaps = 56/450 (12%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWSS+SL I Q    YVWLP PP GY AVG +VT   +KP+ D+IRCV +  T+PCE
Sbjct  125   YSLVWSSESLKIKQDSNGYVWLPTPPDGYKAVGFLVTDVPQKPALDKIRCVRADLTEPCE  184

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG---TFACLKNN  1201
              E W+WG  +  ND  GFN+Y+LRP NRGTQ+ GV VGTF     G      + ACLKN 
Sbjct  185   AESWIWGS-SKENDAKGFNIYSLRPTNRGTQSLGVAVGTFSAQIGGTDALPSSLACLKNA  243

Query  1200  NVAFS-SSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
             N +    S+MPNL QIEA+FR Y+PI+Y HP + Y PSSV W+F NGALLY +G+E+NP 
Sbjct  244   NDSNELHSSMPNLPQIEAIFRAYAPIVYFHPDEKYLPSSVTWYFDNGALLYKRGEESNPT  303

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              + P GSNLPQGG+NDG YW++LP D NEKE+VKRGDL S + YL  KPMFG TFTDIA+
Sbjct  304   PVEPTGSNLPQGGSNDGEYWLDLPKDKNEKEKVKRGDLDSVQAYLQAKPMFGSTFTDIAV  363

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W FYPFNGP+ AK+G I  + LG IGEHIGDWEH+TLR+SNF+G L K+Y S+HS G WV
Sbjct  364   WFFYPFNGPARAKVGAI-TVGLGNIGEHIGDWEHITLRVSNFSGELRKLYLSQHSTGEWV  422

Query  663   DAPNLEFINGS---------NKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAV  511
             +A  LEF   +          + V Y+SLNGHA Y+KPG+V+QG   IG+RNDTAKS  V
Sbjct  423   EASGLEFYENNGGGDSVGGGKRPVTYASLNGHAMYAKPGVVMQGTDAIGVRNDTAKSNIV  482

Query  510   LDTGLRYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFE  343
             +DTG  + VVA        +VEP WV Y  +WGP                          
Sbjct  483   MDTGANFEVVAAEYLAAGAVVEPAWVNYLWKWGP--------------------------  516

Query  342   TLIHLLPNEFFGEEGPTGPNMKASWSGDEK  253
                        G++GPTGP +KASW+GDE+
Sbjct  517   -----------GDDGPTGPKVKASWNGDER  535



>ref|XP_009385974.1| PREDICTED: uncharacterized protein LOC103973198 [Musa acuminata 
subsp. malaccensis]
Length=551

 Score =   466 bits (1200),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 240/439 (55%), Positives = 302/439 (69%), Gaps = 20/439 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+S  I Q G  Y WLP PP+GY AVG VVT S EKPS + +RCV S  TD  E
Sbjct  125   YTLVWSSESSNINQDGRGYFWLPTPPEGYHAVGLVVTNSSEKPSVEEVRCVRSDLTDEPE  184

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNV--GTFACLKNNN  1198
              + ++W         +GF++ +LRP  RG  A GV VGTF+   +G       +CLKN  
Sbjct  185   SDAYIWST-------DGFSVDSLRPATRGINALGVSVGTFIARANGAAISAALSCLKNRK  237

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
               FSS  MPNL Q+EAL + YSP +Y HP + Y PSSV+WFF NGALLY KG++ NP  I
Sbjct  238   ANFSS--MPNLRQVEALMQAYSPWIYFHPDEIYFPSSVSWFFDNGALLYQKGNQ-NPTPI  294

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
                GSNLPQG +NDG YW++LP D+ +K ++ +GD+ S+++YL+IKPM G TFTD+ IWI
Sbjct  295   DSGGSNLPQGDSNDGTYWIDLPADDGQKNKIMKGDISSTKLYLHIKPMLGATFTDVVIWI  354

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+ AK+G +  + LG IGEH+GDWEHLTLRISNF G L ++YF+EHS G+WVDA
Sbjct  355   FYPFNGPAKAKVG-LFNVSLGKIGEHVGDWEHLTLRISNFTGELRRLYFAEHSSGTWVDA  413

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRYSV  484
               L+F  G NK V YSSL+GHA YSKPGLVLQG     IGIRNDTAK  ++ D+G  + V
Sbjct  414   SQLDF-QGGNKPVGYSSLHGHAMYSKPGLVLQGNSKLGIGIRNDTAKGNSI-DSGRSFEV  471

Query  483   VAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             VA       + EP W+ Y REWGPKI+Y    ++K+VE LLP ++R   E++I+ LP+E 
Sbjct  472   VAAEYMGSAVTEPAWLNYMREWGPKISYDISNELKKVEKLLPGKFRSRLESIINSLPDEV  531

Query  312   FGEEGPTGPNMKASWSGDE  256
               EEGPTGP  K SW  DE
Sbjct  532   LREEGPTGPKEKRSWGMDE  550



>gb|KHN49064.1| hypothetical protein glysoja_031275 [Glycine soja]
Length=581

 Score =   467 bits (1202),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 239/437 (55%), Positives = 301/437 (69%), Gaps = 15/437 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVW+S SL I Q GP YVWLP  PQGY AVG+VVTT+  KPS D+IRC     TD CE
Sbjct  156   YTLVWNSASLKIDQDGPIYVWLPTAPQGYKAVGYVVTTTPTKPSLDKIRCARLDLTDQCE  215

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF-SGNVGTFACLKNNNV  1195
                ++WG        + FN Y  RP NRGTQA GV+VGTF+    S N  +  CL+N N 
Sbjct  216   ANSFIWGS-------DNFNFYDFRPSNRGTQAPGVRVGTFVAQNGSPNPPSIVCLRNTNA  268

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
                   MPNL QI+A+ + YSP++ LHP + + PSSV WFFSNGALLY KG E+ PV I 
Sbjct  269   I--PKYMPNLPQIKAILQVYSPVMSLHPDEEFFPSSVEWFFSNGALLYKKGQESKPVSIS  326

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             P+G+NLPQ    DG YWV+LP D+  KERVK+GDL+S+  Y+++KPM GGTFTDIA+W+F
Sbjct  327   PNGANLPQDPNIDGAYWVDLPADSTNKERVKKGDLKSAISYVHVKPMLGGTFTDIAMWVF  386

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+ +   + LG IGEH+GDWEH+TLR+SNFNG L  VYFS+HS G+W D+ 
Sbjct  387   YPFNGPARAKV-EFLTVNLGKIGEHVGDWEHVTLRVSNFNGELKHVYFSQHSKGAWFDSS  445

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
              LEF +G NK + YSSL+GHA+Y   GL L G   IGIRNDTA S  V+D G    V A 
Sbjct  446   QLEFQSG-NKPLYYSSLHGHASYPHGGLNLLGEDKIGIRNDTAISDNVMDLGAFQLVSAE  504

Query  474   LQG--IVE-PPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
               G  +VE PPW+ Y REWGPKI Y   ++++++E  LP + +   E ++  LP+E  GE
Sbjct  505   YLGSDVVEPPPWLNYFREWGPKIDYNVNDELRKLEKFLPGKLKSTLENIVKNLPSEVLGE  564

Query  303   EGPTGPNMKASWSGDEK  253
             EGPTGP +K +WSGDE+
Sbjct  565   EGPTGPKVKDNWSGDER  581



>ref|XP_003545952.1| PREDICTED: uncharacterized protein LOC100820073 [Glycine max]
Length=581

 Score =   466 bits (1200),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 239/437 (55%), Positives = 301/437 (69%), Gaps = 15/437 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVW+S SL I Q GP YVWLP  PQGY AVG+VVTT+  KPS D+IRC     TD CE
Sbjct  156   YTLVWNSASLKIDQDGPIYVWLPTAPQGYKAVGYVVTTTPTKPSLDKIRCARLDLTDQCE  215

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF-SGNVGTFACLKNNNV  1195
                ++WG        + FN Y +RP NRGTQA GV+VGTF+    S N  +  CL+N N 
Sbjct  216   ANSFIWGS-------DNFNFYDVRPSNRGTQAPGVRVGTFVAQNGSPNPPSIVCLRNTNA  268

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
                   MPNL QI+A+ + YSP++ LHP + + PSSV WFFSNGALLY KG E+ PV I 
Sbjct  269   I--PKYMPNLPQIKAILQVYSPVMSLHPDEEFFPSSVEWFFSNGALLYKKGQESKPVSIS  326

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             P+G+NLPQ    DG YWV+LP D+  KERVK+GDL+S+  Y+++KPM GGTFTDIA+W+F
Sbjct  327   PNGANLPQDPNIDGAYWVDLPADSTNKERVKKGDLKSAISYVHVKPMLGGTFTDIAMWVF  386

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+ +   + LG IGEH+GDWEH+TLR+SNFNG L  VYFS+HS G W D+ 
Sbjct  387   YPFNGPARAKV-EFLTVNLGKIGEHVGDWEHVTLRVSNFNGELKHVYFSQHSKGVWFDSS  445

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
              LEF +G NK + YSSL+GHA+Y   GL L G   IGIRNDTA S  V+D G    V A 
Sbjct  446   QLEFQSG-NKPLYYSSLHGHASYPHGGLNLLGEDKIGIRNDTAISDNVMDLGAFQLVSAE  504

Query  474   LQG--IVE-PPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
               G  +VE PPW+ Y REWGPKI Y   ++++++E  LP + +   E ++  LP+E  GE
Sbjct  505   YLGSDVVEPPPWLNYFREWGPKIDYNVNDELRKLEKFLPGKLKSTLENIVKNLPSEVLGE  564

Query  303   EGPTGPNMKASWSGDEK  253
             EGPTGP +K +WSGDE+
Sbjct  565   EGPTGPKVKDNWSGDER  581



>ref|XP_009354799.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103945924 
[Pyrus x bretschneideri]
Length=589

 Score =   466 bits (1200),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 239/442 (54%), Positives = 304/442 (69%), Gaps = 13/442 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             +TL+WSS+ L I + G  YVWLP    GY A+G VVT+S EKPS D+IRCV S+ TD CE
Sbjct  152   FTLIWSSEFLNIKKDGNGYVWLPTASDGYKAIGLVVTSSPEKPSLDKIRCVRSSLTDECE  211

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF-SGNVGTFACLKNNNV  1195
              + W+WG GT++ D NGFN++ +RP NRGT A GV  GTF+ +  +G + T ACLKN   
Sbjct  212   ADLWIWGPGTAS-DANGFNVFRVRPSNRGTSAMGVFAGTFIAAQQNGGLSTVACLKN--T  268

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
             A  S+ MPNL+QIEAL   YSP +Y HP + Y PS    FF+NGA LY K ++   + I 
Sbjct  269   AICSTTMPNLTQIEALLEAYSPFIYFHPDEVYLPSVNVCFFTNGAFLYKKDNDLKSIAIE  328

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
               GSNLPQGG+ND  YW++LPVD +  ERVK+GDL SS VY +IKPM G TFT+IAIW+F
Sbjct  329   ATGSNLPQGGSNDDSYWLDLPVDKSAYERVKKGDLPSSXVYAHIKPMLGSTFTNIAIWVF  388

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             Y FN P+ AK+ +   I LG IGEH+ +WEH+ L++ NF   L KVYF +H+GG WVDA 
Sbjct  389   YSFNDPARAKV-EFLNISLGKIGEHVSNWEHVNLQVINFIWELWKVYFLQHNGGIWVDAS  447

Query  654   NLEFIN-GSNKS---VAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
              LEF N G NK+   V Y+SL+GHA Y+KPGLVLQ    +GIRND AK+  VLDTG    
Sbjct  448   ELEFQNSGGNKAVRPVTYASLHGHAFYAKPGLVLQCTEGLGIRNDAAKTKMVLDTGQSQP  507

Query  486   VVAGLQ----GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
             ++  +      I EPPW+ YCREWGPK++Y   +++K+VE LLP + +  FE  +  LPN
Sbjct  508   IILAVDYSGFAISEPPWLNYCREWGPKLSYHITDELKKVEKLLPGKLKSAFEKFVKSLPN  567

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E  GEEGPTGP MK +W GDEK
Sbjct  568   EVLGEEGPTGPKMKNNWIGDEK  589



>gb|ABN08110.1| Protein of unknown function DUF946, plant [Medicago truncatula]
Length=556

 Score =   465 bits (1196),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 235/439 (54%), Positives = 296/439 (67%), Gaps = 17/439 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV ++ S   TQ    Y+WLP+ P GY A+GHVVTT+ +KPS D+I CV S  TD CE
Sbjct  127   YTLVSNTASFKATQDSTLYIWLPIAPNGYKALGHVVTTTQDKPSLDKIMCVRSDLTDQCE  186

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
                W+WG        N FN Y +RPINRGTQA GV+VGTF     GN    + +CLKN N
Sbjct  187   SSSWIWGS-------NNFNFYNVRPINRGTQAPGVRVGTFFAQNGGNTNPPSISCLKNLN  239

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
                 S  MPN  QIEA+ + YSP LYLH  + Y PSSVNWFFSNGALLY KG+E+NPV I
Sbjct  240   SI--SQIMPNKKQIEAMLQVYSPFLYLHSDEEYLPSSVNWFFSNGALLYKKGEESNPVPI  297

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
               +G+NLPQ    DG YW++LP D   KERVK+G+LQS+E Y+++KPM+GGTFTDIA+W+
Sbjct  298   AQNGTNLPQDPNTDGAYWIDLPADAANKERVKKGNLQSAESYVHVKPMYGGTFTDIAMWV  357

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP  AK+ +   + LG IGEH+GDWEH+TLR+SN +G L  VYFS+H+ GSW+D+
Sbjct  358   FYPFNGPGRAKV-EFLNVKLGKIGEHVGDWEHVTLRVSNLDGQLWHVYFSQHNLGSWIDS  416

Query  657   PNLEFING---SNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
               LEF +G   + + V Y+SL+GHA+Y   GLVL G   IG R+DT K   V+D G    
Sbjct  417   SQLEFQDGIGATKRPVVYASLHGHASYPHAGLVLLGKNGIGARDDTNKGKNVMDMGKFVL  476

Query  486   VVAGLQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             V A   G  + EP W+ Y REWGP + Y  ++++K VE LLP + +  FE +I  LP E 
Sbjct  477   VSAEYLGSEVKEPAWLNYFREWGPHVDYSLDDELKNVEKLLPGKLKNGFEDIIRSLPKEA  536

Query  312   FGEEGPTGPNMKASWSGDE  256
              GE GPTGP  K +WSGDE
Sbjct  537   LGEAGPTGPKQKNNWSGDE  555



>ref|XP_003595840.1| hypothetical protein MTR_2g062410 [Medicago truncatula]
 gb|AES66091.1| DUF946 family protein [Medicago truncatula]
Length=586

 Score =   465 bits (1196),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 235/439 (54%), Positives = 296/439 (67%), Gaps = 17/439 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV ++ S   TQ    Y+WLP+ P GY A+GHVVTT+ +KPS D+I CV S  TD CE
Sbjct  157   YTLVSNTASFKATQDSTLYIWLPIAPNGYKALGHVVTTTQDKPSLDKIMCVRSDLTDQCE  216

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
                W+WG        N FN Y +RPINRGTQA GV+VGTF     GN    + +CLKN N
Sbjct  217   SSSWIWGS-------NNFNFYNVRPINRGTQAPGVRVGTFFAQNGGNTNPPSISCLKNLN  269

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
                 S  MPN  QIEA+ + YSP LYLH  + Y PSSVNWFFSNGALLY KG+E+NPV I
Sbjct  270   SI--SQIMPNKKQIEAMLQVYSPFLYLHSDEEYLPSSVNWFFSNGALLYKKGEESNPVPI  327

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
               +G+NLPQ    DG YW++LP D   KERVK+G+LQS+E Y+++KPM+GGTFTDIA+W+
Sbjct  328   AQNGTNLPQDPNTDGAYWIDLPADAANKERVKKGNLQSAESYVHVKPMYGGTFTDIAMWV  387

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP  AK+ +   + LG IGEH+GDWEH+TLR+SN +G L  VYFS+H+ GSW+D+
Sbjct  388   FYPFNGPGRAKV-EFLNVKLGKIGEHVGDWEHVTLRVSNLDGQLWHVYFSQHNLGSWIDS  446

Query  657   PNLEFING---SNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
               LEF +G   + + V Y+SL+GHA+Y   GLVL G   IG R+DT K   V+D G    
Sbjct  447   SQLEFQDGIGATKRPVVYASLHGHASYPHAGLVLLGKNGIGARDDTNKGKNVMDMGKFVL  506

Query  486   VVAGLQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             V A   G  + EP W+ Y REWGP + Y  ++++K VE LLP + +  FE +I  LP E 
Sbjct  507   VSAEYLGSEVKEPAWLNYFREWGPHVDYSLDDELKNVEKLLPGKLKNGFEDIIRSLPKEA  566

Query  312   FGEEGPTGPNMKASWSGDE  256
              GE GPTGP  K +WSGDE
Sbjct  567   LGEAGPTGPKQKNNWSGDE  585



>gb|AES66087.2| DUF946 family protein [Medicago truncatula]
Length=590

 Score =   463 bits (1191),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 231/444 (52%), Positives = 304/444 (68%), Gaps = 23/444 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV ++ S+ + Q  P Y+WLP+ P GY AVGHVVTT+ +KPS D++ CV +  T+ CE
Sbjct  157   YTLVSNTASVMVDQDSPLYIWLPIAPDGYHAVGHVVTTTQDKPSPDKVMCVRADLTEQCE  216

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
                W+WG        N  N Y +RPINRG++A GV+VGTF+    GN    + +CLKN N
Sbjct  217   SSTWIWGS-------NDLNFYDVRPINRGSKAPGVRVGTFVAQNGGNTNPPSISCLKNLN  269

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
                 S  MPN +QIE L   YSP LYLHP + Y PSSVNWFFSNGALLY KG+E+NPV I
Sbjct  270   SI--SQIMPNQTQIETLLHSYSPFLYLHPDEEYLPSSVNWFFSNGALLYKKGEESNPVPI  327

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
               +G+NLPQ   NDG YW++LPVD+  KERVK+G+LQS+E Y+++KPM+GGTFTDIA+W+
Sbjct  328   EQNGTNLPQDPNNDGAYWLDLPVDDANKERVKQGNLQSAESYVHVKPMYGGTFTDIAMWV  387

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+ AK+  I  + LG +GEH+GDWEH+TLR+SN +G L  VYFS+H+GGSWVDA
Sbjct  388   FYPFNGPAKAKIKFI-NVKLGKVGEHVGDWEHVTLRVSNLDGQLWHVYFSQHNGGSWVDA  446

Query  657   PNLEFING-------SNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTG  499
               LEF          + + V Y+S +GHA+Y   GL L G   +G R+DT K + V+D G
Sbjct  447   SQLEFQMDNSSFDFPTQRPVVYASRHGHASYPHGGLHLLGKNGVGARDDTDKGSNVMDMG  506

Query  498   LRYSVVAG---LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
              +Y +V+       + EP W+ + REWGP + Y  ++++K VE LLP + + VFE +I  
Sbjct  507   -KYVLVSAEYLESEVKEPAWLNFFREWGPHVDYSLDDELKNVEKLLPGKLKDVFEKIIMG  565

Query  327   LPNEFFGEEGPTGPNMKASWSGDE  256
             LP E  GEEGPTGP  K +W+GDE
Sbjct  566   LPKELLGEEGPTGPKEKGNWNGDE  589



>ref|XP_003595836.1| Vacuolar protein sorting-associated protein [Medicago truncatula]
 gb|ABN08112.1| Protein of unknown function DUF946, plant [Medicago truncatula]
Length=621

 Score =   462 bits (1190),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 231/444 (52%), Positives = 304/444 (68%), Gaps = 23/444 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV ++ S+ + Q  P Y+WLP+ P GY AVGHVVTT+ +KPS D++ CV +  T+ CE
Sbjct  188   YTLVSNTASVMVDQDSPLYIWLPIAPDGYHAVGHVVTTTQDKPSPDKVMCVRADLTEQCE  247

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
                W+WG        N  N Y +RPINRG++A GV+VGTF+    GN    + +CLKN N
Sbjct  248   SSTWIWGS-------NDLNFYDVRPINRGSKAPGVRVGTFVAQNGGNTNPPSISCLKNLN  300

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
                 S  MPN +QIE L   YSP LYLHP + Y PSSVNWFFSNGALLY KG+E+NPV I
Sbjct  301   SI--SQIMPNQTQIETLLHSYSPFLYLHPDEEYLPSSVNWFFSNGALLYKKGEESNPVPI  358

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
               +G+NLPQ   NDG YW++LPVD+  KERVK+G+LQS+E Y+++KPM+GGTFTDIA+W+
Sbjct  359   EQNGTNLPQDPNNDGAYWLDLPVDDANKERVKQGNLQSAESYVHVKPMYGGTFTDIAMWV  418

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+ AK+  I  + LG +GEH+GDWEH+TLR+SN +G L  VYFS+H+GGSWVDA
Sbjct  419   FYPFNGPAKAKIKFI-NVKLGKVGEHVGDWEHVTLRVSNLDGQLWHVYFSQHNGGSWVDA  477

Query  657   PNLEFING-------SNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTG  499
               LEF          + + V Y+S +GHA+Y   GL L G   +G R+DT K + V+D G
Sbjct  478   SQLEFQMDNSSFDFPTQRPVVYASRHGHASYPHGGLHLLGKNGVGARDDTDKGSNVMDMG  537

Query  498   LRYSVVAG---LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
              +Y +V+       + EP W+ + REWGP + Y  ++++K VE LLP + + VFE +I  
Sbjct  538   -KYVLVSAEYLESEVKEPAWLNFFREWGPHVDYSLDDELKNVEKLLPGKLKDVFEKIIMG  596

Query  327   LPNEFFGEEGPTGPNMKASWSGDE  256
             LP E  GEEGPTGP  K +W+GDE
Sbjct  597   LPKELLGEEGPTGPKEKGNWNGDE  620



>ref|XP_010934618.1| PREDICTED: uncharacterized protein LOC105054732 [Elaeis guineensis]
Length=548

 Score =   459 bits (1182),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 248/440 (56%), Positives = 311/440 (71%), Gaps = 19/440 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+S  + + G  Y WLP PP+GY A+G +VT+S +KPS DR+RCV +  TD CE
Sbjct  121   YTLVWSSESSNLKRDGNGYFWLPTPPEGYKALGLLVTSSSKKPSLDRVRCVRADLTDQCE  180

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT--FACLKNNN  1198
              +  +W       D +G +++ LRP  RG QA GV VGTFLG  +G+  +   ACLKN  
Sbjct  181   NDASIW-------DKDGLSVHGLRPATRGVQALGVWVGTFLGQANGSPSSSDIACLKNKA  233

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
              +F+S  MPNLSQI+A+ + YSP++  HP + Y PSSV+W+F +GALLY KG+  NP  I
Sbjct  234   SSFTS--MPNLSQIQAIMQAYSPVICFHPDEKYLPSSVSWYFDSGALLYAKGNP-NPTPI  290

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
               DGSNLPQG +NDG YW++LPVD  +KE+VK+GD+ +S+VYL++KPM G TFTDIAIWI
Sbjct  291   TSDGSNLPQGCSNDGGYWIDLPVDEGKKEKVKKGDIPTSKVYLHVKPMLGATFTDIAIWI  350

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+ AK+G I R  LG IG H+GDWEH+TLR+SNFNG L +VY SEHS G+WVDA
Sbjct  351   FYPFNGPAKAKVGLINR-SLGRIGGHVGDWEHVTLRVSNFNGELWRVYLSEHSSGTWVDA  409

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRYSV  484
               LEF  G NK VAYSSL+GHANYSKPGLVLQG     +GIRNDTA+    +DTG R+ V
Sbjct  410   SQLEF-QGGNKPVAYSSLHGHANYSKPGLVLQGNSKLGVGIRNDTARGKNSIDTGERFEV  468

Query  483   VAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
              A       IVEPPW+ Y REWGPKITY   + I +V   LP   +   + ++  LP+E 
Sbjct  469   AAAEYLGSAIVEPPWLNYEREWGPKITYDIGKAIDKVVKRLPGGLKTALKKVVESLPDEV  528

Query  312   FGEEGPTGPNMKASWSGDEK  253
              GEEGPTGP MK  WS DE+
Sbjct  529   LGEEGPTGPKMKREWSMDER  548



>emb|CDY00059.1| BnaC09g02420D [Brassica napus]
Length=570

 Score =   454 bits (1168),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 238/441 (54%), Positives = 304/441 (69%), Gaps = 18/441 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKP--SGDRIRCVFSAFTDP  1378
             Y  V ++ SL I Q GPAYVW PV   GY AVG  +TTS EKP  +     CV S FT+ 
Sbjct  138   YFEVGNTTSLDIKQDGPAYVWQPVCLNGYQAVGMFITTSPEKPLPTQQYTSCVRSEFTEA  197

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-----FAC  1213
              E +  +W         NG +++ LRPI RGTQA GV  GTF  SF G + +        
Sbjct  198   SEADALLWAI-------NGVSVFKLRPIIRGTQATGVYTGTF--SFQGLISSTPLPPLFS  248

Query  1212  LKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET  1033
             LKN  +   S  MP+ +Q   LF+ YSP++Y HP + + PSSV+WFF+NGALLY KG+E+
Sbjct  249   LKNTKLDMYS-CMPSEAQTRVLFQTYSPLIYFHPDEDFLPSSVDWFFTNGALLYQKGNES  307

Query  1032  NPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
             NPV I P+G+NLPQGG+ND ++W++ PVD  +KE VKRGDL S++VYL+IKPMFGGTFTD
Sbjct  308   NPVPIQPNGTNLPQGGSNDDLFWLDYPVDKTQKEMVKRGDLSSTKVYLHIKPMFGGTFTD  367

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             I +WIF PFNG +  K   I+R+ LG IGEHIGDWEH+TLRISNFNG+L +VYFS+HSGG
Sbjct  368   IVVWIFCPFNGNANLKFLFIKRLSLGDIGEHIGDWEHVTLRISNFNGMLWRVYFSQHSGG  427

Query  672   SWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG-IGDIGIRNDTAKSAAVLDTGL  496
             + V+A +LE+++G NK V YSSL+GHA + KPGLVL G  G+ GIRND AKS  VLD G 
Sbjct  428   ALVEACDLEYVDGGNKPVIYSSLHGHAMFPKPGLVLLGNDGNNGIRNDMAKSDKVLDCGS  487

Query  495   RYSVVAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
              Y V++GL G+VEPPW+ Y R+WGP++ Y  ++ ++    +LP   R  F  LI  +P E
Sbjct  488   GYEVISGLSGVVEPPWINYFRKWGPQVRYNIDKSLEGFAKILPWFIRKSFYKLISKIPVE  547

Query  315   FFGEEGPTGPNMKASWSGDEK  253
               GEEGPTGP  K SW+GDEK
Sbjct  548   ILGEEGPTGPKDKLSWTGDEK  568



>ref|XP_006858981.1| hypothetical protein AMTR_s00068p00125530 [Amborella trichopoda]
 gb|ERN20448.1| hypothetical protein AMTR_s00068p00125530 [Amborella trichopoda]
Length=537

 Score =   451 bits (1159),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 224/430 (52%), Positives = 298/430 (69%), Gaps = 26/430 (6%)
 Frame = -2

Query  1518  ITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCEVEDWVWG-RGT  1342
             +  +  AY W PVPP+GY A+GH+VT + +KPS D +          CE +  VW  R  
Sbjct  124   VQDNNSAYFWRPVPPEGYKAIGHLVTNTADKPSTDNV----------CETDSLVWSTRKA  173

Query  1341  SNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFS----GNVGTFACLKNNNVAFSSSAM  1174
             +NN  NG ++Y+LRP  RG+ A G+ VGTF+ + +     +V + ACLKN      S  M
Sbjct  174   ANN--NGLSVYSLRPKERGSNALGICVGTFVATVASTPDADVASLACLKNKGYVLDS--M  229

Query  1173  PNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIGPDGSNLP  994
             PN +QIE+L + YSP ++ HP + Y PSSV W F+NGALLY KGD  NP++I P+GSNLP
Sbjct  230   PNHAQIESLLKAYSPFMFFHPDEMYLPSSVPWLFTNGALLYKKGDP-NPIQIDPNGSNLP  288

Query  993   QGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIFYPFNGPS  814
             Q G+NDG YW++LP +N+  ++VKRGDL S+E YL++KPM G TFTDIAIW+ YPFNGP 
Sbjct  289   QDGSNDGSYWIDLPTNNDAADKVKRGDLGSAESYLHVKPMLGATFTDIAIWVVYPFNGPV  348

Query  813   TAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAPNLEFING  634
               K+ Q+  +PLG IGEH+G WEHLTLRISNF G L +VY++EHSGG W++A  LEF  G
Sbjct  349   KLKV-QLINVPLGKIGEHVGYWEHLTLRISNFTGELWRVYYAEHSGGQWMNASELEFQQG  407

Query  633   SNKSVAYSSLNGHANYSKPGLVLQGIG--DIGIRNDTAKSAAVLDTGLRYSVVAG--LQG  466
              NK+  YSSL+GHA+YSK GLVLQG    DIGIRND+AKS  V+DTG +++++A   L  
Sbjct  408   -NKATVYSSLHGHASYSKAGLVLQGNTKLDIGIRNDSAKSKFVMDTGAKFTIIAAEYLDS  466

Query  465   IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEEGPTGP  286
             I +PPW+ Y REWGPK+++ +  ++K+VE  L  + R   E ++  LP E  GEEGPTGP
Sbjct  467   IAQPPWLNYTREWGPKVSFDTTNELKKVEKFLLKKLRNAVEDIVRSLPKEVLGEEGPTGP  526

Query  285   NMKASWSGDE  256
              MK +W+ DE
Sbjct  527   KMKNNWTTDE  536



>emb|CDY19950.1| BnaA09g03010D [Brassica napus]
Length=570

 Score =   450 bits (1158),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 235/442 (53%), Positives = 304/442 (69%), Gaps = 19/442 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKP---SGDRIRCVFSAFTD  1381
             Y  V ++ SL I Q GPAYVW PV   GY AVG  VTTS EKP   +     CV S FT+
Sbjct  138   YLEVGNTASLNIKQDGPAYVWQPVCHNGYQAVGMFVTTSPEKPLPLTQQYTSCVRSEFTE  197

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-----FA  1216
               E +  +WG        NG +++ LRP+ RGTQA GV  GTF  SF G   +       
Sbjct  198   ASEADGLLWGI-------NGVSVFKLRPVIRGTQATGVYTGTF--SFQGLSSSTPLPPLF  248

Query  1215  CLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDE  1036
              L+N  +   S  MP+ +Q   LF+ YSP++Y HP + + PSSV+WFF+NGALLY KG+E
Sbjct  249   SLRNTKLDMYS-CMPSEAQTRVLFQTYSPLIYFHPDEDFLPSSVDWFFTNGALLYQKGNE  307

Query  1035  TNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
             +NPV I P+G+NLPQGG++D ++W++ PVD  +KE VKRGDL S++VYL+IKPMFGGTFT
Sbjct  308   SNPVPIQPNGTNLPQGGSDDDLFWLDYPVDKTQKEMVKRGDLSSTKVYLHIKPMFGGTFT  367

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             DI +W+F PFNG +  K   I+R+ LG IGEHIGDWEH+TLRISNFNG+L +VYFS+HSG
Sbjct  368   DIVVWVFCPFNGNANLKFLFIKRLSLGDIGEHIGDWEHVTLRISNFNGMLWRVYFSQHSG  427

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG-IGDIGIRNDTAKSAAVLDTG  499
             G+ ++A +LE+++G NK V YSSL+GHA YSKPGLVL G  G+ GIRND  +S  VLD G
Sbjct  428   GALMEACDLEYVDGGNKPVIYSSLHGHAMYSKPGLVLLGNDGNNGIRNDMDRSDKVLDCG  487

Query  498   LRYSVVAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
               Y V++GL G+VEPPW+ Y R+WGP++ Y  ++ ++    +LP   R  F  LI  +P 
Sbjct  488   SGYEVISGLSGVVEPPWINYLRKWGPQVQYNIDKSLEGFAKILPWFIRKSFYKLISKIPV  547

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E  GEEGPTGP  K SW+GDEK
Sbjct  548   EILGEEGPTGPKEKLSWTGDEK  569



>ref|XP_009111945.1| PREDICTED: uncharacterized protein LOC103837336 [Brassica rapa]
Length=570

 Score =   449 bits (1156),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 234/442 (53%), Positives = 304/442 (69%), Gaps = 19/442 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKP---SGDRIRCVFSAFTD  1381
             Y  V ++ SL I Q GPAYVW PV   GY AVG  VTTS EKP   +     CV S FT+
Sbjct  138   YLEVGNTASLNIKQDGPAYVWQPVCHNGYQAVGMFVTTSPEKPLPLTQQYTSCVRSEFTE  197

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-----FA  1216
               E +  +WG        NG +++ LRP+ RGTQA GV  GTF  SF G   +       
Sbjct  198   ASEADGLLWGI-------NGVSVFKLRPVIRGTQATGVYTGTF--SFQGLSSSTPLPPLF  248

Query  1215  CLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDE  1036
              L+N  +   S  MP+ +Q   LF+ YSP++Y HP + + PS+V+WFF+NGALLY KG+E
Sbjct  249   SLRNTKLDMYS-CMPSEAQTRVLFQTYSPLIYFHPDEDFLPSAVDWFFTNGALLYQKGNE  307

Query  1035  TNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
             +NPV I P+G+NLPQGG++D ++W++ PVD  +KE VKRGDL S++VYL+IKPMFGGTFT
Sbjct  308   SNPVPIQPNGTNLPQGGSDDDLFWLDYPVDKTQKEMVKRGDLSSTKVYLHIKPMFGGTFT  367

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             DI +W+F PFNG +  K   I+R+ LG IGEHIGDWEH+TLRISNFNG+L +VYFS+HSG
Sbjct  368   DIVVWVFCPFNGNANLKFLFIKRLSLGDIGEHIGDWEHVTLRISNFNGMLWRVYFSQHSG  427

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG-IGDIGIRNDTAKSAAVLDTG  499
             G+ ++A +LE+++G NK V YSSL+GHA YSKPGLVL G  G+ GIRND  +S  VLD G
Sbjct  428   GALMEACDLEYVDGGNKPVIYSSLHGHAMYSKPGLVLLGNDGNNGIRNDMDRSDKVLDCG  487

Query  498   LRYSVVAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
               Y V++GL G+VEPPW+ Y R+WGP++ Y  ++ ++    +LP   R  F  LI  +P 
Sbjct  488   SGYEVISGLSGVVEPPWINYLRKWGPQVQYNIDKSLEGFAKILPWFIRKSFYKLISKIPV  547

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E  GEEGPTGP  K SW+GDEK
Sbjct  548   EILGEEGPTGPKEKLSWTGDEK  569



>emb|CDX86305.1| BnaA06g30220D [Brassica napus]
Length=544

 Score =   448 bits (1152),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 230/440 (52%), Positives = 300/440 (68%), Gaps = 17/440 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDR--IRCVFSAFTDP  1378
             Y  VW++ SL I Q G AY W PV   GY  VG +VTTS +KP   +  I CV S  T+ 
Sbjct  113   YIEVWNTASLDIKQDGHAYFWQPVCLNGYKPVGVIVTTSSQKPPMKKKSISCVRSELTEQ  172

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF----SGNVGTFACL  1210
              E +  VWG         G ++  LRP+ RGTQA GV  GTF  SF    S  +    CL
Sbjct  173   SEADTLVWGF-------KGVSVVNLRPVQRGTQATGVYTGTF--SFQQLNSSPLPYLFCL  223

Query  1209  KNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETN  1030
             KN  +  SS+ MP+ +Q  ALF+ YSP++Y HP + + PSSV+WFF+NGALLY KG+E+N
Sbjct  224   KNTILNMSSN-MPSKAQTRALFKTYSPLIYFHPKEIFLPSSVHWFFANGALLYKKGNESN  282

Query  1029  PVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDI  850
             P+ I P+G+NLPQGG+ND ++W++ P+D   KE+V+RGDL++++VYLNIKPMFGGTFTDI
Sbjct  283   PIPIQPNGTNLPQGGSNDDLFWLDFPLDKTAKEKVQRGDLRNTKVYLNIKPMFGGTFTDI  342

Query  849   AIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGS  670
             A+WIF PFNG +  K   I+ + LG IGEH+GDWEH+TLRISNFNG L +VYFS+HSGG+
Sbjct  343   AVWIFCPFNGNAHLKFLFIKSLSLGQIGEHVGDWEHVTLRISNFNGKLWRVYFSQHSGGT  402

Query  669   WVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRY  490
              VDA +LE++ G NK V YSSL+GHA +SKPGLVLQG    GIRND A+S   LD G  Y
Sbjct  403   LVDACDLEYVEGGNKPVIYSSLHGHAMFSKPGLVLQGKRKYGIRNDMARSDKWLDCGKGY  462

Query  489   SVVAGLQGIVEPPWVKYCREWGPKITYISEEDIKR-VESLLPVEWRGVFETLIHLLPNEF  313
              V+ G  G+VEP W  Y R+WGP++ Y  ++ IK   + +LP+  R     +I  +P E 
Sbjct  463   EVIGGPWGVVEPAWTSYFRKWGPRVGYKIDKSIKSFAKKILPMFVRKRLRNIIRKIPYEI  522

Query  312   FGEEGPTGPNMKASWSGDEK  253
              GE+GPTGP  K +W+GD+K
Sbjct  523   IGEDGPTGPKAKLTWTGDDK  542



>gb|KHN21340.1| hypothetical protein glysoja_026541 [Glycine soja]
Length=557

 Score =   447 bits (1150),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 229/437 (52%), Positives = 297/437 (68%), Gaps = 17/437 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVW+S SL I Q GP YVWLP+ P GY AVGHVVTT+  KPS ++I CV    TD CE
Sbjct  134   YTLVWNSASLEIDQDGPIYVWLPIAPNGYKAVGHVVTTTPTKPSLEKIMCVRLDLTDQCE  193

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLG-SFSGNVGTFACLKNNNV  1195
                ++W       D + FN   +RP NRG QA GV+VGTF+  + S N  + ACL+N N 
Sbjct  194   TNSFIW-------DSDNFNFLDVRPSNRGIQAPGVRVGTFVAQNASLNSPSIACLRNTNA  246

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
                   MPNL QI+A+ + YSP++ LHP + + PSSV WFFSNGALLY KG E++PV I 
Sbjct  247   I--PKYMPNLPQIKAILQVYSPVMSLHPDEEFFPSSVEWFFSNGALLYKKGQESSPVPIS  304

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             P+G+NLPQ   +DG YWV+LP D+  K+RVK+GDL+S+  Y+++KPM GGTFTDI++W+F
Sbjct  305   PNGANLPQDPNDDGAYWVDLPADSTNKDRVKKGDLKSAISYVHVKPMLGGTFTDISMWVF  364

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNG + A +     I LG IGEH+GDWEH+TLR+SNFNG L  VYFS+H  G+W D+ 
Sbjct  365   YPFNGAARA-IVDFLTIDLGKIGEHVGDWEHVTLRVSNFNGELKHVYFSQHRKGAWFDSS  423

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
              LEF +G NK + YSSL+ HA+Y  P         IGIRNDTA S +V+D G    V A 
Sbjct  424   QLEFQSG-NKPLYYSSLHAHASY--PHAARNITDKIGIRNDTAMSDSVMDLGAFQLVSAE  480

Query  474   --LQGIVE-PPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
               +  +VE PPW+ Y REWGPKI Y  +E++K++E  LP + +   E ++  LP+E   +
Sbjct  481   YLVSDVVEPPPWLNYFREWGPKIYYNVDEELKKLEKFLPGKLKSTLENIVKNLPSEVLRQ  540

Query  303   EGPTGPNMKASWSGDEK  253
             EGPTGP +K SWSGDE+
Sbjct  541   EGPTGPKVKDSWSGDER  557



>ref|XP_006585380.1| PREDICTED: uncharacterized protein LOC100783773 [Glycine max]
Length=579

 Score =   448 bits (1152),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 229/437 (52%), Positives = 297/437 (68%), Gaps = 17/437 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVW+S SL I Q GP YVWLP+ P GY AVGHVVTT+  KPS ++I CV    TD CE
Sbjct  156   YTLVWNSASLEIDQDGPIYVWLPIAPNGYKAVGHVVTTTPTKPSLEKIMCVRLDLTDQCE  215

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLG-SFSGNVGTFACLKNNNV  1195
                ++W       D + FN   +RP NRG QA GV+VGTF+  + S N  + ACL+N N 
Sbjct  216   TNSFIW-------DSDNFNFLDVRPSNRGIQAPGVRVGTFVAQNASLNSPSIACLRNTNA  268

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
                   MPNL QI+A+ + YSP++YLHP + + PSSV WFFSNGALLY KG E++PV I 
Sbjct  269   I--PKYMPNLPQIKAILQVYSPVMYLHPDEEFFPSSVEWFFSNGALLYKKGQESSPVPIS  326

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
             P+G+NLPQ   +DG YWV+LP D+  K+RVK+GDL+S+  Y+++KPM GGTFTDI++W+F
Sbjct  327   PNGANLPQDPNDDGAYWVDLPADSTNKDRVKKGDLKSAISYVHVKPMLGGTFTDISMWVF  386

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNG + A +     I LG IGEH+GDWEH+TLR+SNFNG L  VYF +H  G+W D+ 
Sbjct  387   YPFNGAARA-IVDFLTIDLGKIGEHVGDWEHVTLRVSNFNGELKHVYFLQHRKGAWFDSS  445

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAG  475
              LEF +G NK + YSSL+ HA+Y  P         IGIRNDTA S +V+D G    V A 
Sbjct  446   QLEFQSG-NKPLYYSSLHAHASY--PHAARNITDKIGIRNDTAMSDSVMDLGAFQLVSAE  502

Query  474   --LQGIVE-PPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
               +  +VE PPW+ Y REWGPKI Y  +E++K++E  LP + +   E ++  LP+E   +
Sbjct  503   YLVSDVVEPPPWLNYFREWGPKIYYNVDEELKKLEKFLPGKLKSTLENIVKNLPSEVLRQ  562

Query  303   EGPTGPNMKASWSGDEK  253
             EGPTGP +K SWSGDE+
Sbjct  563   EGPTGPKVKDSWSGDER  579



>ref|XP_006395185.1| hypothetical protein EUTSA_v10005422mg [Eutrema salsugineum]
 gb|ESQ32471.1| hypothetical protein EUTSA_v10005422mg [Eutrema salsugineum]
Length=569

 Score =   445 bits (1145),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 231/436 (53%), Positives = 293/436 (67%), Gaps = 14/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKP--SGDRIRCVFSAFTDP  1378
             Y    ++ SL I Q GP Y+W PV   GY AVG  +TTS +KP  + + I CV S FT+ 
Sbjct  142   YIEAGNTASLNIKQDGPVYLWQPVCLNGYQAVGLFITTSPQKPPLTQEHISCVRSEFTEQ  201

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF--SGNVGTFACLKN  1204
              E +  VWG           +++ LRPINRG QA GV  GTF      S  +    CLKN
Sbjct  202   SEADTLVWGIKE-------MSVFNLRPINRGIQATGVYTGTFSSQMQNSAPLPYLFCLKN  254

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
                 F  S+MP+ +Q   LF+ YSP +Y HP + + PSSV+WFFSNGALLY KG+E+NPV
Sbjct  255   --TKFDMSSMPSQNQTRVLFQTYSPKIYYHPEEDFLPSSVDWFFSNGALLYQKGNESNPV  312

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              + P+GSNLPQGG+ND ++W++ PVD + KE+VKRGDL +++VYL+IKPMFG TFTDI +
Sbjct  313   PVQPNGSNLPQGGSNDDLFWLDYPVDKSAKEKVKRGDLGNTKVYLHIKPMFGATFTDIVV  372

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNG +  K   I+R+ LG IGEHIGDWEH+TLRISNFNG L +VYFS+HS GS +
Sbjct  373   WIFCPFNGNARLKFLFIKRLSLGDIGEHIGDWEHITLRISNFNGELWRVYFSQHSKGSLM  432

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
             +A  LEF    NK V YSSL+GHA YSKPGL+LQG G  GIRND A+S  VLD GL Y V
Sbjct  433   EACELEFEGSENKPVIYSSLHGHAMYSKPGLMLQGNGKNGIRNDMARSDKVLDCGLGYEV  492

Query  483   VAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
             +AGL  +VEPPW  Y R+WGP + Y  ++ ++    +LP   R  F   I  +P E  GE
Sbjct  493   IAGLD-VVEPPWTNYLRKWGPHVRYDIDKSLQSFAKVLPGFIRKSFRKFIRKIPFEVLGE  551

Query  303   EGPTGPNMKASWSGDE  256
             +GPTGP +K +W+GDE
Sbjct  552   DGPTGPKVKGTWTGDE  567



>ref|XP_010030212.1| PREDICTED: uncharacterized protein LOC104420021 isoform X2 [Eucalyptus 
grandis]
 gb|KCW57154.1| hypothetical protein EUGRSUZ_I02787 [Eucalyptus grandis]
Length=724

 Score =   450 bits (1157),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 228/437 (52%), Positives = 293/437 (67%), Gaps = 14/437 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+L+WSS+S  I Q G  Y+W P+PP GY AVGHVVTTS  KPS D+IRCV S  TD CE
Sbjct  296   YSLIWSSNSSKIKQDGSGYIWSPIPPDGYKAVGHVVTTSPGKPSLDKIRCVRSDLTDQCE  355

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSG-NVGTFACLKNNNV  1195
              E  +WG    N +P   ++Y+ R  NR   A  V  GTF+      +    +CL+N N 
Sbjct  356   TETRIWGF---NGNP--LSVYSSRASNREVGALAVSAGTFIAQNGQPSSSPLSCLRNAN-  409

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
               + SAMPN SQIEAL + YSPI+Y HP + Y PSSV+WFF+NG LLYTKG E+NPV + 
Sbjct  410   -HNISAMPNQSQIEALIKAYSPIVYFHPDEAYLPSSVDWFFTNGGLLYTKGQESNPVPVE  468

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
               GSNLP GG+NDG YW++LP+D   K+RVK+G LQS++ Y+++KPM G TFTDIAIW+F
Sbjct  469   ATGSNLPLGGSNDGAYWLDLPLDGAAKDRVKKGYLQSAQAYVHVKPMLGATFTDIAIWLF  528

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNG + AK+  I  + LG IGEH+GDWEH+TLRISNF+G L  VYFSEH  G W    
Sbjct  529   YPFNGAAKAKVKFIN-LSLGRIGEHVGDWEHVTLRISNFDGQLWNVYFSEHGAGIWKGVS  587

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA-  478
              LEF N +NK V Y+SL+GHA + +PG  LQG   +G+RND  KS+  LDTG  YS++A 
Sbjct  588   ELEFQN-ANKFVVYASLHGHAAFFQPGTFLQGSDGVGMRNDVKKSSMFLDTGANYSIIAA  646

Query  477   ---GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                G   +   PW+ YCREWGP+  Y + +++++V   LP + +      I  LP E   
Sbjct  647   DHLGPSAVPVLPWLNYCREWGPRADYDAADEMQKVAKALPGKLKTALANAISGLPPEVLK  706

Query  306   EEGPTGPNMKASWSGDE  256
             +EGPTGP MK +W+GDE
Sbjct  707   QEGPTGPKMKPNWNGDE  723



>ref|XP_010030210.1| PREDICTED: uncharacterized protein LOC104420021 isoform X1 [Eucalyptus 
grandis]
Length=726

 Score =   450 bits (1157),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 228/437 (52%), Positives = 293/437 (67%), Gaps = 14/437 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+L+WSS+S  I Q G  Y+W P+PP GY AVGHVVTTS  KPS D+IRCV S  TD CE
Sbjct  298   YSLIWSSNSSKIKQDGSGYIWSPIPPDGYKAVGHVVTTSPGKPSLDKIRCVRSDLTDQCE  357

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSG-NVGTFACLKNNNV  1195
              E  +WG    N +P   ++Y+ R  NR   A  V  GTF+      +    +CL+N N 
Sbjct  358   TETRIWGF---NGNP--LSVYSSRASNREVGALAVSAGTFIAQNGQPSSSPLSCLRNAN-  411

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
               + SAMPN SQIEAL + YSPI+Y HP + Y PSSV+WFF+NG LLYTKG E+NPV + 
Sbjct  412   -HNISAMPNQSQIEALIKAYSPIVYFHPDEAYLPSSVDWFFTNGGLLYTKGQESNPVPVE  470

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
               GSNLP GG+NDG YW++LP+D   K+RVK+G LQS++ Y+++KPM G TFTDIAIW+F
Sbjct  471   ATGSNLPLGGSNDGAYWLDLPLDGAAKDRVKKGYLQSAQAYVHVKPMLGATFTDIAIWLF  530

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNG + AK+  I  + LG IGEH+GDWEH+TLRISNF+G L  VYFSEH  G W    
Sbjct  531   YPFNGAAKAKVKFIN-LSLGRIGEHVGDWEHVTLRISNFDGQLWNVYFSEHGAGIWKGVS  589

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVA-  478
              LEF N +NK V Y+SL+GHA + +PG  LQG   +G+RND  KS+  LDTG  YS++A 
Sbjct  590   ELEFQN-ANKFVVYASLHGHAAFFQPGTFLQGSDGVGMRNDVKKSSMFLDTGANYSIIAA  648

Query  477   ---GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
                G   +   PW+ YCREWGP+  Y + +++++V   LP + +      I  LP E   
Sbjct  649   DHLGPSAVPVLPWLNYCREWGPRADYDAADEMQKVAKALPGKLKTALANAISGLPPEVLK  708

Query  306   EEGPTGPNMKASWSGDE  256
             +EGPTGP MK +W+GDE
Sbjct  709   QEGPTGPKMKPNWNGDE  725



>ref|XP_010236503.1| PREDICTED: uncharacterized protein LOC104584083 [Brachypodium 
distachyon]
Length=553

 Score =   443 bits (1140),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 293/441 (66%), Gaps = 26/441 (6%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS      Q    + WLP PP GY AVG  VT + +KP  D + CV + FT+ CE
Sbjct  129   YTLVWSSGG----QDDGGFFWLPTPPDGYKAVGVAVTATKDKPRLDEVTCVRADFTEACE  184

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNVA  1192
              E+ VW     ++D +GF+  +LRP  RG  A+GV  GTFL   SG   + ACLKNNN A
Sbjct  185   AEEPVW-----SSDKDGFSASSLRPTARGIDARGVHTGTFLAQSSGITPSLACLKNNNAA  239

Query  1191  FSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIGP  1012
             ++SS MP L+Q+ A+   Y+P++YLHP D Y PSSV WFF NGALL+ KG ET P  +  
Sbjct  240   YTSS-MPRLAQVHAILAAYAPLVYLHPDDPYMPSSVTWFFENGALLFKKGSETAPTPVAA  298

Query  1011  DGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIFY  832
             DGSNLPQGG NDG +W++LP D NEKERVK+GDL S++ Y+  KPM GGT TD+A+W FY
Sbjct  299   DGSNLPQGGGNDGEFWLDLPGDGNEKERVKKGDLGSAKAYVQAKPMLGGTATDLALWFFY  358

Query  831   PFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAPN  652
             PFNGP+ AK+G +  IPLG IGEH+GDWEHLTLR+SNF+G L +VY S+HS G+WVDA  
Sbjct  359   PFNGPARAKVGPLN-IPLGRIGEHVGDWEHLTLRVSNFSGELLRVYLSQHSAGTWVDASL  417

Query  651   LEFI-----NGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLR  493
             LE+      NG  + VAY+S +GHA Y K GLVLQG     +GIRND AK  + +DT  R
Sbjct  418   LEYEDSASGNGRRRPVAYASRHGHAFYPKEGLVLQGDAKLGVGIRNDCAK-GSRMDT--R  474

Query  492   YSVVAG-LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
               VV+G   G+VEP W+ + R WGPK  Y    +I RV   LP   R + E L  L+ N+
Sbjct  475   CEVVSGEYLGVVEPAWLGFERGWGPKEEYDIGREINRVARFLP---RAMKERLGKLV-NK  530

Query  315   FFGEEGPTGPNMKASWSGDEK  253
              F  EGPTGP MK SW  DE+
Sbjct  531   LFVGEGPTGPKMKGSWRNDER  551



>emb|CDX77088.1| BnaC04g38830D [Brassica napus]
Length=474

 Score =   436 bits (1120),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 230/436 (53%), Positives = 295/436 (68%), Gaps = 15/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPS--GDRIRCVFSAFTDP  1378
             Y  + ++ S+ + Q GPAY W P+ P GY AVG  VTTS  KPS   + I CV S  T+ 
Sbjct  50    YMELGNTTSVVVKQDGPAYFWQPLCPNGYGAVGVFVTTSPVKPSLRQESISCVRSDHTEQ  109

Query  1377  C-EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF-LGSFSGNVGTFACLKN  1204
               E + WVWG         G  + +LRP NRGT+A GV  GTF     +  + + +CL+N
Sbjct  110   MSEADAWVWGI-------EGVTVSSLRPANRGTEADGVYTGTFSFQQLNFPLPSLSCLRN  162

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
                 F  S+MP+  Q   LFR YSP++Y HP + + PSSV+W FSNGALLY KG+E+NPV
Sbjct  163   --TKFDLSSMPSQDQTRDLFRAYSPLIYFHPNEEFLPSSVDWVFSNGALLYQKGNESNPV  220

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              + P+GSNLPQGG++DG+YW++ P D + +ERVKRGDL +++VYL+IKPMFGGTFTDI +
Sbjct  221   PVQPNGSNLPQGGSDDGLYWLDYPADESARERVKRGDLGNTKVYLHIKPMFGGTFTDIVL  280

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNG +  K+  ++ + LG +GEHIGDWEH+TLRISNFNG L +VYFSEHSGGS V
Sbjct  281   WIFLPFNGNAHLKILFMKSLSLGNVGEHIGDWEHVTLRISNFNGELWRVYFSEHSGGSLV  340

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
             +A +LEF  G NK VAY+SL+GHA +S+PGLVLQG    GIRND A+S    DT   Y V
Sbjct  341   EACDLEF-QGGNKPVAYASLHGHAMFSRPGLVLQGQDGNGIRNDMARSDKFFDTSTGYEV  399

Query  483   VAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
             +AG QGIVEPPW+ Y R+WGP + +  E+ I      LP   R  F  L   +P+E   E
Sbjct  400   IAG-QGIVEPPWLNYFRKWGPTVQHDLEKTIDGFAKTLPGFLRKKFRELTDKIPHEVLEE  458

Query  303   EGPTGPNMKASWSGDE  256
             EGPTGP +K SW+ DE
Sbjct  459   EGPTGPKVKQSWNADE  474



>emb|CDY37499.1| BnaA05g33640D [Brassica napus]
Length=474

 Score =   435 bits (1118),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 229/436 (53%), Positives = 294/436 (67%), Gaps = 15/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPS--GDRIRCVFSAFTDP  1378
             Y  + ++ S+ + Q GPAY W P+ P GY AVG  VTTS  KPS   + I CV S  T+ 
Sbjct  50    YMELGNTTSVVVKQEGPAYFWQPLCPNGYGAVGVFVTTSPVKPSLRQETISCVRSDHTEQ  109

Query  1377  C-EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF-LGSFSGNVGTFACLKN  1204
               E + WVWG         G  + +LRP NRGT+A GV  GTF     +  + + +CL+N
Sbjct  110   MSEADAWVWGI-------EGVTVSSLRPANRGTEAAGVYTGTFSFQQLNFPLPSLSCLRN  162

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
                 F  S+MP+  Q   LFR YSP++Y HP + + PSSV+W FSNGALLY KG+E+NPV
Sbjct  163   TK--FDLSSMPSQDQTRDLFRAYSPLIYFHPNEEFLPSSVDWVFSNGALLYQKGNESNPV  220

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              + P+GSNLPQGG++DG+YW++ P D + +ERVKRGDL +++VYL+IKPMFGGTFTDI +
Sbjct  221   PVQPNGSNLPQGGSDDGLYWMDYPADESARERVKRGDLGNTKVYLHIKPMFGGTFTDIVV  280

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNG +  K+  ++ + LG +GEHIGDWEH+TLRISNFNG L +VYFSEHSGGS V
Sbjct  281   WIFLPFNGNAHLKILFMKSLSLGNVGEHIGDWEHVTLRISNFNGELWRVYFSEHSGGSLV  340

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
             +A +LEF  G NK VAY+S +GHA +S+PGLVLQG    GIRND A+S    DT   Y V
Sbjct  341   EACDLEF-QGGNKPVAYASFHGHAMFSRPGLVLQGQDGNGIRNDMARSDKFFDTSTGYEV  399

Query  483   VAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
             +AG QGIVEPPW+ Y R+WGP + +  E+ I      LP   R  F  L   +P+E   E
Sbjct  400   IAG-QGIVEPPWLNYFRKWGPTVQHDLEKTIDGFAKTLPGFLRKKFRELTDKIPHEVLEE  458

Query  303   EGPTGPNMKASWSGDE  256
             EGPTGP +K SW+ DE
Sbjct  459   EGPTGPKVKQSWNADE  474



>dbj|BAJ94819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=555

 Score =   437 bits (1125),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 230/446 (52%), Positives = 291/446 (65%), Gaps = 30/446 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS      Q G  + WLP PP GY AVG  VT + +KP    + CV + FTD CE
Sbjct  125   YTLVWSSG-----QDGAGFFWLPTPPDGYKAVGVAVTATKDKPQPGEVMCVRADFTDVCE  179

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF----SGNVGTFACLKN  1204
              E+ VWG     +D +GF+   LRP  RG  A+GV  GTFL       + +V T ACLKN
Sbjct  180   AEESVWG-----SDKDGFSATALRPAVRGVDARGVHTGTFLAQSNVTPAASVSTLACLKN  234

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
             N+ A++S  MP+L Q+ A+   YSP +YLHP D Y PSS  WFF NGALLY KG +T P 
Sbjct  235   NSAAYTS-CMPDLGQVNAVLAAYSPHVYLHPNDPYLPSSATWFFENGALLYQKGSQT-PT  292

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              +  DGSNLPQGG ND  YW++LPVDN +KERVK+GDL S++ Y+  KPM GGT TD+A+
Sbjct  293   PVAADGSNLPQGGGNDDAYWLDLPVDNGQKERVKKGDLASAKAYVQAKPMLGGTATDLAL  352

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W FYPFNGP+ AK+G +  IPLGMIGEH+GDWEHLTLR+SNF+G L ++YFS+HS G+WV
Sbjct  353   WFFYPFNGPARAKVGPLT-IPLGMIGEHVGDWEHLTLRVSNFSGELLRMYFSQHSTGAWV  411

Query  663   DAPNLEFI---NGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTG  499
             DA  LE++    G+ + VAY+SL+GHA Y + GLVLQG     +GIRND AK + +  +G
Sbjct  412   DASQLEYLGDGGGNRRPVAYASLHGHAFYPREGLVLQGNSKLGVGIRNDCAKGSRMDTSG  471

Query  498   LRYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIH  331
              R  VVA    G   + EP W+ + R WGP+  Y    +I R   +LP   R + E L  
Sbjct  472   GRCEVVAAEYLGAGKVAEPAWLGFERGWGPREEYDIGREINRAARILP---RAIKERLAQ  528

Query  330   LLPNEFFGEEGPTGPNMKASWSGDEK  253
             L+ N+    EGPTGP MK SW  DE+
Sbjct  529   LV-NKLLVGEGPTGPKMKGSWRNDER  553



>emb|CAN82512.1| hypothetical protein VITISV_002153 [Vitis vinifera]
Length=913

 Score =   449 bits (1154),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 222/356 (62%), Positives = 265/356 (74%), Gaps = 7/356 (2%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+SL I Q G  YVWLP PP GY AVGHV+T   EKPS D+IRCV S  TD CE
Sbjct  96    YTLVWSSESLKIKQDGNGYVWLPTPPDGYKAVGHVITNLPEKPSLDKIRCVRSDLTDLCE  155

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTF--ACLKNNN  1198
              + W+WG     N  NGFN+Y L+P +RG QA  V VGTF+    G   +   ACLKN  
Sbjct  156   ADTWIWGLDKVAN-ANGFNVYDLQPSDRGAQALAVSVGTFVAQNGGAASSLSLACLKN--  212

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
             ++ +  AMPNL+Q++AL + YSP +YLHP + Y PSSV+WFF NGALLY +G+E+ PV I
Sbjct  213   ISSNLYAMPNLAQVDALVQAYSPWVYLHPDEQYLPSSVSWFFQNGALLYQQGEESKPVNI  272

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
              P GSNLPQGG+NDG YW++LPVD   KE VK+GDLQ S  Y++IKPM G TFTDIAIWI
Sbjct  273   DPTGSNLPQGGSNDGAYWLDLPVDAKAKETVKKGDLQDSMTYMHIKPMLGATFTDIAIWI  332

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNGP+ AK+ ++  I LG IGEH+GDWEH+TLR+SNFNG L  V+FSEHS G+WV+A
Sbjct  333   FYPFNGPARAKV-ELINISLGKIGEHVGDWEHVTLRVSNFNGKLMNVFFSEHSSGTWVNA  391

Query  657   PNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRY  490
               LEF NG NK V+Y+SL+GHA Y KPGLVLQG G  GIRNDTAKS  V+DTG RY
Sbjct  392   SELEFQNG-NKVVSYASLHGHAFYPKPGLVLQGSGAXGIRNDTAKSKMVMDTGTRY  446



>ref|XP_002884255.1| hypothetical protein ARALYDRAFT_896056 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60514.1| hypothetical protein ARALYDRAFT_896056 [Arabidopsis lyrata subsp. 
lyrata]
Length=583

 Score =   438 bits (1127),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 231/437 (53%), Positives = 293/437 (67%), Gaps = 16/437 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPS--GDRIRCVFSAFTDP  1378
             Y  V ++ S+ I Q G AY W P+ P GY AVG  VTTS  KPS   + I CV S  T+ 
Sbjct  158   YVEVINTTSMNINQDGAAYFWQPLCPDGYQAVGLYVTTSPLKPSLSQESISCVRSDLTEQ  217

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLG---SFSGNVGTFACLK  1207
              E + WVWG        N   L +LRP NRGT+A GV  GTF     S         CLK
Sbjct  218   SETDTWVWGT-------NEMTLSSLRPANRGTEATGVHTGTFSCQPLSVPPPPPPLFCLK  270

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N    F  S+MP+ +Q   LF+ YSP +YLHP + + PSSVNWFFSNGALL+ +G+E+NP
Sbjct  271   NTK--FDLSSMPSHNQTSVLFQSYSPWIYLHPDEDFLPSSVNWFFSNGALLFQRGNESNP  328

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             V + PDGSNLPQGG++DG++W++ PVD N KE VKRGDL +++VYL+IKPMFGGTFTDI 
Sbjct  329   VPVQPDGSNLPQGGSDDGLFWLDYPVDKNAKEWVKRGDLGNTKVYLHIKPMFGGTFTDIV  388

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +WIFYPFNG +  K   I+ + LG IGEHIGDWEH+TLRISNFNG L + YFSEHSGG+ 
Sbjct  389   VWIFYPFNGNARLKFLFIKSLSLGDIGEHIGDWEHITLRISNFNGELWRAYFSEHSGGTL  448

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
             V+A +LEF  G NK V+YSSL+GHA +S+PGLVLQG    GIRND A+S    D G+ Y 
Sbjct  449   VEACDLEF-QGGNKPVSYSSLHGHAMFSRPGLVLQGDDGNGIRNDMARSDKFFDAGVAYE  507

Query  486   VVAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
             +VAG  GI EPPW+ Y R+WGP + +  ++++  +   LP   R  F   I+ +P E   
Sbjct  508   LVAG-PGIEEPPWLNYFRKWGPFVRHDIQKNLDGIAKSLPGLLRKKFRKFINKMPREVLE  566

Query  306   EEGPTGPNMKASWSGDE  256
             E+GPTGP +K SW+ D+
Sbjct  567   EDGPTGPKVKRSWTADD  583



>ref|XP_006299211.1| hypothetical protein CARUB_v10015358mg [Capsella rubella]
 gb|EOA32109.1| hypothetical protein CARUB_v10015358mg [Capsella rubella]
Length=581

 Score =   437 bits (1123),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 231/439 (53%), Positives = 292/439 (67%), Gaps = 20/439 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTS-LEKPSGDR-IRCVFSAFTDP  1378
             Y    ++ S+ I Q GPAY W P+ P GY AVG  VTTS LE P   + I CV S  T+ 
Sbjct  155   YIAAMNTTSMIIRQDGPAYFWQPLCPDGYQAVGLYVTTSPLEPPLRQKSISCVRSGLTEQ  214

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFA-----C  1213
              E + WVWG            + +LRP NRGT+A GV  GTF  S  G     A     C
Sbjct  215   SEADTWVWGTAD-------MAISSLRPANRGTEATGVYTGTF--SCQGRNSPPARPPLFC  265

Query  1212  LKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET  1033
             LKN    F  S+MP+  Q   LF  YSP +YLHP + + PSSV+WFFSNGALL+ KG+E+
Sbjct  266   LKNTR--FDLSSMPSKDQTRVLFETYSPWVYLHPDEDFLPSSVDWFFSNGALLFQKGNES  323

Query  1032  NPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
             NPV + PDGSNLPQGG++DG++W++ P D N KERVKRGDL +++VYL+IKPMFGGTFTD
Sbjct  324   NPVPVQPDGSNLPQGGSDDGLFWLDYPADKNAKERVKRGDLGNTKVYLHIKPMFGGTFTD  383

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             I +WIFYPFNG +  K   ++ + LG IGEHIGDWEH+TLRISNFNG L + Y SEHSGG
Sbjct  384   IVVWIFYPFNGNARLKFLFVKSLSLGDIGEHIGDWEHVTLRISNFNGELWRAYLSEHSGG  443

Query  672   SWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLR  493
             + V+A +LEF  G NK V+YSSL+GHA +S+PG+VLQG    G+RND A+S   LD G  
Sbjct  444   TLVEACDLEF-QGGNKLVSYSSLHGHAMFSRPGMVLQGEDGNGVRNDMARSDKFLDAGAA  502

Query  492   YSVVAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             Y +VAG  G+VEPPW+ Y R+WGP +T+  E+  + +   LP   R  F  LI  +P E 
Sbjct  503   YELVAG-PGVVEPPWLNYYRKWGPFVTHDIEKTFQGIAKTLPRLLRTKFNNLISKIPREV  561

Query  312   FGEEGPTGPNMKASWSGDE  256
               E+GPTGP +K SW+ D+
Sbjct  562   LQEDGPTGPKVKTSWTSDD  580



>ref|XP_010485352.1| PREDICTED: uncharacterized protein LOC104763705 [Camelina sativa]
Length=584

 Score =   436 bits (1121),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 225/437 (51%), Positives = 291/437 (67%), Gaps = 16/437 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPS--GDRIRCVFSAFTDP  1378
             Y  V ++ S+ I Q GPAY W P+   GY AVG  VTTS  +PS   + I CV S  T+ 
Sbjct  159   YIAVMNTTSMIIKQDGPAYFWQPLCLNGYQAVGLYVTTSPLEPSLSQESISCVRSDLTEQ  218

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLG---SFSGNVGTFACLK  1207
              E + WVWG            + ++RP NRGT+A GV  GTF     +FS      +CLK
Sbjct  219   SEADTWVWGT-------EELTISSMRPANRGTEATGVYTGTFSCKRLNFSPPPPPLSCLK  271

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N     SS  MP+  Q   LF+ YSP +YLHP + + PSSV WFFSNGALL+ KG+E+NP
Sbjct  272   NTRSGLSS--MPSKDQTSLLFKTYSPWVYLHPDEDFLPSSVEWFFSNGALLFQKGNESNP  329

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             V I PDGSNLPQGG++DG++W++ P D + KERVKRGDL +++VYL+IKPMFGGTFTDI 
Sbjct  330   VAIQPDGSNLPQGGSDDGLFWLDYPADKDAKERVKRGDLGNTKVYLHIKPMFGGTFTDIV  389

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +WIFYPFNG +  K   ++ + LG +GEHIGDWEH+TLRISNFNG L + Y SEHS G+ 
Sbjct  390   VWIFYPFNGNARLKFLFVKSLWLGDVGEHIGDWEHVTLRISNFNGELWRAYLSEHSAGTL  449

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
             V+A +LEF  G NK V+YSSL+GHA +S+PG+VLQG G  G+RND A+S    D G  Y 
Sbjct  450   VEACDLEF-QGGNKPVSYSSLHGHAMFSRPGMVLQGEGGNGLRNDMARSDKFFDAGAAYE  508

Query  486   VVAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
             +VAG  G+VEPPW+ Y R+WGP + +  ++    +   LP  +R  F   I+ +P E F 
Sbjct  509   MVAG-PGMVEPPWLNYFRKWGPFVQHDIQKTFDGIAKTLPGFFRAKFRKFINQIPRELFQ  567

Query  306   EEGPTGPNMKASWSGDE  256
             E+GPTGP +K SW+ DE
Sbjct  568   EDGPTGPKVKRSWTADE  584



>emb|CDX85337.1| BnaC07g26480D [Brassica napus]
Length=982

 Score =   448 bits (1152),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 230/440 (52%), Positives = 298/440 (68%), Gaps = 17/440 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKP--SGDRIRCVFSAFTDP  1378
             Y  VW++ SL I Q G AY W PV  +GY  VG  VTTS +KP    D I CV S  T+ 
Sbjct  551   YIEVWNTASLGIRQDGHAYFWQPVCLKGYKPVGVFVTTSSQKPPMKQDSISCVRSELTEQ  610

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF----SGNVGTFACL  1210
              E +  VWG         G N+   RP+ RGTQA GV  GTF  SF    S  +    CL
Sbjct  611   SEADTLVWGF-------KGINVVNSRPVQRGTQATGVYTGTF--SFQQLNSSPLPYLFCL  661

Query  1209  KNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETN  1030
             KN  +  SS+ MP+ +Q  ALF+ YSP++Y HP + + PSSV+WFF+NGALLY KG+E+N
Sbjct  662   KNTKLNMSSN-MPSKAQTRALFKTYSPLIYFHPKEIFLPSSVHWFFANGALLYKKGNESN  720

Query  1029  PVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDI  850
             P+ I P+G+NLPQGG+ND ++W++ P+D    E+VKRGDL++++VYLNIKPMFGGTFTDI
Sbjct  721   PIPIQPNGTNLPQGGSNDDLFWLDYPLDKTAMEKVKRGDLRNTKVYLNIKPMFGGTFTDI  780

Query  849   AIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGS  670
             A+WIF PFNG +  K   I+ + LG IGEH+GDWEH+TLRISNFNG L +VYFS+HSGG+
Sbjct  781   AVWIFCPFNGNAHLKFLFIKSLSLGQIGEHVGDWEHVTLRISNFNGKLWRVYFSQHSGGT  840

Query  669   WVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRY  490
              VDA +LE++ G NK V YSSL+GHA +SKPGLVLQG    GIRND A+S   L+ G  Y
Sbjct  841   LVDACDLEYVEGGNKPVIYSSLHGHAMFSKPGLVLQGKRRYGIRNDMARSDKWLNCGKGY  900

Query  489   SVVAGLQGIVEPPWVKYCREWGPKITYISEEDIKR-VESLLPVEWRGVFETLIHLLPNEF  313
              V+ G  G+VEP W  Y R+WGP++ Y  ++ IK   + +LP+  R     +I  +P E 
Sbjct  901   EVIGGPWGVVEPAWTSYFRKWGPRVGYKIDKPIKSFAKKILPMFVRKRLRNIIRKIPYEM  960

Query  312   FGEEGPTGPNMKASWSGDEK  253
              GE+GPTGP  K +W+GD+K
Sbjct  961   LGEDGPTGPKAKLTWTGDDK  980



>ref|XP_009124050.1| PREDICTED: uncharacterized protein LOC103848966 [Brassica rapa]
Length=590

 Score =   435 bits (1118),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 229/436 (53%), Positives = 294/436 (67%), Gaps = 15/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPS--GDRIRCVFSAFTDP  1378
             Y  + ++ S+ + Q GPAY W P+ P GY AVG  VTTS  KPS   + I CV S  T+ 
Sbjct  166   YMELGNTTSVVVKQEGPAYFWQPLCPNGYGAVGVFVTTSPVKPSLRQETISCVRSDHTEQ  225

Query  1377  C-EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF-LGSFSGNVGTFACLKN  1204
               E + WVWG         G  + +LRP NRGT+A GV  GTF     +  + + +CL+N
Sbjct  226   MSEADAWVWGI-------EGVTVSSLRPANRGTEAAGVYTGTFSFQQLNFPLPSLSCLRN  278

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
                 F  S+MP+  Q   LFR YSP++Y HP + + PSSV+W FSNGALLY KG+E+NPV
Sbjct  279   TK--FDLSSMPSQDQTRDLFRAYSPLIYFHPNEEFLPSSVDWVFSNGALLYQKGNESNPV  336

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              + P+GSNLPQGG++DG+YW++ P D + +ERVKRGDL +++VYL+IKPMFGGTFTDI +
Sbjct  337   PVQPNGSNLPQGGSDDGLYWMDYPADESARERVKRGDLGNTKVYLHIKPMFGGTFTDIVV  396

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNG +  K+  ++ + LG +GEHIGDWEH+TLRISNFNG L +VYFSEHSGGS V
Sbjct  397   WIFLPFNGNAHLKILFMKSLSLGNVGEHIGDWEHVTLRISNFNGELWRVYFSEHSGGSLV  456

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
             +A +LEF  G NK VAY+S +GHA +S+PGLVLQG    GIRND A+S    DT   Y V
Sbjct  457   EACDLEF-QGGNKPVAYASFHGHAMFSRPGLVLQGQDGNGIRNDMARSDKFFDTSTGYEV  515

Query  483   VAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
             +AG QGIVEPPW+ Y R+WGP + +  E+ I      LP   R  F  L   +P+E   E
Sbjct  516   IAG-QGIVEPPWLNYFRKWGPTVQHDLEKTIDGFAKTLPGFLRKKFRELTDKIPHEVLEE  574

Query  303   EGPTGPNMKASWSGDE  256
             EGPTGP +K SW+ DE
Sbjct  575   EGPTGPKVKQSWNADE  590



>ref|NP_186837.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF03440.1|AC010797_16 hypothetical protein [Arabidopsis thaliana]
 gb|AAF14847.1|AC011664_29 hypothetical protein [Arabidopsis thaliana]
 gb|AEE73729.1| uncharacterized protein AT3G01880 [Arabidopsis thaliana]
Length=592

 Score =   434 bits (1117),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 225/438 (51%), Positives = 295/438 (67%), Gaps = 15/438 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPS--GDRIRCVFSAFTDP  1378
             YT V ++ +L I Q GPAY W P+ P GY AVG  VTTS  KPS   + I CV S  T+ 
Sbjct  163   YTEVGNTTTLLIKQEGPAYFWQPLCPNGYHAVGLYVTTSPMKPSLGQNSISCVRSDLTEQ  222

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLG---SFSGNVGTFACLK  1207
              E + WVW             + +LRP  RG +A GV  GTF     +F  +     CLK
Sbjct  223   SEADTWVW-------RIKDMTISSLRPATRGVEATGVFTGTFSCKQLNFLPHPPPLFCLK  275

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N    F  S+MP+ +Q   LF+ YSP +YLHP + + PSSVNW F+NGALL+ KG+E+ P
Sbjct  276   NTK--FDLSSMPSENQTRVLFKTYSPWIYLHPKEDFLPSSVNWVFANGALLHKKGNESIP  333

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             V I P+GSNLPQGG ND ++W++  VD   +E+VKRGDL+S++VYL+IKPMFG TFTDI 
Sbjct  334   VPIHPNGSNLPQGGCNDDLFWLDYLVDKKAREKVKRGDLESTKVYLHIKPMFGATFTDIV  393

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +W+F+P+NG +  K   I+ + LG IGEH+GDWEH+TLRISNFNG L +VYFSEHSGG+ 
Sbjct  394   VWLFFPYNGNAHLKFLFIKSLSLGNIGEHVGDWEHVTLRISNFNGELWRVYFSEHSGGTL  453

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
             VDA +LEF+ G NK V YSSL+GHA +SKPG+VLQG G  GIRND A+S    D G+ Y 
Sbjct  454   VDACDLEFMQGGNKPVVYSSLHGHAMFSKPGVVLQGGGKSGIRNDMARSDKCFDAGIGYE  513

Query  486   VVAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
             V+AG  G+VEPPW+ Y R+WGP++ Y  +  +  V  +LP+  R     LI+ +P E  G
Sbjct  514   VIAG-PGVVEPPWLNYFRKWGPRVHYRIDIFLNSVAKILPIFLRKGLRKLINKIPLEMRG  572

Query  306   EEGPTGPNMKASWSGDEK  253
             ++GPTGP +K +W+GDE+
Sbjct  573   QDGPTGPKVKVTWTGDEQ  590



>ref|XP_010496432.1| PREDICTED: uncharacterized protein LOC104773502 [Camelina sativa]
Length=584

 Score =   433 bits (1113),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 223/437 (51%), Positives = 294/437 (67%), Gaps = 16/437 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPS--GDRIRCVFSAFTDP  1378
             Y  V ++ S+ I Q GPAY W P+ P+ Y AVG  VTTS ++PS   + I CV S  T+ 
Sbjct  159   YIAVMNTTSMIIKQDGPAYFWQPLCPKEYQAVGLYVTTSPQEPSLSQESISCVRSDLTEK  218

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF---LGSFSGNVGTFACLK  1207
              E + WVWG            + ++RP NRGT+A GV  GTF     + S       CL 
Sbjct  219   SEADTWVWGT-------EELTISSMRPANRGTEATGVYTGTFSCQRPNSSPPPPPLFCL-  270

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
              NN  F+ S+MP+  Q   LF+ YSP +YLHP + + PSSV WFFSNGALL+ KG+E+NP
Sbjct  271   -NNTRFNLSSMPSEDQTSLLFKTYSPWVYLHPDEDFLPSSVEWFFSNGALLFQKGNESNP  329

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             V I PDGSNLPQGG++DG++W++ P D + KERVKRGDL +++VYL+IKPMFGGTFTDI 
Sbjct  330   VPIQPDGSNLPQGGSDDGLFWLDYPADKDAKERVKRGDLGNTKVYLHIKPMFGGTFTDIV  389

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +WIFYPFNG +  K   ++ + LG +GEHIGDWEH+TLRISNFNG L + Y SEHS G+ 
Sbjct  390   VWIFYPFNGNARLKFLFVKGLWLGDVGEHIGDWEHVTLRISNFNGELWRAYLSEHSAGTL  449

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYS  487
             V+A +LEF  G NK V+YSSL+GHA +S+PG+VLQG G  G+RND A+S    D G  Y+
Sbjct  450   VEACDLEF-QGGNKPVSYSSLHGHAMFSRPGMVLQGEGGNGLRNDMARSDKFFDAGASYA  508

Query  486   VVAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFG  307
             +VAG  G+VEPPW+ Y R+WGP + +  ++    +   LP  +R  F   ++ +P E F 
Sbjct  509   MVAG-PGMVEPPWLNYFRKWGPFVQHDIQKTFDGIAKTLPGFFRKKFRKFVNQIPRELFQ  567

Query  306   EEGPTGPNMKASWSGDE  256
             E+GPTGP +K SW+ DE
Sbjct  568   EDGPTGPKVKRSWTADE  584



>ref|XP_003595837.1| hypothetical protein MTR_2g062380 [Medicago truncatula]
 gb|ABN08111.1| Protein of unknown function DUF946, plant [Medicago truncatula]
 gb|AES66088.1| DUF946 family protein [Medicago truncatula]
Length=560

 Score =   432 bits (1110),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 219/443 (49%), Positives = 292/443 (66%), Gaps = 21/443 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LV ++ S+ +TQ    Y+WLP+ P GY AVGHVVT + +KPS +++ CV S  T+ CE
Sbjct  127   YSLVLNTASITVTQDSSLYIWLPIAPNGYHAVGHVVTKTQDKPSTNKVMCVRSDLTEQCE  186

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
                 +WG        NG N Y +RPINRG +A GV+VGTF+    GN+   + +CLKN  
Sbjct  187   SSTLIWGS-------NGLNFYDVRPINRGIKALGVRVGTFVAQNGGNINPPSISCLKN--  237

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
             +   +  MP+  QI+AL +  +P LYLH  + Y PSSVNWFFSNGALLY KG E+NPV I
Sbjct  238   IDSITQIMPSKKQIDALLQVNAPFLYLHSDEEYLPSSVNWFFSNGALLYKKGRESNPVPI  297

Query  1017  GPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWI  838
               +G+NLPQ    DG  W++LPVDN  KERVK+G+LQS+E Y+++KPM+GGTFTDIA+W+
Sbjct  298   AQNGNNLPQDPNTDGSCWLDLPVDNANKERVKKGNLQSAESYVHVKPMYGGTFTDIAMWV  357

Query  837   FYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDA  658
             FYPFNG   AK+  I+ I LG  GEH+GDWEH+TLR+SNF+G L  VYFS+H+ G W+D+
Sbjct  358   FYPFNGAGRAKVEFID-IKLGKAGEHVGDWEHVTLRVSNFDGQLWHVYFSQHNAGKWIDS  416

Query  657   PNLEFINGSN-------KSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTG  499
               LEF + ++       + + Y+SL+GHA+Y   GL L G   +G R+DT K   V+D G
Sbjct  417   SQLEFQSDASSFDFPTKRPIVYASLHGHASYPHAGLNLLGKNGVGARDDTNKGRNVMDMG  476

Query  498   LRYSVVAGLQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
                 V A   G  + EP W+ Y REWGP I +  + ++K V   LP + R  FE +I  L
Sbjct  477   KYVLVCAEYLGSEVKEPAWLNYFREWGPHIDFDLDIELKNVAKALPGKLRDGFENIIRSL  536

Query  324   PNEFFGEEGPTGPNMKASWSGDE  256
             P E  GEEGPTGP  K +W+GDE
Sbjct  537   PKEALGEEGPTGPKEKGNWNGDE  559



>ref|XP_004958121.1| PREDICTED: uncharacterized protein LOC101758191 [Setaria italica]
Length=551

 Score =   431 bits (1108),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 229/442 (52%), Positives = 298/442 (67%), Gaps = 28/442 (6%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS        G    WLP  P+GY AVG VVT + +KPS D +RCV + FTD CE
Sbjct  127   YTLVWSS------PDGAGNFWLPTAPEGYKAVGAVVTATSDKPSRDEVRCVRADFTDACE  180

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLG-SFSGNVGTFACLKNNNV  1195
              E+ +      ++D +GF+  TLRP  RG  A+GV  GTFL  S + +  T ACLKNN+ 
Sbjct  181   TEESLL-----SSDKDGFSAATLRPSVRGIDARGVHAGTFLAQSNAASASTVACLKNNSA  235

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
             +++SS MP+L+Q+ +L   Y+P +YLHP + Y PSSV WFF NGALLY KG +T    + 
Sbjct  236   SYTSS-MPDLAQVNSLLAAYAPHVYLHPNEPYFPSSVTWFFENGALLYQKGSQTA-TPVA  293

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              DGSNLPQGG NDG YW++LPVDN ++E+VKRGDL S++VY+  KPM GGT TD+A+WIF
Sbjct  294   ADGSNLPQGGGNDGGYWLDLPVDNKQREKVKRGDLASAKVYVQAKPMLGGTVTDLAVWIF  353

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+G +  IPLG IGEH+GDWEH+TLR+SNF+G L ++YFS+HS G+WV+A 
Sbjct  354   YPFNGPARAKVGLLT-IPLGEIGEHVGDWEHVTLRVSNFSGELLRMYFSQHSAGTWVEAS  412

Query  654   NLEFI---NGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTG--L  496
              LE++   +G ++ VAY+SL+GHA Y K GLVLQG     +GIRND A+ +  LDTG   
Sbjct  413   QLEYLDAGDGGSRPVAYASLHGHALYPKAGLVLQGDARLGVGIRNDAARGSR-LDTGGAG  471

Query  495   RYSVV-AGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
             R  VV A   G+ EP W+ + REWGP++ Y     I RV  +LP   R   E L  L+  
Sbjct  472   RCEVVSAEYLGVAEPAWLGFEREWGPRVEYDIGRVINRVARILP---RSARERLAKLVEK  528

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
                G +GPTGP M  +W  DE+
Sbjct  529   VLVG-DGPTGPKMHGNWRNDER  549



>emb|CDX91920.1| BnaC03g32220D [Brassica napus]
Length=477

 Score =   427 bits (1099),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 231/438 (53%), Positives = 285/438 (65%), Gaps = 16/438 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKP--SGDRIRCVFSAFTDP  1378
             Y  V ++ SL + Q GPAY W P+ P GY AVG  VTTS  KP    + I CV S  T+ 
Sbjct  50    YIEVGNTTSLAVKQDGPAYFWQPLCPSGYGAVGLFVTTSPLKPPLRQESISCVGSHLTEQ  109

Query  1377  CEVED--WVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTF-ACLK  1207
                 D  WVW          G N Y LRP  RGT+A GV  GTF          F +CL+
Sbjct  110   RSEADTTWVWRM-------EGINFYGLRPATRGTEATGVYTGTFSFQQQNFPRPFLSCLR  162

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N     SS  MP+  Q   LFR YSP++Y HP + + PSSV+W FSNGALLY KG+E+NP
Sbjct  163   NTKFDLSS-MMPSQDQTRVLFRAYSPLIYFHPEEEFLPSSVDWIFSNGALLYQKGNESNP  221

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             V + P+GSNLPQGG++D +YW++ P D   +ERVKRGDL + + YL+IKPMFGGTFTDI 
Sbjct  222   VAVQPNGSNLPQGGSDDDLYWLDYPADKKARERVKRGDLGNIKAYLHIKPMFGGTFTDIV  281

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +WIF PFNG +  K+  I+ + LG IGEHIGDWEH+TLRISNFNG L +VYFSEHSGGS 
Sbjct  282   VWIFSPFNGNARLKILFIKSLSLGDIGEHIGDWEHVTLRISNFNGELWRVYFSEHSGGSL  341

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGI-GDIGIRNDTAKSAAVLDTGLRY  490
             V+A +LEF +G NK V YSSL+GHA +SKPGLVLQG  G+ G+RND A+S   LD G  Y
Sbjct  342   VEACDLEFQSG-NKPVVYSSLHGHAMFSKPGLVLQGQDGNNGLRNDMARSDKFLDAGADY  400

Query  489   SVVAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
              V+ G  GI EPPW+ Y R+WGP + +  E+ +  +   LP   R  F  L+H +P E  
Sbjct  401   EVIGG-PGITEPPWLNYFRKWGPIVRHDVEKTLDSIAKTLPQLLRKRFRDLVHSIPPEVL  459

Query  309   GEEGPTGPNMKASWSGDE  256
              E GPTGP +K SWS DE
Sbjct  460   QEMGPTGPKVKKSWSADE  477



>gb|AAF14848.1|AC011664_30 hypothetical protein, 5' partial [Arabidopsis thaliana]
Length=549

 Score =   428 bits (1101),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 228/436 (52%), Positives = 290/436 (67%), Gaps = 15/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPS--GDRIRCVFSAFTDP  1378
             Y  V ++ S+ I Q G A+ W P+ P GY AVG  VTTS  KPS   + I CV S  T+ 
Sbjct  125   YIQVINTTSMNINQEGAAFFWQPLCPNGYQAVGLYVTTSPIKPSLSQESISCVRSDLTEQ  184

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGS--FSGNVGTFACLKN  1204
              E + WVWG            L +LRP NRGT+A GV  GTF              CLKN
Sbjct  185   SETDTWVWGT-------EEMTLSSLRPANRGTEATGVHTGTFSCQPLNIPPPPPLFCLKN  237

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
                 F  S+MP+ +Q   LF+ YSP +YLHP + +  SSV+WFFSNGALL+ KG+E+NPV
Sbjct  238   --TKFDLSSMPSHNQTTVLFQSYSPWIYLHPDEDFISSSVDWFFSNGALLFQKGNESNPV  295

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              + PDGSNLPQGG++DG++W++ P D N KE VKRGDL  ++VYL+IKPMFGGTFTDI +
Sbjct  296   PVQPDGSNLPQGGSDDGLFWLDYPADKNAKEWVKRGDLGHTKVYLHIKPMFGGTFTDIVV  355

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIFYPFNG +  K    + + LG IGEHIGDWEH+TLRISNFNG L + YFSEHSGG+ V
Sbjct  356   WIFYPFNGNARLKFLFFKSLSLGDIGEHIGDWEHVTLRISNFNGELWRAYFSEHSGGTLV  415

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
             +A +LEF  G NK V+YSSL+GHA +SKPGLVLQG    GIRND A+S    D G+ Y +
Sbjct  416   EACDLEF-QGGNKLVSYSSLHGHAMFSKPGLVLQGDDGNGIRNDMARSNKFFDAGVAYEL  474

Query  483   VAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
             VAG  GI EPPW+ Y R+WGP + +  +++++ +   LP   R  F  LI+ +P E   E
Sbjct  475   VAG-PGIQEPPWLNYFRKWGPLVPHDIQKNLEGIAKSLPGLLRKKFRNLINKIPREVLEE  533

Query  303   EGPTGPNMKASWSGDE  256
             +GPTGP +K SW+GD+
Sbjct  534   DGPTGPKVKRSWTGDD  549



>ref|XP_006658730.1| PREDICTED: uncharacterized protein LOC102705931 [Oryza brachyantha]
Length=555

 Score =   428 bits (1100),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 231/442 (52%), Positives = 290/442 (66%), Gaps = 32/442 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS        G  + WLP PP GY A+G  VT + EKP  D +RCV + FTD CE
Sbjct  134   YTLVWSS------PDGAGHFWLPAPPDGYRAIGAAVTATPEKPPLDEVRCVRADFTDACE  187

Query  1371  VE-DWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNV  1195
              E   +W         +GF    LRP  RG  A+GV  GTF  + + +    ACLKNN+ 
Sbjct  188   AEPKEIWSG-------DGFAATALRPAVRGVDARGVHTGTF--ATAASASALACLKNNSA  238

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
             A++S  MP+L+Q+ AL   Y+P L+LHP D Y PSSV WFF NGALLY KG +T P  + 
Sbjct  239   AYTS-CMPDLAQVNALLAAYAPQLFLHPDDPYLPSSVTWFFQNGALLYQKGGQT-PTPVA  296

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
              DGSNLPQGG NDG YW++LPVDN ++ERVK+GDL  ++VY+  KPM G T TD+A+W F
Sbjct  297   ADGSNLPQGGGNDGGYWLDLPVDNGQRERVKKGDLAGAKVYVQAKPMLGATATDLAVWFF  356

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
             YPFNGP+ AK+G +  IPLG IGEH+GDWEH+TLR+SNF+G L +VYFSEHS G WV+A 
Sbjct  357   YPFNGPARAKVGPLT-IPLGEIGEHVGDWEHVTLRVSNFSGELLRVYFSEHSAGKWVEAS  415

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTG--LRYS  487
              LE+++G+N+  AY+SL+GHA Y KPGLVLQG     +GIRND A+ + V DTG   RY 
Sbjct  416   QLEYLDGNNRPSAYASLHGHALYEKPGLVLQGNSQLGVGIRNDCARGSRV-DTGGAGRYE  474

Query  486   VVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
             VV+    G   + EP W+ + REWGP+  Y    +I RV  LLP   R   E L  L+ +
Sbjct  475   VVSAEYLGAGAVAEPAWLLFDREWGPREEYDIGREINRVAKLLP---RSTREKLRKLVES  531

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
                G EGPTGP MK SW  DE+
Sbjct  532   VLVG-EGPTGPRMKGSWRDDER  552



>ref|NP_186836.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF03439.1|AC010797_15 hypothetical protein [Arabidopsis thaliana]
 gb|AAZ52714.1| hypothetical protein At3g01870 [Arabidopsis thaliana]
 gb|ABE97186.1| hypothetical protein At3g01870 [Arabidopsis thaliana]
 gb|AEE73728.1| uncharacterized protein AT3G01870 [Arabidopsis thaliana]
Length=583

 Score =   429 bits (1102),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 228/436 (52%), Positives = 290/436 (67%), Gaps = 15/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPS--GDRIRCVFSAFTDP  1378
             Y  V ++ S+ I Q G A+ W P+ P GY AVG  VTTS  KPS   + I CV S  T+ 
Sbjct  159   YIQVINTTSMNINQEGAAFFWQPLCPNGYQAVGLYVTTSPIKPSLSQESISCVRSDLTEQ  218

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGS--FSGNVGTFACLKN  1204
              E + WVWG            L +LRP NRGT+A GV  GTF              CLKN
Sbjct  219   SETDTWVWGT-------EEMTLSSLRPANRGTEATGVHTGTFSCQPLNIPPPPPLFCLKN  271

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
                 F  S+MP+ +Q   LF+ YSP +YLHP + +  SSV+WFFSNGALL+ KG+E+NPV
Sbjct  272   --TKFDLSSMPSHNQTTVLFQSYSPWIYLHPDEDFISSSVDWFFSNGALLFQKGNESNPV  329

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              + PDGSNLPQGG++DG++W++ P D N KE VKRGDL  ++VYL+IKPMFGGTFTDI +
Sbjct  330   PVQPDGSNLPQGGSDDGLFWLDYPADKNAKEWVKRGDLGHTKVYLHIKPMFGGTFTDIVV  389

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIFYPFNG +  K    + + LG IGEHIGDWEH+TLRISNFNG L + YFSEHSGG+ V
Sbjct  390   WIFYPFNGNARLKFLFFKSLSLGDIGEHIGDWEHVTLRISNFNGELWRAYFSEHSGGTLV  449

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
             +A +LEF  G NK V+YSSL+GHA +SKPGLVLQG    GIRND A+S    D G+ Y +
Sbjct  450   EACDLEF-QGGNKLVSYSSLHGHAMFSKPGLVLQGDDGNGIRNDMARSNKFFDAGVAYEL  508

Query  483   VAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
             VAG  GI EPPW+ Y R+WGP + +  +++++ +   LP   R  F  LI+ +P E   E
Sbjct  509   VAG-PGIQEPPWLNYFRKWGPLVPHDIQKNLEGIAKSLPGLLRKKFRNLINKIPREVLEE  567

Query  303   EGPTGPNMKASWSGDE  256
             +GPTGP +K SW+GD+
Sbjct  568   DGPTGPKVKRSWTGDD  583



>ref|XP_004958115.1| PREDICTED: vacuolar protein sorting-associated protein 62-like 
[Setaria italica]
Length=553

 Score =   426 bits (1094),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 228/444 (51%), Positives = 294/444 (66%), Gaps = 29/444 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVWSS        G  + WLP  P GY AVG VVT + +KPS D +RCV + FTD CE
Sbjct  125   YNLVWSS------PDGAGHFWLPTAPDGYKAVGAVVTATSDKPSPDEVRCVRADFTDACE  178

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFS---GNVGTFACLKNN  1201
              E        SN+D +GF+  TLRP  RG  A+GV  GTFL   S    N  + ACLKNN
Sbjct  179   TEK----PELSNSDKDGFSAATLRPAVRGIDARGVHAGTFLAQSSVTPANASSLACLKNN  234

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             + +++S AMP+L+Q+ +L   Y+P +YLHP ++Y PSS  WFF NGALLY KG +  P  
Sbjct  235   SASYTS-AMPDLAQVNSLLAAYAPHVYLHPNESYFPSSATWFFENGALLYQKGSQI-PTP  292

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             +  DGSNLPQGG NDG YW++LP DN ++E+VK+ DL S++VY+  KPM GGT TD+A+W
Sbjct  293   VAADGSNLPQGGGNDGGYWLDLPADNKQREKVKKSDLASAKVYVQAKPMLGGTVTDLAVW  352

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             IFYPFNGP+ AK+G +  IPLG IGEH+GDWEH+TLR+SNF+G L ++YFS+HS G+WV+
Sbjct  353   IFYPFNGPARAKVGFLT-IPLGEIGEHVGDWEHVTLRVSNFSGELRRMYFSQHSAGTWVE  411

Query  660   APNLEFI---NGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTG-  499
             A  LE++   +G N+ VAY+S +GHA Y K GLVLQG     +GIRNDT++ +  LDTG 
Sbjct  412   ASQLEYLDAGDGGNRPVAYASRHGHALYPKAGLVLQGDSRLGVGIRNDTSRGSR-LDTGG  470

Query  498   -LRYSVV-AGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
               R  VV A   G+ EP W+ + R WGPK  Y+    I RV  +LP   R V E L  L+
Sbjct  471   AGRCEVVSAEYLGVAEPAWLGFERGWGPKEEYVIGRVINRVAWILP---RSVRERLAKLV  527

Query  324   PNEFFGEEGPTGPNMKASWSGDEK  253
                F G +GPTGP M  +W  DE+
Sbjct  528   EKVFVG-DGPTGPKMHGNWRNDER  550



>gb|EEC82315.1| hypothetical protein OsI_26592 [Oryza sativa Indica Group]
Length=538

 Score =   425 bits (1092),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 230/450 (51%), Positives = 293/450 (65%), Gaps = 35/450 (8%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y  VWSS      Q G A+ WLP PP GY A+G  VT S +KP  D + CV + FTD CE
Sbjct  110   YAPVWSS------QDGAAHFWLPTPPDGYRAIGVAVTASPDKPPRDEVACVRADFTDACE  163

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL----GSFSGNVGTFACLKN  1204
              E  VW       D +GF+   LRP  RG  A+GV  GTF+     + + +    ACLKN
Sbjct  164   AEATVW-------DKDGFSAVALRPAVRGVDARGVHAGTFVLARSDATAASASALACLKN  216

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
             N  A++S  MP+L+Q+ AL   Y+P L+LHP + Y PSSV WFF NGALLY KG++T P 
Sbjct  217   NGAAYTS-CMPDLAQVNALLAAYAPQLFLHPDEPYLPSSVTWFFQNGALLYQKGNQT-PT  274

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              +  DGSNLPQGG NDG YW++LPVDN+++ERVK+GDL  ++VY+  KPM G T TD+A+
Sbjct  275   PVAADGSNLPQGGGNDGGYWLDLPVDNSQRERVKKGDLPGAKVYVQAKPMLGATATDLAV  334

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W FYPFNGP+ AK+G +  IPLG IGEH+GDWEH+TLR+SNF+G L ++YFS+HS G+WV
Sbjct  335   WFFYPFNGPARAKVGPLT-IPLGKIGEHVGDWEHVTLRVSNFSGELLRMYFSQHSAGAWV  393

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTG--L  496
             DAP LE+++G N+  AYSSL+GHA Y + GLVLQG     +GIRND  + +  LDTG   
Sbjct  394   DAPQLEYLDGGNRPSAYSSLHGHALYPRAGLVLQGDARLGVGIRNDCDRGSR-LDTGGAG  452

Query  495   RYSVVAG------LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLI  334
             R  VV+         G+ EP W+ + REWGP+  Y    +I RV  LLP   R   E L 
Sbjct  453   RCEVVSAEYLGGGGGGVAEPTWLLFDREWGPREEYDIGREINRVAKLLP---RSTRERLR  509

Query  333   HLLPNEFFGEEGPTGPNMKASWSGDEK*GK  244
              L+ + F G EGPTGP MK SW  DE+  K
Sbjct  510   KLVESVFVG-EGPTGPRMKGSWRNDEREAK  538



>ref|XP_007149125.1| hypothetical protein PHAVU_005G043100g [Phaseolus vulgaris]
 gb|ESW21119.1| hypothetical protein PHAVU_005G043100g [Phaseolus vulgaris]
Length=580

 Score =   426 bits (1094),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 223/436 (51%), Positives = 293/436 (67%), Gaps = 18/436 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTL+WSS++  I Q GP Y+WLP+ P GY AVG+V T +   PS D++ CV S FTD CE
Sbjct  160   YTLIWSSENTKIDQDGPIYIWLPIAPDGYKAVGNVATNTSGMPSLDKVMCVRSDFTDECE  219

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNVA  1192
                 +WG  T+N       +Y +RP NRG QA GV+VGTF+   + N    +CLKNNN  
Sbjct  220   TNGSIWGLDTAN-------VYDVRPSNRGIQAPGVRVGTFVAG-NPNPPPISCLKNNNPI  271

Query  1191  FSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIGP  1012
                + MPNL QI+A+   YSP+++LHP + Y PSSV WFF+N ALLY KG    P  I  
Sbjct  272   --PNHMPNLKQIKAILEVYSPVMFLHPDEEYFPSSVEWFFANEALLYRKGGGI-PEIITL  328

Query  1011  DGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIFY  832
             +GSNLPQ   NDG YW++LP+D   +E VK+GD +S+  Y+++KPM GGTFTD+ +W FY
Sbjct  329   NGSNLPQDPHNDGAYWIDLPLDPAVQEIVKKGDSKSALSYVHVKPMLGGTFTDVVLWTFY  388

Query  831   PFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAPN  652
             PFNGP+ AK+  I  + LG IGEH+GDWEH+TLRISNF+G L ++YFS+HS G W+DA  
Sbjct  389   PFNGPARAKVEFI-TLNLGKIGEHVGDWEHVTLRISNFDGELKQMYFSQHSKGMWLDASQ  447

Query  651   LEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAGL  472
             +E+  G N  + YSSL+GHA+Y   GL L G   +GIRNDT K   VLD  + Y +VA  
Sbjct  448   IEYQTG-NTPLFYSSLHGHASYPHAGLHLVGQNAVGIRNDTDK-GNVLDL-IAYQLVAAE  504

Query  471   ---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEE  301
                  +VEPPW+ Y REWGPKI Y  ++++K++E L P   R V E ++  LP+E  GEE
Sbjct  505   YLGSQVVEPPWLNYYREWGPKIDYDIDDELKKLEKLFPGRLRSVIENIVKKLPSEVLGEE  564

Query  300   GPTGPNMKASWSGDEK  253
             GPTGP  K +W+GDE+
Sbjct  565   GPTGPKEKDNWNGDER  580



>ref|XP_002884254.1| hypothetical protein ARALYDRAFT_340259 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60513.1| hypothetical protein ARALYDRAFT_340259 [Arabidopsis lyrata subsp. 
lyrata]
Length=590

 Score =   425 bits (1093),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 226/432 (52%), Positives = 289/432 (67%), Gaps = 20/432 (5%)
 Frame = -2

Query  1551  YTLVWSSDSL-PITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPS--GDRIRCVFSAFTD  1381
             YT V ++ SL  I Q GPAY W P+ P GY AVG  VTTS  KPS   D I CV S  T+
Sbjct  163   YTEVGNTTSLISIKQDGPAYFWQPLCPNGYQAVGLYVTTSPVKPSLGQDSINCVRSELTE  222

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFA----C  1213
               E + WVW             + +LRP  RG +A GV  GTF  SF  N+        C
Sbjct  223   KSEADTWVW-------RIKDMTISSLRPATRGVEATGVYTGTF--SFK-NLKLLPPPLFC  272

Query  1212  LKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET  1033
             LKN  + F  S+MP+ +Q   LF+ YSP +YLHP + + PSSV+W F+NGALLY KG+E+
Sbjct  273   LKN--IKFDLSSMPSENQTRVLFQTYSPWIYLHPQEDFLPSSVDWVFANGALLYQKGNES  330

Query  1032  NPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
             NPV I P+GSNLPQGG ND ++W++  VD   +E+VKRGDL S++VYL+IKPMFG TFTD
Sbjct  331   NPVLIHPNGSNLPQGGCNDDLFWLDYLVDEKAREKVKRGDLGSTKVYLHIKPMFGATFTD  390

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             I +W+F+P+NG +  K   I+ + LG IGEH+GDWEH+TLRISNFNG L +VYFSEHSGG
Sbjct  391   IVVWLFFPYNGNAHLKFLFIKSMSLGNIGEHVGDWEHVTLRISNFNGELWRVYFSEHSGG  450

Query  672   SWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLR  493
             + VDA +LEFI G NK V YSSL+GHA +SKPG+VLQG G  GIRND A+S    D  + 
Sbjct  451   TLVDACDLEFIQGGNKPVVYSSLHGHAMFSKPGVVLQGGGKSGIRNDMARSDKFFDASIG  510

Query  492   YSVVAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEF  313
             Y V+AG  G+VEPPW+ Y R+WGP++ Y  ++ +  V  +LP+  R     LI+ +P E 
Sbjct  511   YEVIAG-PGVVEPPWLNYFRKWGPRVHYNIDKFLNSVAKILPIFLRKGLRKLINKIPLEV  569

Query  312   FGEEGPTGPNMK  277
              G+ GPTGP +K
Sbjct  570   LGQNGPTGPKVK  581



>tpg|DAA63291.1| TPA: hypothetical protein ZEAMMB73_737791 [Zea mays]
Length=559

 Score =   424 bits (1089),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 230/448 (51%), Positives = 292/448 (65%), Gaps = 32/448 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVWSS        G  + WLP  P+GY AVG VVT + +KPS D +RCV + FTD CE
Sbjct  127   YALVWSS------PDGAGHFWLPTAPEGYKAVGVVVTAAADKPSPDEVRCVRADFTDACE  180

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFS-------GNVGTFAC  1213
              ED VW     ++D +GF+  TLRP  RG +A+GV  GTFL   S       G   T AC
Sbjct  181   AEDSVW-----SSDKDGFSASTLRPAVRGIEARGVHAGTFLAQSSATPAAAAGVSTTLAC  235

Query  1212  LKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET  1033
             LKNN+ +++SS MP+L+Q+ +L   Y+P +YLHP + Y PSSV WFF NGAL+Y KG   
Sbjct  236   LKNNSASYTSS-MPDLAQLNSLLAAYAPHVYLHPNEPYFPSSVAWFFENGALMYQKGSSQ  294

Query  1032  NPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
              P  +  DGSNLPQGG NDG YW++LP D N++E+ KRGDL  ++VY+  KPM GGT  D
Sbjct  295   TPTPVAADGSNLPQGGGNDGGYWLDLPADGNQREKAKRGDLAGAKVYVQAKPMLGGTVAD  354

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             +A+WIFYPFNGP+ AK+G I  IPLG IGEH+GDWEH+TLR+SNF+G L ++YFS+HS G
Sbjct  355   LAVWIFYPFNGPARAKVGLIPSIPLGEIGEHVGDWEHVTLRVSNFSGELLRMYFSQHSAG  414

Query  672   SWVDAPNLEFINGSN----KSVAYSSLNGHANYSKPGLVLQGIG--DIGIRNDTAKSAAV  511
             +WVDA  LE+++G +    + VAY+SL+GHA Y   G VLQG     IGIRND A+  + 
Sbjct  415   TWVDASRLEYLDGGDGGGSRPVAYASLHGHAFYPNAGTVLQGNSGLGIGIRNDCAR-GSR  473

Query  510   LDTGL-RYSVV-AGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETL  337
             LDTG  R  VV A   G+ EP W+ + REWGP+  Y    +I R   LLP   R V E L
Sbjct  474   LDTGAGRCEVVSAEYLGVKEPAWLGFEREWGPRDEYDIGREINRAARLLP---RSVRERL  530

Query  336   IHLLPNEFFGEEGPTGPNMKASWSGDEK  253
               L+     G EGPTGP M  +W  DE+
Sbjct  531   AKLVEKVLVG-EGPTGPKMHGNWRNDER  557



>ref|XP_010496430.1| PREDICTED: uncharacterized protein LOC104773501 [Camelina sativa]
Length=587

 Score =   424 bits (1091),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 222/436 (51%), Positives = 283/436 (65%), Gaps = 13/436 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPS--GDRIRCVFSAFTDP  1378
             YT V ++ SL I Q GPAY W P+ P GY AVG  VTTS  KPS   D I CV    T+ 
Sbjct  160   YTEVGNTISLSIKQDGPAYFWQPLCPNGYQAVGLYVTTSPLKPSLGQDSISCVRRDLTEQ  219

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF-LGSFSGNVGTFACLKNN  1201
              E + WVW             + +LRP  RGT A GV  GTF     +       CLKN 
Sbjct  220   TEADTWVW-------RIKEMTISSLRPAKRGTAATGVYTGTFSFKQVNFPAPPLYCLKNT  272

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
                F  S+MP+ +Q   LF+ YSP +YLHP + Y PSSVNW F+NGALLY KG+E NPV 
Sbjct  273   R--FDLSSMPSKNQTRLLFQTYSPWIYLHPEEEYLPSSVNWVFTNGALLYQKGNEFNPVP  330

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             +  +GSNLP+GG+ND ++W++  V+   KE+VKRGDL S++ YL+IKPMFG TFTDI +W
Sbjct  331   VYSNGSNLPKGGSNDDLFWLDYLVEKEAKEKVKRGDLGSAKAYLHIKPMFGATFTDIVVW  390

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             +FYPFNG +  K   I+ + LGMIGEH+GDWEH+TLRISNFNG L +VYFS+HSGG+ ++
Sbjct  391   LFYPFNGNAHLKFLFIKSLSLGMIGEHVGDWEHVTLRISNFNGELWRVYFSKHSGGTLME  450

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVV  481
             A +LEF  G NK V YSSL+GHA + KPGLVLQG    GIRND A+S   LD G+ Y V+
Sbjct  451   ACDLEF-QGGNKPVVYSSLHGHAMFPKPGLVLQGKYKSGIRNDMARSDKFLDAGVAYEVI  509

Query  480   AGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEE  301
             AG   + EPPW+ Y R+WGP++ Y  +     +  +LP   R     L   +P E FG++
Sbjct  510   AGPGVVHEPPWLNYLRKWGPRVHYTIDNIRHYIAKILPFFIRAGLRKLTRKIPKEVFGQD  569

Query  300   GPTGPNMKASWSGDEK  253
             GPTGP  K +W+GDE+
Sbjct  570   GPTGPKSKVTWTGDEQ  585



>ref|XP_009134576.1| PREDICTED: uncharacterized protein LOC103858883 [Brassica rapa]
Length=587

 Score =   424 bits (1089),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 229/438 (52%), Positives = 285/438 (65%), Gaps = 16/438 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKP--SGDRIRCVFSAFTDP  1378
             Y  V ++ SL I Q G AY W P+ P GY AVG  VTTS  KP    + I CV S  T+ 
Sbjct  160   YIEVGNTTSLAIKQDGAAYFWQPLCPSGYRAVGLFVTTSPLKPPLRQESISCVGSHLTEQ  219

Query  1377  CEVED--WVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTF-ACLK  1207
                 D  WVW          G     LRP NRGT+A G+  GTF          F +CL+
Sbjct  220   KSEADTTWVWTM-------EGITFSGLRPANRGTEATGMYTGTFSFQQQNYPRPFLSCLR  272

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N     SS  MP+  Q   LFR YSP++Y HP + + PSSV+W FSNGALLY KG+E+NP
Sbjct  273   NTKFDLSS-MMPSQDQTRVLFRAYSPLIYFHPEEEFLPSSVDWIFSNGALLYQKGNESNP  331

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             V + P+GSNLPQGG++D +YW++ P D   +ERVKRGDL +++VYL+IKPMFGGTFTDI 
Sbjct  332   VPVQPNGSNLPQGGSDDDLYWLDYPADKKARERVKRGDLGNTKVYLHIKPMFGGTFTDIV  391

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +WIF PFNG +  K+  I+ + LG IGEHIGDWEH+TLRISNFNG L +VYFSEHSGGS 
Sbjct  392   VWIFSPFNGNARLKILFIKSLSLGDIGEHIGDWEHVTLRISNFNGELWRVYFSEHSGGSL  451

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGI-GDIGIRNDTAKSAAVLDTGLRY  490
             V+A +LEF +G NK V Y+SL+GHA +SKPGLVLQG  G+ G+RND A+S   LD G  Y
Sbjct  452   VEACDLEFQSG-NKPVVYASLHGHALFSKPGLVLQGQDGNNGLRNDMARSDKFLDAGADY  510

Query  489   SVVAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
              V+ G  GI EPPW+ Y R+WGP + +  E+ +  +   LP   R  F  L+H +P E  
Sbjct  511   EVIGG-PGITEPPWLNYFRKWGPIVRHDVEKTLDSIAKTLPQLLRKRFRDLVHSIPPEVL  569

Query  309   GEEGPTGPNMKASWSGDE  256
              E GPTGP +K SWS DE
Sbjct  570   QEMGPTGPKVKKSWSADE  587



>ref|NP_001060082.1| Os07g0575900 [Oryza sativa Japonica Group]
 dbj|BAC83058.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30244.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21996.1| Os07g0575900 [Oryza sativa Japonica Group]
Length=522

 Score =   421 bits (1081),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 229/450 (51%), Positives = 290/450 (64%), Gaps = 35/450 (8%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y  VWSS      Q   A+ WLP PP GY A+G  VT S +KP  D + CV + FTD CE
Sbjct  94    YAPVWSS------QDDAAHFWLPTPPDGYRAIGVAVTASPDKPPRDEVACVRADFTDACE  147

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL----GSFSGNVGTFACLKN  1204
              E  VW       D +GF+   LRP  RG  A+GV  GTF+     + + +    ACLKN
Sbjct  148   AEATVW-------DKDGFSAVALRPAVRGVDARGVHAGTFVLARSDATAASASALACLKN  200

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
             N  A++S  MP+L+Q+ AL   Y+P L+LHP + Y PSSV WFF NGALLY KG +T P 
Sbjct  201   NGAAYTS-CMPDLAQVNALLAAYAPQLFLHPDEPYLPSSVTWFFQNGALLYQKGSQT-PT  258

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              +  DGSNLPQGG NDG YW++LPVDN ++ERVK+GDL  ++VY+  KPM G T TD+A+
Sbjct  259   PVAADGSNLPQGGGNDGGYWLDLPVDNFQRERVKKGDLAGAKVYVQAKPMLGATATDLAV  318

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W FYPFNGP+ AK+G +  IPLG IGEH+GDWEH+TLR+SNF+G L ++YFS+HS G+WV
Sbjct  319   WFFYPFNGPARAKVGPLT-IPLGKIGEHVGDWEHVTLRVSNFSGELLRMYFSQHSAGAWV  377

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTG--L  496
             DAP LE+++G N+  AYSSL+GHA Y + GLVLQG     +GIRND  + +  LDTG   
Sbjct  378   DAPQLEYLDGGNRPSAYSSLHGHALYPRAGLVLQGDARLGVGIRNDCDRGSR-LDTGGAG  436

Query  495   RYSVVAG------LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLI  334
             R  VV+         G+ EP W+ + REWGP+  Y    +I RV  LLP   R   E L 
Sbjct  437   RCEVVSAEYLGGGGGGVAEPTWLLFDREWGPREEYDIGREINRVAKLLP---RSTRERLR  493

Query  333   HLLPNEFFGEEGPTGPNMKASWSGDEK*GK  244
              L+ + F G EGPTGP MK SW  DE+  K
Sbjct  494   KLVESVFVG-EGPTGPRMKGSWRNDEREAK  522



>ref|NP_001145101.1| uncharacterized protein LOC100278316 [Zea mays]
 gb|ACG45082.1| hypothetical protein [Zea mays]
Length=559

 Score =   422 bits (1084),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 230/448 (51%), Positives = 293/448 (65%), Gaps = 32/448 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVWSS        G  + WLP  P+GY AVG VVT + +KPS D +RCV + FTD CE
Sbjct  127   YALVWSS------PDGAGHFWLPTAPEGYKAVGVVVTAAADKPSPDEVRCVRADFTDACE  180

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFS-------GNVGTFAC  1213
              E+ VW     ++D +GF+  TLRP  RG +A+GV  GTFL   S       G   T AC
Sbjct  181   TEESVW-----SSDKDGFSASTLRPAVRGIEARGVHAGTFLAQSSATPAAAAGVSTTLAC  235

Query  1212  LKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET  1033
             LKNN+ +++SS MP+L+Q+ +L   Y+P +YLHP + Y PSSV WFF NGAL+Y KG   
Sbjct  236   LKNNSASYTSS-MPDLAQLNSLLAAYAPHVYLHPNEPYFPSSVAWFFENGALMYQKGSSQ  294

Query  1032  NPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
              P  +  DGSNLPQGG NDG YW++LP D N++E+VKRGDL  ++VY+  KPM GGT  D
Sbjct  295   TPTPVPADGSNLPQGGGNDGGYWLDLPADGNQREKVKRGDLAGAKVYVQAKPMLGGTVAD  354

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             +A+WIFYPFNGP+ AK+G I  IPLG IGEH+GDWEH+TLR+SNF+G L ++YFS+HS G
Sbjct  355   LAVWIFYPFNGPARAKVGLIPSIPLGEIGEHVGDWEHVTLRVSNFSGELLRMYFSQHSAG  414

Query  672   SWVDAPNLEFINGSN----KSVAYSSLNGHANYSKPGLVLQGIG--DIGIRNDTAKSAAV  511
             +WVDA  LE+++G +    + VAY+SL+GHA Y   G VLQG     IGIRND A+ +  
Sbjct  415   TWVDASRLEYLDGGDGGGSRPVAYASLHGHAFYPNAGTVLQGNSGLGIGIRNDCARGSR-  473

Query  510   LDTGL-RYSVV-AGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETL  337
             LDTG  R  VV A   G+ EP W+ + REWGP+  Y    +I R   LLP   R V E L
Sbjct  474   LDTGAGRCEVVSAEYLGVKEPAWLGFEREWGPRDEYDIGREINRAARLLP---RSVRERL  530

Query  336   IHLLPNEFFGEEGPTGPNMKASWSGDEK  253
               L+     G EGPTGP M  +W  DE+
Sbjct  531   AKLVEKVLVG-EGPTGPKMHGNWRNDER  557



>gb|EEE67462.1| hypothetical protein OsJ_24853 [Oryza sativa Japonica Group]
Length=538

 Score =   421 bits (1081),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 229/450 (51%), Positives = 290/450 (64%), Gaps = 35/450 (8%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y  VWSS      Q   A+ WLP PP GY A+G  VT S +KP  D + CV + FTD CE
Sbjct  110   YAPVWSS------QDDAAHFWLPTPPDGYRAIGVAVTASPDKPPRDEVACVRADFTDACE  163

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL----GSFSGNVGTFACLKN  1204
              E  VW       D +GF+   LRP  RG  A+GV  GTF+     + + +    ACLKN
Sbjct  164   AEATVW-------DKDGFSAVALRPAVRGVDARGVHAGTFVLARSDATAASASALACLKN  216

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
             N  A++S  MP+L+Q+ AL   Y+P L+LHP + Y PSSV WFF NGALLY KG +T P 
Sbjct  217   NGAAYTS-CMPDLAQVNALLAAYAPQLFLHPDEPYLPSSVTWFFQNGALLYQKGSQT-PT  274

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              +  DGSNLPQGG NDG YW++LPVDN ++ERVK+GDL  ++VY+  KPM G T TD+A+
Sbjct  275   PVAADGSNLPQGGGNDGGYWLDLPVDNFQRERVKKGDLAGAKVYVQAKPMLGATATDLAV  334

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W FYPFNGP+ AK+G +  IPLG IGEH+GDWEH+TLR+SNF+G L ++YFS+HS G+WV
Sbjct  335   WFFYPFNGPARAKVGPLT-IPLGKIGEHVGDWEHVTLRVSNFSGELLRMYFSQHSAGAWV  393

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTG--L  496
             DAP LE+++G N+  AYSSL+GHA Y + GLVLQG     +GIRND  + +  LDTG   
Sbjct  394   DAPQLEYLDGGNRPSAYSSLHGHALYPRAGLVLQGDARLGVGIRNDCDRGSR-LDTGGAG  452

Query  495   RYSVVAG------LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLI  334
             R  VV+         G+ EP W+ + REWGP+  Y    +I RV  LLP   R   E L 
Sbjct  453   RCEVVSAEYLGGGGGGVAEPTWLLFDREWGPREEYDIGREINRVAKLLP---RSTRERLR  509

Query  333   HLLPNEFFGEEGPTGPNMKASWSGDEK*GK  244
              L+ + F G EGPTGP MK SW  DE+  K
Sbjct  510   KLVESVFVG-EGPTGPRMKGSWRNDEREAK  538



>ref|XP_002460910.1| hypothetical protein SORBIDRAFT_02g037340 [Sorghum bicolor]
 gb|EER97431.1| hypothetical protein SORBIDRAFT_02g037340 [Sorghum bicolor]
Length=553

 Score =   421 bits (1082),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 232/445 (52%), Positives = 296/445 (67%), Gaps = 31/445 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVWSS        G  + WLP  P+GY AVG VVT + +KPS D +RCV S FTD  E
Sbjct  126   YALVWSS------PDGAGHFWLPTAPEGYKAVGVVVTAAADKPSPDEVRCVRSDFTDASE  179

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFS----GNVGTFACLKN  1204
             +ED V       +D +GF+  TLRP  RG  A+GV  GTFL   S    G   T ACLKN
Sbjct  180   IEDTVL-----TSDKDGFSAATLRPAVRGIDARGVHAGTFLAQSSATPAGASTTPACLKN  234

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
             N+ +++S AMP+L+Q+ +L   Y+P +YLHP ++Y PSSV WFF N ALLY KG +T P 
Sbjct  235   NSASYTS-AMPDLAQVNSLLAAYAPHVYLHPNESYLPSSVTWFFENDALLYQKGSQT-PT  292

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              +  DGSNLPQGG NDG YW++LPVDNN++E+VK+GDL  ++VY+  KPM GGT TD+A+
Sbjct  293   PVAADGSNLPQGGGNDGGYWLDLPVDNNQREKVKKGDLAGAKVYVQAKPMLGGTVTDLAV  352

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF+PFNGP+ AK+G I+ IPLG IGEH+GDWEH+TLR+SNF+G L +VYFS+HS G+WV
Sbjct  353   WIFFPFNGPARAKVGLIQSIPLGKIGEHVGDWEHVTLRVSNFSGELLRVYFSQHSAGTWV  412

Query  663   DAPNLEFI---NGSNKSVAYSSLNGHANYSKPGLVLQG---IGDIGIRNDTAKSAAVLDT  502
             DA  LE++   +G N+ VAY+S +GHA Y   G VLQG   +G IGIRND A+ +  LDT
Sbjct  413   DASRLEYLADGDGGNRPVAYASQHGHAFYPNAGTVLQGNTSLG-IGIRNDCARGSR-LDT  470

Query  501   GLRYSVVAGLQ--GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             G     V  ++  G+ EP WV + REWGP+  Y    +I R   +LP   R V E L  L
Sbjct  471   GAGRCEVVSVEYLGVKEPAWVGFEREWGPREEYDIGREINRAARILP---RSVRERLAKL  527

Query  327   LPNEFFGEEGPTGPNMKASWSGDEK  253
             +     G EGPTGP M  +W  DEK
Sbjct  528   VEKVLVG-EGPTGPKMHGNWRNDEK  551



>ref|XP_010485351.1| PREDICTED: uncharacterized protein LOC104763704 [Camelina sativa]
Length=581

 Score =   422 bits (1084),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 225/436 (52%), Positives = 284/436 (65%), Gaps = 16/436 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPS--GDRIRCVFSAFTDP  1378
             YT V ++ SL I Q GPAY W P+ P GY AVG  VTTS  KPS   D I CV +  T+ 
Sbjct  157   YTEVGNTISLSIKQDGPAYFWQPLCPNGYQAVGLYVTTSPLKPSLGQDSISCVRTDLTEQ  216

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF-LGSFSGNVGTFACLKNN  1201
              E + WVW             L +LRP  RGT A GV  GTF     +       CLKN 
Sbjct  217   SEADTWVW-------RIKEMTLSSLRPAKRGTVATGVYTGTFSFKQLNFPAPPLYCLKNT  269

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
                F  S+MP+ +Q   LF+ YSP +YLHP + Y PSSVNW F+NGALLY KG+E +PV 
Sbjct  270   R--FDLSSMPSKNQTRLLFQTYSPWIYLHPEEEYLPSSVNWVFTNGALLYQKGNEFSPVP  327

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             +  +GSNLPQGG+ND ++W++  V   EKE+VKRGDL S++ YL+IKPMFG TFTDI +W
Sbjct  328   VHINGSNLPQGGSNDNLFWLDYLV---EKEKVKRGDLGSAKAYLHIKPMFGATFTDIVVW  384

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             +FYPFNG +  K   I+ + LGMIGEH+GDWEH+TLRISNFNG L +VYFS+HSGG+ V+
Sbjct  385   LFYPFNGNAHLKFLFIKSLSLGMIGEHVGDWEHVTLRISNFNGELWRVYFSKHSGGTLVE  444

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVV  481
             A +LEF  G NK V YSSL+GHA + KPGLVLQG    GIRND A+S   LD G+ Y V+
Sbjct  445   ACDLEF-QGGNKPVVYSSLHGHAVFPKPGLVLQGKYKSGIRNDMARSDKFLDAGVGYEVI  503

Query  480   AGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEE  301
             AG   + EPPW+ Y R+WGP++ Y  +     +  +LP   R     LI  +P E  G++
Sbjct  504   AGPGVVHEPPWLNYLRKWGPRVHYTIDNIRHYIAKILPFFIRAGLRKLIRKIPKEVLGQD  563

Query  300   GPTGPNMKASWSGDEK  253
             GPTGP  K +W+GDE+
Sbjct  564   GPTGPKSKVTWTGDEQ  579



>emb|CDX74324.1| BnaA03g27230D [Brassica napus]
Length=587

 Score =   422 bits (1084),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 228/438 (52%), Positives = 286/438 (65%), Gaps = 16/438 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKP--SGDRIRCVFSAFTDP  1378
             Y  V ++ SL + Q GPAY W P+ P GY  VG  VTTS  KP    + I CV S  T+ 
Sbjct  160   YIEVGNTTSLTVKQDGPAYFWQPLCPSGYGVVGLFVTTSPLKPPLRQESISCVGSHLTEE  219

Query  1377  CEVED--WVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTF-ACLK  1207
                 D  WVW          G     LRP NRGT+A GV  GTF          F +CL+
Sbjct  220   RSEADTTWVWTM-------EGITFSGLRPANRGTEATGVYAGTFSFQQQNYPRPFLSCLR  272

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N     SS  MP+  Q   LFR YSP++Y HP + + PSSV+W FSNGALLY +G+E+NP
Sbjct  273   NTKFDLSS-MMPSQDQTRVLFRAYSPLIYFHPEEEFLPSSVDWIFSNGALLYQEGNESNP  331

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             V + P+GSNL QGG++D +YW++ P D   +ERVKRGDL +++VYL+IKPMFGGTFTDIA
Sbjct  332   VPVQPNGSNLLQGGSDDDLYWLDYPADKKARERVKRGDLGNTKVYLHIKPMFGGTFTDIA  391

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +WIF PFNG +  K+  I+ + LG IGEHIGDWEH+TLRISNFNG L +VYFSEHSGGS 
Sbjct  392   VWIFSPFNGNARLKILFIKSLSLGDIGEHIGDWEHVTLRISNFNGELWRVYFSEHSGGSL  451

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGI-GDIGIRNDTAKSAAVLDTGLRY  490
             V+A +LEF +G NK V Y+SL+GHA +SKPGLVLQG  G+ G+RND A+S   LD G+ Y
Sbjct  452   VEACDLEFQSG-NKPVVYASLHGHAMFSKPGLVLQGQDGNNGLRNDMARSDKFLDAGVDY  510

Query  489   SVVAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
              V+ G  GI EPPW+ Y R+WGP + +  E+ +  +   LP   R  F  L+H +P E  
Sbjct  511   EVIGG-PGITEPPWLNYFRKWGPIVRHDVEKTLDSIAKTLPQLLRKRFRDLVHSIPPEVL  569

Query  309   GEEGPTGPNMKASWSGDE  256
              E GPTGP +K SWS DE
Sbjct  570   QEMGPTGPKVKKSWSADE  587



>ref|XP_003610391.1| hypothetical protein MTR_4g131710 [Medicago truncatula]
 gb|AES92588.1| pre-mRNA processing protein PRP39, putative [Medicago truncatula]
Length=586

 Score =   420 bits (1079),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 221/445 (50%), Positives = 288/445 (65%), Gaps = 23/445 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YT V  + S   TQ  P Y+WLPV P GY A+GHVVT + +KP  D+I CV S  T+ CE
Sbjct  151   YTFVLKAKSYSATQVLPLYIWLPVAPNGYRALGHVVTKTRDKPPLDKIMCVRSDLTEKCE  210

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFS--GNVGTFACLKNNN  1198
                 +W       +   FN Y +RPI+RGTQA+G+ VGTF+       N  + +CLKN N
Sbjct  211   TSSLIW-------ESEDFNFYDVRPISRGTQARGIHVGTFVAQNGRLTNPPSISCLKNLN  263

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRI  1018
                 S  MPNL QI+A+ + YSP +YLHP + Y PSSVNWFFSNGALLY KG E+NP  I
Sbjct  264   SI--SKIMPNLQQIKAILKVYSPFVYLHPDEKYLPSSVNWFFSNGALLYKKGHESNPRPI  321

Query  1017  GPDGSNLPQG--GTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
               +G+NLPQG    +D  YW++LP D+  K+RVK+G+LQS+E Y+++KPMFGGTFTD A+
Sbjct  322   AQNGTNLPQGPNPKHDRAYWIDLPADHANKDRVKQGNLQSAESYVHVKPMFGGTFTDFAM  381

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W FYPFNGP   K+G I  I L  IGEH+GDWEH+TLR+SN +G L KVYFS H  GSWV
Sbjct  382   WTFYPFNGPGRLKIGFIN-IKLERIGEHVGDWEHVTLRVSNLDGKLWKVYFSHHKTGSWV  440

Query  663   DAPNLEFINGSN-------KSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLD  505
             D+  LEF N ++       + V ++SL+GH+ Y   GLVL G   IG R+DT KS+ V+D
Sbjct  441   DSSQLEFQNDTSNIDFPTKRPVVHASLHGHSTYPHAGLVLLGKKGIGARDDTDKSSKVMD  500

Query  504   TGLRYSVVAGLQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIH  331
              G    V A   G  + EP W+ + R WGP + Y  E+++ +++ L   + + VFE +I 
Sbjct  501   MGKYVLVSAEYLGSKVKEPAWLNFYRTWGPHVDYKLEDELNKLKKLFLGKLKHVFEKVIR  560

Query  330   LLPNEFFGEEGPTGPNMKASWSGDE  256
              LP E   EEGPTGP  K +W+GDE
Sbjct  561   GLPKEMLQEEGPTGPKEKKNWNGDE  585



>gb|KFK37645.1| hypothetical protein AALP_AA3G010100 [Arabis alpina]
Length=1024

 Score =   432 bits (1112),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 226/437 (52%), Positives = 289/437 (66%), Gaps = 15/437 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDR---IRCVFSAFTD  1381
             YT V ++ SL I Q GP Y W PV   GY A+G  VT+S +KP   R   I CV S  T+
Sbjct  597   YTEVGNTSSLNIKQDGPVYFWQPVCLNGYQAIGLFVTSSPQKPPLGRQESISCVLSNLTE  656

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF-LGSFSGNVGTFACLKN  1204
               E + W+WG         G ++++LRP+ RG QA GV  GTF     +  + +  CLKN
Sbjct  657   QSEADTWIWGI-------KGISIFSLRPVKRGAQATGVYTGTFSFQQRNSPLPSLFCLKN  709

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
               + F  S+MP+  Q   LF+ YSP +Y HP + + PSSVNWFF NGALLY KG+E NPV
Sbjct  710   --MKFDLSSMPSEDQTRVLFQAYSPWIYFHPKEDFLPSSVNWFFGNGALLYQKGNEYNPV  767

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I P+GSNLPQ   ND ++W++ P D N KE++KRGD+ +++VYL+IKPMFG TFTDI +
Sbjct  768   PIQPNGSNLPQSSCNDDLFWLDYPDDENAKEKIKRGDIGNTKVYLHIKPMFGSTFTDIVV  827

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIFYPFNG +  K   I+ + LG IGEHIGDWEH+TLRISNFNG L +VY S+HSGG+ V
Sbjct  828   WIFYPFNGNARLKFWFIKSLSLGDIGEHIGDWEHVTLRISNFNGELWRVYLSQHSGGALV  887

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSV  484
             DA +LEF  G NK V YSSL+GHA + +PGLVLQG G  GIRND   S  +LD G+ Y V
Sbjct  888   DACDLEF-KGGNKPVIYSSLHGHAMFPRPGLVLQGGGKNGIRNDMETSDKLLDCGVGYEV  946

Query  483   VAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGE  304
             +A   GIVEPPW  Y R+WGP+++    + +  +  +LP   R  F  LI  +P E  GE
Sbjct  947   IAA-SGIVEPPWTNYSRKWGPRVSSNIGKSLSTIAKILPSFIRKGFRKLIGRIPIEVLGE  1005

Query  303   EGPTGPNMKASWSGDEK  253
             +GPTGP +K SW+GDEK
Sbjct  1006  DGPTGPKVKLSWTGDEK  1022


 Score =   426 bits (1095),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 223/430 (52%), Positives = 289/430 (67%), Gaps = 14/430 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKP--SGDRIRCVFSAFTDP  1378
             YT V  + ++ + Q GPAY W PV P GY AVG   T S +KP  + D I CV S  T+ 
Sbjct  50    YTEVGDTTTIIVRQDGPAYFWQPVCPDGYEAVGLSFTNSPQKPPLTKDSISCVRSDLTEQ  109

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF-LGSFSGNVGTFACLKNN  1201
              E + WVWG        N   + +LRP+ RGT+A GV  GTF     +    +F+CLKN 
Sbjct  110   SEADTWVWGI-------NEITISSLRPVIRGTEATGVYTGTFSFQQVNIPSRSFSCLKN-  161

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
                F  S+MP+  Q   LF+ YSP +YLHP D + PSSVNWFF+NGALLY +G+E+NPV 
Sbjct  162   -TKFDLSSMPSNDQTRVLFQAYSPWVYLHPNDDFRPSSVNWFFANGALLYQQGNESNPVP  220

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I P+GSNLPQGG++DG++W++ PVD   KE+VKRGD+ S++VYL+IKPMFGGTFTDI +W
Sbjct  221   IQPNGSNLPQGGSDDGLFWLDYPVDGIAKEKVKRGDIGSTKVYLHIKPMFGGTFTDIVVW  280

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             IFYPFNG +  K   I+ +PLG IG+H+GDWEH+TLRISNFNG L +VYFSEHS G+ ++
Sbjct  281   IFYPFNGNARLKFLFIKSLPLGDIGQHVGDWEHVTLRISNFNGELWRVYFSEHSRGTLME  340

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVV  481
             A ++EF  G NK V YSS +GHA YS+PGLVLQG  + GIRND A+S    D G  Y ++
Sbjct  341   ACDVEF-QGGNKPVVYSSFHGHAMYSRPGLVLQGNDENGIRNDMARSNKFFDAGAGYELI  399

Query  480   AGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEE  301
             AG  GIVEP W+ Y R+WGP + +  + D++ V   LP   R  F  LI  +P+E   E+
Sbjct  400   AG-PGIVEPAWLNYFRKWGPTVQHDIQRDLEGVAKSLPGLLRKKFRDLISKIPSEVLEEK  458

Query  300   GPTGPNMKAS  271
             GP GP  K +
Sbjct  459   GPLGPKAKRT  468



>ref|XP_006408555.1| hypothetical protein EUTSA_v10020344mg [Eutrema salsugineum]
 gb|ESQ50008.1| hypothetical protein EUTSA_v10020344mg [Eutrema salsugineum]
Length=596

 Score =   420 bits (1080),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 225/441 (51%), Positives = 291/441 (66%), Gaps = 19/441 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPS---GDRIRCVFSAFTD  1381
             Y  V +++S+ + Q GPAY+W P+ P GY AVG  VTTS  KP+    + I CV S  T+
Sbjct  166   YIQVGNTNSINVKQDGPAYIWQPLCPNGYQAVGLSVTTSPTKPTLRQEESISCVRSDLTE  225

Query  1380  PCEVED-WVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGN---VGTFAC  1213
               E ++ WVWG            L   RP  RGT+A GV  GTF  SF        + +C
Sbjct  226   QSEADNTWVWGIKEMTT------LSGSRPAKRGTEATGVYTGTF--SFQQQNFPPPSLSC  277

Query  1212  LKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET  1033
             L+N  +  S S+MP+  Q   LFR YSP +Y HP + + PSSV+W FSNGALLY KG+E+
Sbjct  278   LRNTRLFDSLSSMPSEDQTRDLFRAYSPWIYFHPREEFLPSSVDWVFSNGALLYQKGNES  337

Query  1032  NPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
             NPV + P+GSNLPQGG++D +YW++ P D   +ER+KRGDL +++VYL++KPMFG TFTD
Sbjct  338   NPVPVKPNGSNLPQGGSDDDLYWLDYPADEGARERLKRGDLGNNKVYLHVKPMFGATFTD  397

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             I +WIF PFNG +  K   I+ + LG IGEHIGDWEH+TLRISNFNG L +VYFSEHSGG
Sbjct  398   IVVWIFCPFNGNARLKFLFIKSLSLGDIGEHIGDWEHVTLRISNFNGELWRVYFSEHSGG  457

Query  672   SWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG--IGDIGIRNDTAKSAAVLDTG  499
             + V+A +LEF  G NK VAYSSL+GHA +S+PG+V+QG   G+ G+RND AKS    D G
Sbjct  458   TLVEACDLEF-QGGNKPVAYSSLHGHAMFSRPGVVVQGGQDGNNGVRNDMAKSDKFFDAG  516

Query  498   LRYSVVAGLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
               Y VVAG  GIVEPPW+ Y R+WGP + +  E+ +  +   LP   R     LI+ +P 
Sbjct  517   AGYEVVAG-PGIVEPPWLNYLRKWGPIVRHDIEKTLDGIAKTLPGLLRKKLRNLINKIPR  575

Query  318   EFFGEEGPTGPNMKASWSGDE  256
             E    EGPTGP +K SW+ DE
Sbjct  576   ELLQGEGPTGPKVKTSWTADE  596



>ref|XP_002863623.1| hypothetical protein ARALYDRAFT_494605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39882.1| hypothetical protein ARALYDRAFT_494605 [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   416 bits (1069),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 218/444 (49%), Positives = 288/444 (65%), Gaps = 16/444 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS+ L   +S   Y WLP PPQGY  +G +VTTS  KP  D++RCV +  TD CE
Sbjct  123   YTLVWSSNDLS-EESQSGYFWLPQPPQGYKTIGFLVTTSPSKPELDQVRCVRADLTDKCE  181

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSG----NVGTFACLKN  1204
                 V     SN+      ++  RP +RG   KGV  GTF  +       ++ T ACLKN
Sbjct  182   AHK-VIITAISNSLSIPLFIWQTRPSDRGMWGKGVSTGTFFCTTQSPEEDHLSTIACLKN  240

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              + +    AMPN+ QI AL + Y P +Y HP + Y PSSV+WFF NGA+L +  + ++  
Sbjct  241   LDSSLH--AMPNMEQIHALIQHYGPRVYFHPNEVYLPSSVSWFFRNGAVLCSNSNSSDIN  298

Query  1023  R-IGPDGSNLPQGGTNDGVYWVNLPV-DNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDI  850
               I   GSNLP GGTND  YW++LP+ D   +E +KRG+L+SS++Y+++KP FGGTFTD+
Sbjct  299   EPIDETGSNLPHGGTNDKRYWIDLPINDQQRREFLKRGNLESSKLYVHVKPAFGGTFTDL  358

Query  849   AIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGS  670
             A WIF PFNGP+T KLG +  I L   G+H+ DWEH TLRISNF+G +  +YFS+HSGG 
Sbjct  359   AFWIFCPFNGPATLKLG-LMNISLAKTGQHVCDWEHFTLRISNFSGEIYSIYFSQHSGGE  417

Query  669   WVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG--IGDIGIRNDTAKSAAVLDTGL  496
             W+   +LEFI GSNK+V YSS +GHA++SK GL LQG  +  IGIRNDTA+S   +D+ L
Sbjct  418   WIKPQDLEFIEGSNKAVVYSSKHGHASFSKSGLYLQGSDLLGIGIRNDTARSDFFVDSSL  477

Query  495   RYSVVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
             RY +VA       +VEPPW+ Y REWGPKI Y S  +I+++   LP   R   + ++  +
Sbjct  478   RYEIVAAEYLGDAVVEPPWLGYMREWGPKIVYNSRSEIEKLNERLPWRMRSWVDAVLRKI  537

Query  324   PNEFFGEEGPTGPNMKASWSGDEK  253
             P E  GEEGPTGP  K +W GDE+
Sbjct  538   PVELSGEEGPTGPKEKDNWFGDER  561



>ref|NP_199208.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09055.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL24350.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13309.1| unknown protein [Arabidopsis thaliana]
 gb|AED95036.1| uncharacterized protein AT5G43950 [Arabidopsis thaliana]
Length=566

 Score =   414 bits (1065),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 217/447 (49%), Positives = 293/447 (66%), Gaps = 18/447 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAY--VWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             YTLVWSS+ L   +   +Y   WLP PPQGY  +G++VTTS  KP  D++RCV +  TD 
Sbjct  123   YTLVWSSNDLSEERQSESYGYFWLPQPPQGYKPIGYLVTTSPAKPELDQVRCVRADLTDK  182

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSG----NVGTFACL  1210
             CE    V     S++      ++  RP +RG + KGV  GTF  +       ++ T ACL
Sbjct  183   CEAHK-VIITAISDSLSIPMFIWKTRPSDRGMRGKGVSTGTFFCTTQSPEEDHLSTIACL  241

Query  1209  KNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETN  1030
             KN + +    AMPN+ QI A+ + Y P +Y HP + Y PSSV+WFF NGALL +  + + 
Sbjct  242   KNLDSSLH--AMPNIEQIHAMIQHYGPRVYFHPNEVYLPSSVSWFFKNGALLCSNSNSSV  299

Query  1029  PVR--IGPDGSNLPQGGTNDGVYWVNLPV-DNNEKERVKRGDLQSSEVYLNIKPMFGGTF  859
                  I   GSNLP GGTND  YW++LP+ D   +E +KRGDL+SS++Y+++KP FGGTF
Sbjct  300   INNEPIDETGSNLPHGGTNDKRYWIDLPINDQQRREFIKRGDLESSKLYVHVKPAFGGTF  359

Query  858   TDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHS  679
             TD+A WIF PFNGP+T KLG ++ + L   G+H+ DWEH T+RISNF+G L  +YFS+HS
Sbjct  360   TDLAFWIFCPFNGPATLKLGLMD-LSLAKTGQHVCDWEHFTVRISNFSGELYSIYFSQHS  418

Query  678   GGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG--IGDIGIRNDTAKSAAVLD  505
             GG W+   NLEF+ GSNK+V YSS NGHA++SK G+ LQG  +  IGIRND+AKS   +D
Sbjct  419   GGEWIKPENLEFVEGSNKAVVYSSKNGHASFSKSGMYLQGSALLGIGIRNDSAKSDLFVD  478

Query  504   TGLRYSVVAG--LQG-IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLI  334
             + L+Y +VA   L+G +VEPPW+ Y REWGPKI Y S  +I+++   LP   R   + ++
Sbjct  479   SSLKYEIVAAEYLRGAVVEPPWLGYMREWGPKIVYNSRSEIEKLNERLPWRLRSWVDAVL  538

Query  333   HLLPNEFFGEEGPTGPNMKASWSGDEK  253
               +P E  GEEGPTGP  K +W GDE+
Sbjct  539   RKIPVELSGEEGPTGPKEKNNWFGDER  565



>ref|XP_010420612.1| PREDICTED: uncharacterized protein LOC104706157 [Camelina sativa]
Length=556

 Score =   414 bits (1063),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 215/446 (48%), Positives = 285/446 (64%), Gaps = 35/446 (8%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWSSDS         Y WLP PP GY AVG +VT   E+P  D +RCV    T+ CE
Sbjct  130   YSLVWSSDS-------DCYFWLPNPPAGYRAVGVIVTDGPEEPEVDEVRCVREDLTESCE  182

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT--------FA  1216
               + V G G+       FN+++ +P  RG  ++GV VG+F    S +  +         A
Sbjct  183   ASEKVLGVGS-------FNVWSTKPCERGIWSRGVAVGSFFCCTSSDRSSDNKAAAMNIA  235

Query  1215  CLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDE  1036
             CLKN + + +   MPNL Q+ AL   Y P++Y HP +TY PSSV WFF NGALLY  G  
Sbjct  236   CLKNLDPSLN--GMPNLDQVHALIHHYGPMVYFHPEETYLPSSVPWFFKNGALLYRNGTS  293

Query  1035  TNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
                 +I PDGSNLP GG NDG YW++LP D+  +  +K+G+L+SSE+Y+++KP  GG FT
Sbjct  294   QGE-KINPDGSNLPAGGENDGSYWIDLPEDDEVRSNLKKGNLESSELYVHVKPAVGGIFT  352

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             DI +WIF PFNGP+T K+G +  +P+  +GEH+GDWEH T RISNF+G L +++FS+HSG
Sbjct  353   DIVMWIFCPFNGPATLKIGLL-TVPMNRVGEHVGDWEHFTFRISNFSGELTQMFFSQHSG  411

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDT  502
             G WVD  +LEF+ GSNK V YSS +GHA++  PG+ LQG     IG+RND AKS  V+D+
Sbjct  412   GGWVDVSDLEFVKGSNKPVVYSSKHGHASFPHPGMYLQGPSKLGIGVRNDVAKSNYVVDS  471

Query  501   GLRYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLI  334
               RY +VA    G   + EP W+++ REWGP I Y S  +I ++  LLP+  R  FE+  
Sbjct  472   SQRYRIVAAEYLGEGAVSEPCWLQFMREWGPTIVYDSAAEINKIFDLLPLIVRYSFES--  529

Query  333   HLLPNEFFGEEGPTGPNMKASWSGDE  256
              L P E +GEEGPTGP  K +W GDE
Sbjct  530   -LFPIELYGEEGPTGPKEKDNWVGDE  554



>ref|XP_006281615.1| hypothetical protein CARUB_v10027740mg [Capsella rubella]
 gb|EOA14513.1| hypothetical protein CARUB_v10027740mg [Capsella rubella]
Length=565

 Score =   412 bits (1059),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 214/445 (48%), Positives = 292/445 (66%), Gaps = 18/445 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPA--YVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             YTLVWSS+ L   +   +  Y WLP PPQGY  +G +VTTS  +P  D++RCV +  TD 
Sbjct  126   YTLVWSSNDLSEERQSESCGYFWLPQPPQGYKPIGFLVTTSPVRPELDQVRCVRADLTDQ  185

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSG----NVGTFACL  1210
             CE    V   G S++      ++  RP++RG   KGV  GTF  +       ++ T ACL
Sbjct  186   CEAHK-VIITGISDSLQVPLFIWKTRPLDRGMWGKGVSTGTFFCTTQSPEEDHLRTIACL  244

Query  1209  KNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETN  1030
             KN + +    AMPN+ QI AL + Y P +Y HP + Y PSSV+WFF NGA+L +      
Sbjct  245   KNLDSSLH--AMPNIEQIHALIQHYGPRVYFHPNEIYLPSSVSWFFKNGAVLCSSDIINE  302

Query  1029  PVRIGPDGSNLPQGGTNDGVYWVNLPV-DNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
             P  I   GSNLP GGTND  +W++LP+ D   +E++KRGDL+SS++Y+++KP FGGTFTD
Sbjct  303   P--IDETGSNLPHGGTNDKQFWLDLPINDQQRREKLKRGDLESSKLYVHVKPAFGGTFTD  360

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             +A WIF PFNGP+T KLG +  + L   G+H+ DWEH TLRISNF+G L  +Y S+HSGG
Sbjct  361   LAFWIFCPFNGPATLKLG-LMNLSLAKTGQHVCDWEHFTLRISNFSGELYSIYLSQHSGG  419

Query  672   SWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG--IGDIGIRNDTAKSAAVLDTG  499
              W++  +LEF+ GSN++V YSS +GHA++++ G+ LQG  +  IGIRNDTA+S   +D+ 
Sbjct  420   EWIEPQDLEFVEGSNRAVVYSSKHGHASFARSGMYLQGSDLLGIGIRNDTARSDLFVDSS  479

Query  498   LRYSVVAG--LQG-IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             LRY +VA   L G +VEPPW+ Y REWGPKI Y S  +I+++   LP   R + + ++  
Sbjct  480   LRYEIVAAEYLGGVVVEPPWLGYMREWGPKIVYDSRTEIEKLNERLPWRLRSLIDAVLRK  539

Query  327   LPNEFFGEEGPTGPNMKASWSGDEK  253
             LP E  GEEGPTGP  K +W GDE+
Sbjct  540   LPVELSGEEGPTGPKEKNNWFGDER  564



>ref|XP_010454091.1| PREDICTED: uncharacterized protein LOC104735910 [Camelina sativa]
Length=556

 Score =   410 bits (1054),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 213/446 (48%), Positives = 283/446 (63%), Gaps = 35/446 (8%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWSSDS         Y W P PP GY AVG +VT   E+P  D +RCV    T+ CE
Sbjct  130   YSLVWSSDS-------DCYFWFPNPPAGYRAVGVIVTDGPEEPEADEVRCVREDLTESCE  182

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT--------FA  1216
               + V G G+       FN+++ +P  RG  ++GV VG+F    S +  +         A
Sbjct  183   ASEKVLGVGS-------FNVWSTKPCERGIWSRGVAVGSFFCCTSSDRSSDNKAAAMNIA  235

Query  1215  CLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDE  1036
             CLKN + + +   MPNL Q+ AL   Y P++Y HP +TY PSSV WFF NGALLY  G  
Sbjct  236   CLKNLDPSLN--GMPNLDQVHALIHHYGPLVYFHPEETYLPSSVPWFFKNGALLYRNGTS  293

Query  1035  TNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
                 +I  DGSNLP+GG NDG YW++LP D+  +  +K+G+L SSE+Y+++KP  GG FT
Sbjct  294   QGE-KINSDGSNLPEGGENDGSYWIDLPEDDEVRSNLKKGNLDSSELYVHVKPAVGGIFT  352

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             DI +WIF PFNGP+T K+G +  +P+  +GEH+GDWEH T RISNF+G L +++FS+HSG
Sbjct  353   DIVMWIFCPFNGPATLKIGLL-TVPMNRVGEHVGDWEHFTFRISNFSGELTQMFFSQHSG  411

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDT  502
             G WVD  +LEF+ GSNK V YSS +GHA++  PG+ LQG     IG+RND AKS  V+D+
Sbjct  412   GGWVDVSDLEFVKGSNKPVVYSSKHGHASFPHPGMYLQGPSKLGIGVRNDVAKSNYVVDS  471

Query  501   GLRYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLI  334
               RY +VA    G   + EP W+++ REWGP I Y S  +I ++  LLP+  R  FE+  
Sbjct  472   SQRYRIVAAEYLGEGAVSEPCWLQFMREWGPTIVYDSAAEINKIIDLLPLIVRYSFES--  529

Query  333   HLLPNEFFGEEGPTGPNMKASWSGDE  256
              L P E +GEEGPTGP  K +W GDE
Sbjct  530   -LFPIELYGEEGPTGPKEKDNWVGDE  554



>ref|XP_006287419.1| hypothetical protein CARUB_v10000625mg [Capsella rubella]
 gb|EOA20317.1| hypothetical protein CARUB_v10000625mg [Capsella rubella]
Length=552

 Score =   410 bits (1053),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 215/444 (48%), Positives = 283/444 (64%), Gaps = 33/444 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWSSDS         Y WLP PP GY AVG +VT   E+P  D +RCV    T+ CE
Sbjct  128   YSLVWSSDS-------DCYFWLPNPPAGYRAVGVIVTDGSEEPEVDEVRCVREDLTESCE  180

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG------TFACL  1210
               + V G G+       FN+++ +P  RG  ++GV VG+F  S S            ACL
Sbjct  181   TGEKVLGVGS-------FNVWSTKPCERGIWSRGVAVGSFFCSTSDRSSDNKSSMNIACL  233

Query  1209  KNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETN  1030
             KN + +     MPNL Q+ AL + Y P++Y HP +TY PSSV WFF NGALLY  G  + 
Sbjct  234   KNLDPSLH--GMPNLDQVHALIQHYGPMVYFHPEETYLPSSVPWFFKNGALLYRFG-ASQ  290

Query  1029  PVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDI  850
                I  DGSNLP GG NDG +W++LP D+  +  +K+G+++SSE+Y+++KP  GG FTDI
Sbjct  291   GEPINSDGSNLPAGGENDGGFWIDLPEDDEVRSNIKKGNIESSELYVHVKPALGGIFTDI  350

Query  849   AIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGS  670
              +WIF PFNGP+T K+G +  +P+  +GEH+GDWEH T RISNFNG L+++YFS+HSGG 
Sbjct  351   VMWIFCPFNGPATLKIGLL-TVPMNRVGEHVGDWEHFTFRISNFNGELSQMYFSQHSGGG  409

Query  669   WVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGL  496
             WVD  +LEF+ GSNK V YSS +GHA++  PGL LQG     IG+RND AKS   +D+  
Sbjct  410   WVDVSDLEFVKGSNKPVVYSSKHGHASFPHPGLYLQGSSKLGIGVRNDVAKSKYAVDSSQ  469

Query  495   RYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             RY +VA    G   + EP W+++ REWGP I Y S  +I ++  LLP+  R  FE+   L
Sbjct  470   RYMIVAAEYLGEGAVSEPCWLQFMREWGPTIVYDSAAEINKIIDLLPLILRYSFES---L  526

Query  327   LPNEFFGEEGPTGPNMKASWSGDE  256
              P E +GEEGPTGP  K +W GDE
Sbjct  527   FPIELYGEEGPTGPKEKDNWVGDE  550



>ref|XP_010481793.1| PREDICTED: uncharacterized protein LOC104760554 [Camelina sativa]
Length=565

 Score =   409 bits (1052),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 214/445 (48%), Positives = 289/445 (65%), Gaps = 18/445 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPA--YVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             YTLVWSS+ L   +   +  Y WLP PP+GY  +G +VTTS  KP  D++RCV +  TD 
Sbjct  126   YTLVWSSNDLSEERQHESCGYFWLPQPPKGYKPIGFLVTTSPVKPELDQVRCVRADLTDK  185

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSG----NVGTFACL  1210
             CE    V     S++      ++  RP +RG   KGV  GTF  +       ++ T ACL
Sbjct  186   CEAHK-VLITAFSDSLSMPLFIWKTRPSDRGVCGKGVSTGTFFCTTHSPEEDHLRTIACL  244

Query  1209  KNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETN  1030
             KN++ +    AMPN+ QI AL + Y P +Y HP + Y PSSV+WFF NGA+L +      
Sbjct  245   KNHDSSLH--AMPNIEQIHALVQHYGPRVYFHPNEIYLPSSVSWFFKNGAVLCSSDINNE  302

Query  1029  PVRIGPDGSNLPQGGTNDGVYWVNLPV-DNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
             P  I   GSNLP GGTND  +W++LP+ D   +E++KRGDL+S+++Y+++KP FGGTFTD
Sbjct  303   P--IDETGSNLPHGGTNDKQFWIDLPINDQQRREKLKRGDLESAKLYVHVKPAFGGTFTD  360

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             +  WIF PFNGP+T KLG +  + L   G+H+ DWEH TLRISNF+G L  VYFS+HSGG
Sbjct  361   LVFWIFCPFNGPATLKLG-LMNLSLAKTGQHVCDWEHFTLRISNFSGELYSVYFSQHSGG  419

Query  672   SWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG--IGDIGIRNDTAKSAAVLDTG  499
              W++  +LEF+ GSN++V YSS +GHA+++  G+ LQG  +  IGIRNDTA S   +D+ 
Sbjct  420   EWIEPQDLEFVGGSNRAVVYSSKHGHASFATSGMYLQGSDMLGIGIRNDTAASDLFVDSS  479

Query  498   LRYSVVAG--LQG-IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             LRY +VA   L G +VEPPW+ Y REWGPKI Y S  +I+R+   LP+  R   + ++  
Sbjct  480   LRYEIVAAEYLGGVVVEPPWLGYMREWGPKIVYDSRTEIERLNERLPLRLRTWLDAVLRK  539

Query  327   LPNEFFGEEGPTGPNMKASWSGDEK  253
             LP E  GEEGPTGP  K +W GDE+
Sbjct  540   LPVELSGEEGPTGPKEKNNWYGDER  564



>ref|XP_010492853.1| PREDICTED: uncharacterized protein LOC104770176 [Camelina sativa]
Length=556

 Score =   409 bits (1050),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 213/446 (48%), Positives = 286/446 (64%), Gaps = 35/446 (8%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWSSDS         Y WLP PP GY AVG +VT   ++P  D +RCV    T+ CE
Sbjct  130   YSLVWSSDS-------DCYFWLPNPPAGYRAVGVIVTEGPDEPEVDEVRCVREDLTESCE  182

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT--------FA  1216
               + V G G+       FN++  +P  RG  ++GV VG+F    S +  +         A
Sbjct  183   ASEKVLGVGS-------FNVWNTKPCERGIWSRGVAVGSFFCCTSSDRSSDNKAAAMNIA  235

Query  1215  CLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDE  1036
             CLKN + + +   MPNL Q+ AL   Y P++Y HP +TY PSSV WFF NGALLY  G  
Sbjct  236   CLKNLDPSLN--GMPNLDQVHALIHHYGPLVYFHPEETYLPSSVPWFFKNGALLYCNGIS  293

Query  1035  TNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
                 +I  DGSNLP GG NDG +W++LP D++ +  +K+G+++SSE+Y+++KP  GG FT
Sbjct  294   QGE-KINSDGSNLPAGGENDGSFWIDLPEDDDVRSNLKKGNIESSELYVHVKPAVGGIFT  352

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             DI +WIF PFNGP+T K+G +  +P+  +GEH+GDWEH T RISNFNG L +++FS+HSG
Sbjct  353   DIVMWIFCPFNGPATLKIGLL-TLPMNRVGEHVGDWEHFTFRISNFNGELTQMFFSQHSG  411

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDT  502
             G WVD  +LEF+ GSNK V YSS +GHA++  PG+ LQG     IG+RND AKS  V+D+
Sbjct  412   GGWVDVSDLEFVKGSNKPVVYSSKHGHASFPHPGMYLQGPSKLGIGVRNDVAKSKYVVDS  471

Query  501   GLRYSVVAGL---QGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLI  334
               RY +VA     +G+V EP W+++ REWGP I Y S  +I ++  LLP+  R  FE+  
Sbjct  472   SQRYRIVAAEYLGEGVVSEPCWLQFMREWGPTIVYDSAAEINKIIDLLPLIVRYSFES--  529

Query  333   HLLPNEFFGEEGPTGPNMKASWSGDE  256
              L P E +GEEGPTGP  K +W GDE
Sbjct  530   -LFPIELYGEEGPTGPKEKDNWVGDE  554



>ref|XP_004511442.1| PREDICTED: uncharacterized protein LOC101506697 isoform X2 [Cicer 
arietinum]
Length=543

 Score =   407 bits (1046),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 225/445 (51%), Positives = 285/445 (64%), Gaps = 18/445 (4%)
 Frame = -2

Query  1551  YTLVWSSDS---LPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTD  1381
             YTLVW +DS     +T    AY WLP PP+GY A+G++VT + EKP  D I CV    TD
Sbjct  104   YTLVWCTDSGRKKMVTLVDSAYFWLPQPPEGYKALGYLVTNNHEKPDLDEISCVRVDLTD  163

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFS----GNVGTFAC  1213
              CE    ++  G S      F ++ LRP +RG   KGV VGTF  S      G      C
Sbjct  164   KCEPYRTLFDVG-SILPKFPFWVWNLRPCDRGMLGKGVSVGTFFCSSCCWNKGEELPVMC  222

Query  1212  LKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET  1033
             LKN N      AMP L QI AL   Y P ++ HP + Y PSSV+WFFSNGALLY KG E+
Sbjct  223   LKNLNPVLP--AMPRLDQINALIEHYGPTVFFHPDEVYLPSSVDWFFSNGALLYRKG-ES  279

Query  1032  NPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
                 I  +GSNLP GGTNDG +W++LP D   +E +K GDL+S+++Y+++KP FGGTFTD
Sbjct  280   KGEAIDSNGSNLPGGGTNDGEFWIDLPSDVIRRESIKHGDLESAKLYVHVKPAFGGTFTD  339

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             I +WIF PFNGPST K G I+ I    IGEHIGDWEH TLRISNF+G L  +Y+S+HSGG
Sbjct  340   IVMWIFCPFNGPSTLKFG-IKSISFNKIGEHIGDWEHFTLRISNFSGELWSIYYSQHSGG  398

Query  672   SWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTG  499
              WVDA +LE+I+G NK+V YSS NGHA+Y  PG  +QG     IGIRND  +S   +D+ 
Sbjct  399   KWVDAYDLEYIDG-NKAVVYSSKNGHASYFYPGTYIQGSSKLGIGIRNDARRSNLCVDSS  457

Query  498   LRYSVVAG--LQGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             + Y VVA   L  +V EP W+++ R WGPKI Y S+ ++ ++   LP+  R  F  L+  
Sbjct  458   VSYEVVAAEYLGDVVKEPQWLQFMRLWGPKIVYDSKTELDKILHALPIRLRSSFGNLLKK  517

Query  327   LPNEFFGEEGPTGPNMKASWSGDEK  253
             LP E +GEEGPTGP  K +W GDE+
Sbjct  518   LPVELYGEEGPTGPKEKNTWIGDER  542



>ref|XP_006403160.1| hypothetical protein EUTSA_v10003172mg [Eutrema salsugineum]
 gb|ESQ44613.1| hypothetical protein EUTSA_v10003172mg [Eutrema salsugineum]
Length=564

 Score =   408 bits (1048),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 218/449 (49%), Positives = 289/449 (64%), Gaps = 21/449 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPI--TQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             YTLVWSS+ L     + G  Y WLP PP+GY  +G VVTTS  KP  D++RCV +  TD 
Sbjct  120   YTLVWSSNDLSEEPQRRGCGYFWLPQPPRGYKPMGFVVTTSPSKPESDQVRCVRADLTDE  179

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF-LGSFSG-------NVGT  1222
             CE    V     S++      ++  RP +RG   +GV VGTF  G+ S        ++  
Sbjct  180   CEAYR-VIITAISDSLSVPLFIWKTRPSDRGMWGRGVSVGTFNCGTRSPEEEEDIVSINN  238

Query  1221  FACLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKG  1042
              ACLKNN+ +    AMPNL QI AL R Y P +Y HP + Y PSSV+WFF NGA+L    
Sbjct  239   IACLKNNDSSLH--AMPNLDQIHALIRHYGPTVYFHPDEAYLPSSVSWFFKNGAVL-CSS  295

Query  1041  DETNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKER-VKRGDLQSSEVYLNIKPMFGG  865
             D      +  +GSNLP GGTND  +W++LP ++ ++ + + RGDL+SS++Y+++KP FGG
Sbjct  296   DSNFQEPVDENGSNLPHGGTNDKQFWIDLPRNDEQRSKFLMRGDLESSKLYVHVKPAFGG  355

Query  864   TFTDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSE  685
             TFTD+A WIF PFNGP+T KLG +  +PL   G+H+ DWEH TLRISNF+G L  VYFS+
Sbjct  356   TFTDLAFWIFCPFNGPATLKLGLVN-LPLAKTGQHVCDWEHFTLRISNFSGELYAVYFSQ  414

Query  684   HSGGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG--IGDIGIRNDTAKSAAV  511
             HSGG W++A +LEF+ GSNK V YSS +GHA++ + G+ LQG  +  IGIRNDTA+S   
Sbjct  415   HSGGEWIEAQDLEFVGGSNKPVVYSSKHGHASFGRSGMYLQGSDLLGIGIRNDTARSDLF  474

Query  510   LDTGLRYSVVAGLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFET  340
             +D+  RY +VA       +VEPPW+ Y REWGPKI Y S  +I+R+   LP   R   + 
Sbjct  475   VDSSSRYEIVAAEYLGGAVVEPPWLGYMREWGPKIVYGSRTEIERLNERLPWRLRCWVDA  534

Query  339   LIHLLPNEFFGEEGPTGPNMKASWSGDEK  253
             ++  LP E  GEEGPTGP  K +W GDE+
Sbjct  535   VLRKLPVELSGEEGPTGPKEKNNWFGDER  563



>ref|XP_007147204.1| hypothetical protein PHAVU_006G104300g [Phaseolus vulgaris]
 gb|ESW19198.1| hypothetical protein PHAVU_006G104300g [Phaseolus vulgaris]
Length=523

 Score =   406 bits (1044),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 210/442 (48%), Positives = 279/442 (63%), Gaps = 18/442 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+L+WS+DS      G  Y WLP PP GY A+G VVT + ++P  +++RCV +  T+ CE
Sbjct  89    YSLIWSADS---PHDGSGYFWLPNPPFGYKAMGIVVTKTPDEPEVEQVRCVRADLTENCE  145

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGN---VGTFACLKNN  1201
               D +     S      F ++  RP  RG  ++GV VGTF  S   +   V   ACLKN 
Sbjct  146   TCDLLLSM-NSKFSKVSFKVWNTRPCKRGMWSRGVSVGTFFCSTYSDYEQVADIACLKNL  204

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             +      AMPNL Q+ AL   Y P +Y HP + Y PSSV WFF NGA++Y++G E     
Sbjct  205   DSTLH--AMPNLDQVHALINHYGPTVYFHPDEIYLPSSVQWFFKNGAVVYSRGSEKGKA-  261

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I   GSNLP GGTNDG +W++ P DN+ +  +K+GD++S+E+Y+++KP  GGTFTDIA+W
Sbjct  262   IDNQGSNLPSGGTNDGAFWIDFPRDNDARSNIKKGDIESAELYVHVKPALGGTFTDIAMW  321

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             +F PFNGP   ++G +  I +  IGEH+GDWEH TLR+SNF G L  V+FS+HSGG W++
Sbjct  322   VFCPFNGPGILQVGLV-NIEMNKIGEHVGDWEHFTLRVSNFTGELWSVFFSQHSGGEWIN  380

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGI--RNDTAKSAAVLDTGLRYS  487
             A NLEFI G NK V YSS +GHA++   G+ LQG   +GI  RN+ A+S   +D+  RY 
Sbjct  381   AFNLEFIEG-NKPVVYSSRHGHASFPHAGIYLQGASKLGIGARNEAARSKLAVDSSSRYK  439

Query  486   VVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
             VVA    G   I EP W++Y REWGP I Y S  +I ++ +LLPV  R     L  L P 
Sbjct  440   VVAAEYLGEGAIAEPSWLQYMREWGPAIVYGSRSEIDKLINLLPVYVRLSVVNLFELFPT  499

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E +GEEGP GP  KA+W GDEK
Sbjct  500   ELYGEEGPIGPKGKANWEGDEK  521



>ref|XP_009802615.1| PREDICTED: uncharacterized protein LOC104248123 [Nicotiana sylvestris]
Length=571

 Score =   407 bits (1046),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 214/445 (48%), Positives = 286/445 (64%), Gaps = 21/445 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQS--GPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             YTLVWSS  +   ++  G  Y WLP PP+GY A+G + T    KP    ++CV +  TD 
Sbjct  135   YTLVWSSSDVGSEENFDGSGYFWLPQPPEGYKALGFIATNKPVKPELGEVKCVRADLTDE  194

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF---SGNVGTFACLK  1207
             CE    +    TS+       ++++RP +RG   KG+  GTF  S    +G   + ACLK
Sbjct  195   CETHRLI--LKTSSVLSEVLAVWSIRPRHRGMHGKGISAGTFFCSCYWSTGEELSIACLK  252

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET-N  1030
             + +++    AMPNL QI A+ R Y P L+ HP + Y PSSV WFF NGALLYT+GD    
Sbjct  253   SFDMSLQ--AMPNLDQIHAIIRHYGPTLFFHPDEVYLPSSVQWFFDNGALLYTRGDSVVK  310

Query  1029  PVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDI  850
             P+   PDGSNLP GGTNDG YW++LP D   +E VK G+LQS+++Y+++KP  GGTFTDI
Sbjct  311   PIE--PDGSNLPGGGTNDGQYWIDLPSDV-RREIVKFGNLQSAKLYVHVKPALGGTFTDI  367

Query  849   AIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGS  670
             A+WIF PFNGP+T K+G +  +PL  IG+H+GDWEH TLR+SNF G L  +YFS+HSGG 
Sbjct  368   AMWIFCPFNGPATLKVGLVN-VPLSKIGQHVGDWEHFTLRVSNFTGELWSIYFSQHSGGE  426

Query  669   WVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGL  496
             WVDA +LEFI G NK+  YSS NGHA++  PG  +QG     IGIRND A+S   +D+  
Sbjct  427   WVDAYDLEFIAG-NKATVYSSKNGHASFPHPGNYMQGSSKLGIGIRNDAARSNLCIDSST  485

Query  495   RYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             +Y ++A    G   + EP W++Y REWGP I Y S ++++++   LPV  R   + +   
Sbjct  486   KYEIMAAEYLGHGAVSEPCWLQYMREWGPTIIYDSRKELEKIVDRLPVMVRNSVQNIFDK  545

Query  327   LPNEFFGEEGPTGPNMKASWSGDEK  253
             LP E F EEGPTGP  K +W GDE+
Sbjct  546   LPVELFKEEGPTGPKEKNNWVGDER  570



>gb|KHN49063.1| hypothetical protein glysoja_031274 [Glycine soja]
Length=518

 Score =   405 bits (1040),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 219/444 (49%), Positives = 274/444 (62%), Gaps = 56/444 (13%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVW++ SL I Q G  Y+WLP+ P+GY  VGHVVTTS EKPS D+IRCV S  TD C 
Sbjct  120   YKLVWNTKSLKIKQDGQGYIWLPIAPEGYKPVGHVVTTSPEKPSLDKIRCVRSDLTDECT  179

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFA----CLKN  1204
                 +    T N     FN+Y +RPI RG +A+GV VGTFL    G   + A    CLKN
Sbjct  180   TCHSMKLWRTENKR---FNVYDVRPIKRGIEAQGVSVGTFLAQSGGGTNSKALPISCLKN  236

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET-NP  1027
                +FS   MPNLSQI+A+ + YSP +YLHP++ Y PSSV+WFF+NGA+L  K       
Sbjct  237   TKGSFS--YMPNLSQIKAMIKAYSPYMYLHPMEEYLPSSVDWFFTNGAVLIEKRKGVIRE  294

Query  1026  VRIGPDGSNLPQGGTNDG---VYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
               I P+GSNLPQGG+ND     YW++LP+D  ++  +K+GDL SS+ Y+++KPM GGTFT
Sbjct  295   SSIEPNGSNLPQGGSNDDDDVTYWLDLPLDETKRVSIKKGDLASSQAYVHVKPMLGGTFT  354

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             DI +WIFYPFNG + AK+     IPL   GEH+GDWEHLTLR+SNFNG L +VYFS+HS 
Sbjct  355   DIVMWIFYPFNGGARAKVA-CTNIPLRTKGEHVGDWEHLTLRVSNFNGELWRVYFSQHSE  413

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGL  496
             G WVDA  LEF NG N+  AYSSL+GHA + KPGLV+QG+  +G+RND A+S AV+D   
Sbjct  414   GKWVDASELEFQNG-NRPAAYSSLHGHALFPKPGLVMQGMRGLGVRNDAARSDAVMDMAT  472

Query  495   RYSVVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
              + +VA       I EPPW+ Y   WGPK                               
Sbjct  473   WFEIVAAEYLGSQIREPPWLNYWMNWGPK-------------------------------  501

Query  324   PNEFFGEEGPTGPNMKASWSGDEK  253
                    EGP GP  K  W GDE+
Sbjct  502   -------EGPKGPKQKDMWKGDER  518



>ref|XP_010441929.1| PREDICTED: uncharacterized protein LOC104725034 [Camelina sativa]
Length=568

 Score =   406 bits (1044),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 214/447 (48%), Positives = 286/447 (64%), Gaps = 20/447 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQS---GPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTD  1381
             YTLVWSS+ L   +       Y WLP PPQGY  +G +VTTS  KP  D++RCV +  TD
Sbjct  127   YTLVWSSNDLSEERQISECSGYFWLPQPPQGYKPIGFLVTTSPVKPELDQVRCVRADLTD  186

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSG----NVGTFAC  1213
              CE    V     S++      ++  RP +RG   KGV  GTF  +       ++ T AC
Sbjct  187   KCEAHK-VLITAFSDSLSIPLFIWKTRPSDRGVWGKGVSTGTFFCTTQSPEEDHLRTIAC  245

Query  1212  LKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET  1033
             LKN + +    AMPN+ QI AL + Y P +Y HP +TY PSSV+WFF NGA+L +     
Sbjct  246   LKNLDSSLH--AMPNMEQIHALVQHYGPRVYFHPNETYLPSSVSWFFKNGAVLCSSDINN  303

Query  1032  NPVRIGPDGSNLPQGGTNDGVYWVNLPV-DNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
              P  I   GSNLP GGTND  +W++LP+ D   +E++KRGD +S+++Y+++KP FGGTFT
Sbjct  304   EP--IDETGSNLPHGGTNDKQFWIDLPINDQQRREKLKRGDRESAKLYVHVKPTFGGTFT  361

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             D+  WIF PFNGP+T KLG +  + L   G+H+ DWEH TLRISNF+G L  +YFS+HSG
Sbjct  362   DLVFWIFCPFNGPATLKLG-LMNLSLAKTGQHVCDWEHFTLRISNFSGELYSIYFSQHSG  420

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG--IGDIGIRNDTAKSAAVLDT  502
             G W++  +LEF+ GSN++V YSS +GHA+++  G+ LQG  +  IGIRNDTA S   +D+
Sbjct  421   GEWIEPQDLEFVGGSNRAVVYSSKHGHASFATSGMYLQGSDMLGIGIRNDTATSDLFVDS  480

Query  501   GLRYSVVAG--LQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLI  334
              LRY +VA   L G  +VEPPW+ Y REWGPKI Y S  +I+R+   LP+  R     ++
Sbjct  481   SLRYEIVAAEYLGGGVVVEPPWLGYMREWGPKIVYDSRTEIERLNERLPLRLRSWLVAVL  540

Query  333   HLLPNEFFGEEGPTGPNMKASWSGDEK  253
               LP E  GEEGPTGP  K +W GDE+
Sbjct  541   RKLPVELSGEEGPTGPKEKNNWFGDER  567



>ref|XP_002873898.1| hypothetical protein ARALYDRAFT_909860 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50157.1| hypothetical protein ARALYDRAFT_909860 [Arabidopsis lyrata subsp. 
lyrata]
Length=553

 Score =   405 bits (1042),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 214/444 (48%), Positives = 283/444 (64%), Gaps = 33/444 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWSSDS         Y WLP PP GY AVG +VT   E+P  D +RCV    T+ CE
Sbjct  129   YSLVWSSDS-------DCYFWLPNPPVGYRAVGVIVTDGSEEPEVDEVRCVREDLTESCE  181

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGS---FSGNVGT---FACL  1210
               + V G G+       FN+++ +P   G  ++GV+VG+F  S    S N       ACL
Sbjct  182   TGEKVLGMGS-------FNVWSTKPCETGIWSRGVEVGSFFCSTNDMSSNYKAAMNIACL  234

Query  1209  KNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETN  1030
             KN + +     MPNL Q+ AL + Y P++Y HP +TY PSSV WFF NGALLY  G ++ 
Sbjct  235   KNLDPSLH--GMPNLDQVHALIQHYGPMVYFHPEETYMPSSVPWFFKNGALLYRSG-KSQ  291

Query  1029  PVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDI  850
                I   GSNLP GG NDG +W++LP D+  +  +K+G+L+SSE+Y+++KP  GG FTDI
Sbjct  292   GEPINSTGSNLPAGGENDGSFWIDLPEDDEVRSNLKKGNLESSELYVHVKPALGGIFTDI  351

Query  849   AIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGS  670
              +WIF PFNGP+T K+G +  +P+  IGEH+GDWEH T RISNFNG L +++FS+HSGG 
Sbjct  352   VMWIFCPFNGPATLKIGLL-TVPMNRIGEHVGDWEHFTFRISNFNGELTQMFFSQHSGGG  410

Query  669   WVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGL  496
             WVD  +LEF+ GSNK V YSS +GHA++  PG+ LQG     IG+RND AKS   +D+  
Sbjct  411   WVDVSDLEFVKGSNKPVVYSSKHGHASFPHPGMYLQGPSKLGIGVRNDVAKSKYAVDSSQ  470

Query  495   RYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             RY +VA    G   I EP W+++ REWGP + Y S  +I ++  LLP+  R  FE+   L
Sbjct  471   RYRIVAAEYLGEGAISEPCWLQFMREWGPTLVYDSAAEINKIIDLLPLIVRYSFES---L  527

Query  327   LPNEFFGEEGPTGPNMKASWSGDE  256
              P E +GEEGPTGP  K +W GDE
Sbjct  528   FPIELYGEEGPTGPKEKDNWEGDE  551



>ref|XP_004511441.1| PREDICTED: uncharacterized protein LOC101506697 isoform X1 [Cicer 
arietinum]
Length=601

 Score =   407 bits (1046),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 225/445 (51%), Positives = 285/445 (64%), Gaps = 18/445 (4%)
 Frame = -2

Query  1551  YTLVWSSDS---LPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTD  1381
             YTLVW +DS     +T    AY WLP PP+GY A+G++VT + EKP  D I CV    TD
Sbjct  162   YTLVWCTDSGRKKMVTLVDSAYFWLPQPPEGYKALGYLVTNNHEKPDLDEISCVRVDLTD  221

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFS----GNVGTFAC  1213
              CE    ++  G S      F ++ LRP +RG   KGV VGTF  S      G      C
Sbjct  222   KCEPYRTLFDVG-SILPKFPFWVWNLRPCDRGMLGKGVSVGTFFCSSCCWNKGEELPVMC  280

Query  1212  LKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET  1033
             LKN N      AMP L QI AL   Y P ++ HP + Y PSSV+WFFSNGALLY KG E+
Sbjct  281   LKNLNPVLP--AMPRLDQINALIEHYGPTVFFHPDEVYLPSSVDWFFSNGALLYRKG-ES  337

Query  1032  NPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
                 I  +GSNLP GGTNDG +W++LP D   +E +K GDL+S+++Y+++KP FGGTFTD
Sbjct  338   KGEAIDSNGSNLPGGGTNDGEFWIDLPSDVIRRESIKHGDLESAKLYVHVKPAFGGTFTD  397

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             I +WIF PFNGPST K G I+ I    IGEHIGDWEH TLRISNF+G L  +Y+S+HSGG
Sbjct  398   IVMWIFCPFNGPSTLKFG-IKSISFNKIGEHIGDWEHFTLRISNFSGELWSIYYSQHSGG  456

Query  672   SWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTG  499
              WVDA +LE+I+G NK+V YSS NGHA+Y  PG  +QG     IGIRND  +S   +D+ 
Sbjct  457   KWVDAYDLEYIDG-NKAVVYSSKNGHASYFYPGTYIQGSSKLGIGIRNDARRSNLCVDSS  515

Query  498   LRYSVVAG--LQGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             + Y VVA   L  +V EP W+++ R WGPKI Y S+ ++ ++   LP+  R  F  L+  
Sbjct  516   VSYEVVAAEYLGDVVKEPQWLQFMRLWGPKIVYDSKTELDKILHALPIRLRSSFGNLLKK  575

Query  327   LPNEFFGEEGPTGPNMKASWSGDEK  253
             LP E +GEEGPTGP  K +W GDE+
Sbjct  576   LPVELYGEEGPTGPKEKNTWIGDER  600



>ref|XP_007147203.1| hypothetical protein PHAVU_006G104300g [Phaseolus vulgaris]
 gb|ESW19197.1| hypothetical protein PHAVU_006G104300g [Phaseolus vulgaris]
Length=563

 Score =   405 bits (1042),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 210/442 (48%), Positives = 279/442 (63%), Gaps = 18/442 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+L+WS+DS      G  Y WLP PP GY A+G VVT + ++P  +++RCV +  T+ CE
Sbjct  129   YSLIWSADS---PHDGSGYFWLPNPPFGYKAMGIVVTKTPDEPEVEQVRCVRADLTENCE  185

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGN---VGTFACLKNN  1201
               D +     S      F ++  RP  RG  ++GV VGTF  S   +   V   ACLKN 
Sbjct  186   TCDLLLSM-NSKFSKVSFKVWNTRPCKRGMWSRGVSVGTFFCSTYSDYEQVADIACLKNL  244

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             +      AMPNL Q+ AL   Y P +Y HP + Y PSSV WFF NGA++Y++G E     
Sbjct  245   DSTLH--AMPNLDQVHALINHYGPTVYFHPDEIYLPSSVQWFFKNGAVVYSRGSEKGKA-  301

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I   GSNLP GGTNDG +W++ P DN+ +  +K+GD++S+E+Y+++KP  GGTFTDIA+W
Sbjct  302   IDNQGSNLPSGGTNDGAFWIDFPRDNDARSNIKKGDIESAELYVHVKPALGGTFTDIAMW  361

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             +F PFNGP   ++G +  I +  IGEH+GDWEH TLR+SNF G L  V+FS+HSGG W++
Sbjct  362   VFCPFNGPGILQVGLV-NIEMNKIGEHVGDWEHFTLRVSNFTGELWSVFFSQHSGGEWIN  420

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGI--RNDTAKSAAVLDTGLRYS  487
             A NLEFI G NK V YSS +GHA++   G+ LQG   +GI  RN+ A+S   +D+  RY 
Sbjct  421   AFNLEFIEG-NKPVVYSSRHGHASFPHAGIYLQGASKLGIGARNEAARSKLAVDSSSRYK  479

Query  486   VVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
             VVA    G   I EP W++Y REWGP I Y S  +I ++ +LLPV  R     L  L P 
Sbjct  480   VVAAEYLGEGAIAEPSWLQYMREWGPAIVYGSRSEIDKLINLLPVYVRLSVVNLFELFPT  539

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E +GEEGP GP  KA+W GDEK
Sbjct  540   ELYGEEGPIGPKGKANWEGDEK  561



>ref|XP_003538932.1| PREDICTED: uncharacterized protein LOC100793026 [Glycine max]
 gb|KHN05524.1| hypothetical protein glysoja_020489 [Glycine soja]
Length=543

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 209/442 (47%), Positives = 282/442 (64%), Gaps = 15/442 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             + LVWS ++  +   G  Y WLP PP+GY A+G++VT   +KP  D + CV +  TD CE
Sbjct  107   FKLVWSHNAASMEIPG-VYFWLPEPPEGYKALGYLVTNKHDKPLLDEMCCVRADLTDKCE  165

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT----FACLKN  1204
                 +   G+   +   F +++LRP +RG   KGV VGTF  S    +G      ACLKN
Sbjct  166   PYRQILAAGSRIPE-FSFQVWSLRPCDRGMLGKGVSVGTFFCSNGWTMGEELLPVACLKN  224

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              N      AMP+L QI AL + Y P ++ HP + Y PSSV+WFF+NGA+L+ KG      
Sbjct  225   LNPVLP--AMPDLQQIHALIKHYGPTVFFHPQEKYLPSSVDWFFNNGAMLHKKGVSKGE-  281

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I   GSNLP GGTNDG +W++LP D++ K  VKRGDL+SS +Y+++KP  GGTFTDIA+
Sbjct  282   GIDASGSNLPSGGTNDGQFWIDLPSDHDRKNFVKRGDLKSSRLYVHVKPALGGTFTDIAM  341

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP+T K+G I+ IPL  +GEH+GDWEH TLRI NF+G L  +YFS+HSGG WV
Sbjct  342   WVFCPFNGPATLKIG-IKSIPLSKVGEHVGDWEHFTLRICNFSGELYSIYFSQHSGGEWV  400

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             DA +L++I G NK+  YSS  GHA+Y  PG  +QG     IGIRND A+S   +D+ + Y
Sbjct  401   DAYDLDYIKGYNKATVYSSKCGHASYPHPGTYMQGSSKLGIGIRNDAARSNLYVDSSVHY  460

Query  489   SVVAG---LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
              +VA       + EP W+++ REWGPKI Y ++ ++ +V + LP   R     L +  P 
Sbjct  461   ELVAAEYLENDVTEPQWLQFMREWGPKIVYDTKTELDKVINALPRMLRYSVRNLFNKFPV  520

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E +GEEGPTGP  K +W  DE+
Sbjct  521   ELYGEEGPTGPKEKNNWIQDER  542



>ref|XP_006598236.1| PREDICTED: uncharacterized protein LOC102669203 [Glycine max]
Length=518

 Score =   403 bits (1036),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 218/444 (49%), Positives = 274/444 (62%), Gaps = 56/444 (13%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVW++ SL I Q G  Y+WLP+ P+GY  VGHVVTTS EKPS D+IRCV S  TD C 
Sbjct  120   YKLVWNTKSLKIKQDGQGYIWLPIAPEGYKPVGHVVTTSPEKPSLDKIRCVRSDLTDECT  179

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFA----CLKN  1204
                 +    T N     FN+Y +RPI RG +A+GV VGTFL    G   + A    CLKN
Sbjct  180   TCHSMKLWRTENKR---FNVYDVRPIKRGIEAQGVSVGTFLAQSGGGTNSKALPISCLKN  236

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET-NP  1027
                +FS   MPNLSQI+A+ + YSP +YLHP++ Y PSSV+WFF+NGA+L  K       
Sbjct  237   TKGSFS--YMPNLSQIKAMIKAYSPYMYLHPMEEYLPSSVDWFFTNGAVLIEKRKGVIRE  294

Query  1026  VRIGPDGSNLPQGGTNDG---VYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
               I P+GSNLPQGG+ND     YW++LP+D  ++  +K+GDL SS+ Y+++KPM GGTFT
Sbjct  295   SSIEPNGSNLPQGGSNDDDDVTYWLDLPLDETKRVSIKKGDLASSQAYVHVKPMLGGTFT  354

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             DI +WIFYPFNG + AK+     IPL   GEH+GDWEHLTLR+SNFNG L +VYFS+HS 
Sbjct  355   DIVMWIFYPFNGGARAKVA-CTNIPLRTKGEHVGDWEHLTLRVSNFNGELWRVYFSQHSE  413

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGL  496
             G WVDA  L+F NG N+  AYSSL+GHA + KPGLV+QG+  +G+RND A+S AV+D   
Sbjct  414   GKWVDASELDFQNG-NRPAAYSSLHGHALFPKPGLVMQGMRGLGVRNDAARSDAVMDMAT  472

Query  495   RYSVVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
              + +VA       I EPPW+ Y   WGPK                               
Sbjct  473   WFEIVAAEYLGSQIREPPWLNYWMNWGPK-------------------------------  501

Query  324   PNEFFGEEGPTGPNMKASWSGDEK  253
                    EGP GP  K  W GDE+
Sbjct  502   -------EGPKGPKQKDMWKGDER  518



>ref|XP_010102201.1| hypothetical protein L484_024482 [Morus notabilis]
 gb|EXB93144.1| hypothetical protein L484_024482 [Morus notabilis]
Length=568

 Score =   404 bits (1039),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 213/443 (48%), Positives = 280/443 (63%), Gaps = 19/443 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTL+WSSDS      G  Y W+P PP GY A+G VVT + E+P  D +RCV    T+ CE
Sbjct  135   YTLLWSSDSY---SDGCGYFWMPKPPSGYRAMGFVVTNTPEEPKVDEVRCVREDLTETCE  191

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF---SGNVGTFACLKNN  1201
               D ++    S    + F ++T  P  RG   KGV VGTF  S    S +     CLKN 
Sbjct  192   TSDAIFSM-DSKLSKDSFRVWTTVPCERGMWCKGVSVGTFFCSRYLSSEDDLDIRCLKNG  250

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET-NPV  1024
             +       MPNL Q+ AL + Y P L+ +P +TY  SSV WFF NGALLY +G E   P+
Sbjct  251   DPNLH--GMPNLDQVHALIQHYGPTLFFYPDETYLASSVQWFFKNGALLYREGSEKGEPI  308

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
               G  G+NLP GG NDG  W++LP D++ K  VK G+++SSE+Y+++KP  GGTFTDIA+
Sbjct  309   DFG--GANLPAGGVNDGECWIDLPSDDDAKNCVKCGNMESSELYVHVKPALGGTFTDIAM  366

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP+T ++G +  I L  IGEH+GDWEH TLR+SNF G L ++YFSEHSGG W+
Sbjct  367   WVFCPFNGPATIRVGGLLNIELNKIGEHVGDWEHYTLRVSNFTGELWQIYFSEHSGGRWL  426

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGI--RNDTAKSAAVLDTGLRY  490
             DA +LEFI G NK+V Y+S +GHA++  PG  +QG    GI  RND A+S   +D+  +Y
Sbjct  427   DASDLEFIQG-NKAVVYASRHGHASFPHPGTYIQGSTKFGIGARNDVARSDNFIDSSTKY  485

Query  489   SVVAGL---QGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              +VA      GIV EP W++Y REWGP I Y S  ++ ++  LLP  +R   E +  L P
Sbjct  486   QIVAAEYLGDGIVTEPCWLQYMREWGPTIVYDSRSELDKLLDLLPFYFRFSVENIFDLFP  545

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
              E +GEEGPTGP  K +W GDE+
Sbjct  546   TELYGEEGPTGPKEKDNWEGDER  568



>ref|XP_009120969.1| PREDICTED: uncharacterized protein LOC103845831 [Brassica rapa]
Length=549

 Score =   403 bits (1035),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 214/442 (48%), Positives = 283/442 (64%), Gaps = 32/442 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSSDS         Y WLP PP GY AVG +VT   E+P  + +RCV    T+ CE
Sbjct  128   YTLVWSSDS-------DCYFWLPNPPVGYKAVGVIVTDESEEPDTEEVRCVREDLTETCE  180

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
               + + G G+       FN+++  P +RG  ++GV VG+F  S + N      ACLKN +
Sbjct  181   TRERILGVGS-------FNVWSTEPCSRGIWSRGVAVGSFFCSTNDNKADMNIACLKNLD  233

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGD-ETNPVR  1021
              +    AMPNL Q+ AL + Y P +Y HP +TY PSSV WFF NGALLY  G  E  P  
Sbjct  234   PSLQ--AMPNLDQVHALIQHYGPTVYFHPEETYLPSSVPWFFKNGALLYRFGKPEGEP--  289

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNE-KERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
             I   GSNLP GG NDG YW++LP ++ E    +K+G+++SSE+Y+++KP  GG FTD+ +
Sbjct  290   INSTGSNLPSGGKNDGSYWIDLPQEDEEVANNLKKGNIESSELYVHVKPALGGIFTDVVM  349

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+T K+G +  +P+  IGEH+GDWEH T RISNFNG L +++FS+HSGG WV
Sbjct  350   WIFCPFNGPATLKIGLL-TVPMNRIGEHVGDWEHFTFRISNFNGELTQMFFSQHSGGGWV  408

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             D  +LEF+ GSN+ V YSS +GHA++  PG+ LQG     IG+RND  KS  V+D+  RY
Sbjct  409   DVSDLEFVKGSNRPVVYSSKHGHASFPHPGMYLQGSSKLGIGVRNDVGKSEFVVDSSQRY  468

Query  489   SVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              VVA    G   ++EP W++Y REWGP I Y S  +I ++ +LLP+  R   E   +L P
Sbjct  469   RVVAAEYLGEGVVLEPCWLQYMREWGPTIVYDSAAEIDKIINLLPLIVRFSIE---NLFP  525

Query  321   NEFFGEEGPTGPNMKASWSGDE  256
                +GEEGPTGP  K +W GDE
Sbjct  526   IALYGEEGPTGPKEKDNWEGDE  547



>gb|KDP23733.1| hypothetical protein JCGZ_23566 [Jatropha curcas]
Length=573

 Score =   404 bits (1037),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 212/442 (48%), Positives = 287/442 (65%), Gaps = 19/442 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWS+       +G  Y WLP PP GY A+G VVTTS E+P+ + +RC+ +  T+ CE
Sbjct  138   YSLVWSTRP---QDNGSGYFWLPNPPTGYKAMGVVVTTSPEEPNVEEVRCIRADLTEKCE  194

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF-LGSF---SGNVGTFACLKN  1204
                 ++    S      F ++ +RP  RG  A+GV VGTF  G++     ++   ACLKN
Sbjct  195   TFKLIFS-SDSKTYKEQFRVWNIRPCRRGMFAEGVSVGTFYCGTYLKSEDDLLDVACLKN  253

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              + A    AMPNL QI AL + Y P ++ HP + Y PSSV WFF NGALLY +G +    
Sbjct  254   FDDALK--AMPNLDQIHALIKHYGPTVFFHPDEEYLPSSVQWFFKNGALLYQEGKQKGE-  310

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I   GSNLP GG+NDG YW++LP +++ +  +KRGDL+S+E+Y+++KP  GGTFTDIA+
Sbjct  311   PIDYRGSNLPSGGSNDGEYWIDLPNEDDARNNLKRGDLESAELYVHVKPALGGTFTDIAM  370

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP+T K+G +  IP+  +GEH+GDWEH TLRISNF G L +V+FS+HSGG WV
Sbjct  371   WVFCPFNGPATLKVG-LMSIPMTKVGEHVGDWEHFTLRISNFTGELWQVFFSQHSGGQWV  429

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             DA +LEFI G N+ V YSS NGHA++ +PG  LQG     IG+RND A+S   +D+   Y
Sbjct  430   DASDLEFI-GGNRPVVYSSKNGHASFPRPGTYLQGSTKLGIGVRNDAARSKYYVDSSQMY  488

Query  489   SVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              +VA    G   + EP W+++ REWGP I Y S  ++ ++ +LLP   R   E +  L P
Sbjct  489   QLVAAEYLGDGVVTEPFWLQFMREWGPTILYDSRSEVDKIINLLPFFVRFSVENIFDLFP  548

Query  321   NEFFGEEGPTGPNMKASWSGDE  256
              E +GEEGPTGP  K +W GDE
Sbjct  549   TELYGEEGPTGPKEKRNWLGDE  570



>gb|AAM64724.1| unknown [Arabidopsis thaliana]
Length=553

 Score =   402 bits (1034),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 210/444 (47%), Positives = 285/444 (64%), Gaps = 33/444 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWSSDS         Y WLP PP GY AVG +VT   E+P  D +RCV    T+ CE
Sbjct  129   YSLVWSSDS-------DCYFWLPNPPVGYRAVGVIVTDGSEEPEVDEVRCVREDLTESCE  181

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF------LGSFSGNVGTFACL  1210
               + V G G+       FN+++ +P  RG  ++GV+VG+F      L S +      ACL
Sbjct  182   TGEKVLGVGS-------FNVWSTKPCERGIWSRGVEVGSFFCSTNDLSSDNKAAMNIACL  234

Query  1209  KNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETN  1030
             KN + +     MPNL Q+ AL   Y P++Y HP +TY PSSV WFF NGALL+ + +++ 
Sbjct  235   KNLDPSLQ--GMPNLDQVHALIHHYGPMVYFHPEETYMPSSVPWFFKNGALLH-RFEKSQ  291

Query  1029  PVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDI  850
                I   GSNLP GG NDG +W++LP D+  +  +K+G+++SSE+Y+++KP  GG FTDI
Sbjct  292   GEPINSTGSNLPAGGENDGSFWIDLPEDDEVRSNLKKGNIESSELYVHVKPALGGIFTDI  351

Query  849   AIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGS  670
              +WIF PFNGP+T K+G +  +P+  +GEH+GDWEH T RISNFNG L +++FS+HSGG 
Sbjct  352   VMWIFCPFNGPATLKIGLL-TVPMNRLGEHVGDWEHFTFRISNFNGDLTQMFFSQHSGGG  410

Query  669   WVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGL  496
             WVD  +LEF+ GSNK V YSS +GHA++  PG+ LQG     IG+RND AKS  ++D+  
Sbjct  411   WVDVSDLEFVKGSNKPVVYSSKHGHASFPHPGMYLQGPSKLGIGVRNDVAKSKYMVDSSQ  470

Query  495   RYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             RY +VA    G   + EP W+++ REWGP I Y S  +I ++  LLP+  R  FE+   L
Sbjct  471   RYKIVAAEYLGEGAVSEPYWLQFMREWGPTIVYDSAAEINKIIDLLPLILRYSFES---L  527

Query  327   LPNEFFGEEGPTGPNMKASWSGDE  256
              P E +GEEGPTGP  K +W GDE
Sbjct  528   FPIELYGEEGPTGPKEKDNWEGDE  551



>emb|CDX92605.1| BnaA10g16440D [Brassica napus]
Length=549

 Score =   402 bits (1033),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 215/442 (49%), Positives = 284/442 (64%), Gaps = 32/442 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSSDS         Y WLP PP GY AVG +VT   E+P  + +RCV    T+ CE
Sbjct  128   YTLVWSSDS-------DCYFWLPNPPVGYKAVGVIVTDESEEPDTEEVRCVREDLTETCE  180

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
               + + G G+       FN+++  P +RG  ++GV VG+F  S + N      ACLKN +
Sbjct  181   TRERILGVGS-------FNVWSTEPCSRGIWSRGVAVGSFFCSTNDNKADMNIACLKNLD  233

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGD-ETNPVR  1021
              +    AMPNL Q+ AL + Y P +Y HP +TY PSSV WFF NGALLY  G  E  P  
Sbjct  234   PSLQ--AMPNLDQVHALIQHYGPTVYFHPEETYLPSSVPWFFKNGALLYRFGKPEGEP--  289

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNE-KERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
             I   GSNLP GG NDG YW++LP ++ E    +K+G+++SSE+Y+++KP  GG FTD+ +
Sbjct  290   INSTGSNLPSGGKNDGSYWIDLPQEDEEVTNNLKKGNIESSELYVHVKPALGGIFTDVVM  349

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+T K+G +  +P+  IGEH+GDWEH T RISNFNG L +++FS+HSGG WV
Sbjct  350   WIFCPFNGPATLKIGLL-TVPMNRIGEHVGDWEHFTFRISNFNGELTQMFFSQHSGGGWV  408

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             D  +LEF+ GSN+ V YSS +GHA++  PG+ LQG     IG+RND  KS  V+D+  RY
Sbjct  409   DVSDLEFVKGSNRPVVYSSKHGHASFPHPGMYLQGSSKLGIGVRNDVGKSEYVVDSSERY  468

Query  489   SVVAGL---QGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              VVA     +G+V EP W++Y REWGP I Y S  +I ++ +LLP+  R   E   +L P
Sbjct  469   RVVAAEYLGEGVVSEPCWLQYMREWGPTIVYDSAAEIDKIINLLPLIVRFSIE---NLFP  525

Query  321   NEFFGEEGPTGPNMKASWSGDE  256
                +GEEGPTGP  K +W GDE
Sbjct  526   IALYGEEGPTGPKEKDNWEGDE  547



>gb|KHG15512.1| Vacuolar sorting-associated protein 62 [Gossypium arboreum]
Length=572

 Score =   403 bits (1035),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 215/442 (49%), Positives = 280/442 (63%), Gaps = 23/442 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+L+WS+D      SG  + WLP PP GY A+G +VT + ++P  + +RCV    T  CE
Sbjct  144   YSLIWSTDC----GSGCGFFWLPNPPLGYKAMGILVTDTPDEPDVEEVRCVREDLTKSCE  199

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF----SGNVGTFACLKN  1204
             + D +        D N F ++  RP  RG   KGV VGTF               ACLKN
Sbjct  200   IMDTILA-----TDANTFQVWNTRPCRRGMFCKGVSVGTFFCCTYFVSENQELEIACLKN  254

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              +   S  AMPNL QI AL + Y   ++ HP +   PSSV WFF NGALLY  G + N  
Sbjct  255   LDP--SLHAMPNLDQIHALIKHYGATVFFHPNEDCMPSSVQWFFKNGALLYKDG-KVNGE  311

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I   GSNLP GGTNDG +W++LP D+N ++ V+ G+L+S+E+Y+++KP  GGTFTDI +
Sbjct  312   PIDYLGSNLPSGGTNDGAFWIDLPRDDNARKNVRNGNLESAELYVHVKPALGGTFTDIVM  371

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+  K+G +  I +  IG+H+GDWEH TLRISNF G L +VYFS+HSGG WV
Sbjct  372   WIFCPFNGPANLKIG-LMNIQMNKIGQHVGDWEHFTLRISNFTGELWQVYFSQHSGGEWV  430

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             DA NLEFI G NK + YSS +GHA++  PG+ LQG     IGIRNDTA+S   +D+  RY
Sbjct  431   DAFNLEFIEG-NKPIVYSSKHGHASFPHPGIYLQGSDKLGIGIRNDTARSKYFVDSSTRY  489

Query  489   SVVAG--LQGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
              +VA   L G+V EP W++Y REWGP I Y S  ++ ++ SLLP+  R   E +  L P 
Sbjct  490   QIVAAEYLGGVVTEPCWLQYMREWGPTIVYDSRSELDKIISLLPLFVRFSVENIFDLFPT  549

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E +GEEGPTGP  K +W GDE+
Sbjct  550   ELYGEEGPTGPKEKDNWVGDER  571



>ref|NP_197350.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK96703.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP68343.1| At5g18490 [Arabidopsis thaliana]
 gb|AED92570.1| uncharacterized protein AT5G18490 [Arabidopsis thaliana]
Length=553

 Score =   402 bits (1033),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 210/444 (47%), Positives = 283/444 (64%), Gaps = 33/444 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWSSDS         Y WLP PP GY AVG +VT   E+P  D +RCV    T+ CE
Sbjct  129   YSLVWSSDS-------DCYFWLPNPPVGYRAVGVIVTDGSEEPEVDEVRCVREDLTESCE  181

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF------LGSFSGNVGTFACL  1210
               + V G G+       FN+++ +P  RG  ++GV+VG+F      L S +      ACL
Sbjct  182   TGEKVLGVGS-------FNVWSTKPCERGIWSRGVEVGSFVCSTNDLSSDNKAAMNIACL  234

Query  1209  KNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETN  1030
             KN + +     MPNL Q+ AL   Y P++Y HP +TY PSSV WFF NGALL+  G ++ 
Sbjct  235   KNLDPSLQ--GMPNLDQVHALIHHYGPMVYFHPEETYMPSSVPWFFKNGALLHRFG-KSQ  291

Query  1029  PVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDI  850
                I   GSNLP GG NDG +W++LP D   +  +K+G+++SSE+Y+++KP  GG FTD+
Sbjct  292   GEPINSAGSNLPAGGENDGSFWIDLPEDEEVRSNLKKGNIESSELYVHVKPALGGIFTDV  351

Query  849   AIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGS  670
              +WIF PFNGP+T K+G +  +P+  +GEH+GDWEH T RISNFNG L +++FS+HSGG 
Sbjct  352   VMWIFCPFNGPATLKIGLL-TVPMNRLGEHVGDWEHFTFRISNFNGDLTQMFFSQHSGGG  410

Query  669   WVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGL  496
             WVD  +LEF+ GSNK V YSS +GHA++  PG+ LQG     IG+RND AKS  ++D+  
Sbjct  411   WVDVSDLEFVKGSNKPVVYSSKHGHASFPHPGMYLQGPSKLGIGVRNDVAKSKYMVDSSQ  470

Query  495   RYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             RY +VA    G   + EP W+++ REWGP I Y S  +I ++  LLP+  R  FE+   L
Sbjct  471   RYRIVAAEYLGEGAVSEPYWLQFMREWGPTIVYDSAAEINKIIDLLPLILRNSFES---L  527

Query  327   LPNEFFGEEGPTGPNMKASWSGDE  256
              P E +GEEGPTGP  K +W GDE
Sbjct  528   FPIELYGEEGPTGPKEKDNWEGDE  551



>ref|XP_004239684.1| PREDICTED: uncharacterized protein LOC101256489 [Solanum lycopersicum]
Length=567

 Score =   402 bits (1034),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 216/443 (49%), Positives = 287/443 (65%), Gaps = 19/443 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV+++++L        Y+WLP  P GY A+G V T    +P+ D ++CV +  T+ CE
Sbjct  133   YTLVYNTNAL---YKEVGYIWLPNAPVGYKAMGFVTTAEPNEPNLDEVKCVRADLTESCE  189

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFS---GNVGTFACLKNN  1201
               + V+    S      F+++  RP  RG   +GV VGTF  S S   G+  T ACLKN 
Sbjct  190   TCEVVFS-ANSLFSKRQFDVWKTRPCKRGMLCRGVSVGTFFCSTSFTKGDDLTIACLKNF  248

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             + +    AMPNL Q+ AL + Y P +Y HP +TY PSSV WFFSNGALL+  G + N + 
Sbjct  249   DSSLQ--AMPNLEQVHALIKHYGPTVYFHPDETYLPSSVPWFFSNGALLFKDGKD-NGIA  305

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNE-KERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
             I   GSNLP GG NDG YW++LP  N E ++ VK G+++++E+Y+++KP  GGTFTDIA+
Sbjct  306   IDAKGSNLPAGGRNDGKYWLDLPNKNVENRQIVKCGNIETAELYVHVKPAEGGTFTDIAM  365

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+T K+G +  + L  +GEH+ DWEH TLRISNF+G L  VYFSEHSGG WV
Sbjct  366   WIFCPFNGPATLKVG-LMNLSLNKVGEHVCDWEHYTLRISNFSGELCSVYFSEHSGGEWV  424

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGI--RNDTAKSAAVLDTGLRY  490
             DA +LEFI G NKSV Y+S NGHA++  PG  LQG   +GI  RND AKS   +D+  +Y
Sbjct  425   DARDLEFIEG-NKSVVYASKNGHASFPHPGCYLQGNTKLGIGARNDCAKSKYYVDSSSKY  483

Query  489   SVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              ++A    G   +VEPPW++Y REWGP I Y S  ++  +   LP  +R   ETL+ L P
Sbjct  484   QIIAAEYLGEGTVVEPPWLQYMREWGPTIEYKSGYEVDEIIKHLPSFFRFSVETLVELFP  543

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
             NE +GE GPTGP  K +W GDE+
Sbjct  544   NELYGEAGPTGPKEKNNWFGDER  566



>ref|XP_002263468.1| PREDICTED: uncharacterized protein LOC100263054 [Vitis vinifera]
 emb|CAN61465.1| hypothetical protein VITISV_005001 [Vitis vinifera]
Length=568

 Score =   402 bits (1034),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 214/443 (48%), Positives = 281/443 (63%), Gaps = 20/443 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTL+W++DS      G  Y WLP PP GY A+G VVT +  +P+ + +RCV +  T+ CE
Sbjct  135   YTLMWNTDS---HYDGCGYFWLPNPPAGYKAMGFVVTDNPNQPALEEVRCVRTDLTETCE  191

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG---TFACLKNN  1201
               + +   G SN     F ++  RP  RG     V VGTF  S   +       ACLKN 
Sbjct  192   TYNMILNTG-SNFSKYPFIVWNARPCKRGMLGNSVSVGTFFCSTHPSPDEEPNIACLKNL  250

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGD-ETNPV  1024
             +      AMPNL QI AL + Y   ++ HP D Y PSSV WFF NGAL+Y  G  E  P 
Sbjct  251   DSTLH--AMPNLKQIHALIKHYGATVFFHPDDIYMPSSVPWFFKNGALVYQNGKLEGKP-  307

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I   GSNLP GG NDG +W++LP D++E+  +K G+++S+E+Y+++KP  GGTFTDIA+
Sbjct  308   -IDSRGSNLPSGGKNDGEFWIDLPDDDDERTYLKSGNIESAELYVHVKPALGGTFTDIAM  366

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP+T K+G I  IP+  IG+H+GDWEH TLR+SNF G L  VYFS+HSGG WV
Sbjct  367   WVFCPFNGPATIKVG-IMSIPMSRIGQHVGDWEHFTLRLSNFTGELWSVYFSQHSGGEWV  425

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             DAPNLEFI G NK V YSS  GHA++  PG+ +QG     IG+RND A+S   +D+   Y
Sbjct  426   DAPNLEFIEG-NKPVVYSSKGGHASFPHPGIYVQGSSKLGIGVRNDAARSKFFIDSSTNY  484

Query  489   SVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              +VA    G   +VEP W++Y REWGP I Y S  +++++ SLLPV +R   E +  L P
Sbjct  485   QIVAAEYLGDTAVVEPNWLQYMREWGPTIVYDSRAELEKIISLLPVFFRFSVENIFDLFP  544

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
              E +GEEGPTGP  K +W  DE+
Sbjct  545   TELYGEEGPTGPKEKNNWVEDER  567



>emb|CBI18663.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   398 bits (1023),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 217/420 (52%), Positives = 258/420 (61%), Gaps = 89/420 (21%)
 Frame = -2

Query  1506  GPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCEVEDWVWGRGTSNNDP  1327
             G  YVWLP PP GY AVGHV+T   EKPS D+IRCV S  TD CE +             
Sbjct  119   GNGYVWLPTPPDGYKAVGHVITNLPEKPSLDKIRCVRSDLTDLCEAD-------------  165

Query  1326  NGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNVAFSSSAMPNLSQIEAL  1147
                        +RG QA        L + S N+                AMPNL+Q++AL
Sbjct  166   ----------TDRGAQA--------LANISSNL---------------YAMPNLAQVDAL  192

Query  1146  FREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIGPDGSNLPQGGTNDGVY  967
              + YSP +YLHP + Y PSSV+WFF NGALLY +G+E+ PV I P GSNLPQGG+NDG Y
Sbjct  193   VQAYSPWVYLHPDEQYLPSSVSWFFQNGALLYQQGEESKPVNIDPTGSNLPQGGSNDGAY  252

Query  966   WVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIFYPFNGPSTAKLGQIER  787
             W++LPVD   KE VK+GDLQ S  Y++IKPM G TFTDIAIWIFYPFNGP+ AK+ ++  
Sbjct  253   WLDLPVDAKAKETVKKGDLQDSMTYMHIKPMLGATFTDIAIWIFYPFNGPARAKV-ELIN  311

Query  786   IPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAPNLEFINGSNKSVAYSS  607
             I LG IGEH+GDWEH+TLR+SNFNG L  V+FSEHS G+WV+A  LEF NG NK V+Y+S
Sbjct  312   ISLGKIGEHVGDWEHVTLRVSNFNGKLMNVFFSEHSSGTWVNASELEFQNG-NKVVSYAS  370

Query  606   LNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLRYSVVAGL---QGIVEPPWVKYC  436
             L+GHA Y KPGLVLQG G +GIRNDTAKS  V+DTG RY VVA       +VEPPW+ Y 
Sbjct  371   LHGHAFYPKPGLVLQGSGAMGIRNDTAKSKMVMDTGTRYIVVAAEYLGSAVVEPPWLNYY  430

Query  435   REWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFFGEEGPTGPNMKASWSGDE  256
             R+WGPKI                                       PTGP MK +W GDE
Sbjct  431   RKWGPKIR--------------------------------------PTGPKMKKNWDGDE  452



>ref|XP_006299082.1| hypothetical protein CARUB_v10015223mg [Capsella rubella]
 gb|EOA31980.1| hypothetical protein CARUB_v10015223mg [Capsella rubella]
Length=567

 Score =   402 bits (1033),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 206/446 (46%), Positives = 280/446 (63%), Gaps = 22/446 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWS+DS    + G  Y WLP+PP GY A+G +VT    +P+ + +RCV    T+ CE
Sbjct  128   YSLVWSADS---EKDGGGYFWLPIPPVGYRAMGVIVTQQPGEPATEEVRCVREDLTESCE  184

Query  1371  VEDWVWGRGTS---NNDPNGFNLYTLRPINRGTQAKGVKVGTFLG-----SFSGNVGTFA  1216
               + +   G+S   N   + F++++ RP  RG  ++GV VG+F       S    V    
Sbjct  185   TYEMILQVGSSKKSNRSDSPFSVWSTRPCERGMLSQGVAVGSFFCCIYDLSSDRTVSDIG  244

Query  1215  CLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDE  1036
             CL+N +      AMPNL Q+ A+   Y P +Y HP + Y PSSV WFF NGALLY  G  
Sbjct  245   CLRNLDPTLH--AMPNLDQVHAVIEHYGPTVYFHPEEAYMPSSVQWFFKNGALLYRSGKS  302

Query  1035  TNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
                  I   GSNLP GG ND  +W++LP D  EK  +K+G+L+SSE+Y+++KP  GGTFT
Sbjct  303   QGET-INSTGSNLPAGGCNDMEFWIDLPEDEEEKSNLKKGNLESSELYVHVKPALGGTFT  361

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             DI +WIF PFNGP+T K+G I  +P+  IGEH+GDWEH T RI NF+G L +++FS+HSG
Sbjct  362   DIVMWIFCPFNGPATLKIG-IFTLPMTRIGEHVGDWEHFTFRICNFSGELWQMFFSQHSG  420

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDT  502
             G WVDA ++EF+   NK   YSS +GHA++   G+ LQG     IG+RND AKS ++LD+
Sbjct  421   GGWVDASDIEFVK-DNKPAVYSSKHGHASFPHSGMYLQGSSKLGIGVRNDVAKSKSILDS  479

Query  501   GLRYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLI  334
               RY +VA    G   ++EP W++Y REWGP I Y S  +I ++  LLP+  R  FE ++
Sbjct  480   SRRYVIVAAEYLGNGVVIEPCWLQYMREWGPSIAYDSGSEINKIMDLLPLVVRFSFENIV  539

Query  333   HLLPNEFFGEEGPTGPNMKASWSGDE  256
              L P   +GEEGPTGP  K +W GDE
Sbjct  540   DLFPIALYGEEGPTGPKEKDNWEGDE  565



>ref|XP_006585381.1| PREDICTED: uncharacterized protein LOC100783235 [Glycine max]
Length=518

 Score =   400 bits (1028),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 218/444 (49%), Positives = 272/444 (61%), Gaps = 56/444 (13%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVW++ S  I Q G  Y+WLP+ P GY+ VGHVVTTS EKPS D+IRCV S  TD   
Sbjct  120   YKLVWNTKSQKIKQDGHGYIWLPISPDGYNPVGHVVTTSPEKPSLDKIRCVRSDLTDEST  179

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFA----CLKN  1204
                 +    T N     FN+Y +RPI RG +A+GV VGTFL    G   + A    CLKN
Sbjct  180   TCHSMKLWRTENKR---FNVYDVRPIKRGIEAQGVSVGTFLAQSGGGTNSKAFPIFCLKN  236

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET-NP  1027
                +FS   MPNLSQI+A+ + YSP +YLHP++ Y PSSV+WFF+NGA+L  K       
Sbjct  237   TKGSFS--YMPNLSQIKAMIKAYSPYMYLHPMEEYLPSSVDWFFTNGAVLIEKRKGVIRE  294

Query  1026  VRIGPDGSNLPQGGTND---GVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
               I P+G+NLPQG +ND     YW++LP+D  ++  VK+GDL SS+ Y+++KPM GGTFT
Sbjct  295   SSIEPNGTNLPQGSSNDYDDATYWLDLPLDETKRVSVKKGDLASSQAYVHVKPMLGGTFT  354

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             DI +W+FYPFNG + AK+     IPL   GEH+GDWEHLTLRISNFNG L KVYFS+HS 
Sbjct  355   DIVMWVFYPFNGGARAKVA-CTNIPLRTKGEHVGDWEHLTLRISNFNGELWKVYFSQHSK  413

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGL  496
             G W DA  LEF NG N+ VAYSSL+GHA + KPGLV+QG+  +G+RND AKS AV+D   
Sbjct  414   GQWEDASELEFQNG-NRPVAYSSLHGHALFPKPGLVMQGMRGLGVRNDAAKSDAVMDMAT  472

Query  495   RYSVVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
              + +VA       I EPPW+ +C  WGPK                               
Sbjct  473   WFEIVAAEYLGSQIREPPWLNFCMNWGPK-------------------------------  501

Query  324   PNEFFGEEGPTGPNMKASWSGDEK  253
                    EGP GP  K  W GDE+
Sbjct  502   -------EGPKGPKQKDMWKGDER  518



>gb|KFK26090.1| hypothetical protein AALP_AA8G201500 [Arabis alpina]
Length=556

 Score =   401 bits (1031),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 216/447 (48%), Positives = 287/447 (64%), Gaps = 36/447 (8%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVWSSDS         Y WLP PP GY AVG VVT    +P  + +RCV    T+ CE
Sbjct  129   YFLVWSSDS-------DCYFWLPNPPVGYRAVGVVVTDGSAEPEIEEVRCVREDLTESCE  181

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGS---FSGNVGT---FACL  1210
               + + G G+       FN+++ +P  RG  ++GV VG+F  S    S N       ACL
Sbjct  182   TGEMILGMGS-------FNVWSTKPCERGIWSRGVAVGSFFCSNNDMSSNNQAGVNIACL  234

Query  1209  KNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETN  1030
             KN + +     MPNL Q+ AL + Y P +Y HP +TY PSSV WFF NGALLY  G ++ 
Sbjct  235   KNLDPSLH--GMPNLDQLHALIQHYGPTVYFHPEETYMPSSVPWFFKNGALLYRLG-KSQ  291

Query  1029  PVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKE---RVKRGDLQSSEVYLNIKPMFGGTF  859
              V I   GSNLP GG NDG +W++LP  ++++E    +K G+L+SSE+Y+++KP+ GG F
Sbjct  292   GVPINSAGSNLPAGGENDGTFWIDLPGSDDDEEVRNHLKIGNLESSELYVHVKPVLGGIF  351

Query  858   TDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHS  679
             TDI +WIF PFNGP+T K+G +  +P+  IGEH+GDWEH T RISNF+G L++++FSEHS
Sbjct  352   TDIVMWIFCPFNGPATLKIGLLT-VPMNRIGEHVGDWEHFTFRISNFDGNLSQMFFSEHS  410

Query  678   GGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLD  505
             GG WVD  +LEF+ GSNK V YSS +GHA++  PG+ LQG     IG+RND AKS  VLD
Sbjct  411   GGRWVDVSDLEFVKGSNKPVVYSSKHGHASFPHPGMYLQGSSKLGIGVRNDVAKSEYVLD  470

Query  504   TGLRYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETL  337
             +  RY +VA    G   ++EP W+++ REWGP I Y S  +I ++ +LLP+  R  FE+ 
Sbjct  471   SSQRYRIVAAEYLGEGAVLEPCWLQFMREWGPTIVYDSAAEINKIINLLPLIMRYSFES-  529

Query  336   IHLLPNEFFGEEGPTGPNMKASWSGDE  256
               L P E +GEEGPTGP  K +W GDE
Sbjct  530   --LFPIELYGEEGPTGPKEKDNWEGDE  554



>emb|CDY29997.1| BnaC01g40110D [Brassica napus]
Length=564

 Score =   402 bits (1032),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 209/445 (47%), Positives = 286/445 (64%), Gaps = 25/445 (6%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWS DS    ++G  Y WLP PP GY A+G +VT   E+P  + +RCV    T+ CE
Sbjct  130   YTLVWSVDS---EKNGCGYFWLPNPPVGYKAMGVIVTDVPEEPRTEVVRCVRGDLTESCE  186

Query  1371  VEDWVWGRGTS---NNDPNGFNLYTLRPINRGTQAKGVKVGTFLG-----SFSGNVGTFA  1216
               + +    +S   N   + F++++++P  RG +A+GV VGTF       S    V   A
Sbjct  187   TSEMILDVASSKKWNRSDSPFSVWSIQPCERGMRAQGVSVGTFFSCTYELSSHETVRDIA  246

Query  1215  CLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDE  1036
             CLKN +      AMPNL+Q+ A+ + Y P +Y HP +TY PSSV WFF NGALLY +G+ 
Sbjct  247   CLKNLDPTLH--AMPNLNQVHAVIKHYGPTVYFHPEETYMPSSVQWFFKNGALLYPQGEP  304

Query  1035  TNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
                  I   GSNLP GG+ND  +W++LP +   K  +K+G+L+SSE+Y+++KP  GGTFT
Sbjct  305   -----ISSTGSNLPAGGSNDLKFWIDLPEEEEAKSYLKKGNLESSELYVHVKPALGGTFT  359

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             D+A+WIF PFNGP+T K+G +  +P+  IGEH+GDWEH T R+ NF+G L +++FS+HSG
Sbjct  360   DVAMWIFCPFNGPATLKIG-LFTLPMTRIGEHVGDWEHFTFRVCNFSGELWEMFFSQHSG  418

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDT  502
             G WVDA  +EF+ G NK   YSS +GHA++  PG+ LQG     IG+RND AKS  V+++
Sbjct  419   GGWVDASEIEFVKG-NKPAVYSSKHGHASFPHPGMYLQGSSKFGIGVRNDVAKSEYVVES  477

Query  501   GLRYSVVAGLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIH  331
               RY VVA      G+ EP W++Y REWGP I Y S  +I ++  LLP+  R  FE ++ 
Sbjct  478   SERYVVVAAEYLGGGVDEPCWLQYMREWGPVIEYDSGSEIGKIMDLLPLVVRFSFENIVD  537

Query  330   LLPNEFFGEEGPTGPNMKASWSGDE  256
             L P   +GEEGPTGP  K +W GDE
Sbjct  538   LFPVALYGEEGPTGPKEKDNWEGDE  562



>ref|XP_009621765.1| PREDICTED: uncharacterized protein LOC104113342 [Nicotiana tomentosiformis]
Length=571

 Score =   402 bits (1032),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 213/445 (48%), Positives = 285/445 (64%), Gaps = 21/445 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQS--GPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             YTLVWSS  +   ++  G  Y WLP PP+GY A+G + T    KP    ++CV +  TD 
Sbjct  135   YTLVWSSSDVGSEENFDGSGYFWLPQPPEGYKALGFIATNKPVKPELGEVKCVRADLTDE  194

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG---TFACLK  1207
             CE    +    TS+       ++++RP +RG   KG+  GTF  S   + G   + ACLK
Sbjct  195   CETHRLI--LKTSSVLSEVLAVWSIRPRHRGMHGKGISAGTFFCSCYWSTGEELSIACLK  252

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET-N  1030
             + + +    AMPNL QI A+ R Y P L+ HP + Y PSSV WFF NGALLYT+GD    
Sbjct  253   SFDTSLQ--AMPNLDQIHAIIRHYGPTLFFHPDEVYLPSSVQWFFDNGALLYTRGDSVVK  310

Query  1029  PVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDI  850
             P+   PDGSNLP  GTNDG YW++LP D  ++E VK G+LQS+++Y+++KP  GGTFTDI
Sbjct  311   PIE--PDGSNLPGDGTNDGQYWIDLPSDV-QREIVKFGNLQSAKLYVHVKPALGGTFTDI  367

Query  849   AIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGS  670
             A+WIF PFNGP+T K+G +  +PL  IG+H+GDWEH TLR+SNF G L  +YFS+HSGG 
Sbjct  368   AMWIFCPFNGPATLKVGLV-NVPLSKIGQHVGDWEHFTLRVSNFTGELWSIYFSQHSGGE  426

Query  669   WVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGL  496
             WV A +LEFI G NK+  YSS NGHA++  PG  +QG     IGIRNDTA+S   +D+  
Sbjct  427   WVGAYDLEFIAG-NKATVYSSKNGHASFPHPGNYMQGSSKLGIGIRNDTARSNLYVDSST  485

Query  495   RYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             +Y ++A    G   + EP W++Y REWGP I Y S ++++++   LPV  R   + +   
Sbjct  486   QYEIMAAEYLGHGAVSEPCWLQYMREWGPTIIYDSRKELEKIVGRLPVMVRNSVQNIFDK  545

Query  327   LPNEFFGEEGPTGPNMKASWSGDEK  253
             LP E F EEGPTGP  K +W GDE+
Sbjct  546   LPVELFKEEGPTGPKEKNNWVGDER  570



>ref|XP_010542907.1| PREDICTED: vacuolar protein sorting-associated protein 62 [Tarenaya 
hassleriana]
Length=573

 Score =   402 bits (1032),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 213/450 (47%), Positives = 285/450 (63%), Gaps = 23/450 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPA-YVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             Y LVWSS+ L    SG   Y WLP PP+GY  +G VVT    KP    +RCV +  TD C
Sbjct  129   YKLVWSSNGLAEEHSGECGYFWLPQPPEGYRPIGFVVTNRSAKPELQEVRCVRADLTDEC  188

Query  1374  EVEDWVWGRGTSNNDPNGFNLYT--LRPINRGTQAKGVKVGTFLGS---FSGNVGTFACL  1210
             E    +    T+ +  +G  L+    RP +RG   KGV  GTF       SG     ACL
Sbjct  189   EAHKII---VTAVSKSSGVPLFIWRTRPSDRGMWGKGVSAGTFFCRPPLASGEDLAIACL  245

Query  1209  KNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETN  1030
             +N + +    AMPN+ QI AL R Y P ++ HP + Y PSSV+WFF NGALL  K +E+ 
Sbjct  246   RNLDSSLH--AMPNIDQIHALIRHYGPTVFFHPGEIYLPSSVSWFFKNGALLCRKAEESG  303

Query  1029  ----PVR--IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFG  868
                 P+R  I   GSNLPQGGTND  +W+++P D  ++  +KRG+L+SS++Y+++KP  G
Sbjct  304   SNAYPIREAIDEKGSNLPQGGTNDKQFWIDIPSDEEQRSFLKRGNLESSKLYVHVKPALG  363

Query  867   GTFTDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFS  688
             GTFTD+A WIF PFNGP+T KLG +  +    IG+H+GDWEH TLRISNF+G L+ VYFS
Sbjct  364   GTFTDMAFWIFCPFNGPATLKLGLVN-VSFSKIGQHVGDWEHFTLRISNFSGELSSVYFS  422

Query  687   EHSGGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAA  514
             +HSGG WV+A +LE+I+G+NK+V YSS  GHA++ +PG  LQG     +GIRND  +S  
Sbjct  423   QHSGGEWVEAYDLEYISGTNKTVVYSSRYGHASFPRPGTYLQGSSKLGVGIRNDAERSDL  482

Query  513   VLDTGLRYSVVAG--LQGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFE  343
              +D+  RY VV+   L G V EPPW+KY REWGPK+ Y +  +++R+   LP   R    
Sbjct  483   FVDSSSRYEVVSAEYLGGAVREPPWLKYMREWGPKVVYDTRAEMERMVDRLPWRLRSSVA  542

Query  342   TLIHLLPNEFFGEEGPTGPNMKASWSGDEK  253
              ++  +P E  GEEGP+GP  K +W GDE+
Sbjct  543   AVVGKIPVELSGEEGPSGPKEKNNWFGDER  572



>ref|XP_008796406.1| PREDICTED: uncharacterized protein LOC103711872 [Phoenix dactylifera]
Length=562

 Score =   401 bits (1030),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 213/442 (48%), Positives = 281/442 (64%), Gaps = 16/442 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQS-GPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             Y LVWSS+        G    WLP PP+ Y AVG VVT   +KPS D +RCV +  TD C
Sbjct  127   YMLVWSSNIWNEDNCYGCGCFWLPSPPEYYKAVGFVVTKEPQKPSLDEVRCVRADLTDEC  186

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG---TFACLKN  1204
             E    +     S N    F +++ RP +RG   KGV VGTF  S + + G      CLKN
Sbjct  187   ETHGLIL-HTESMNSEVPFRVWSTRPSDRGMGGKGVSVGTFFCSAARSSGYRPNIFCLKN  245

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              N  FS  AMPNL QI AL + Y P ++ HP + Y PSSV+WFF NGA LY +G+     
Sbjct  246   AN--FSLHAMPNLEQIHALIKHYGPTVFFHPKEIYLPSSVSWFFKNGATLYKRGESVGEA  303

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I  +GSNLP GG NDG YW++LP D+N    VK G+L+ +++Y ++K   GGTFTDI++
Sbjct  304   -IDANGSNLPSGGGNDGGYWIDLP-DDNRNSYVKHGNLECAQLYAHVKAALGGTFTDISM  361

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP+T K+G +  I L  IG+H+GDWEH TLRISNF G L  +Y+S+HSGG WV
Sbjct  362   WVFCPFNGPATIKIGPV-NISLDKIGQHVGDWEHFTLRISNFTGELWSIYYSQHSGGEWV  420

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             D P+LEFI+G NK+V YSS +GHA++  PG  LQG     IG+RND A+S  VLD+ ++Y
Sbjct  421   DTPSLEFIHG-NKAVVYSSKSGHASFPHPGNYLQGSETLGIGVRNDAARSKLVLDSSVKY  479

Query  489   SVVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
              ++A       ++EPPW++Y REWGP I Y S  +++++   LP+  R   E +   LP 
Sbjct  480   HIIAAEYLGNVVLEPPWLQYMREWGPTIIYNSRSELEKILGYLPLNLRFSVENIFDKLPT  539

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E +GEEGPTGP  K +W GDE+
Sbjct  540   ELYGEEGPTGPKEKNNWEGDER  561



>ref|XP_003590981.1| hypothetical protein MTR_1g080370 [Medicago truncatula]
 ref|XP_003590985.1| hypothetical protein MTR_1g080410 [Medicago truncatula]
 gb|AES61232.1| pre-mRNA processing protein PRP39, putative [Medicago truncatula]
 gb|AES61236.1| pre-mRNA processing protein PRP39, putative [Medicago truncatula]
Length=560

 Score =   401 bits (1030),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 210/441 (48%), Positives = 279/441 (63%), Gaps = 21/441 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+L+W  DS         Y WLP PP+GY AVG VVTT+ ++P  + +RCV +  T+ CE
Sbjct  130   YSLIWCMDS----HDECVYFWLPNPPKGYKAVGIVVTTNPDEPKAEEVRCVRTDLTEVCE  185

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSF--SGNVGTFACLKNN  1201
               D +    T  +  N F ++  +P +RG  A+GV VGTF  G++  S  V    CLKN 
Sbjct  186   TSDLLL---TIKSKKNSFQVWNTQPCDRGMLARGVSVGTFFCGTYFDSEQVVDVVCLKNL  242

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             +      AMPNL+QI AL   Y P +Y HP + Y PSSV+WFF NGA+LYT G+      
Sbjct  243   DSLLH--AMPNLNQIHALIEHYGPTVYFHPDEKYMPSSVSWFFKNGAILYTAGNAKGKA-  299

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I   G+NLP GG NDG +W++LP D + +  +K+G+++S+E+Y+++KP  GG FTDIA+W
Sbjct  300   IDYHGTNLPGGGYNDGAFWIDLPTDEDARSNLKKGNIESAELYVHVKPALGGAFTDIAMW  359

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             +F PFNGP+T K+  +  I +  IGEH+GDWEH TLR+SNF G L  V+FSEHSGG WV+
Sbjct  360   VFCPFNGPATLKV-SLMNIEMNKIGEHVGDWEHFTLRVSNFTGELWSVFFSEHSGGKWVN  418

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRYS  487
             A +LEFI   NK + YSS +GHA+Y   G  LQG     IG+RND AKS  +LD+  RY 
Sbjct  419   AFDLEFIK-ENKPIVYSSRHGHASYPHAGTYLQGSSKLGIGVRNDAAKSNFILDSSFRYK  477

Query  486   VVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
             +VA    G   I EP W++Y REWGP I Y S  +I+++  +LP+  R   E L  L P 
Sbjct  478   IVAAEYLGDGVITEPCWLQYMREWGPTIVYDSRSEIEKIIDMLPIFVRFSVENLFELFPT  537

Query  318   EFFGEEGPTGPNMKASWSGDE  256
             E  GEEGPTGP  K +W GDE
Sbjct  538   ELSGEEGPTGPKEKDNWLGDE  558



>ref|XP_010494389.1| PREDICTED: uncharacterized protein LOC104771549 isoform X1 [Camelina 
sativa]
 ref|XP_010494390.1| PREDICTED: uncharacterized protein LOC104771549 isoform X2 [Camelina 
sativa]
Length=585

 Score =   402 bits (1032),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 213/445 (48%), Positives = 286/445 (64%), Gaps = 18/445 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPA--YVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             YTLVWSS+ L   +      Y WLP PPQGY  +G +VTTS  KP  D++RCV +  TD 
Sbjct  146   YTLVWSSNDLSEERQSECSGYFWLPQPPQGYKPIGFLVTTSPVKPELDQVRCVRADQTDI  205

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSG----NVGTFACL  1210
             CE    V     S++      ++  RP  RG   KGV  GTF  +       ++ T ACL
Sbjct  206   CEAHK-VLITAFSDSLSIPLFIWKTRPSERGMWGKGVSTGTFFCTTHSPEEDHLRTIACL  264

Query  1209  KNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETN  1030
             KN + +    AMPN+ QI AL + Y P +Y HP +TY PSSV+WFF NGA+L +   +TN
Sbjct  265   KNLDSSLH--AMPNMEQIHALIQHYGPRVYFHPNETYLPSSVSWFFKNGAVLCSS--DTN  320

Query  1029  PVRIGPDGSNLPQGGTNDGVYWVNLPV-DNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
                I   GSNLP GGTND  +W++LP+ D   +E++KRGDL+S+++Y+++KP FGGTFTD
Sbjct  321   NEPIDETGSNLPHGGTNDKQFWIDLPINDQQRREKLKRGDLESAKLYVHVKPAFGGTFTD  380

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             +  WIF PFNGP+T KLG +  + L   G+H+ DWEH T+RISNF+G L  +YFS+HSGG
Sbjct  381   LVFWIFCPFNGPATLKLG-LMNLSLAKTGQHVCDWEHFTVRISNFSGELYSIYFSQHSGG  439

Query  672   SWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG--IGDIGIRNDTAKSAAVLDTG  499
              W++  +LEF+ GSN++V YSS +GHA+++  G+ LQG  +  IGIRND   S   +D+ 
Sbjct  440   EWIEPQDLEFVGGSNRAVVYSSKHGHASFATSGMYLQGSDLLGIGIRNDMETSDLFVDSS  499

Query  498   LRYSVVAG--LQG-IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             LRY +VA   L G +VEPPW+ Y REWGPKI Y S  +I+R+   LP   R   + ++  
Sbjct  500   LRYEIVAAEYLGGVVVEPPWLGYMREWGPKIVYDSRTEIERLNERLPWRLRTWLDAVLTK  559

Query  327   LPNEFFGEEGPTGPNMKASWSGDEK  253
             LP E  GEEGPTGP  K +W GDE+
Sbjct  560   LPVELSGEEGPTGPKEKNNWFGDER  584



>ref|XP_010024939.1| PREDICTED: uncharacterized protein LOC104415357 [Eucalyptus grandis]
 gb|KCW61488.1| hypothetical protein EUGRSUZ_H04219 [Eucalyptus grandis]
Length=567

 Score =   401 bits (1030),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 212/443 (48%), Positives = 277/443 (63%), Gaps = 20/443 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y L+W +DS    Q+G  Y WLP  P GY A+G +VT SL++P  D +RCV    T+ CE
Sbjct  134   YKLIWKADS---DQNGSGYFWLPNAPMGYRAMGILVTDSLDEPDVDEVRCVREDLTEDCE  190

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSFSG--NVGTFACLKNN  1201
               D ++      N P  F ++T RP  RG    GV VGTF   SF G       ACLKN 
Sbjct  191   PCDLMFDI-QPKNAPYPFRIWTTRPCKRGMWGTGVSVGTFFCDSFLGIEEELDIACLKNV  249

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKG-DETNPV  1024
             N      AMP+L QI AL R Y P ++ HP + Y PSSV WFF NGALLY  G D   P+
Sbjct  250   NCTMH--AMPSLDQIHALIRHYGPTVFFHPDEVYMPSSVEWFFKNGALLYEYGKDRGEPI  307

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
             +   DGSNLP  G NDG +W++LP +   + RVK GDL S+E+Y+++KP  GGTFTDI +
Sbjct  308   KY--DGSNLPCEGCNDGEFWIDLPDEEEARNRVKNGDLDSAELYVHVKPALGGTFTDIVM  365

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP+T K+G +  IP+  IG+H+GDWEH TLR+SNF G L   YFS+HSGG WV
Sbjct  366   WVFCPFNGPATLKIG-LMTIPMTRIGQHVGDWEHFTLRVSNFTGELWGAYFSQHSGGGWV  424

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGI--RNDTAKSAAVLDTGLRY  490
             +AP LE+I G N+ + YSS  GHA++  PG  LQG   +GI  RND A+S   +D+  +Y
Sbjct  425   NAPELEYIEG-NRPMVYSSKCGHASFPHPGTYLQGSSKLGIGARNDCAQSEFYVDSSKKY  483

Query  489   SVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              +++    G   + EP W++Y REWGP ITY S  ++ ++ ++LP   R   E L  L P
Sbjct  484   RIISAEYLGDGVVAEPCWLQYMREWGPTITYDSRSEVDKIINMLPFFVRFSVENLFDLFP  543

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
              E +GEEGPTGP  K +W GDE+
Sbjct  544   TELYGEEGPTGPKEKDNWVGDER  566



>ref|XP_009395601.1| PREDICTED: uncharacterized protein LOC103980787 [Musa acuminata 
subsp. malaccensis]
Length=563

 Score =   400 bits (1029),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 213/442 (48%), Positives = 282/442 (64%), Gaps = 16/442 (4%)
 Frame = -2

Query  1551  YTLVWSSDSL-PITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             YTLVWSSD     +  G  Y WLP+PP+GY A+G++VT+   KPS   +RCV S  TD C
Sbjct  128   YTLVWSSDDFTEESHVGCGYFWLPIPPEGYRALGYLVTSGPNKPSVVEVRCVRSDLTDTC  187

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL---GSFSGNVGTFACLKN  1204
             E  + +    T   +     ++ +RP +RG    GV VGTF     S S ++    CLKN
Sbjct  188   EAHELMIDMETIFPELPC-QVWKMRPSSRGLLGTGVSVGTFCCNTDSTSEDMLNICCLKN  246

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              + +    AMPNL Q+ AL + Y P L  HP + Y PSSV+WFF  GA+LY KG +    
Sbjct  247   CDSSLK--AMPNLEQMHALIKHYGPTLMFHPKEVYLPSSVSWFFEKGAILYKKGIKLGET  304

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I  +GSNLP GGTNDG YW++LP D++    VKRG++ S+E+Y+++KP  GGTFTDIA+
Sbjct  305   -IDSEGSNLPLGGTNDGEYWIDLP-DDDRNNLVKRGNIGSAELYVHVKPALGGTFTDIAM  362

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+T K+G +   PL  IG+H+GDWEH TLRISNF G L  +YFS+HSGG W+
Sbjct  363   WIFCPFNGPATIKIG-MANFPLNKIGQHVGDWEHYTLRISNFTGELWSIYFSQHSGGEWI  421

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             DA  LEF  G N++V YSS +GHA++  PG  LQG     IG+RNDTA+S+  +D+  RY
Sbjct  422   DACGLEFFGG-NRAVVYSSKSGHASFPHPGNYLQGSEKLGIGVRNDTARSSLFVDSSTRY  480

Query  489   SVVAGLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
              +VA       + +P W++Y REWGP ITY S  ++ ++ S LP   R   E +   LP 
Sbjct  481   QIVAAEHLGDAVEQPFWLQYMREWGPTITYNSRSELDKILSFLPFTLRFTVENIFDSLPM  540

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E +GEEGPTGP  K +W GDE+
Sbjct  541   ELYGEEGPTGPKEKNNWVGDER  562



>ref|XP_002521999.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40403.1| conserved hypothetical protein [Ricinus communis]
Length=569

 Score =   400 bits (1029),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 214/442 (48%), Positives = 275/442 (62%), Gaps = 18/442 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+L+WS++  P       Y WLP PP+GY A+G VVT S E+P  + +RCV +  T+ C+
Sbjct  134   YSLIWSTN--PENDGDTGYFWLPNPPKGYKAMGIVVTNSPEEPDVEEVRCVRADLTEKCK  191

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG----TFACLKN  1204
               D ++    S    N F ++   P  RG  AKGV VGTF      N G      ACLKN
Sbjct  192   TCDQIFS-SESKTFKNQFQVWNTTPCKRGMCAKGVSVGTFYCGTYLNSGDDLIEVACLKN  250

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              +      AMPNL QI AL + Y P +Y HP + Y PSSV WFF NGALLY     T   
Sbjct  251   LDSTLH--AMPNLEQIHALIKHYGPTVYFHPDEEYLPSSVQWFFKNGALLYQDSKPTGE-  307

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I   G NLP GG NDG YW++LP  +  +E +KRGDL+S+E+Y+N+KP  GGTFTDIA+
Sbjct  308   SIDYRGLNLPSGGENDGEYWIDLPSKDEARENIKRGDLESAELYVNVKPAIGGTFTDIAM  367

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+T K+G +  IP+  IG+H+GDWEH TLRISNF G L + +FSEHSGG WV
Sbjct  368   WIFCPFNGPATLKVG-LMSIPMTKIGQHVGDWEHYTLRISNFTGELWQAFFSEHSGGRWV  426

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             DA +LEFI   NK + YSS +GHA++  PG  LQG     IG+RND A+S   +D+  +Y
Sbjct  427   DASDLEFIE-DNKIIVYSSKHGHASFPHPGTYLQGSTKLGIGVRNDVARSKYYIDSSTKY  485

Query  489   SVVAGL---QGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              ++A      G+V EP W++Y REWGP I Y S  +  ++ +LLP   R   + L  L P
Sbjct  486   QLIAAEYLGDGVVKEPCWLQYMREWGPTIVYDSRSEADKIINLLPFFVRFSVDVLFDLFP  545

Query  321   NEFFGEEGPTGPNMKASWSGDE  256
              E +GEEGPTGP  K +W GDE
Sbjct  546   TELYGEEGPTGPKEKDNWLGDE  567



>ref|XP_010414155.1| PREDICTED: uncharacterized protein LOC104700315 [Camelina sativa]
Length=567

 Score =   400 bits (1028),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 206/446 (46%), Positives = 282/446 (63%), Gaps = 22/446 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWS+DS    ++G  Y WLP+PP GY A+G VVT    KP  + +RCV    T+ CE
Sbjct  128   YSLVWSADS---EKNGGGYFWLPIPPVGYRAMGFVVTHQPGKPETEEVRCVRQDLTESCE  184

Query  1371  VEDWVWGRGTS---NNDPNGFNLYTLRPINRGTQAKGVKVGTFLG-----SFSGNVGTFA  1216
               + +   G+S   N   + F++++ +P  RG  +KGV VG+F       +    V    
Sbjct  185   TSEMILEVGSSKKSNRSGSPFSVWSTQPCERGMLSKGVAVGSFFCCTYDLASDRTVPDIG  244

Query  1215  CLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDE  1036
             CLKN +      AMPNL+Q+ A+   Y P +Y HP + Y PSSV WFF NGALLY  G +
Sbjct  245   CLKNLDSTLH--AMPNLNQVHAVIEHYGPTVYFHPEEAYMPSSVQWFFKNGALLYRSG-K  301

Query  1035  TNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
             +    I   GSNLP GG ND  +W++LP D   K  +K+G+ +SSE+Y+++KP  GGTFT
Sbjct  302   SQGEPINSTGSNLPAGGCNDMEFWIDLPEDEEAKSHLKKGNHESSELYVHVKPALGGTFT  361

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             DI +WIF PFNGP+T K+G I  +P+  IGEH+GDWEH T R+ NF+G L +++FS+HSG
Sbjct  362   DIVMWIFCPFNGPATLKIG-IFTLPMTRIGEHVGDWEHFTFRVCNFSGELRQMFFSQHSG  420

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDT  502
             G WVDA ++EF+   NK   YSS +GHA++  PG+ LQG     IG+RND AKS  +LD+
Sbjct  421   GGWVDASDIEFVK-DNKPAVYSSKHGHASFPHPGMYLQGSSKFGIGVRNDVAKSKYMLDS  479

Query  501   GLRYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLI  334
               RY +VA    G   ++EP W++Y REWGP I Y S  +I ++ +LLP+  R  FE ++
Sbjct  480   SQRYVIVAAEYLGNGVVIEPRWLQYMREWGPSIAYDSGSEINKIMNLLPLVVRFSFENIV  539

Query  333   HLLPNEFFGEEGPTGPNMKASWSGDE  256
              L P   +GEEGPTGP  K +W GDE
Sbjct  540   DLFPIALYGEEGPTGPKEKDNWEGDE  565



>ref|XP_011038467.1| PREDICTED: uncharacterized protein LOC105135340 [Populus euphratica]
Length=573

 Score =   400 bits (1029),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 214/443 (48%), Positives = 283/443 (64%), Gaps = 21/443 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+L+WS +S      G  Y WLP PP+GY A+G VVT + E+P  + +RCV +  T+ CE
Sbjct  139   YSLIWSLNSE--KTGGGGYFWLPNPPEGYKAMGIVVTNNPEEPKVEEVRCVRADLTERCE  196

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLG----SFSGNVGTFACLKN  1204
               D +    + +++P  F ++  RP  RG  A+GV VGTF      S    +   ACLKN
Sbjct  197   TSDRIISSDSKSSNP--FEVWNTRPHRRGMFAQGVSVGTFYCNAYLSSDEVLTDIACLKN  254

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTK-GDETNP  1027
               +  S  AMPNL Q+ AL + Y P ++ HP +   PSSV WFF NGALLY   G +  P
Sbjct  255   --LDLSQPAMPNLDQVHALIKHYGPTVFFHPDEDCLPSSVQWFFKNGALLYQDCGQKGEP  312

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             + +   GSNLP GG NDG +W++LPVD+  +  V  GDL+S+E+Y++ KP FGGTFTDIA
Sbjct  313   IDLM--GSNLPSGGENDGEFWIDLPVDDAARNDVIAGDLESAELYVHAKPAFGGTFTDIA  370

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +WIF PFNGP+T K+G +  IP+  IG+H+GDWEH TLR+SNF G L +V+FSEHSGG W
Sbjct  371   MWIFCPFNGPATLKIG-LMTIPMTKIGQHVGDWEHYTLRVSNFTGELWQVFFSEHSGGRW  429

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLR  493
             VDA +LEFI G N+ V YSS +GHA++  PG  LQG     IG+RND A+S   +D+ L+
Sbjct  430   VDASDLEFIEG-NRPVVYSSKHGHASFPHPGTYLQGSTKLGIGVRNDVARSKYYVDSSLK  488

Query  492   YSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
             Y +VA    G   + EP W++Y REWGP I Y S  +I ++   LP   R   E L+ L 
Sbjct  489   YQLVAAEYLGDGVVTEPCWLQYMREWGPTIVYDSRSEIDKILDHLPFFVRFSVENLVDLF  548

Query  324   PNEFFGEEGPTGPNMKASWSGDE  256
             P E +GEEGPTGP  K +W GDE
Sbjct  549   PTELYGEEGPTGPKEKCNWVGDE  571



>ref|XP_009598580.1| PREDICTED: uncharacterized protein LOC104094361 [Nicotiana tomentosiformis]
Length=572

 Score =   400 bits (1028),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 213/444 (48%), Positives = 284/444 (64%), Gaps = 20/444 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTL+WSSDS     +G +Y+WLP  P GY ++G V +    +P  D ++CV +  T  CE
Sbjct  137   YTLIWSSDS---QYNGSSYIWLPNAPVGYKSMGFVASVEPNEPDPDEVKCVRADLTAKCE  193

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG----TFACLKN  1204
               + ++    S    + F ++  RP  RG   KGV VGTF  S + + G      ACLKN
Sbjct  194   ACEMMFS-SDSIFTRDQFQVWKTRPCKRGMLCKGVSVGTFFCSTTFSSGDELDNIACLKN  252

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              + +    AMPNL QI AL + Y P +YLHP + Y PSSV WFF NGALLY  G  +  +
Sbjct  253   LDSSLH--AMPNLEQIHALIKHYGPTVYLHPDEIYLPSSVPWFFINGALLYKDGRNSG-I  309

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNN-EKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
              I   GSNLP GG NDG YW++LP  N+  +  VK G+++S+E+Y+++KP  GGTFTDIA
Sbjct  310   AINSKGSNLPAGGENDGEYWLDLPNKNDANRTNVKCGNIESAELYVHVKPALGGTFTDIA  369

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +WIF PFNGP+T K+G +    L  +GEH+GDWEH TLRISNF+G L+ VYFSEHSGG W
Sbjct  370   MWIFCPFNGPATLKIGLLS-FALNKVGEHVGDWEHYTLRISNFSGELSSVYFSEHSGGEW  428

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLR  493
             +DA NLEFI G NKSV Y+S NGHA++  PG  LQG     +G+RND A+S   +D+  +
Sbjct  429   LDACNLEFIEG-NKSVVYASRNGHASFPHPGCYLQGSTKLGVGVRNDCARSKYHVDSSSQ  487

Query  492   YSVVAGL---QGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
             Y ++A     +G+V EPPW++Y REWGP I Y    +++++   LP   R   E+LI L 
Sbjct  488   YQIIAAEYLGEGVVSEPPWLQYMREWGPTIIYDGRSEVEKIIKHLPFFMRFSVESLIELF  547

Query  324   PNEFFGEEGPTGPNMKASWSGDEK  253
             P E +GE GPTGP  K +W GDE+
Sbjct  548   PTELYGEAGPTGPKEKDNWLGDER  571



>ref|XP_002319114.1| hypothetical protein POPTR_0013s04580g [Populus trichocarpa]
 gb|EEE95037.1| hypothetical protein POPTR_0013s04580g [Populus trichocarpa]
Length=573

 Score =   400 bits (1028),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 214/443 (48%), Positives = 283/443 (64%), Gaps = 21/443 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+L+W S+S      G  Y WLP PP+GY A+G VVT + E+P  + +RCV +  T+ CE
Sbjct  139   YSLIWGSNSE--KNGGGGYFWLPNPPEGYKAMGIVVTKNPEEPKVEEVRCVRADLTERCE  196

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLG----SFSGNVGTFACLKN  1204
               D +    + +++P  F ++  RP  RG  AKGV VGTF      S    +   ACLKN
Sbjct  197   TSDQIISSDSKSSNP--FEVWNTRPHRRGMFAKGVSVGTFYCNAYLSSDEVLIDIACLKN  254

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTK-GDETNP  1027
               +  S  AMPNL Q+ AL + Y P ++ HP +   PSSV WFF NGALLY   G +  P
Sbjct  255   --LDHSQPAMPNLDQVHALIKHYGPTVFFHPDEDCLPSSVQWFFKNGALLYQDCGQKCEP  312

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             + +   GSNLP GG NDG +W++LPVD+  +  V  GDL+S+E+Y++ KP FGGTFTDIA
Sbjct  313   IDL--RGSNLPSGGENDGEFWIDLPVDDAARNDVIAGDLESAELYVHAKPAFGGTFTDIA  370

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +WIF PFNGP+T K+G +  IP+  IG+H+GDWEH TLR+SNF G L +V+FSEHSGG W
Sbjct  371   MWIFCPFNGPATLKIG-LMTIPMTKIGQHVGDWEHYTLRVSNFTGELWQVFFSEHSGGRW  429

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLR  493
             VDA +LEFI G N+ V YSS +GHA++  PG  LQG     IG+RND A+S   +D+ L+
Sbjct  430   VDASDLEFIEG-NRPVVYSSKHGHASFPHPGTYLQGSTKLGIGVRNDVARSKYYVDSSLK  488

Query  492   YSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
             Y +VA    G   + EP W++Y REWGP I Y S  +I ++   LP   R   E L+ L 
Sbjct  489   YQLVAAEYLGDGVVTEPCWLQYMREWGPTIVYDSRSEIDKILDHLPFFVRFSVENLVDLF  548

Query  324   PNEFFGEEGPTGPNMKASWSGDE  256
             P E +GEEGP+GP  K +W GDE
Sbjct  549   PTELYGEEGPSGPKEKYNWVGDE  571



>ref|XP_010463914.1| PREDICTED: uncharacterized protein LOC104744543 [Camelina sativa]
Length=569

 Score =   399 bits (1026),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 205/447 (46%), Positives = 279/447 (62%), Gaps = 22/447 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWS+D   + ++G  Y WLP+PP GY A+G  VT    KP  + +RCV    T+ CE
Sbjct  128   YSLVWSAD---LEKNGGGYFWLPIPPVGYRAMGFFVTHQPGKPETEEVRCVREDLTESCE  184

Query  1371  VEDWVWGRGTSNNDPNG----FNLYTLRPINRGTQAKGVKVGTFLG-----SFSGNVGTF  1219
               + +   G+S    N     F++++ +P  RG  ++GV VG+F       S    V   
Sbjct  185   TSEMILEVGSSKKKSNRSGSPFSVWSTQPCERGMLSQGVAVGSFFCCTYDLSSDRTVPDI  244

Query  1218  ACLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGD  1039
              CLKN +      AMPNL+Q+ A+   Y P +Y HP + Y PSSV WFF NGALLY  G 
Sbjct  245   GCLKNLDSTLH--AMPNLNQVHAVIEHYGPTVYFHPEEAYMPSSVQWFFKNGALLYRSGK  302

Query  1038  ETNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTF  859
                   I   GSNLP GG ND  +W++LP D   K  +K+G+L+SSE+Y+++KP  GGTF
Sbjct  303   SQEGEPINSTGSNLPVGGCNDMEFWIDLPEDEEAKSHLKKGNLESSELYVHVKPALGGTF  362

Query  858   TDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHS  679
             TDI +WIF PFNGP+T K+G I  +P+  IGEH+GDWEH T RI NF+G L +++FS+HS
Sbjct  363   TDIVMWIFCPFNGPATLKIG-IFTLPMTRIGEHVGDWEHFTFRICNFSGELWQMFFSQHS  421

Query  678   GGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLD  505
             GG WVDA ++EF+   NK   YSS +GHA++  PG+ LQG     IG+RND AKS  ++D
Sbjct  422   GGGWVDASDIEFVK-DNKPAVYSSKHGHASFPHPGMYLQGSSKFGIGVRNDVAKSDYIVD  480

Query  504   TGLRYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETL  337
             +  RY +VA    G   ++EP W++Y REWGP I Y S  +I ++ +LLP+  R  FE +
Sbjct  481   SSQRYVIVAAEYLGNGVVMEPRWLQYMREWGPSIAYDSGSEINKIMNLLPLVVRFSFENI  540

Query  336   IHLLPNEFFGEEGPTGPNMKASWSGDE  256
             + L P   +GEEGPTGP  K +W GDE
Sbjct  541   VDLFPIALYGEEGPTGPKEKDNWEGDE  567



>ref|XP_007131534.1| hypothetical protein PHAVU_011G021100g [Phaseolus vulgaris]
 gb|ESW03528.1| hypothetical protein PHAVU_011G021100g [Phaseolus vulgaris]
Length=576

 Score =   400 bits (1027),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 213/441 (48%), Positives = 285/441 (65%), Gaps = 16/441 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             + LVW  ++  +  S   Y W+P PP+GY A+G +VTT  EKPS D + CV +  T  CE
Sbjct  143   FKLVWGENAASLEISS-VYFWVPEPPEGYKALGCLVTTKHEKPSLDEMCCVRTDLTHKCE  201

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT---FACLKNN  1201
                 +   G S      F + +LRP +RG   KGV VGTF  S    +      ACLKN 
Sbjct  202   PYRQILTSG-SRIPEFSFQVCSLRPCDRGMLGKGVCVGTFFCSSGWTMREDVPVACLKNL  260

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             N A    AMPNL QI AL   Y P ++ HP + Y PSSV+WFF+NGALLYTKG      R
Sbjct  261   NPAIL--AMPNLQQIHALINHYGPTIFFHPQEIYLPSSVDWFFNNGALLYTKGVSKGE-R  317

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I   GSNLP GG+NDG +W++LP D+ +++ VKRGDL+S+++Y+++K   GGTFTDIA+W
Sbjct  318   IDATGSNLPGGGSNDGQFWIDLPRDD-KRDVVKRGDLKSAKLYVHVKAAVGGTFTDIAMW  376

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             +F PFNGP+T K G I+ IPLG +GEH+GDWEH TLRISNF+G L  +YFS+HSGG WVD
Sbjct  377   VFCPFNGPATLKFG-IKNIPLGRVGEHVGDWEHFTLRISNFSGELYSIYFSQHSGGEWVD  435

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRYS  487
             A +L++I G NK++ YSS  GHA+Y +PG  +QG     IGIRND A+S   +D+ + Y 
Sbjct  436   ACDLDYIEG-NKAIVYSSKCGHASYPRPGTCIQGSSKLGIGIRNDAARSNLYVDSSVHYE  494

Query  486   VVAG---LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
             +VA       + EP W+++ REWGPKI Y S+ ++ +V + LP   +   + L +  P E
Sbjct  495   LVAAEYLENDVTEPQWLQFMREWGPKIVYDSKTELDKVINALPRMLKYSVKNLFNKFPVE  554

Query  315   FFGEEGPTGPNMKASWSGDEK  253
              +GEEGPTGP  K +W  DE+
Sbjct  555   LYGEEGPTGPKEKNNWLEDER  575



>ref|XP_006408193.1| hypothetical protein EUTSA_v10020390mg [Eutrema salsugineum]
 gb|ESQ49646.1| hypothetical protein EUTSA_v10020390mg [Eutrema salsugineum]
Length=570

 Score =   399 bits (1025),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 209/446 (47%), Positives = 288/446 (65%), Gaps = 22/446 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWS+DS    ++G  Y WLP PP GY AVG VVT   E+P  + +RCV    T+ CE
Sbjct  131   YSLVWSTDS---EKNGSGYFWLPNPPVGYKAVGVVVTDEPEEPETEEVRCVREDLTESCE  187

Query  1371  VEDWVWGRGTS---NNDPNGFNLYTLRPINRGTQAKGVKVGTFLG-----SFSGNVGTFA  1216
               + +   G+S   N+  + F+++++ P  RG +++GV VG+F       S    V   A
Sbjct  188   TSEIILEVGSSKKSNHSDSPFSVWSILPCERGMRSQGVAVGSFFCCTYDLSSGRTVRDIA  247

Query  1215  CLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDE  1036
             CLKN  +  +  AMPNL Q+ A+   Y P +Y HP +TY PSSV+WFF NGALLY  G +
Sbjct  248   CLKN--LDHTLHAMPNLDQVHAVIEHYGPTVYFHPEETYMPSSVSWFFKNGALLYRSG-K  304

Query  1035  TNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
             +    I   GSNLP GG ND  +W++LP D   K  +K+G+L+SSE+Y+++KP  GGTFT
Sbjct  305   SQGEPINSTGSNLPVGGCNDMEFWIDLPKDEEAKSNLKKGNLESSELYVHVKPALGGTFT  364

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             DI +WIF PFNGP+T K+G +  +P+  IGEH+GDWEH T R+ NF+G L +++FS+HSG
Sbjct  365   DIVMWIFCPFNGPATLKIG-LFTLPMTRIGEHVGDWEHFTFRVCNFSGELWQMFFSQHSG  423

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDT  502
             G WVDA ++EF+ G NK+  YSS +GHA++  PG+ LQG     IG+RND AKS  +LD+
Sbjct  424   GGWVDASDIEFVEG-NKAAVYSSKHGHASFPHPGMYLQGSSKLGIGVRNDVAKSKYILDS  482

Query  501   GLRYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLI  334
               RY +VA    G   + EP W++Y REWGP I Y S  +I ++ +LLP+  R   E ++
Sbjct  483   SQRYVIVAAEYLGKDAVAEPCWLQYMREWGPIIAYDSGSEINKIMNLLPLVVRFSIENIV  542

Query  333   HLLPNEFFGEEGPTGPNMKASWSGDE  256
              L P   +GEEGPTGP  K +W GDE
Sbjct  543   DLFPIALYGEEGPTGPKEKDNWEGDE  568



>ref|XP_010674262.1| PREDICTED: uncharacterized protein LOC104890460 [Beta vulgaris 
subsp. vulgaris]
Length=546

 Score =   398 bits (1023),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 207/442 (47%), Positives = 283/442 (64%), Gaps = 30/442 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             ++LVWSS+          ++WLP  P GY A+G +VT +  +PS D IRCV    T+ CE
Sbjct  125   FSLVWSSEC--------GFIWLPNAPTGYRAMGLLVTDTPVEPSVDDIRCVRCDLTENCE  176

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL----GSFSGNVGTFACLKN  1204
               D +          + F ++  RP  RG  A+GV VGTF     G    +V T ACLKN
Sbjct  177   ACDMILD--------DDFTVWKTRPCRRGMYARGVCVGTFFSCTYGILEEDVVTTACLKN  228

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              +   +  AMPNL QI AL ++Y P +Y HP + Y PSSV WFF NGA L   G + +  
Sbjct  229   RDPTLN--AMPNLEQIHALIKQYGPTVYFHPDEIYMPSSVQWFFDNGARLCENG-KCDGE  285

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
             RI  +GS LP+GG NDG YW++LP D+++++ VKRG+L+S+E+Y+++KP FGG FTDIA+
Sbjct  286   RIDSNGSLLPKGGLNDGEYWIDLPKDDDKRDYVKRGNLESAELYVHVKPAFGGAFTDIAM  345

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP+T K+G +    L  +GEH+GDWEH TLR+SNF G L  +YFSEHSGG WV
Sbjct  346   WVFCPFNGPATLKVG-LANFSLTRVGEHVGDWEHFTLRVSNFTGELWSIYFSEHSGGKWV  404

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             DA NLE+IN  NK++ YSS  GHA+Y+  G  L G     IG+RND AKS   +D+  +Y
Sbjct  405   DASNLEYIN-ENKAIVYSSKCGHASYAHSGTYLLGPSKLGIGVRNDVAKSKYFVDSSSKY  463

Query  489   SVVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
              +VA       + EP W+++ REWGPK+TY +  +++++ + LP+  R   E L+ L P 
Sbjct  464   KIVAAEYLGDTVEEPCWLQFMREWGPKLTYDACSELEKIMNHLPIFVRFSMENLLDLFPT  523

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E +GEEGPTGP  K +W GDE+
Sbjct  524   ELYGEEGPTGPKEKDNWFGDER  545



>gb|AFK13836.1| putative pre-mRNA processing protein PRP39 [Beta vulgaris subsp. 
vulgaris]
Length=578

 Score =   399 bits (1024),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 207/442 (47%), Positives = 283/442 (64%), Gaps = 30/442 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             ++LVWSS+          ++WLP  P GY A+G +VT +  +PS D IRCV    T+ CE
Sbjct  157   FSLVWSSEC--------GFIWLPNAPTGYRAMGLLVTDTPVEPSVDDIRCVRCDLTENCE  208

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL----GSFSGNVGTFACLKN  1204
               D +          + F ++  RP  RG  A+GV VGTF     G    +V T ACLKN
Sbjct  209   ACDMILD--------DDFTVWKTRPCRRGMYARGVCVGTFFSCTYGILEEDVVTTACLKN  260

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              +   +  AMPNL QI AL ++Y P +Y HP + Y PSSV WFF NGA L   G + +  
Sbjct  261   RDPTLN--AMPNLEQIHALIKQYGPTVYFHPDEIYMPSSVQWFFDNGARLCENG-KCDGE  317

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
             RI  +GS LP+GG NDG YW++LP D+++++ VKRG+L+S+E+Y+++KP FGG FTDIA+
Sbjct  318   RIDSNGSLLPKGGLNDGEYWIDLPKDDDKRDYVKRGNLESAELYVHVKPAFGGAFTDIAM  377

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP+T K+G +    L  +GEH+GDWEH TLR+SNF G L  +YFSEHSGG WV
Sbjct  378   WVFCPFNGPATLKVG-LANFSLTRVGEHVGDWEHFTLRVSNFTGELWSIYFSEHSGGEWV  436

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             DA NLE+IN  NK++ YSS  GHA+Y+  G  L G     IG+RND AKS   +D+  +Y
Sbjct  437   DASNLEYIN-ENKAIVYSSKCGHASYAHSGTYLLGPSKLGIGVRNDVAKSKYFVDSSTKY  495

Query  489   SVVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
              +VA       + EP W+++ REWGPK+TY +  +++++ + LP+  R   E L+ L P 
Sbjct  496   KIVAAEYLGDTVEEPCWLQFMREWGPKLTYDACSELEKIMNHLPIFVRFSMENLLDLFPT  555

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E +GEEGPTGP  K +W GDE+
Sbjct  556   ELYGEEGPTGPKEKDNWFGDER  577



>gb|AES89598.2| pre-mRNA processing protein PRP39, putative [Medicago truncatula]
Length=569

 Score =   398 bits (1023),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 218/444 (49%), Positives = 289/444 (65%), Gaps = 19/444 (4%)
 Frame = -2

Query  1551  YTLVWSSD---SLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTD  1381
             + LVWSS+   SL I+ SG  Y WLP PP+GY AVG++VT   EKP  D + CV +  TD
Sbjct  133   FELVWSSNAPASLEIS-SGCGYFWLPEPPEGYKAVGYLVTDKPEKPKLDEMCCVRADLTD  191

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL---GSFSGNVGTFACL  1210
              CE     +   +   + + F L + RP +RG   KGV VGTFL   G  +G     ACL
Sbjct  192   KCEPYHVKFAVASKIPELS-FQLSSSRPCDRGMLGKGVCVGTFLCSSGLSNGEENPIACL  250

Query  1209  KNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETN  1030
             KN N A  S  MPNL QI  L   Y P ++ HP + Y PSSV+WFFSNGALL  KG  T 
Sbjct  251   KNLNAALQS--MPNLQQIHGLINHYGPTVFFHPEEIYLPSSVDWFFSNGALLCRKGMCTG  308

Query  1029  PVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDI  850
                I   GSNLP GG+NDG +W+ LP D+  ++ +KRGDL S+++Y+++KP  GGTFTDI
Sbjct  309   E-GIDATGSNLPSGGSNDGQFWIELPSDD-RRDFIKRGDLNSAKLYVHVKPALGGTFTDI  366

Query  849   AIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGS  670
             A+WIF PFNGP+T K+G I+ IPL  IGEH+GDWEH TLRI NF G L  +YFS+HSGG 
Sbjct  367   AMWIFCPFNGPATLKVG-IKNIPLSKIGEHVGDWEHFTLRICNFAGELYSIYFSQHSGGE  425

Query  669   WVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGL  496
             W+D  +L++I+G NK++ YSS +GHA+Y +PG  +QG     +GIRND  +S   +D+ +
Sbjct  426   WMDTCDLDYIDG-NKAIVYSSKSGHASYPRPGTYIQGSSKLGLGIRNDAVRSNLYVDSSI  484

Query  495   RYSVVAG--LQGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
              Y VVA   L+ +V EP W+++ R+WGPKI Y S+ ++ +V + LP   +     LI+ L
Sbjct  485   HYEVVAAEYLENVVAEPNWLQFMRKWGPKIIYDSKTELDKVINALPRMLQYSMRDLINKL  544

Query  324   PNEFFGEEGPTGPNMKASWSGDEK  253
             P E +GEEGPTGP  K +W  DE+
Sbjct  545   PVELYGEEGPTGPKEKNNWIHDER  568



>gb|KFK37858.1| hypothetical protein AALP_AA3G038300 [Arabis alpina]
Length=567

 Score =   398 bits (1023),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 207/446 (46%), Positives = 280/446 (63%), Gaps = 22/446 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWS+DS    ++G  Y WLP PP GY  +G +VT    +P  + +RCV    T+ CE
Sbjct  128   YSLVWSTDS---DKNGGGYFWLPNPPAGYKTMGVIVTDEPGEPKTEEVRCVREDLTESCE  184

Query  1371  VEDWVWGRGTSNNDPNG---FNLYTLRPINRGTQAKGVKVGTFLG-----SFSGNVGTFA  1216
               + ++  G+S         FN++++RP  RG +++GV VG+F       S    V   A
Sbjct  185   ASEIIFDVGSSKKSSRSSSPFNVWSIRPCERGMRSQGVAVGSFFCCSYDLSSGETVADIA  244

Query  1215  CLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDE  1036
             CLKN ++     AMPNL Q+ A+ + Y P +Y HP +TY PSSV WFF NGALLY  G  
Sbjct  245   CLKNLDLTLH--AMPNLDQVHAVIKHYGPTVYFHPEETYMPSSVQWFFKNGALLYRSGKS  302

Query  1035  TNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
                  I   GSNLP GG ND  +W++LP D   K  +K+G+ +SSE+Y+++KP  GGTFT
Sbjct  303   LGE-PINSTGSNLPLGGKNDTDFWIDLPEDEEAKSNLKKGNFESSELYVHVKPALGGTFT  361

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             DI +WIF PFNGP+T K+G +  +P+  IGEH+GDWEH T RI NF+G L ++YFS+HSG
Sbjct  362   DIVMWIFCPFNGPATLKIG-VFTLPMTRIGEHVGDWEHFTFRICNFSGELWQMYFSQHSG  420

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDT  502
             G WVDA ++EF+   NK   YSS +GHA++  PG+ LQG     IG+RND AKS   LD+
Sbjct  421   GGWVDASDIEFVK-DNKPAVYSSKHGHASFPHPGMFLQGSSKLGIGVRNDVAKSKYSLDS  479

Query  501   GLRYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLI  334
               RY +VA    G  G+VEP W++Y REWGP I Y S  +I ++ +LLP   R   + ++
Sbjct  480   SQRYVIVAAEYLGKGGVVEPCWLQYMREWGPTIAYDSGSEIDKIMNLLPWVVRFSVQNIV  539

Query  333   HLLPNEFFGEEGPTGPNMKASWSGDE  256
              L P   +GEEGPTGP  K +W GDE
Sbjct  540   DLFPIALYGEEGPTGPKEKDNWEGDE  565



>gb|EYU46397.1| hypothetical protein MIMGU_mgv1a003803mg [Erythranthe guttata]
Length=563

 Score =   398 bits (1023),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/441 (46%), Positives = 282/441 (64%), Gaps = 13/441 (3%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQS--GPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDP  1378
             Y+L+WSS+     +S  G  Y WLP  P+GY ++G VVT   +KP  D ++CV S  TD 
Sbjct  127   YSLMWSSNEGDDDESFDGCGYFWLPQSPEGYKSLGFVVTNKSDKPDLDEVKCVRSDLTDT  186

Query  1377  CEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG---TFACLK  1207
             CE    +     S        +   RP++RG   +GV VGTF   +S + G   + ACLK
Sbjct  187   CEAYGLIMDI-HSKFSKIPLTIRNTRPLHRGMYGRGVSVGTFFCGYSFSSGEELSIACLK  245

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N +      AMPN+ QI AL   Y P ++ HP + Y PSSV+WFF NGALLY+    +  
Sbjct  246   NLDSDLH--AMPNIDQIHALVTHYGPAVFFHPDEVYLPSSVSWFFENGALLYSNSSSSTG  303

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
               I   GSNLP GGTNDG YW++LP DNN ++ +K+G+L+S+++Y+++KP  GGTFTDI 
Sbjct  304   QAIDSQGSNLPNGGTNDGTYWIDLPCDNNRRQTLKKGNLESAKLYIHVKPALGGTFTDIV  363

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +W+F PFNGP T K+G +  I L  +GEH+GDWEH TLR+SNF+G L  VYFS+HSGG W
Sbjct  364   MWVFCPFNGPGTVKVG-LMNISLSKVGEHVGDWEHFTLRVSNFSGELWSVYFSQHSGGEW  422

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLR  493
             V+A +LEFI G NKSV YSS +GHA+YS+PG  +QG     IG+RND A S+  + +  +
Sbjct  423   VEAFDLEFIEG-NKSVIYSSKSGHASYSRPGSYIQGSSKLGIGVRNDAALSSYCVHSSRK  481

Query  492   YSVVAG-LQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNE  316
             + ++A    G+ EP W++Y R+WGP I Y S  ++ ++  +LP   +     +++ LP E
Sbjct  482   FEIIAAEYLGVKEPCWLQYMRKWGPSIVYDSRTELDKIIDVLPPAVKNSMRNILNKLPLE  541

Query  315   FFGEEGPTGPNMKASWSGDEK  253
              +GEEGPTGP  K +W GDE+
Sbjct  542   LYGEEGPTGPKEKNNWIGDER  562



>ref|XP_007149123.1| hypothetical protein PHAVU_005G043000g [Phaseolus vulgaris]
 gb|ESW21117.1| hypothetical protein PHAVU_005G043000g [Phaseolus vulgaris]
Length=434

 Score =   394 bits (1011),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 210/443 (47%), Positives = 266/443 (60%), Gaps = 55/443 (12%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVW++ SL I Q G  Y+WLP+ P  Y  VG+VVTTS EKPS D+IRCV S  TD C 
Sbjct  37    YKLVWTTSSLKIKQDGEGYIWLPIAPDEYKPVGYVVTTSQEKPSLDKIRCVRSDLTDECT  96

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT----FACLKN  1204
                    +         FN++ +RP+ R  +A+GV VGTFL    G   +      CLKN
Sbjct  97    TYH---SKKLWRTQNKRFNVFDVRPMKRSIEAQGVSVGTFLAQSGGGANSKPLPIVCLKN  153

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET-NP  1027
                 FS   MPN SQ+EA+ + YSP +YLHP++ Y PSSV+WFF+NGA+L  K       
Sbjct  154   TKAKFS--YMPNFSQVEAMIKAYSPYMYLHPMEEYLPSSVDWFFTNGAVLIEKRKGVIRE  211

Query  1026  VRIGPDGSNLPQGGTNDG--VYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
               I P+GSNLPQGG+ND    YW++LP+D  ++ +VK+GDL SS+ Y+++KPM GGTFTD
Sbjct  212   SAIEPNGSNLPQGGSNDEEVTYWLDLPLDETKRVKVKQGDLASSQAYVHVKPMMGGTFTD  271

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             IA+W+FYPFNG + AK+     IPL   GEH+GDWEH+TLR+SN NG L KVYFS+HS G
Sbjct  272   IAMWVFYPFNGGAKAKVA-CTNIPLRTKGEHVGDWEHVTLRVSNLNGELWKVYFSQHSRG  330

Query  672   SWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLR  493
              WVDA  LEF NG N+ VAYSSL+GHA + KPG+V+QG+   G+RND AKS AV+D    
Sbjct  331   KWVDASELEFQNG-NRVVAYSSLHGHALFPKPGVVMQGMRRFGVRNDAAKSDAVMDMANG  389

Query  492   YSVVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
             + +V        I EPPW+ Y   WGPK                                
Sbjct  390   FEIVGAEYLGSEIREPPWLNYWMNWGPK--------------------------------  417

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
                    GP GP  K SW GDE+
Sbjct  418   ------NGPKGPKQKDSWKGDER  434



>gb|EYU39520.1| hypothetical protein MIMGU_mgv1a003717mg [Erythranthe guttata]
Length=568

 Score =   398 bits (1023),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 212/447 (47%), Positives = 286/447 (64%), Gaps = 22/447 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTL++SS S    ++G  Y+WLP PP GY + G +V+    +P  + +RCV S  T+ CE
Sbjct  129   YTLIFSSKS---RKNGSGYIWLPNPPTGYKSAGFIVSNEPNEPDLEEVRCVRSNLTESCE  185

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG----TFACLKN  1204
             V++ ++ R  S    + F ++  RP  RG   KGV +GTF  S   +      + ACLKN
Sbjct  186   VDEIIFDR-NSLFSKSRFYVWNTRPCERGMLCKGVPIGTFFCSRDKSDEDSSLSIACLKN  244

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGD-----  1039
               V  S +AMPN+ QI AL + Y P +Y HP + Y PSSV+WFF NGALLY + D     
Sbjct  245   --VDSSYAAMPNVDQIHALVQHYGPTIYFHPDEAYFPSSVSWFFKNGALLYKEEDGDNNN  302

Query  1038  ETNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTF  859
               N + I  +GSNLP GG NDG +W++LP ++ +++ VKRG+++++EVY+++KP  GGTF
Sbjct  303   NNNGLAIDSNGSNLPCGGKNDGEFWLDLPKEDEKRDYVKRGNIETAEVYVHVKPSSGGTF  362

Query  858   TDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHS  679
             TDI++WIF PFNGPST K G ++      IG+H+GDWEH TLR+SNFNG L  VYFSEHS
Sbjct  363   TDISMWIFCPFNGPSTIKAGPLD-YAFDKIGQHVGDWEHYTLRLSNFNGELFCVYFSEHS  421

Query  678   GGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGI--RNDTAKSAAVLD  505
             GG WVDA  LEFING NK + Y+S +GHA++   G  +QG   +GI  RND AKS   +D
Sbjct  422   GGEWVDASELEFING-NKFIVYASKSGHASFPHEGCYIQGSEKLGIGARNDCAKSEYSVD  480

Query  504   TGLRYSVVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLI  334
             +  +Y VVA      GI EP W++Y REWGP + Y S  +I ++   LP   R   E L+
Sbjct  481   SSRKYCVVAAEYIGDGITEPRWLQYMREWGPTVVYKSGSEIDKIMKNLPFFIRFSLENLV  540

Query  333   HLLPNEFFGEEGPTGPNMKASWSGDEK  253
              L P E +GEEGPTGP  K +W GDE+
Sbjct  541   ELFPTEIYGEEGPTGPKEKDNWLGDER  567



>ref|NP_171905.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAY25448.1| At1g04090 [Arabidopsis thaliana]
 gb|ABO38755.1| At1g04090 [Arabidopsis thaliana]
 gb|AEE27655.1| uncharacterized protein AT1G04090 [Arabidopsis thaliana]
Length=572

 Score =   398 bits (1023),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 217/454 (48%), Positives = 298/454 (66%), Gaps = 30/454 (7%)
 Frame = -2

Query  1551  YTLVWSS----DSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFT  1384
             +TLVWSS    ++   ++S   Y WLP PP+GY ++G VVT +  KP  + +RCV +  T
Sbjct  127   FTLVWSSNDSAENECSSKSECGYFWLPQPPEGYRSIGFVVTKTSVKPELNEVRCVRADLT  186

Query  1383  DPCEVEDWVWGRGTSNNDPNGFNLYT--LRPINRGTQAKGVKVGTF-----LGSFSGNVG  1225
             D CE  + +    T+ ++  G  L+    RP +RG   KGV  GTF     L +   ++G
Sbjct  187   DICEPHNVI---VTAVSESLGVPLFIWRTRPSDRGMWGKGVSAGTFFCRTRLVAAREDLG  243

Query  1224  T-FACLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYT  1048
                ACLKN  +  S  AMPN+ QI+AL + Y P L  HP +TY PSSV+WFF NGA+L  
Sbjct  244   IGIACLKN--LDLSLHAMPNVDQIQALIQHYGPTLVFHPGETYLPSSVSWFFKNGAVLCE  301

Query  1047  KGDETNPVR--IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPM  874
             KG   NP+   I  +GSNLPQGG+ND  +W++LP D+ +++ VKRG+L+SS++Y++IKP 
Sbjct  302   KG---NPIEEPIDENGSNLPQGGSNDKQFWIDLPCDDQQRDFVKRGNLESSKLYIHIKPA  358

Query  873   FGGTFTDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVY  694
              GGTFTD+  WIF PFNGP+T KLG ++ I L  IG+H+ DWEH TLRISNF+G L  +Y
Sbjct  359   LGGTFTDLVFWIFCPFNGPATLKLGLVD-ISLISIGQHVCDWEHFTLRISNFSGELYSIY  417

Query  693   FSEHSGGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG--IGDIGIRNDTAKS  520
              S+HSGG W++A +LE I GSNK+V YSS +GHA++ + G  LQG  +  IGIRNDTA+S
Sbjct  418   LSQHSGGEWIEAYDLEIIPGSNKAVVYSSKHGHASFPRAGTYLQGSTMLGIGIRNDTARS  477

Query  519   AAVLDTGLRYSVVAG--LQG---IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWR  355
               ++D+  RY ++A   L G   + EPPW++Y REWGPK+ Y S E+I+R+ +  P   R
Sbjct  478   ELLVDSSSRYEIIAAEYLSGNSVLAEPPWLQYMREWGPKVVYDSREEIERLVNRFPRTVR  537

Query  354   GVFETLIHLLPNEFFGEEGPTGPNMKASWSGDEK  253
                 T++  LP E  GEEGPTGP  K +W GDE+
Sbjct  538   VSLATVLRKLPVELSGEEGPTGPKEKNNWYGDER  571



>ref|XP_006345810.1| PREDICTED: uncharacterized protein LOC102590400 [Solanum tuberosum]
Length=567

 Score =   398 bits (1022),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 215/443 (49%), Positives = 282/443 (64%), Gaps = 19/443 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV+++++L        Y+WLP  P GY A+G V T    +P+ D +RCV +  T+ CE
Sbjct  133   YTLVYNANTL---YKEVGYIWLPNAPVGYKAMGFVATAEPNEPNLDEVRCVRADLTESCE  189

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFS---GNVGTFACLKNN  1201
               + V+    S      F ++  RP  RG   +GV VGTF  S S   G+  T ACLKN 
Sbjct  190   TCEVVFS-ANSFFAKRQFQVWKTRPCKRGMLCRGVSVGTFFCSTSFTKGDELTVACLKNF  248

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             + +    AMPNL Q+ AL + Y P +Y HP + Y PSSV WFFSNGALL+  G + N + 
Sbjct  249   DSSLQ--AMPNLEQVHALIKHYGPTVYFHPDEIYLPSSVPWFFSNGALLFKDGKD-NGIA  305

Query  1020  IGPDGSNLPQGGTNDGVYWVNLP-VDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
             I   GSNLP GG NDG YW++LP  D   ++ VK G ++++E+Y+++KP  GGTFTDIA+
Sbjct  306   IDAKGSNLPAGGRNDGKYWLDLPNKDVENRQTVKCGKIETAELYVHVKPAEGGTFTDIAM  365

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+T K+G I  + L  +GEH+ DWEH TLRISNF+G L  VYFSEHSGG WV
Sbjct  366   WIFCPFNGPATLKVGLI-NLSLNKVGEHVCDWEHYTLRISNFSGELCSVYFSEHSGGEWV  424

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGI--RNDTAKSAAVLDTGLRY  490
             DA +LEFI G NKSV Y+S NGHA++  PG  LQG   +GI  RND AKS   +D+  +Y
Sbjct  425   DARDLEFIEG-NKSVVYASRNGHASFPHPGCYLQGNTKLGIGARNDCAKSKYYVDSSSKY  483

Query  489   SVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              ++A    G   +VEPPW++Y REWGP I Y S  ++  +   LP  +R   ETL+ L P
Sbjct  484   RIIAAEYLGEGTVVEPPWLQYMREWGPTIEYKSGYEVDDIIKHLPSFFRFSVETLVELFP  543

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
              E +GE GPTGP  K +W GDE+
Sbjct  544   TELYGEAGPTGPKEKNNWFGDER  566



>ref|XP_003607401.1| hypothetical protein MTR_4g077620 [Medicago truncatula]
Length=624

 Score =   400 bits (1027),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 218/444 (49%), Positives = 289/444 (65%), Gaps = 19/444 (4%)
 Frame = -2

Query  1551  YTLVWSSD---SLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTD  1381
             + LVWSS+   SL I+ SG  Y WLP PP+GY AVG++VT   EKP  D + CV +  TD
Sbjct  133   FELVWSSNAPASLEIS-SGCGYFWLPEPPEGYKAVGYLVTDKPEKPKLDEMCCVRADLTD  191

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL---GSFSGNVGTFACL  1210
              CE     +   +   + + F L + RP +RG   KGV VGTFL   G  +G     ACL
Sbjct  192   KCEPYHVKFAVASKIPELS-FQLSSSRPCDRGMLGKGVCVGTFLCSSGLSNGEENPIACL  250

Query  1209  KNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETN  1030
             KN N A  S  MPNL QI  L   Y P ++ HP + Y PSSV+WFFSNGALL  KG  T 
Sbjct  251   KNLNAALQS--MPNLQQIHGLINHYGPTVFFHPEEIYLPSSVDWFFSNGALLCRKGMCTG  308

Query  1029  PVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDI  850
                I   GSNLP GG+NDG +W+ LP D+  ++ +KRGDL S+++Y+++KP  GGTFTDI
Sbjct  309   E-GIDATGSNLPSGGSNDGQFWIELPSDD-RRDFIKRGDLNSAKLYVHVKPALGGTFTDI  366

Query  849   AIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGS  670
             A+WIF PFNGP+T K+G I+ IPL  IGEH+GDWEH TLRI NF G L  +YFS+HSGG 
Sbjct  367   AMWIFCPFNGPATLKVG-IKNIPLSKIGEHVGDWEHFTLRICNFAGELYSIYFSQHSGGE  425

Query  669   WVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGL  496
             W+D  +L++I+G NK++ YSS +GHA+Y +PG  +QG     +GIRND  +S   +D+ +
Sbjct  426   WMDTCDLDYIDG-NKAIVYSSKSGHASYPRPGTYIQGSSKLGLGIRNDAVRSNLYVDSSI  484

Query  495   RYSVVAG--LQGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
              Y VVA   L+ +V EP W+++ R+WGPKI Y S+ ++ +V + LP   +     LI+ L
Sbjct  485   HYEVVAAEYLENVVAEPNWLQFMRKWGPKIIYDSKTELDKVINALPRMLQYSMRDLINKL  544

Query  324   PNEFFGEEGPTGPNMKASWSGDEK  253
             P E +GEEGPTGP  K +W  DE+
Sbjct  545   PVELYGEEGPTGPKEKNNWIHDER  568



>ref|XP_009370479.1| PREDICTED: uncharacterized protein LOC103959833 [Pyrus x bretschneideri]
Length=568

 Score =   397 bits (1021),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 215/444 (48%), Positives = 281/444 (63%), Gaps = 19/444 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGP-AYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             Y LVWS D       G   Y W P PP+GY A+G +VT   +KP  D +RC+ +  TD C
Sbjct  132   YMLVWSPDEGNEDNHGAYGYFWRPQPPEGYKAMGFLVTNKPDKPRLDEVRCIRADLTDRC  191

Query  1374  EVEDWVWGRGTSN-NDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT---FACLK  1207
             E    V    T   N P  F ++T RP +RG   KGV  GTF  S   NVG      CLK
Sbjct  192   ETYRPVLNAITKFLNIP--FQVWTTRPHHRGMMGKGVSAGTFFCSSDSNVGKDLHIGCLK  249

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N N       MPNL QI +L   Y P ++ HP + Y PSSV+WFF +GALLY  G     
Sbjct  250   NLNPKLP--GMPNLDQIHSLIHHYGPTVFFHPEEIYLPSSVSWFFKSGALLYKTGTSDGE  307

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
               I   GSNLP GG+NDG +W++LP     +E +KRG+L+S+E+Y+++KP  GGTFTDIA
Sbjct  308   A-IDGSGSNLPGGGSNDGGFWIDLPT-GERREIIKRGNLESAELYVHVKPALGGTFTDIA  365

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +W+F PFNGP+T K+G ++  PL  IG+H+GDWEH TLRI NF+G L ++YFSEHSGG W
Sbjct  366   MWVFCPFNGPATLKVGPLD-FPLSKIGQHVGDWEHFTLRICNFSGELQRIYFSEHSGGKW  424

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLR  493
             VDA +LE+ +G NK++ YSS NGHA+Y  PG  LQG     IGIRND A+S   +D+ +R
Sbjct  425   VDACDLEYTDG-NKAIVYSSKNGHASYPYPGTYLQGSDKLGIGIRNDAARSNLFVDSSIR  483

Query  492   YSVVAGL---QGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
             Y +VA      G+V EP W+++ REWGP I Y S  D+ +V ++LPV ++   E + + L
Sbjct  484   YEIVAAEYLGDGVVSEPDWLQFMREWGPTIVYNSRTDLDKVINVLPVVFKHRLENIFNKL  543

Query  324   PNEFFGEEGPTGPNMKASWSGDEK  253
             P E +GEEGPTGP  K +W GDE+
Sbjct  544   PVELYGEEGPTGPKEKNNWVGDER  567



>ref|XP_009772277.1| PREDICTED: uncharacterized protein LOC104222703 [Nicotiana sylvestris]
Length=572

 Score =   397 bits (1021),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 212/444 (48%), Positives = 280/444 (63%), Gaps = 20/444 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTL+WSSDS     +G  Y+W+P  P GY ++G V +    +P  D +RCV +  T  CE
Sbjct  137   YTLIWSSDS---QYNGSGYIWMPNAPVGYKSMGFVASVEPNEPDPDEVRCVRADLTAKCE  193

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGS----FSGNVGTFACLKN  1204
               + ++    S    + F ++  RP  RG   KGV VGTF  S    F   +   ACLKN
Sbjct  194   ACEMMFS-SDSIFPRDQFQVWKTRPCKRGMLCKGVSVGTFFCSTTFSFGDELDNIACLKN  252

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              + +    AMPNL QI AL + Y P +YLHP + Y PSSV WFF NGALLY  G  +   
Sbjct  253   LDSSLH--AMPNLEQIHALIKHYGPTVYLHPDEIYLPSSVPWFFINGALLYEDGRNSG-T  309

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLP-VDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
              I   GSNLP GG NDG YW++LP  D+  +  VK G+++S+E+Y+++KP  GGTFTDIA
Sbjct  310   AIDSKGSNLPAGGENDGEYWLDLPNKDDANRTNVKCGNIESAELYVHVKPALGGTFTDIA  369

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +WIF PFNGP+T K+G +    L  +GEH+GDWEH TLRISNF+G L+ VYFSEHSGG W
Sbjct  370   MWIFCPFNGPATLKIGLLS-FALNKVGEHVGDWEHYTLRISNFSGELSSVYFSEHSGGEW  428

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLR  493
             +DA NLEFI G NKSV Y+S NGHA++   G  LQG     +G+RND A+S   +D+  +
Sbjct  429   LDACNLEFIAG-NKSVVYASRNGHASFPHAGCYLQGSTKLGVGVRNDCARSKYHVDSSSK  487

Query  492   YSVVAGL---QGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
             Y ++A     +G+V EPPW++Y REWGP I Y    +++++   LP   R   E+LI L 
Sbjct  488   YQIIAAEYLGEGVVSEPPWLQYMREWGPTIIYDGRSEVEKIIKHLPFFMRFSVESLIELF  547

Query  324   PNEFFGEEGPTGPNMKASWSGDEK  253
             P E +GE GPTGP  K +W GDE+
Sbjct  548   PTELYGEAGPTGPKEKDNWLGDER  571



>ref|XP_009123923.1| PREDICTED: uncharacterized protein LOC103848849 [Brassica rapa]
Length=569

 Score =   397 bits (1020),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 217/458 (47%), Positives = 289/458 (63%), Gaps = 34/458 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQ---SGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTD  1381
             YTLVWSS+ L   +    G AY WLP PP+GY  VG +VTTS  KP  D++RCV +  TD
Sbjct  120   YTLVWSSNDLSEDEPKSEGCAYFWLPKPPRGYKPVGFLVTTSPTKPDLDQVRCVRADLTD  179

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-------  1222
              CE    V     S++      ++  RP +RG   KGV  GTF       +         
Sbjct  180   KCEARR-VIITALSDSLRVPLFIWKTRPSDRGMSGKGVSAGTFFCRTPLMISAEEMEEEE  238

Query  1221  -------FACLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNG  1063
                     ACLKN + +    AMPNL QI AL + Y P ++ HP + Y PSSV+WFF NG
Sbjct  239   EDRLCNNIACLKNLDPSLH--AMPNLDQIHALVQHYGPRVFFHPDEVYLPSSVSWFFKNG  296

Query  1062  ALLYTKGDETNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKER---VKRGDLQSSEVY  892
             A+L +  D   PV    +GSNLP GG ND  +W++LP  NN+++R   +KRGDL+S+++Y
Sbjct  297   AVLCS-SDNQEPV--DENGSNLPHGGANDKQFWIDLP--NNDEQRNKFLKRGDLESAKLY  351

Query  891   LNIKPMFGGTFTDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNG  712
             +++KP FGGTFTD+  WIF PFNGP+T KLG +  + L   G+H+ DWEH TLRISNF+G
Sbjct  352   VHVKPAFGGTFTDLVFWIFCPFNGPATLKLG-LMNLSLAKTGQHVCDWEHFTLRISNFSG  410

Query  711   VLNKVYFSEHSGGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG--IGDIGIR  538
              L+ VYFS+HSGG WV+A +LEF++GSNK+V YSS +GHA++++ G+ LQG  +  IGIR
Sbjct  411   ELHAVYFSQHSGGEWVEAQDLEFVDGSNKAVVYSSKHGHASFARSGMYLQGSDLLGIGIR  470

Query  537   NDTAKSAAVLDTGLRYSVVAGLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLP  367
             NDTA+S   +D+  +Y VVA       +VEPPW+ Y REWGPKI Y S  +I+R+   LP
Sbjct  471   NDTARSDLFVDSCSKYEVVAAEYLGGAVVEPPWLGYMREWGPKIVYGSRTEIERLNERLP  530

Query  366   VEWRGVFETLIHLLPNEFFGEEGPTGPNMKASWSGDEK  253
                R   + ++  LP E  GEEGPTGP  K +W GDE+
Sbjct  531   WRLRCWVDAVLRKLPVELSGEEGPTGPKEKNNWFGDER  568



>gb|KHN21339.1| hypothetical protein glysoja_026540 [Glycine soja]
Length=540

 Score =   396 bits (1017),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 217/444 (49%), Positives = 271/444 (61%), Gaps = 56/444 (13%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVW++ S  I Q G  Y+WLP+ P GY+ VGHVVTTS EKPS D+IRCV S  TD   
Sbjct  142   YKLVWNTKSQKIKQDGHGYIWLPISPDGYNPVGHVVTTSPEKPSLDKIRCVRSDLTDEST  201

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFA----CLKN  1204
                 +    T N     FN+Y +RPI RG +A+GV VGTFL    G   + A    CLKN
Sbjct  202   TCHSMKLWRTENKR---FNVYDVRPIKRGIEAQGVSVGTFLAQSGGGTNSKAFPIFCLKN  258

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET-NP  1027
                +FS   MPNLSQI+A+ + YSP +YLHP++ Y PSSV+WFF+NGA+L  K       
Sbjct  259   TKGSFS--YMPNLSQIKAMIKAYSPYMYLHPMEEYLPSSVDWFFTNGAVLIEKRKGVIRE  316

Query  1026  VRIGPDGSNLPQGGTND---GVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
               I P+G+NLPQG +ND     YW++LP+D  ++  VK+GDL SS+ Y+++KPM GGTFT
Sbjct  317   SSIEPNGTNLPQGSSNDYDDATYWLDLPLDETKRVSVKKGDLASSQAYVHVKPMLGGTFT  376

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             DI +W+FYPFNG + AK+     IPL   GEH+GDWEHLTLRISNFNG L KVYFS+HS 
Sbjct  377   DIVMWVFYPFNGGARAKVA-CTNIPLRTKGEHVGDWEHLTLRISNFNGELWKVYFSQHSK  435

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGL  496
             G W DA  LEF NG N+ VAYSSL+GHA + KPGLV+QG+  +G+RND AKS AV+D   
Sbjct  436   GQWEDASELEFQNG-NRPVAYSSLHGHALFPKPGLVMQGMRGLGVRNDAAKSDAVMDMAT  494

Query  495   RYSVVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
              + +VA       I EPP + +C  WGPK                               
Sbjct  495   WFEIVAAEYLGSQIREPPRLNFCMNWGPK-------------------------------  523

Query  324   PNEFFGEEGPTGPNMKASWSGDEK  253
                    EGP GP  K  W GDE+
Sbjct  524   -------EGPKGPKQKDMWKGDER  540



>ref|XP_004495588.1| PREDICTED: uncharacterized protein LOC101489287 [Cicer arietinum]
Length=563

 Score =   397 bits (1019),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 207/442 (47%), Positives = 277/442 (63%), Gaps = 20/442 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+L+WS DS         Y WLP PP GY  +G +VTT+  +P  + +RCV +  T+ CE
Sbjct  130   YSLMWSVDS----HDECVYFWLPNPPTGYKPLGVIVTTNPNEPEVEEVRCVRTDLTEICE  185

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSFSGN---VGTFACLKN  1204
               D +     S    N F ++   P +RG  A+GV VGTF  G++  +   V   ACLKN
Sbjct  186   TSDLLLTM-KSKFSKNSFQVWKTEPCDRGMLARGVSVGTFFCGTYFDSEQVVVDIACLKN  244

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              + +    AMPNL+QI AL   Y P +Y HP + Y PSSV WFF NGALLY  G E    
Sbjct  245   LDSSLH--AMPNLNQIHALIEHYGPTVYFHPDEIYMPSSVPWFFKNGALLYAAGSEKGKT  302

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I   GSNLP+GG NDG +W++LP D   +  +K+G+++S+E+Y+++KP  GG FTDIA+
Sbjct  303   -IDYQGSNLPRGGLNDGAFWIDLPSDEQARNNLKKGNIESAELYVHVKPALGGAFTDIAM  361

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP+T K+  +  I +  IGEH+GDWEH TLR+SNF G L   +FSEHSGG W+
Sbjct  362   WVFCPFNGPATLKVSLV-NIEMSKIGEHVGDWEHFTLRVSNFTGELWSAFFSEHSGGKWI  420

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             +A +LEF+   NK + YSS +GHA+Y  PG  LQG     IG+RND A+S  ++D+ +RY
Sbjct  421   NAFDLEFVK-ENKPIVYSSRHGHASYPHPGTYLQGSSKLGIGVRNDAARSKFIVDSSVRY  479

Query  489   SVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              +VA    G   I EP W++Y REWGP I Y S  +I+++  LLP+  R   E L  L P
Sbjct  480   KIVAAEYLGDGVITEPCWLQYMREWGPTIVYDSRSEIEKIIDLLPIFVRFSVENLFELFP  539

Query  321   NEFFGEEGPTGPNMKASWSGDE  256
              E +GEEGPTGP  K +W GDE
Sbjct  540   TELYGEEGPTGPKEKDNWLGDE  561



>ref|XP_006400398.1| hypothetical protein EUTSA_v10013152mg [Eutrema salsugineum]
 gb|ESQ41851.1| hypothetical protein EUTSA_v10013152mg [Eutrema salsugineum]
Length=555

 Score =   396 bits (1018),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 215/442 (49%), Positives = 283/442 (64%), Gaps = 32/442 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSSDS         Y WLP PP GY AVG +VT   E+P  + +RCV    T+ CE
Sbjct  129   YTLVWSSDS-------DCYFWLPDPPPGYRAVGVIVTDEAEEPEVEEVRCVREDLTESCE  181

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
               + + G G+       FN+++  P  RG  ++GV VG+F  S + N    + ACLKN +
Sbjct  182   TREMILGLGS-------FNVWSTEPCERGIWSRGVVVGSFFCSTNANRAAMSIACLKNLD  234

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGD-ETNPVR  1021
              +     MPNL Q+ AL + Y P +Y HP +TY PSSV WFF NGALLY  G  +  PV 
Sbjct  235   PSLH--GMPNLDQVHALIQHYGPTVYFHPEETYMPSSVPWFFKNGALLYRFGKSQGEPVN  292

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNE-KERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
                 GSNLP GG NDG +W++LP D+ E +  +K+G+L+SSE+Y+++KP  GG FTD+ +
Sbjct  293   SA--GSNLPAGGENDGNFWIDLPQDDEEARSNLKKGNLESSELYVHVKPALGGIFTDVVM  350

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+T K+G +  +P+  IGEH+GDWEH T RISNF+G L +++FS+HSGG WV
Sbjct  351   WIFCPFNGPATLKIGLLT-VPMNRIGEHVGDWEHFTFRISNFDGELTQMFFSQHSGGGWV  409

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             DA +LEF+ GSNK V YSS +GHA++  PGL LQG     IG+RND  KS   +D+  RY
Sbjct  410   DASDLEFVKGSNKPVVYSSKHGHASFPHPGLYLQGSSKLGIGVRNDVGKSKFAVDSSQRY  469

Query  489   SVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              VVA    G   + EP W++Y REWGP I Y S  +I ++ +LLP+  R  FE   +L P
Sbjct  470   RVVAAEYLGEGAVSEPCWLQYMREWGPTIVYDSAAEIDKIINLLPLIVRYSFE---NLFP  526

Query  321   NEFFGEEGPTGPNMKASWSGDE  256
                +GEEGPTGP  K +W GDE
Sbjct  527   IALYGEEGPTGPKEKDNWEGDE  548



>ref|XP_004155688.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101223927 
[Cucumis sativus]
Length=555

 Score =   396 bits (1018),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 208/439 (47%), Positives = 278/439 (63%), Gaps = 17/439 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTL+WSS    +    P ++WLP  P+GY A+G +VT   E+PS D IRCV +  T+ CE
Sbjct  127   YTLIWSSG---LNGVDPGFIWLPNAPEGYRAMGFLVTDRSEEPSRDDIRCVRADLTERCE  183

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFS-GNVGTFACLKNNNV  1195
               D +    T  +    F ++  RP  RG    GV VGTF    S       +CLKN N 
Sbjct  184   TGDLI---VTIKSKSQSFQVWETRPFERGMYKSGVSVGTFFCCTSLKEYLNISCLKNLNS  240

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              F    MPNL+Q++AL   Y P ++ HP + + PSSV WFF NGALLY  G+ T    I 
Sbjct  241   TFE--GMPNLNQVQALIGHYGPTVFFHPDEEFFPSSVPWFFKNGALLYRNGN-TKGEPID  297

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
               GSNLP GG NDG YW++LP ++N +E +K G+++++ +Y+++KP  GGTFTDI +W+F
Sbjct  298   MRGSNLPCGGENDGAYWIDLPTNDNARENLKSGNIKTARLYVHVKPALGGTFTDIVMWVF  357

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
              PFNGP+  K+  +  I L  IGEH+ DWEH TLRI NF+G L +VYFSEHSGG WVDA 
Sbjct  358   CPFNGPAAIKVSFLN-IKLKKIGEHVSDWEHFTLRICNFSGELWQVYFSEHSGGKWVDAS  416

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQG-IGDIGIRNDTAKSAAVLDTGLRYSVVA  478
             +LEFI+G NK + YSS +GHA+Y  PG  LQG +  IG+RND A+S   +D+ L+Y ++A
Sbjct  417   DLEFIHG-NKPIVYSSKHGHASYPHPGSYLQGSVAGIGVRNDAARSKFFVDSSLKYEIIA  475

Query  477   ----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
                 G   I EP W++Y REWGP + Y S  +I+R+  LLP   +   E L+ L P E +
Sbjct  476   AEYLGDGYIAEPDWLQYMREWGPTVKYNSRSEIERLIDLLPPFVQFSLEDLLALFPTELY  535

Query  309   GEEGPTGPNMKASWSGDEK  253
             GEEGPTGP  K +W GDE+
Sbjct  536   GEEGPTGPKXKNNWFGDER  554



>ref|XP_006400397.1| hypothetical protein EUTSA_v10013152mg [Eutrema salsugineum]
 gb|ESQ41850.1| hypothetical protein EUTSA_v10013152mg [Eutrema salsugineum]
Length=553

 Score =   396 bits (1018),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 215/442 (49%), Positives = 283/442 (64%), Gaps = 32/442 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSSDS         Y WLP PP GY AVG +VT   E+P  + +RCV    T+ CE
Sbjct  127   YTLVWSSDS-------DCYFWLPDPPPGYRAVGVIVTDEAEEPEVEEVRCVREDLTESCE  179

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG--TFACLKNNN  1198
               + + G G+       FN+++  P  RG  ++GV VG+F  S + N    + ACLKN +
Sbjct  180   TREMILGLGS-------FNVWSTEPCERGIWSRGVVVGSFFCSTNANRAAMSIACLKNLD  232

Query  1197  VAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGD-ETNPVR  1021
              +     MPNL Q+ AL + Y P +Y HP +TY PSSV WFF NGALLY  G  +  PV 
Sbjct  233   PSLH--GMPNLDQVHALIQHYGPTVYFHPEETYMPSSVPWFFKNGALLYRFGKSQGEPVN  290

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNE-KERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
                 GSNLP GG NDG +W++LP D+ E +  +K+G+L+SSE+Y+++KP  GG FTD+ +
Sbjct  291   SA--GSNLPAGGENDGNFWIDLPQDDEEARSNLKKGNLESSELYVHVKPALGGIFTDVVM  348

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+T K+G +  +P+  IGEH+GDWEH T RISNF+G L +++FS+HSGG WV
Sbjct  349   WIFCPFNGPATLKIGLLT-VPMNRIGEHVGDWEHFTFRISNFDGELTQMFFSQHSGGGWV  407

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             DA +LEF+ GSNK V YSS +GHA++  PGL LQG     IG+RND  KS   +D+  RY
Sbjct  408   DASDLEFVKGSNKPVVYSSKHGHASFPHPGLYLQGSSKLGIGVRNDVGKSKFAVDSSQRY  467

Query  489   SVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              VVA    G   + EP W++Y REWGP I Y S  +I ++ +LLP+  R  FE   +L P
Sbjct  468   RVVAAEYLGEGAVSEPCWLQYMREWGPTIVYDSAAEIDKIINLLPLIVRYSFE---NLFP  524

Query  321   NEFFGEEGPTGPNMKASWSGDE  256
                +GEEGPTGP  K +W GDE
Sbjct  525   IALYGEEGPTGPKEKDNWEGDE  546



>ref|XP_004142542.1| PREDICTED: uncharacterized protein LOC101216081 [Cucumis sativus]
Length=555

 Score =   396 bits (1018),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 208/439 (47%), Positives = 278/439 (63%), Gaps = 17/439 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTL+WSS    +    P ++WLP  P+GY A+G +VT   E+PS D IRCV +  T+ CE
Sbjct  127   YTLIWSSG---LNGVDPGFIWLPNAPEGYRAMGFLVTDRSEEPSRDDIRCVRADLTERCE  183

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFS-GNVGTFACLKNNNV  1195
               D +    T  +    F ++  RP  RG    GV VGTF    S       +CLKN N 
Sbjct  184   TGDLI---VTIKSKSQSFQVWETRPFERGMYKSGVSVGTFFCCTSLKEYLNISCLKNLNS  240

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
              F    MPNL+Q++AL   Y P ++ HP + + PSSV WFF NGALLY  G+ T    I 
Sbjct  241   TFE--GMPNLNQVQALIGHYGPTVFFHPDEEFFPSSVPWFFKNGALLYRNGN-TKGEPID  297

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
               GSNLP GG NDG YW++LP ++N +E +K G+++++ +Y+++KP  GGTFTDI +W+F
Sbjct  298   MRGSNLPCGGENDGAYWIDLPTNDNARENLKSGNIKTARLYVHVKPALGGTFTDIVMWVF  357

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
              PFNGP+  K+  +  I L  IGEH+ DWEH TLRI NF+G L +VYFSEHSGG WVDA 
Sbjct  358   CPFNGPAAIKVSFL-NIKLKKIGEHVSDWEHFTLRICNFSGELWQVYFSEHSGGKWVDAS  416

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQG-IGDIGIRNDTAKSAAVLDTGLRYSVVA  478
             +LEFI+G NK + YSS +GHA+Y  PG  LQG +  IG+RND A+S   +D+ L+Y ++A
Sbjct  417   DLEFIHG-NKPIVYSSKHGHASYPHPGSYLQGSVAGIGVRNDAARSKFFVDSSLKYEIIA  475

Query  477   ----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
                 G   I EP W++Y REWGP + Y S  +I+R+  LLP   +   E L+ L P E +
Sbjct  476   AEYLGDGYIAEPDWLQYMREWGPTVKYNSRSEIERLIDLLPPFVQFSLEDLLALFPTELY  535

Query  309   GEEGPTGPNMKASWSGDEK  253
             GEEGPTGP  K +W GDE+
Sbjct  536   GEEGPTGPKEKNNWFGDER  554



>emb|CDY14902.1| BnaA02g22440D [Brassica napus]
Length=569

 Score =   397 bits (1019),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 217/458 (47%), Positives = 289/458 (63%), Gaps = 34/458 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQ---SGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTD  1381
             YTLVWSS+ L   +    G  Y WLP PP+GY  VG +VTTS  KP  D++RCV +  TD
Sbjct  120   YTLVWSSNDLSEDEPKSEGCGYFWLPKPPRGYKPVGFLVTTSPTKPDLDQVRCVRADLTD  179

Query  1380  PCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT-------  1222
              CE    V     S++      ++  RP +RG   KGV  GTF       + T       
Sbjct  180   KCEAHR-VIITALSDSLRVPLFIWKTRPSDRGMWGKGVSAGTFFCRTPLMISTEEMEEEE  238

Query  1221  -------FACLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNG  1063
                     ACLKN + +    AMPNL QI AL + Y P ++ HP + Y PSSV+WFF NG
Sbjct  239   EDRLCNNIACLKNLDSSLH--AMPNLDQIHALVQHYGPRVFFHPDEVYLPSSVSWFFKNG  296

Query  1062  ALLYTKGDETNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKER---VKRGDLQSSEVY  892
             A+L +  D   PV    +GSNLP GG ND  +W++LP  NN+++R   +KRGDL+S+++Y
Sbjct  297   AVLCS-ADNQEPV--DENGSNLPHGGANDKQFWIDLP--NNDEQRNKFLKRGDLESAKLY  351

Query  891   LNIKPMFGGTFTDIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNG  712
             +++KP FGGTFTD+  WIF PFNGP+T KLG +  + L   G+H+ DWEH TLRISNF+G
Sbjct  352   VHVKPAFGGTFTDLVFWIFCPFNGPATLKLG-LMNLSLAKTGQHVCDWEHFTLRISNFSG  410

Query  711   VLNKVYFSEHSGGSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG--IGDIGIR  538
              L+ VYFS+HSGG WV+A +LEF++GSNK+V YSS +GHA++++ G+ LQG  +  IGIR
Sbjct  411   ELHAVYFSQHSGGEWVEAQDLEFVDGSNKAVVYSSKHGHASFARSGMYLQGSDLLGIGIR  470

Query  537   NDTAKSAAVLDTGLRYSVVAGLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLP  367
             NDTA+S   +D+  +Y VVA       +VEPPW+ Y REWGPKI Y S  +I+R+   LP
Sbjct  471   NDTARSDLFVDSCSKYEVVAAEYLGGAVVEPPWLGYMREWGPKIVYGSRTEIERLNERLP  530

Query  366   VEWRGVFETLIHLLPNEFFGEEGPTGPNMKASWSGDEK  253
                R   + ++  LP E  GEEGPTGP  K +W GDE+
Sbjct  531   WRLRCWVDAVLRKLPVELSGEEGPTGPKEKNNWFGDER  568



>ref|XP_006355887.1| PREDICTED: uncharacterized protein LOC102585636 [Solanum tuberosum]
Length=570

 Score =   397 bits (1019),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 208/443 (47%), Positives = 284/443 (64%), Gaps = 18/443 (4%)
 Frame = -2

Query  1551  YTLVWSS-DSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             YTLVWSS D       G  Y WLP PP+GY A+G +VTT+  KP    ++CV    TD C
Sbjct  135   YTLVWSSNDGTEENFDGSGYFWLPQPPEGYKALGFIVTTNPVKPELGEVKCVRGDLTDEC  194

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF---SGNVGTFACLKN  1204
             E    +    TS+       ++++RP +RG   KG+ VGTF  S    +G     ACLKN
Sbjct  195   ETYRLI--LKTSSVLSEVLAIWSIRPRHRGMHGKGISVGTFFCSSYWSTGQELNIACLKN  252

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              + +    AMPNL QI A+ R Y P L+ HP +TY PSSV WF  NGA+LYT+GD     
Sbjct  253   FDTSLQ--AMPNLDQIHAIIRHYGPTLFFHPSETYLPSSVQWFLDNGAMLYTRGDSVAK-  309

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I P+GSNLP GGTNDG  W++LP D   ++ V  G+L+S+++Y+++KP  GGTFTD+A+
Sbjct  310   PIEPEGSNLPGGGTNDGQCWIDLPSDV-RRDIVIFGNLESAKLYVHVKPALGGTFTDLAM  368

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+T K+G +  +PL  +G+H+GDWEH TLR+SN  G L  +YFS+HSGG WV
Sbjct  369   WIFCPFNGPATLKVGVV-NVPLSKVGQHVGDWEHFTLRVSNCTGELWSIYFSQHSGGEWV  427

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             DA +LEFI G NK++ YSS  GHA++  PG  +QG     IGIRND A+S   +D+  +Y
Sbjct  428   DAYDLEFIAG-NKAIVYSSKGGHASFPHPGTYIQGSSKLGIGIRNDVARSNLYVDSSTQY  486

Query  489   SVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              ++A    G + + EP W++Y REWGP I Y S ++++++ + LP+  R   +++   LP
Sbjct  487   EIIAAQYLGHEAVSEPCWLQYMREWGPTIIYDSRKELEKIVNRLPIMVRNSVQSIFDKLP  546

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
              E F EEGPTGP  K +W GDE+
Sbjct  547   MELFKEEGPTGPKEKNNWFGDER  569



>ref|XP_010262454.1| PREDICTED: uncharacterized protein LOC104600975 [Nelumbo nucifera]
Length=569

 Score =   396 bits (1018),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 209/443 (47%), Positives = 285/443 (64%), Gaps = 18/443 (4%)
 Frame = -2

Query  1551  YTLVWSSDSL-PITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             Y LVWS+D        G  Y WLP PP+GY A+GHVVT +  KPS + +RCV +  T+ C
Sbjct  134   YILVWSTDEWSEDNHDGCGYFWLPQPPEGYKAMGHVVTNTPNKPSLEEVRCVRADLTETC  193

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF---SGNVGTFACLKN  1204
             E    ++   +S +    F ++  RP +RG   KGV VGTF  S    S +  + ACLKN
Sbjct  194   EAYSLIFDTDSSIHK-FPFRVWNTRPCHRGMLGKGVSVGTFFCSSYLSSEDELSIACLKN  252

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              +      AMPNL Q+ AL + Y P ++ HP + Y PSSV WFF NGALLY KG      
Sbjct  253   GDPTLH--AMPNLDQVHALIKNYGPTVFFHPDEIYLPSSVPWFFKNGALLYQKGKSAGEA  310

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I   GSNLP GG+NDG +W++LP  N+++  +K G+++S+E+Y+++KP  GGTFTDI +
Sbjct  311   -IDSRGSNLPSGGSNDGEFWIDLP--NDDQNNIKYGNIESAELYVHVKPALGGTFTDIVM  367

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+T K+G +    L  +G+H+GDWEH TLR+SNF G L  +YFS+HSGG WV
Sbjct  368   WIFCPFNGPATIKVGAV-NFALNRVGQHVGDWEHFTLRVSNFTGELWSMYFSQHSGGEWV  426

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             DA NLEFI G NK++ YSS +GHA+++ PG  +QG     IG+RND A+S   +D+ ++Y
Sbjct  427   DACNLEFIKG-NKAIVYSSKSGHASFAHPGNYIQGSTKLGIGVRNDAAQSNFFVDSSIKY  485

Query  489   SVVAGL---QGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              +VA      GIV EP W+++ REWGP I Y S  +++++ SLLP   R   E++    P
Sbjct  486   QIVAAEYLGDGIVTEPCWLQFMREWGPTIVYNSRSELEKIISLLPFLIRFSVESIFDKFP  545

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
              E +GEEGPTGP  K +W GDE+
Sbjct  546   VELYGEEGPTGPKEKNNWVGDER  568



>ref|XP_009379740.1| PREDICTED: uncharacterized protein LOC103968124 [Pyrus x bretschneideri]
Length=568

 Score =   396 bits (1018),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 209/442 (47%), Positives = 281/442 (64%), Gaps = 20/442 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVW++D   ++ +G  Y+WLP PP GY A+G VVT   E+PS + +RCV    T+ CE
Sbjct  138   YSLVWNAD---LSNNGCGYIWLPNPPVGYKAMGFVVTDKPEEPSPEEVRCVREDLTETCE  194

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF---SGNVGTFACLKNN  1201
               D +      ++  + F ++  RP  RG    GV VGTF  S    S      ACLKN 
Sbjct  195   THDRILAM---DSKLDQFQVWNTRPCKRGMFCSGVSVGTFFCSTYLDSDEELEVACLKNF  251

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             +++    AMPNL+QI +L   Y P ++ HP + Y PSSV WFF NGALLY + D  N   
Sbjct  252   DLSLH--AMPNLNQIHSLIEHYGPTVFFHPNEVYLPSSVQWFFKNGALLY-REDTGNGEP  308

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I   GSNLP GG ND  +W++LP D+  K  +K G++ S+E+Y+++KP  GGTFTDIA+W
Sbjct  309   IDYRGSNLPAGGENDSDFWIDLPSDDEAKNLLKAGNIDSAELYVHVKPALGGTFTDIAMW  368

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             +F PFNGPST K+G +  I L  IGEH+GDWEH TLR++NF G L +VYFSEHSGG WVD
Sbjct  369   VFCPFNGPSTIKIGLV-NIALNKIGEHVGDWEHFTLRVNNFTGELWQVYFSEHSGGRWVD  427

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIG--DIGIRNDTAKSAAVLDTGLRYS  487
             A +LEFI GS K + YSS +GH++Y+ PG  LQG    DIG+RND A+S   +D+  +Y 
Sbjct  428   AFDLEFIEGS-KPIVYSSKHGHSSYAHPGTYLQGSSKFDIGVRNDAARSKFFIDSSTKYQ  486

Query  486   VVAGL---QGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
             +VA      GI+ EP W++Y R+WGP + Y    ++ ++   LP   R   E LI L P 
Sbjct  487   IVAAEYLGNGIISEPCWLQYMRDWGPTVVYDGRSELDKLIDRLPFFVRFSVENLIELFPT  546

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             + +GEEGPTGP  K +W GDE+
Sbjct  547   QIYGEEGPTGPKEKDNWVGDER  568



>ref|XP_004505614.1| PREDICTED: uncharacterized protein LOC101493338 [Cicer arietinum]
Length=567

 Score =   396 bits (1017),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 213/443 (48%), Positives = 284/443 (64%), Gaps = 17/443 (4%)
 Frame = -2

Query  1551  YTLVWSSDS-LPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             + L WSS++      SG  Y WLP PP+GY A+G+ VT   +KP  D + CV +  TD C
Sbjct  131   FKLFWSSNAGSQEISSGCGYFWLPEPPEGYKAIGYFVTNKPDKPELDEMCCVRADLTDEC  190

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT----FACLK  1207
             E    ++  G+   +   F +++LRP +RG   KGV VGTFL S   + G      ACLK
Sbjct  191   EPYRIIFSAGSRILE-FSFQVWSLRPCDRGMLGKGVSVGTFLCSSGWSNGEEHHPIACLK  249

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N N    S  MPNL QI AL   Y P ++ HP + Y PSSV+WFF NGALLY KG  T  
Sbjct  250   NLNPLLPS--MPNLQQIHALIEHYGPTVFFHPNEIYLPSSVDWFFDNGALLYRKGVSTGE  307

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
              RI   GSNLP GG+NDG +W++LP D+  ++ VKRGDL+S+ +Y+++KP  GGTFTDI 
Sbjct  308   -RIDATGSNLPCGGSNDGQFWIDLPSDD-RRDFVKRGDLKSARLYVHVKPAVGGTFTDIV  365

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
              W+F PFNGP+T K+G I+ IPL  IGEH+GDWEH TLRI NF G L  +YFS+HSGG W
Sbjct  366   FWVFCPFNGPATLKIG-IKNIPLSKIGEHVGDWEHFTLRICNFAGELYSIYFSQHSGGEW  424

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLR  493
             VDA +L++I+G NK++ YSS +GHA+Y  PG  +QG     +GIRND  +S   LD+ + 
Sbjct  425   VDAHDLDYIDG-NKAIVYSSKSGHASYPHPGTYIQGSSKLGLGIRNDAVRSNLYLDSSVH  483

Query  492   YSVVAG--LQGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
             Y +VA   L+ +V EP W+++ REWGPKI Y  + ++ ++ + LP   R     L +  P
Sbjct  484   YELVAAEYLENVVAEPNWLQFMREWGPKIVYDLKTELDKIINALPRMLRYSMRNLFNKFP  543

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
              E +GEEGPTGP  K +W  DE+
Sbjct  544   VELYGEEGPTGPKEKNNWIQDER  566



>ref|XP_009124997.1| PREDICTED: uncharacterized protein LOC103850048 [Brassica rapa]
Length=552

 Score =   395 bits (1015),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 206/442 (47%), Positives = 280/442 (63%), Gaps = 31/442 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV S D       G  Y WLP PP GY A+G +VT   ++P  + +RCV    T+ CE
Sbjct  130   YTLVSSVD-------GGGYFWLPNPPAGYKAMGVIVTDKPKEPETEEVRCVREDLTESCE  182

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLG-----SFSGNVGTFACLK  1207
               + +  + +     N F+++T++P  RG +A+GV VGTF       S    V   ACLK
Sbjct  183   TSEMILSKKS-----NPFSVWTVQPCERGMRAQGVSVGTFFCCTYELSSHETVRDIACLK  237

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N +      AMPNL+Q+ A+ + Y P +Y HP +TY PSSV WFF NGALLY +G+    
Sbjct  238   NLDPTLH--AMPNLNQVHAVIQHYGPTVYFHPEETYMPSSVQWFFKNGALLYPQGEP---  292

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
               I   GSNLP GG+ND  YW++LP +   K  +KRG+L+S+E+Y+++KP  GGTFTDI 
Sbjct  293   --ISSTGSNLPSGGSNDLEYWIDLPEEEEAKSNLKRGNLESAELYVHVKPALGGTFTDIV  350

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +WIF PFNGP+T K+G +  +P+  IGEH+GDWEH T R+ NF+G L +++FS+HSGG W
Sbjct  351   MWIFCPFNGPATLKIG-LFTLPMTRIGEHVGDWEHFTFRVCNFSGELWQMFFSQHSGGGW  409

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLR  493
             VDA  +EF+ G NK   YSS +GHA++  PG+ LQG+    IG+RND AKS  V+++  R
Sbjct  410   VDASEIEFVKG-NKPAVYSSKHGHASFPHPGMYLQGLSKFGIGVRNDVAKSEYVVESSER  468

Query  492   YSVVAGLQ---GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
             Y VVA      G+ EP W++Y REWGP I Y S  +I ++  LLP+  R   E ++ L P
Sbjct  469   YVVVAAEYLGGGVDEPCWLQYMREWGPVIEYDSGSEISKIMDLLPLVVRFSVENIVDLFP  528

Query  321   NEFFGEEGPTGPNMKASWSGDE  256
                +GEEGPTGP  K +W GDE
Sbjct  529   VALYGEEGPTGPKEKDNWEGDE  550



>ref|XP_008388738.1| PREDICTED: uncharacterized protein LOC103451082 [Malus domestica]
Length=570

 Score =   395 bits (1016),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 211/442 (48%), Positives = 280/442 (63%), Gaps = 20/442 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVW++DS   +++G  Y+WLP PP GY A+G VVT   E+PS + +RCV    T+ CE
Sbjct  140   YSLVWNADS---SKNGCGYIWLPNPPVGYKAMGFVVTDKPEEPSPEEVRCVREDLTETCE  196

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF---SGNVGTFACLKNN  1201
               D +      ++  + F ++  RP  RG    GV VGTF  S    S      ACLKN 
Sbjct  197   THDRMLAM---DSKLDQFQVWNTRPCKRGMFYSGVSVGTFFCSTYLDSDEELEVACLKNF  253

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             + +    AMPNL+QI +L   Y P ++ HP + Y PSSV WFF NGALLY + D  N   
Sbjct  254   DSSLH--AMPNLNQIHSLIEHYGPTVFFHPNEVYLPSSVQWFFKNGALLY-REDTGNGKP  310

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I   GSNLP GG ND  +W++LP D+  K  +K G++ S+E+Y+++KP  GGTFTDIA+W
Sbjct  311   IDYRGSNLPAGGENDSDFWIDLPSDDEAKNLLKAGNIDSAELYVHVKPALGGTFTDIAMW  370

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             +F PFNGPST K+G +  I L  IGEH+GDWEH TLR++NF G L +VYFSEHSGG WVD
Sbjct  371   VFCPFNGPSTIKIGLV-NIALNKIGEHVGDWEHFTLRVNNFTGELWQVYFSEHSGGRWVD  429

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIG--DIGIRNDTAKSAAVLDTGLRYS  487
             A +LEFI GS K + YSS +GH++Y+ PG  LQG    DIG+RND A+S   +D+  +Y 
Sbjct  430   AFDLEFIEGS-KPIVYSSKHGHSSYAHPGTYLQGSSKFDIGVRNDAARSKFFIDSSSKYQ  488

Query  486   VVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
             +VA    G   I EP W++Y R+WGP I Y    ++ ++   LP   R   E LI L P 
Sbjct  489   IVAAEYLGNGVISEPSWLQYMRDWGPTIVYDGRSELDKLIDRLPFFVRFSVENLIELFPT  548

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             + +GEEGPTGP  K +W GDE+
Sbjct  549   QIYGEEGPTGPKEKDNWVGDER  570



>gb|KDO60351.1| hypothetical protein CISIN_1g045952mg [Citrus sinensis]
Length=569

 Score =   395 bits (1016),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 210/443 (47%), Positives = 281/443 (63%), Gaps = 17/443 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPI-TQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             YTLVW SD        G A+ WLP PP GY ++G +VT +  KP  D +RCV    TD C
Sbjct  133   YTLVWCSDEGGQGNYEGCAFFWLPQPPDGYKSMGFLVTKTPNKPELDEVRCVRDDLTDKC  192

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGS---FSGNVGTFACLKN  1204
             EV   ++    S    + F++++ RP NRG   +GV VGTF  S    SG     ACLKN
Sbjct  193   EVHHLIF-DAISKFSSSPFSVWSTRPCNRGMLGRGVSVGTFFCSSNWISGQELNIACLKN  251

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              +      AMPN  QI AL R Y P ++ HP + Y PSSV+WFF+NGALLY  GD     
Sbjct  252   LDPKLH--AMPNCDQIHALIRNYGPTVFFHPDEVYLPSSVSWFFTNGALLYKAGDLVGEA  309

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I P GSNLP GG NDG +W++LP D   ++ VK G+++S+++Y+++KP  GGTFTDI +
Sbjct  310   -IDPSGSNLPSGGRNDGEFWIDLPSDGG-RQIVKHGNMESAKLYVHVKPAVGGTFTDIVM  367

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP T K+G I  +    IG+H+GDWEH TLRI NF G L  +YFS+HSGG WV
Sbjct  368   WVFCPFNGPGTLKVG-IMNVAFSKIGQHVGDWEHFTLRICNFTGELWSIYFSQHSGGKWV  426

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG--IGDIGIRNDTAKSAAVLDTGLRY  490
              A +LE+I G NK++ YSS NGHA++  PG  LQG  I  IG+RND A+S   +D+ ++Y
Sbjct  427   AAYDLEYIEG-NKAIVYSSKNGHASFPHPGTYLQGSEILGIGVRNDAARSNLYVDSSIQY  485

Query  489   SVVAGL---QGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              +VA     +G+V EP W+++ R+WGP I Y S+ ++ ++  LLP+  R   E  +  LP
Sbjct  486   ELVAAEYLGEGVVAEPSWLQFMRKWGPTIVYDSKTELDKIIKLLPLMIRYSVENAVSKLP  545

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
              E +GEEGPTGP  K +W GDE+
Sbjct  546   LELYGEEGPTGPKEKNNWVGDER  568



>ref|XP_006437467.1| hypothetical protein CICLE_v10031092mg [Citrus clementina]
 gb|ESR50707.1| hypothetical protein CICLE_v10031092mg [Citrus clementina]
Length=570

 Score =   395 bits (1015),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 213/442 (48%), Positives = 283/442 (64%), Gaps = 18/442 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWS+D         +Y WLP PP GY A+G +VT + E+P  + +RCV    T+ CE
Sbjct  137   YTLVWSTDP---HNGDCSYFWLPNPPMGYKAMGILVTNTSEEPEVEEVRCVREDLTESCE  193

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSF--SGNVGTFACLKNN  1201
               D +     S+     F +Y+ RP  RG  A+GV VG+F+ G++  S      ACLKN 
Sbjct  194   TCDLILST-ESDMSKTPFQVYSTRPWIRGMFARGVSVGSFVCGTYLNSEEELDIACLKNL  252

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             N + +  AMPNL QI AL + Y P ++ HP + Y PSSV WFF NGALLY  G       
Sbjct  253   NSSLN--AMPNLDQIHALIKHYGPTVFFHPDEEYLPSSVPWFFKNGALLYQDGKPKGE-P  309

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I   GSNLP GGTNDG +W++LP D++ +  +K+G+L+S+E+Y+++KP  GGTFTDIA+W
Sbjct  310   IDSRGSNLPCGGTNDGAFWIDLPEDDDARNSLKKGNLESAELYVHVKPEQGGTFTDIAMW  369

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             IF PFNGP T K+G +  I +  IGEH+ DWEH TLR+SNF G L +VYFSEHSGG W D
Sbjct  370   IFCPFNGPVTLKVGLLS-IAMTKIGEHVSDWEHFTLRVSNFTGELWQVYFSEHSGGRWRD  428

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDI--GIRNDTAKSAAVLDTGLRYS  487
             A  LE+I G NK + YSS +GHA++   G  LQG   +  G+RNDTAKS   +D+  +Y 
Sbjct  429   AFELEYIKG-NKPIVYSSKHGHASFPHAGTYLQGSTKLGTGVRNDTAKSNFFVDSSTKYQ  487

Query  486   VVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
             ++A    G   + EP W+++ REWGP I Y S+ +I ++ +LLP   R   E LI LLP 
Sbjct  488   IIAAEYLGDGVVTEPCWLQFMREWGPTIVYDSKSEIDKILNLLPFFMRFSVENLIDLLPT  547

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E +GEEGPTGP  K +W GDE+
Sbjct  548   ELYGEEGPTGPKEKDNWVGDER  569



>ref|XP_006340465.1| PREDICTED: uncharacterized protein LOC102604240 [Solanum tuberosum]
Length=562

 Score =   395 bits (1015),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 211/443 (48%), Positives = 277/443 (63%), Gaps = 19/443 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTL+WSSDS     +G  Y+W+P  P GY ++G + +    +P  D +RCV +  T+ CE
Sbjct  128   YTLIWSSDS---QYNGGGYIWMPNAPVGYKSIGCLASVEPNEPDPDEVRCVRADLTENCE  184

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFS---GNVGTFACLKNN  1201
               + ++    S      F ++  RP  RG    GV  GTF GS S   G+    ACLKN 
Sbjct  185   ASEMMFSS-DSFFQRKQFQVWKTRPCKRGMLCAGVSAGTFFGSTSFSSGDELDIACLKNL  243

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             + +    AMPNL QI AL + Y P +YLHP + Y PSSV WFF NGALLY  G   N   
Sbjct  244   DSSLH--AMPNLEQIHALIKHYGPTMYLHPDEIYLPSSVPWFFMNGALLYKDG-RNNGTV  300

Query  1020  IGPDGSNLPQGGTNDGVYWVNLP-VDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
             I   GSNLP GG NDG YW++LP  D+  +  VK G+++S+E+Y+++KP  GGTFTDIA+
Sbjct  301   INSKGSNLPAGGLNDGQYWLDLPNKDDANRTSVKCGNIESAELYVHVKPSLGGTFTDIAM  360

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+  K+G +    L  +GEH+GDWEH TLRISNF+G L  VYFSEHSGG WV
Sbjct  361   WIFCPFNGPAIVKIGLLS-FTLNKVGEHVGDWEHYTLRISNFSGELWSVYFSEHSGGEWV  419

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDI--GIRNDTAKSAAVLDTGLRY  490
             DA  LEFI G NK + Y+S NGHA++  PG  LQG   +  G+RND A+S   +D+  +Y
Sbjct  420   DACKLEFIEG-NKPIVYASRNGHASFPHPGCYLQGSSKLGFGLRNDCARSKYYVDSSSKY  478

Query  489   SVVAGL---QGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              +VA     +G+V EPPW++Y REWGP I Y    +++++   LP   R   E+LI L P
Sbjct  479   QIVAAEYLGEGVVAEPPWLQYMREWGPTIIYNGRSEVEKIIKHLPFFMRFSVESLIELFP  538

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
              E +GE GPTGP  K +W GDE+
Sbjct  539   TELYGEAGPTGPKEKDNWLGDER  561



>ref|XP_006484620.1| PREDICTED: uncharacterized protein LOC102609992 [Citrus sinensis]
Length=570

 Score =   395 bits (1015),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 213/442 (48%), Positives = 282/442 (64%), Gaps = 18/442 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWS+D          Y WLP PP GY A+G +VT + E+P  + +RCV    T+ CE
Sbjct  137   YTLVWSTDP---HNGDCGYFWLPNPPMGYKAMGILVTNTSEEPEVEEVRCVREDLTESCE  193

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSF--SGNVGTFACLKNN  1201
               D +     S+     F +Y+ RP  RG  A+GV VG+F+ G++  S      ACLKN 
Sbjct  194   TCDLILST-ESDMSKTPFQVYSTRPWIRGMFARGVSVGSFVCGTYLNSEEELDIACLKNL  252

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             N + +  AMPNL QI AL + Y P ++ HP + Y PSSV WFF NGALLY  G       
Sbjct  253   NSSLN--AMPNLDQIHALIKHYGPTVFFHPDEEYLPSSVPWFFKNGALLYQDGKPKGE-P  309

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I   GSNLP GGTNDG +W++LP D++ +  +K+G+L+S+E+Y+++KP  GGTFTDIA+W
Sbjct  310   IDSRGSNLPCGGTNDGAFWIDLPEDDDARNSLKKGNLESAELYVHVKPEQGGTFTDIAMW  369

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             IF PFNGP T K+G +  I +  IGEH+ DWEH TLR+SNF G L +VYFSEHSGG W D
Sbjct  370   IFCPFNGPVTLKVGLLS-IAMTKIGEHVSDWEHFTLRVSNFTGELWQVYFSEHSGGRWRD  428

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDI--GIRNDTAKSAAVLDTGLRYS  487
             A  LE+I G NK + YSS +GHA++   G  LQG   +  G+RNDTAKS   +D+  +Y 
Sbjct  429   AFELEYIKG-NKPIVYSSKHGHASFPHAGTYLQGSTKLGTGVRNDTAKSNFFVDSSTKYQ  487

Query  486   VVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
             ++A    G   + EP W+++ REWGP I Y S+ +I ++ +LLP   R   E LI LLP 
Sbjct  488   IIAAEYLGDGVVTEPCWLQFMREWGPTIVYDSKSEIDKILNLLPFFMRFSVENLIDLLPT  547

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E +GEEGPTGP  K +W GDE+
Sbjct  548   ELYGEEGPTGPKEKDNWVGDER  569



>gb|KDO53065.1| hypothetical protein CISIN_1g008314mg [Citrus sinensis]
Length=570

 Score =   395 bits (1015),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 213/442 (48%), Positives = 282/442 (64%), Gaps = 18/442 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWS+D          Y WLP PP GY A+G +VT + E+P  + +RCV    T+ CE
Sbjct  137   YTLVWSTDP---HNGDCGYFWLPNPPMGYKAMGILVTNTSEEPEVEEVRCVREDLTESCE  193

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSF--SGNVGTFACLKNN  1201
               D +     S+     F +Y+ RP  RG  A+GV VG+F+ G++  S      ACLKN 
Sbjct  194   TCDLILST-ESDMSKTPFQVYSTRPWIRGMFARGVSVGSFVCGTYLNSEEELDIACLKNL  252

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
             N + +  AMPNL QI AL + Y P ++ HP + Y PSSV WFF NGALLY  G       
Sbjct  253   NSSLN--AMPNLDQIHALIKHYGPTVFFHPDEEYLPSSVPWFFKNGALLYQDGKPKGE-P  309

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I   GSNLP GGTNDG +W++LP D++ +  +K+G+L+S+E+Y+++KP  GGTFTDIA+W
Sbjct  310   IDSRGSNLPCGGTNDGAFWIDLPEDDDARNSLKKGNLESAELYVHVKPEQGGTFTDIAMW  369

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             IF PFNGP T K+G +  I +  IGEH+ DWEH TLR+SNF G L +VYFSEHSGG W D
Sbjct  370   IFCPFNGPVTLKVGLLS-IAMTKIGEHVSDWEHFTLRVSNFTGELWQVYFSEHSGGRWRD  428

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDI--GIRNDTAKSAAVLDTGLRYS  487
             A  LE+I G NK + YSS +GHA++   G  LQG   +  G+RNDTAKS   +D+  +Y 
Sbjct  429   AFELEYIKG-NKPIVYSSKHGHASFPHAGTYLQGSTKLGTGVRNDTAKSNFFVDSSTKYQ  487

Query  486   VVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
             ++A    G   + EP W+++ REWGP I Y S+ +I ++ +LLP   R   E LI LLP 
Sbjct  488   IIAAEYLGDGVVTEPCWLQFMREWGPTIVYDSKSEIDKILNLLPFFMRFSVENLIDLLPT  547

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E +GEEGPTGP  K +W GDE+
Sbjct  548   ELYGEEGPTGPKEKDNWVGDER  569



>ref|XP_010936079.1| PREDICTED: vacuolar protein sorting-associated protein 62-like 
[Elaeis guineensis]
Length=562

 Score =   394 bits (1013),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 213/442 (48%), Positives = 279/442 (63%), Gaps = 16/442 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQS-GPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             Y LVWSS+        G  Y WLP PP+ Y AVG VVT   +KPS D +RCV +  TD  
Sbjct  127   YMLVWSSNIWNDDNCYGCGYFWLPSPPEYYKAVGFVVTKEPQKPSLDEVRCVRADLTDEG  186

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG---TFACLKN  1204
             E    +     S N    F + + RP NRG   KG+ VGTF  S + +        CLKN
Sbjct  187   ETHGLILDT-ESMNSKVPFRVCSTRPSNRGMWGKGISVGTFCCSTARSSDYRPNIFCLKN  245

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              N  FS  AMPNL QI AL + Y P ++ HP + Y PSSV+WFF NGA +Y +G+     
Sbjct  246   VN--FSLHAMPNLEQIHALIKHYGPTVFFHPKEIYLPSSVSWFFKNGATIYKRGESVGEA  303

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I  +GSNLP GG NDG YW++LP D+++   VK G+L+S+++Y ++K   GGTFTDIA+
Sbjct  304   -IDANGSNLPSGGENDGAYWIDLP-DDDKNSHVKHGNLESAQLYAHVKAALGGTFTDIAM  361

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP+T K+G +  I L  IG+H+GDWEH TLRISNF G L  +Y+S+HSGG WV
Sbjct  362   WVFCPFNGPATIKIGPV-NISLDKIGQHVGDWEHFTLRISNFTGELWTIYYSQHSGGEWV  420

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             D  +LEFI G NK+V YSS +GHA++  PG  +QG     IG+RND A+S  VLD+ + Y
Sbjct  421   DTTSLEFIQG-NKAVVYSSKSGHASFPHPGNYIQGSQTLGIGVRNDAARSKLVLDSSVNY  479

Query  489   SVVAG--LQGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
              ++A   L  IV EPPW++Y REWGP I Y S  +++++   LP+  R   E +   LP 
Sbjct  480   QIIAAEYLGSIVTEPPWLQYMREWGPTIIYNSRSELEKILGYLPLNLRFSVENIFDKLPT  539

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             E +GEEGPTGP  K +W GDE+
Sbjct  540   ELYGEEGPTGPKEKNNWEGDER  561



>ref|XP_010264864.1| PREDICTED: uncharacterized protein LOC104602762 [Nelumbo nucifera]
Length=567

 Score =   394 bits (1013),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 215/443 (49%), Positives = 278/443 (63%), Gaps = 18/443 (4%)
 Frame = -2

Query  1551  YTLVWSSDSL-PITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             Y LVWS+D        G  + W P PP GY A+GHV+T+  EKP+ + +RCV    T+ C
Sbjct  132   YKLVWSTDECSEENHCGRGFFWFPEPPVGYKAMGHVITSKPEKPALEEVRCVREDLTETC  191

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF---SGNVGTFACLKN  1204
             E    ++    SN       ++  R  NRG   +GV VGTF  S    S N    ACL+N
Sbjct  192   ENSCLIF-NADSNICKFPLQVWNTRACNRGMLGRGVSVGTFFCSSCSGSDNELGIACLRN  250

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              +      AMPN+ QI AL   Y P ++ HP ++Y PSSV WFF NGALLY KG      
Sbjct  251   CDPNLH--AMPNMEQIHALIEHYGPTVFFHPDESYLPSSVPWFFKNGALLYRKGGPFGE-  307

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I   GSNLP GG+NDG YW++LP  NNE+  +K G+++S+E+Y+++KP  GGTFTDI +
Sbjct  308   PIDSRGSNLPSGGSNDGEYWIDLP--NNEQNSIKYGNIESAELYVHVKPALGGTFTDIVM  365

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+T K G +  I LG IG+H+GDWEH TLRISNF G L  +YFS+HSGG WV
Sbjct  366   WIFCPFNGPATMKFGAV-NIALGRIGQHVGDWEHFTLRISNFTGDLWSMYFSQHSGGEWV  424

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             DA NLEFI G NK++ YSS +GHA++  PG  LQG     IG+RND A+S   +D+  +Y
Sbjct  425   DAWNLEFIEG-NKAIVYSSKSGHASFPHPGTYLQGSTKLGIGVRNDAARSNFCVDSSKKY  483

Query  489   SVVAGL---QGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              +VA     +GIV EP W++Y REWGP I Y S  ++++V S LPV  R   E +    P
Sbjct  484   QIVAAEYLGEGIVTEPCWLQYMREWGPTIVYNSRTELEKVISYLPVLIRFSVENIFDKFP  543

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
              E +GEEGPTGP  K +W GDE+
Sbjct  544   VELYGEEGPTGPKEKNNWVGDER  566



>ref|XP_010485809.1| PREDICTED: uncharacterized protein LOC104764063 [Camelina sativa]
Length=567

 Score =   394 bits (1013),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 204/446 (46%), Positives = 281/446 (63%), Gaps = 22/446 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVWS+DS    ++G  Y WLP+PP GY A+G  VT    +P  + +RCV    T+ CE
Sbjct  128   YSLVWSADS---EKNGGGYFWLPIPPVGYRAMGFFVTHQPGEPETEEVRCVREDLTESCE  184

Query  1371  VEDWVWGRGTS---NNDPNGFNLYTLRPINRGTQAKGVKVGTFLG-----SFSGNVGTFA  1216
               + +   G+S   N   + F++++ +P  RG  ++GV VG+F       S    V    
Sbjct  185   TSEMILEVGSSKKSNRSGSPFSVWSTQPCERGMLSQGVAVGSFFCCTYDISSDRKVPDIG  244

Query  1215  CLKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDE  1036
             CLKN +      AMPNL+Q+ A+   Y P +Y HP + Y PSSV WFF NGALLY  G +
Sbjct  245   CLKNLDSTLH--AMPNLNQVHAVIEHYGPTVYFHPEEAYMPSSVQWFFKNGALLYRSG-K  301

Query  1035  TNPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFT  856
             +    I   GSNLP GG ND  +W++LP D   K  +K+G+L+SSE+Y+++KP  GGTFT
Sbjct  302   SQGEPINSTGSNLPAGGCNDMEFWIDLPEDEEAKSHLKKGNLESSELYVHVKPALGGTFT  361

Query  855   DIAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSG  676
             DI +WIF PFNGP+T K+G I  +P+  IGEH+GDWEH T R+ NF+G L +++FS+HSG
Sbjct  362   DIVMWIFCPFNGPATLKIG-IFTLPMTRIGEHVGDWEHFTFRVCNFSGELWQMFFSQHSG  420

Query  675   GSWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDT  502
             G WVDA  +EF+   NK   YSS +GHA++  PG+ LQG     IG+RND AKS  +L++
Sbjct  421   GGWVDASEIEFVK-DNKPAVYSSKHGHASFPHPGMYLQGSSKFGIGVRNDVAKSKYMLES  479

Query  501   GLRYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLI  334
               RY +VA    G   ++EP W++Y REWGP I Y S  +I ++ +LLP+  R  FE ++
Sbjct  480   SQRYVIVAAEYLGNGVVMEPRWLQYMREWGPSIAYDSGSEINKIMNLLPLVVRFSFENIV  539

Query  333   HLLPNEFFGEEGPTGPNMKASWSGDE  256
              L P   +GEEGPTGP  K +W GDE
Sbjct  540   DLFPIALYGEEGPTGPKEKDNWEGDE  565



>ref|XP_003556481.1| PREDICTED: uncharacterized protein LOC100814522 [Glycine max]
 gb|KHN14717.1| hypothetical protein glysoja_038126 [Glycine soja]
Length=559

 Score =   394 bits (1012),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 208/442 (47%), Positives = 281/442 (64%), Gaps = 20/442 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+L+WS DS         Y WLP PP GY A+G VVT+S  +P  + +RCV    T+ CE
Sbjct  126   YSLIWSLDS----HDECVYFWLPNPPTGYKAMGIVVTSSPNEPEVEEVRCVRDDLTESCE  181

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSFSGN---VGTFACLKN  1204
               D +     S    + F ++  +P +RG  A+GV VG F  GS S +   V   ACLKN
Sbjct  182   TSDLLLTV-KSKYSKDSFQVWNTQPCDRGMLARGVAVGAFFCGSTSVDPEQVVDIACLKN  240

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              + +    AMPN +QI AL + Y P +Y HP + Y PSSV WFF NGA+L+  G++   +
Sbjct  241   LDSSLH--AMPNQNQIHALIQHYGPTVYFHPDEKYLPSSVQWFFKNGAVLHAAGNKKG-I  297

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I   GSNLP GGTNDG +W++LP D + +  +K+G+++S+E+Y+++KP  GG +TDI +
Sbjct  298   AIDYQGSNLPSGGTNDGAFWIDLPTDADARNNLKKGNIESAELYVHVKPALGGAYTDIVM  357

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP+T K+  +  I +  IGEHIGDWEH TLRISNF G L  VYFS+HSGG WV
Sbjct  358   WVFCPFNGPATLKVA-LMNIEMNKIGEHIGDWEHFTLRISNFTGELWSVYFSQHSGGGWV  416

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             +A +LEFI G NK + YSS +GHA++  PG  LQG     IG+RND A S  ++D+ ++Y
Sbjct  417   NAFDLEFIKG-NKPIVYSSKDGHASFPHPGTYLQGSSKLGIGVRNDAAPSKFIVDSSIKY  475

Query  489   SVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              +VA    G   I EP W++Y REWGP I Y S  +I+++ +LLP+  R   E L  L P
Sbjct  476   QIVAAEYLGDGVIAEPCWLQYMREWGPTIVYDSRSEIEKIINLLPLFVRFSVENLFELFP  535

Query  321   NEFFGEEGPTGPNMKASWSGDE  256
              E +GEEGPTGP  K +W GDE
Sbjct  536   TELYGEEGPTGPKEKDNWLGDE  557



>ref|XP_008218355.1| PREDICTED: vacuolar protein sorting-associated protein 62 isoform 
X2 [Prunus mume]
Length=525

 Score =   393 bits (1009),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 206/442 (47%), Positives = 279/442 (63%), Gaps = 18/442 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVW++DS    ++G  Y+WLP PP GY A+G VVT + E+P  + +RCV    T+ CE
Sbjct  92    YSLVWNADS---NKNGCGYIWLPNPPVGYKAMGFVVTDNSEEPRPEEVRCVREDLTEACE  148

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF---SGNVGTFACLKNN  1201
               D V    +  ++ + F ++  RP  RG    GV VGTF  S    S +    ACLKN 
Sbjct  149   TRDRVLAMDSKLSE-DKFQVWNTRPCKRGMLCSGVSVGTFFCSTYLDSDDELEVACLKN-  206

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
              +  S  AMPNL+QI AL   Y P ++ HP + Y PSSV WFF NGALLY + D  N   
Sbjct  207   -IDSSLHAMPNLNQIHALIEHYGPTVFFHPDEVYLPSSVQWFFKNGALLYHE-DSGNGEP  264

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I   GSNLP GG ND  +W++LP D++ +  +K G+++S+++Y+++KP  GGTF+DIA+W
Sbjct  265   IDYRGSNLPSGGENDSDFWIDLPNDDDARNHLKGGNIESAKLYVHVKPALGGTFSDIAMW  324

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             +F PFNGP+T K+G +  I +  IG+H+GDWEH TLR+SNF G L + YFSEHSGG WVD
Sbjct  325   VFCPFNGPATIKIGLVS-IAMNKIGQHVGDWEHFTLRVSNFTGELWQAYFSEHSGGRWVD  383

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIG--DIGIRNDTAKSAAVLDTGLRYS  487
             A +LEFI G NK + YSS  GH++Y  PG  LQG    DIG+RND A+S   +D+  +Y 
Sbjct  384   ASDLEFIEG-NKPIVYSSKYGHSSYPHPGTYLQGSSKFDIGVRNDAARSKFYIDSSTKYQ  442

Query  486   VVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
             +VA    G   I EP W++Y  +WGP I Y S  ++ ++   LP   R   E L  L P 
Sbjct  443   IVAAEYLGDGVISEPCWLQYMSDWGPTIVYDSRSELDKLIDRLPFFVRFSVENLFDLFPT  502

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             + +GEEGPTGP  K +W GDE+
Sbjct  503   QLYGEEGPTGPKEKDNWLGDER  524



>emb|CDX89845.1| BnaA10g02370D [Brassica napus]
Length=555

 Score =   394 bits (1011),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 216/445 (49%), Positives = 288/445 (65%), Gaps = 28/445 (6%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             +T VWSS       S   Y WLP PP+GY ++G VVT S  KP  + +RCV +  TD CE
Sbjct  126   FTPVWSS-----KDSSNGYFWLPQPPEGYKSMGFVVTKSSAKPELNEVRCVRADLTDKCE  180

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTF-----LGSFSGNVGTFACLK  1207
                 +     S +      ++  RP +RG   KGV  GTF     L S   ++ + +CLK
Sbjct  181   THKLI-VTAVSESLTVPLFIWRTRPSDRGMWGKGVSTGTFFCRTRLVSREQHL-SISCLK  238

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N +      AMPNL QI+AL + Y P L  HP +TY PSSV+WFFSNGA+L  KG   NP
Sbjct  239   NLDSGLH--AMPNLDQIQALIQHYGPTLIFHPDETYLPSSVSWFFSNGAVLCQKG---NP  293

Query  1026  V--RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
             +   I  +GSNLPQGG+ND  YW++LP D++    VKRG+++SS++Y++IKP  GGTFTD
Sbjct  294   ICELIDENGSNLPQGGSNDKQYWIDLPFDDD---HVKRGNIESSKLYVHIKPALGGTFTD  350

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             +  WIF PFNGP+T KLG I+ + L  IG+H+ DWEH TLRISNF+G L  +YFS+HSGG
Sbjct  351   LVFWIFCPFNGPATLKLGLID-VSLVSIGQHVCDWEHFTLRISNFSGELYSIYFSQHSGG  409

Query  672   SWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTG  499
              W+++ +LEF+ G+NK+V YSS +GHA++ + G+ LQG     IGIRNDTA+S  ++D+ 
Sbjct  410   EWIESHDLEFVTGTNKAVVYSSKHGHASFPRAGVYLQGSTTLGIGIRNDTARSDLLVDSS  469

Query  498   LRYSVVAG--LQGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             LRY +VA   L  +V EPPW++Y REWGPKI Y S E+I+R+ S  P         ++  
Sbjct  470   LRYEIVAAEYLGAVVKEPPWLQYMREWGPKIVYDSREEIERLASRFPRTVGVTVGNVLRK  529

Query  327   LPNEFFGEEGPTGPNMKASWSGDEK  253
             LP E  GEEGPTGP  K +W GDE+
Sbjct  530   LPVELSGEEGPTGPKEKNNWYGDER  554



>emb|CDY21128.1| BnaA01g33590D [Brassica napus]
Length=553

 Score =   393 bits (1010),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 206/443 (47%), Positives = 279/443 (63%), Gaps = 32/443 (7%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV S D       G  Y WLP PP GY A+G +VT   ++P  + +RCV    T+ CE
Sbjct  130   YTLVSSVD-------GGGYFWLPNPPAGYKAMGVIVTDKPKEPETEEVRCVREDLTESCE  182

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLG-----SFSGNVGTFACLK  1207
               + +  + +     N F+++T++P  RG +A+GV VGTF       S    V   ACLK
Sbjct  183   TSEMILSKKS-----NPFSVWTVQPCERGMRAQGVSVGTFFCCTYELSSHETVRDIACLK  237

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N +      AMPNL+Q+ A+ + Y P +Y HP +TY PSSV WFF NGALLY +G+    
Sbjct  238   NLDPTLH--AMPNLNQVHAVIQHYGPTVYFHPEETYMPSSVQWFFKNGALLYPQGEP---  292

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
               I   GSNLP GG+ND  YW++LP +   K  +KRG+L+S+E+Y+++KP  GGTFTDI 
Sbjct  293   --ISSTGSNLPSGGSNDLEYWIDLPEEEEAKSNLKRGNLESAELYVHVKPALGGTFTDIV  350

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +WIF PFNGP+T K+G +  +P+  IGEH+GDWEH T R+ NF+G L +++FS+HSGG W
Sbjct  351   MWIFCPFNGPATLKIG-LFTLPMTRIGEHVGDWEHFTFRVCNFSGELWQMFFSQHSGGGW  409

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLR  493
             VDA  +EF+ G NK   YSS +GHA++  PG+ LQG     IG+RND AKS  V+++  R
Sbjct  410   VDASEIEFVKG-NKPAVYSSKHGHASFPHPGMYLQGSSKFGIGVRNDVAKSEYVVESSER  468

Query  492   YSVVAGLQ----GIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
             Y VVA       G+ EP W++Y REWGP I Y S  +I ++  LLP+  R   E ++ L 
Sbjct  469   YVVVAAEYLREGGVDEPCWLQYMREWGPVIEYDSGSEISKIMDLLPLVVRFSVENIVDLF  528

Query  324   PNEFFGEEGPTGPNMKASWSGDE  256
             P   +GEEGPTGP  K +W GDE
Sbjct  529   PVALYGEEGPTGPKEKDNWEGDE  551



>ref|XP_009757101.1| PREDICTED: uncharacterized protein LOC104210010 [Nicotiana sylvestris]
Length=568

 Score =   394 bits (1011),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 214/444 (48%), Positives = 287/444 (65%), Gaps = 21/444 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLV+S+ SL    +   Y+WLP  P GY  +G V T    +P+ + +RCV +  T+ CE
Sbjct  134   YTLVYSAKSL---YNEVGYIWLPNAPVGYKPMGFVATAEPNEPNLEEVRCVRADLTESCE  190

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFS---GNVGTFACLKNN  1201
               + V+    S    N F ++  RP  RG   +GV VGTF  S S   G+    ACLKN 
Sbjct  191   ACEVVFS-SNSLFGKNQFQVWKTRPCARGMLCEGVSVGTFFCSTSFTKGDELNIACLKN-  248

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
              +  S  AMPNL Q+ AL + Y P +Y HP + Y PSSV WFF NGALL+  G + N + 
Sbjct  249   -LDSSLKAMPNLEQVHALIKHYGPTVYFHPDEIYLPSSVQWFFKNGALLFKDGKD-NGIA  306

Query  1020  IGPDGSNLPQGGTNDGVYWVNLP-VDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
             I   GSNLP GG NDG YW++LP  D   +  VK G+++++E+Y+++KP  GGTFTDIA+
Sbjct  307   IDSKGSNLPAGGQNDGKYWLDLPNKDVENRHTVKCGNIETAELYVHVKPAEGGTFTDIAM  366

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP+T K+  +  + +  +GEH+GDWEH TLRISNF+GVL  VYFSEHSGG WV
Sbjct  367   WVFCPFNGPATLKISLL-NLAMNRVGEHVGDWEHYTLRISNFSGVLWCVYFSEHSGGEWV  425

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG---IGDIGIRNDTAKSAAVLDTGLR  493
             DA NLEFI+G NKS+ Y+S NGHA++  PG  LQG   IG IG+RND A+S   +D+  +
Sbjct  426   DARNLEFIDG-NKSIVYASRNGHASFPHPGCYLQGNTKIG-IGVRNDCARSKYYVDSSSK  483

Query  492   YSVVAGL---QGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
             Y ++A     +GIV EPPW++Y REWGP I Y S  ++ ++ + LP  +R   E+L+ L 
Sbjct  484   YQIIAAEYLGEGIVAEPPWLQYMREWGPTIEYKSGYEVDKIINHLPSFFRISVESLVELF  543

Query  324   PNEFFGEEGPTGPNMKASWSGDEK  253
             P E +GE GPTGP  K +W GDE+
Sbjct  544   PTELYGEAGPTGPKEKNNWFGDER  567



>ref|XP_010326346.1| PREDICTED: uncharacterized protein LOC101247062 [Solanum lycopersicum]
Length=570

 Score =   394 bits (1011),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 282/443 (64%), Gaps = 18/443 (4%)
 Frame = -2

Query  1551  YTLVWSS-DSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             YTLVWSS D       G  Y WLP PP+GY A+G +VTT   KP    ++CV +  TD C
Sbjct  135   YTLVWSSNDGTEENFDGSGYFWLPQPPEGYKALGFIVTTKPVKPELGEVKCVRADLTDEC  194

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF---SGNVGTFACLKN  1204
             E    +    TS+       ++++RP +RG   KG+ +GTF  S    +G     ACLKN
Sbjct  195   ETYRLI--LKTSSVLSEVLAIWSIRPRHRGMHGKGISIGTFFCSSYWSTGQELNIACLKN  252

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              +      AMPNL QI A+ R Y P L+ HP + Y PSSV WF  NGA+LYT+GD     
Sbjct  253   FDTNLQ--AMPNLDQIHAIIRHYGPTLFFHPNEVYLPSSVQWFLDNGAMLYTRGDSVAK-  309

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I P+GSNLP GGTNDG  W++LP D   ++ V  G+L+S+++Y+++KP  GGTFTD+A+
Sbjct  310   PIEPEGSNLPGGGTNDGQCWIDLPCDV-RRDIVIFGNLESAKLYVHVKPALGGTFTDLAM  368

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+T K+G +  + L  +G+H+GDWEH TLR+SNF G L  +YFS+HSGG WV
Sbjct  369   WIFCPFNGPATLKVGVV-NVSLSKVGQHVGDWEHFTLRVSNFTGELWSIYFSQHSGGEWV  427

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
             DA +LEFI G NK++ YSS +GHA++  PG  +QG     IGIRND A+S   +D+  +Y
Sbjct  428   DAYDLEFIAG-NKAIVYSSKSGHASFPHPGTYIQGSSKLGIGIRNDVARSNLYVDSSTKY  486

Query  489   SVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              +++    G + + EP W++Y REWGP I Y S ++++++   LP+  R   +++   LP
Sbjct  487   EIISAQYLGHEAVSEPCWLQYMREWGPTIIYDSRKELEKIVHRLPIMVRNSVQSIFDKLP  546

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
              E F EEGPTGP  K +W GDE+
Sbjct  547   MELFKEEGPTGPKEKNNWFGDER  569



>gb|EAY88495.1| hypothetical protein OsI_09966 [Oryza sativa Indica Group]
Length=547

 Score =   392 bits (1008),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 210/439 (48%), Positives = 279/439 (64%), Gaps = 18/439 (4%)
 Frame = -2

Query  1551  YTLVWSSDSL-PITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPC  1375
             YTLVW+S  L     S     W P PP GY A+G+VVT   +KPS D +RCV+   TD C
Sbjct  120   YTLVWTSTDLNDDDNSDCGCFWSPSPPDGYEALGYVVTRGPKKPSLDAVRCVWGDLTDEC  179

Query  1374  EVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGTFACLKNNNV  1195
             E       +  +N   N + ++  RP +RG   +G+ VGTF            CLKN + 
Sbjct  180   EN-----FKSITNMGGNCY-IWNTRPCHRGMTGRGIPVGTFFCGTDTEESDIPCLKNFDS  233

Query  1194  AFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVRIG  1015
             + SS  MPNL QI+AL   Y P ++ HP + Y PSSV+WFF NGA L+ KG E   V I 
Sbjct  234   SLSS--MPNLEQIKALIEHYGPTVFFHPQEIYLPSSVSWFFENGATLHKKGKEMGDV-IL  290

Query  1014  PDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIWIF  835
               GSNLP GGTNDG YW+++P D +  E VK G+L+S+E+Y++IKP  GGTFTDIA+W+F
Sbjct  291   ASGSNLPAGGTNDGEYWIDIP-DGDRNEYVKAGNLKSAELYVHIKPAHGGTFTDIAMWVF  349

Query  834   YPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVDAP  655
              PFNGP+T K+G      L  +G H GDWEH TLRISNF+G L+ +YFS+HSGG WVDA 
Sbjct  350   CPFNGPATIKVG-FASFALQKVGRHTGDWEHFTLRISNFSGELSSIYFSQHSGGDWVDAC  408

Query  654   NLEFINGSNKSVAYSSLNGHANYSKPGLVLQG--IGDIGIRNDTAKSAAVLDTGLRYSVV  481
             +LEFI+G NK++ YS+ +GHA+Y+ PG  L G     +G+RND A+S  ++D+  RY ++
Sbjct  409   DLEFISG-NKAIVYSAKDGHASYAHPGCYLLGSEKAGVGVRNDAARSDILVDSSTRYKII  467

Query  480   -AGLQG--IVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPNEFF  310
              AG  G  ++EP W++Y REWGP + Y S  +I  V S LP   R   E +++ LP E +
Sbjct  468   SAGHLGDAVIEPCWLQYMREWGPTVEYNSRSEIDAVLSFLPFFLRFTAEAILNSLPVELY  527

Query  309   GEEGPTGPNMKASWSGDEK  253
              EEGPTGP  K +W GDE+
Sbjct  528   EEEGPTGPKEKNNWEGDER  546



>ref|XP_007149124.1| hypothetical protein PHAVU_005G043000g [Phaseolus vulgaris]
 gb|ESW21118.1| hypothetical protein PHAVU_005G043000g [Phaseolus vulgaris]
Length=517

 Score =   391 bits (1005),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 212/443 (48%), Positives = 267/443 (60%), Gaps = 55/443 (12%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y LVW++ SL I Q G  Y+WLP+ P  Y  VG+VVTTS EKPS D+IRCV S  TD C 
Sbjct  120   YKLVWTTSSLKIKQDGEGYIWLPIAPDEYKPVGYVVTTSQEKPSLDKIRCVRSDLTDECT  179

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVGT----FACLKN  1204
                      T N     FN++ +RP+ R  +A+GV VGTFL    G   +      CLKN
Sbjct  180   TYHSKKLWRTQNKR---FNVFDVRPMKRSIEAQGVSVGTFLAQSGGGANSKPLPIVCLKN  236

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET-NP  1027
                 FS   MPN SQ+EA+ + YSP +YLHP++ Y PSSV+WFF+NGA+L  K       
Sbjct  237   TKAKFS--YMPNFSQVEAMIKAYSPYMYLHPMEEYLPSSVDWFFTNGAVLIEKRKGVIRE  294

Query  1026  VRIGPDGSNLPQGGTNDG--VYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
               I P+GSNLPQGG+ND    YW++LP+D  ++ +VK+GDL SS+ Y+++KPM GGTFTD
Sbjct  295   SAIEPNGSNLPQGGSNDEEVTYWLDLPLDETKRVKVKQGDLASSQAYVHVKPMMGGTFTD  354

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             IA+W+FYPFNG + AK+     IPL   GEH+GDWEH+TLR+SN NG L KVYFS+HS G
Sbjct  355   IAMWVFYPFNGGAKAKVA-CTNIPLRTKGEHVGDWEHVTLRVSNLNGELWKVYFSQHSRG  413

Query  672   SWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGIRNDTAKSAAVLDTGLR  493
              WVDA  LEF NG N+ VAYSSL+GHA + KPG+V+QG+   G+RND AKS AV+D    
Sbjct  414   KWVDASELEFQNG-NRVVAYSSLHGHALFPKPGVVMQGMRRFGVRNDAAKSDAVMDMANG  472

Query  492   YSVVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
             + +V        I EPPW+ Y   WGPK                                
Sbjct  473   FEIVGAEYLGSEIREPPWLNYWMNWGPK--------------------------------  500

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
                    GP GP  K SW GDE+
Sbjct  501   ------NGPKGPKQKDSWKGDER  517



>ref|XP_011077064.1| PREDICTED: uncharacterized protein LOC105161158 [Sesamum indicum]
Length=568

 Score =   393 bits (1009),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 214/443 (48%), Positives = 277/443 (63%), Gaps = 21/443 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             YTLVWSS S     +   Y+WLP PP+GY   G VVTT  E+P  + +RCV    T+ CE
Sbjct  136   YTLVWSSHS---HGNEYGYIWLPNPPEGYKPTGFVVTTEPEEPDLEEVRCVREDLTESCE  192

Query  1371  VEDWVWGRGTSNNDPNGFNLYT--LRPINRGTQAKGVKVGTFLGSF---SGNVGTFACLK  1207
             V + ++ R +    P G  +Y    RP  RG   +GV VGTF  S    S N  + ACLK
Sbjct  193   VNEVIFERNSVF--PKG-RIYVGNTRPCRRGMLCRGVPVGTFYCSQDEDSENDMSIACLK  249

Query  1206  NNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNP  1027
             N + +    AMPNL Q+ AL + Y P +YLHP + + PSSV+WFF NGALLY  G +   
Sbjct  250   NLDSSLL--AMPNLDQVHALIKHYGPTVYLHPDEAFLPSSVSWFFENGALLYKDGRDKG-  306

Query  1026  VRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIA  847
             + I   GSNLP GG NDG +W++LPVDNN  + VK G ++++E+Y+++KP  GGTFTDIA
Sbjct  307   LAIDSKGSNLPGGGRNDGQFWLDLPVDNNRSDHVKSGSMKTAELYVHVKPASGGTFTDIA  366

Query  846   IWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSW  667
             +WIF PFNGPST K G         IG+H+GDWEH TLR+SNF G L  VYFSEHSGG W
Sbjct  367   MWIFCPFNGPSTIKAGAFNYT-FSRIGQHVGDWEHYTLRLSNFEGELWSVYFSEHSGGEW  425

Query  666   VDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGDIGI--RNDTAKSAAVLDTGLR  493
             +DA  LEFI+G NK + Y+S +GHA++   G  +QG   +GI  RND AKS   +D+  +
Sbjct  426   LDASALEFIDG-NKPIIYASKSGHASFPHEGCYIQGSTKLGIGARNDCAKSNYSIDSSTK  484

Query  492   YSVVAGL---QGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
             Y V+A       I EP W++Y REWGP + Y S  ++ ++   LP   R   E LI L P
Sbjct  485   YQVIAAEYLGDEIEEPHWLQYMREWGPTVVYDSRSELDKILKHLPFFVRFSLENLIELFP  544

Query  321   NEFFGEEGPTGPNMKASWSGDEK  253
              E +GEEGPTGP  K +W GDE+
Sbjct  545   TELYGEEGPTGPKEKDNWLGDER  567



>ref|XP_007204992.1| hypothetical protein PRUPE_ppa003496mg [Prunus persica]
 gb|EMJ06191.1| hypothetical protein PRUPE_ppa003496mg [Prunus persica]
Length=570

 Score =   393 bits (1009),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 207/442 (47%), Positives = 277/442 (63%), Gaps = 18/442 (4%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+LVW++DS    ++G  Y+WLP PP GY A+G VVT + E+P  + +RCV    T+ CE
Sbjct  137   YSLVWNADS---NKNGCGYIWLPNPPVGYKAMGFVVTDNSEEPRPEEVRCVREDLTEACE  193

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF---SGNVGTFACLKNN  1201
               D V    +  ++   F ++  RP  RG    GV VGTF  S    S +    ACLKN 
Sbjct  194   TRDRVLAMDSKLSEEQ-FQVWNTRPCKRGMLCSGVSVGTFFCSTYLDSDDELEVACLKN-  251

Query  1200  NVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPVR  1021
              +  S  AMPNL+QI AL   Y P ++ HP + Y PSSV WFF NGALLY + D  N   
Sbjct  252   -IDSSLHAMPNLNQIHALIEHYGPTVFFHPDEVYLPSSVQWFFKNGALLYHE-DSGNGEP  309

Query  1020  IGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAIW  841
             I   GSNLP GG ND  +W++LP D++ +  +K G+++S+E+Y+++KP  GGTFTDIA+W
Sbjct  310   IDYRGSNLPSGGENDSDFWIDLPNDDDARNHLKGGNIESAELYVHVKPALGGTFTDIAMW  369

Query  840   IFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWVD  661
             +F PFNGP+T K+G +  I +  IG+H+GDWEH TLR+SNF G L + YFSEHSGG WVD
Sbjct  370   VFCPFNGPATIKIGLVS-IAMNKIGQHVGDWEHFTLRVSNFTGELWQAYFSEHSGGRWVD  428

Query  660   APNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIG--DIGIRNDTAKSAAVLDTGLRYS  487
               +LEFI G NK + YSS  GH++Y  PG  LQG    DIG+RND A+S   +D+  +Y 
Sbjct  429   VSDLEFIEG-NKPIVYSSKYGHSSYPHPGTYLQGSSKFDIGVRNDAARSKFCIDSSTKYQ  487

Query  486   VVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLPN  319
             +VA    G   I EP W++Y  +WGP I Y S  ++ ++   LP   R   E L  L P 
Sbjct  488   IVAAEYLGDGVISEPCWLQYMSDWGPTIVYDSRSELDKLIDHLPFFVRFSVENLFDLFPT  547

Query  318   EFFGEEGPTGPNMKASWSGDEK  253
             + +GEEGPTGP  K +W GDE+
Sbjct  548   QLYGEEGPTGPKEKDNWLGDER  569



>gb|KHN14825.1| hypothetical protein glysoja_020998 [Glycine soja]
Length=560

 Score =   392 bits (1008),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 205/442 (46%), Positives = 280/442 (63%), Gaps = 20/442 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+L+WS DS         Y WLP PP GY A+G VVT+S ++P  + +RCV    T+ CE
Sbjct  127   YSLIWSLDS----HDECVYFWLPNPPTGYKAMGIVVTSSPKEPEVEEVRCVRDDLTETCE  182

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSF---SGNVGTFACLKN  1204
               D +     S    + F ++  +P +RG  A+GV VGTF  GS    S  V    CLKN
Sbjct  183   TSDLLLTV-KSKYAKDSFQVWNTQPCDRGMLARGVDVGTFFCGSTYFDSEQVVDIVCLKN  241

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              + +    AMPN +QI AL + Y P +Y HP + Y PSSV WFF NGA+L+  G++   +
Sbjct  242   LDSSLH--AMPNQNQIHALIQHYGPTVYFHPDEKYLPSSVQWFFKNGAVLHAAGNKKG-I  298

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I   GSNLP GGTNDG +W++LP D + +  +K+G+++S+E+Y+++KP  GG FTDI +
Sbjct  299   AIDYQGSNLPSGGTNDGAFWIDLPTDGDARNNLKKGNIESAELYVHVKPALGGAFTDIVM  358

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP+T K+  +  I +  IGEH+GDWEH TLRISNF G L  VYFS+HSGG W+
Sbjct  359   WVFCPFNGPATLKVA-LMNIEMSKIGEHVGDWEHFTLRISNFTGELWSVYFSQHSGGGWI  417

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
              A +LEF N  NK + YSS +GHA++  PG  LQG     IG+RND A+S  ++D+ ++Y
Sbjct  418   HAFDLEF-NKGNKPIVYSSKDGHASFPHPGTYLQGSSKLGIGVRNDAAQSKFIVDSSVKY  476

Query  489   SVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              +VA    G   I EP W++Y REWGP + Y S  +I+++ +LLP+  R   E L  L P
Sbjct  477   QIVAAEYLGEGVITEPCWLQYMREWGPTVVYDSRSEIEKIINLLPLFVRFSVENLFELFP  536

Query  321   NEFFGEEGPTGPNMKASWSGDE  256
              E +GEEGPTGP  K +W GDE
Sbjct  537   TELYGEEGPTGPKEKDNWLGDE  558



>ref|XP_006854359.1| hypothetical protein AMTR_s00039p00159460 [Amborella trichopoda]
 gb|ERN15826.1| hypothetical protein AMTR_s00039p00159460 [Amborella trichopoda]
Length=577

 Score =   393 bits (1009),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 211/446 (47%), Positives = 289/446 (65%), Gaps = 21/446 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQS---GPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTD  1381
             YTLVW S+          G  Y WLP PP+GY AVG VVT S +KPS + +RCV +  T+
Sbjct  139   YTLVWGSNEWSDESQALFGCGYFWLPYPPKGYKAVGFVVTNSSDKPSLEEVRCVRADLTE  198

Query  1380  PCEVEDWVWGRGTSNNDPN-GFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG---TFAC  1213
             PC     +    T +  P   F ++  RP +RG +A+GV VGTF  S   N     + +C
Sbjct  199   PCASHGLI--LSTVSTLPKFPFRVWKTRPCHRGIEARGVPVGTFYCSSYFNSSEDLSISC  256

Query  1212  LKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET  1033
             LKN+  +    AMPNL Q+ AL + Y P +Y HP + Y PSS++WFF NGALLY K DE 
Sbjct  257   LKNSEPSLH--AMPNLDQVHALIKHYGPTVYFHPDEIYLPSSLSWFFDNGALLY-KRDEA  313

Query  1032  NPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
                 I   GSNLPQGG+NDG YW++LP  N ++E VK G+L+S+E+Y+++KP  GG+FTD
Sbjct  314   RGEPIDSLGSNLPQGGSNDGKYWLDLP-SNGDEEWVKLGNLESAELYVHVKPALGGSFTD  372

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             IA+WIF PFNGP+T K+G +  + L  +G+H+ DWEH TLRI NF+G L  +YFS+HSGG
Sbjct  373   IAMWIFCPFNGPATIKIGMV-NVALSKVGQHVCDWEHYTLRICNFSGELWAIYFSQHSGG  431

Query  672   SWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTG  499
              WV+A +LEF+  +N+++ YSS + HA+++ PG  LQG     IG+RND  KS   +D+ 
Sbjct  432   EWVEAWDLEFVE-NNRAIIYSSKSSHASFAHPGNYLQGDNKLGIGVRNDAEKSDLFVDSS  490

Query  498   LRYSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIH  331
             +RY +V+    G   + EP W++Y REWGP I Y S  +++++ SLLPV  R   E + +
Sbjct  491   VRYKIVSAEYSGEDWVKEPCWLQYMREWGPTIVYNSRSELEKIISLLPVLVRFSVENIFN  550

Query  330   LLPNEFFGEEGPTGPNMKASWSGDEK  253
              LP E +GEEGPTGP  K +W GDE+
Sbjct  551   RLPMELYGEEGPTGPKEKNNWEGDER  576



>ref|XP_003536134.1| PREDICTED: uncharacterized protein LOC100788778 [Glycine max]
Length=560

 Score =   392 bits (1008),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 205/442 (46%), Positives = 280/442 (63%), Gaps = 20/442 (5%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+L+WS DS         Y WLP PP GY A+G VVT+S ++P  + +RCV    T+ CE
Sbjct  127   YSLIWSLDS----HDECVYFWLPNPPTGYKAMGIVVTSSPKEPEVEEVRCVRDDLTETCE  182

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFL-GSF---SGNVGTFACLKN  1204
               D +     S    + F ++  +P +RG  A+GV VGTF  GS    S  V    CLKN
Sbjct  183   TSDLLLTV-KSKYAKDSFQVWNTQPCDRGMLARGVDVGTFFCGSTYFDSEQVVDIMCLKN  241

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              + +    AMPN +QI AL + Y P +Y HP + Y PSSV WFF NGA+L+  G++   +
Sbjct  242   LDSSLH--AMPNQNQIHALIQHYGPTVYFHPDEKYLPSSVQWFFKNGAVLHAAGNKKG-I  298

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I   GSNLP GGTNDG +W++LP D + +  +K+G+++S+E+Y+++KP  GG FTDI +
Sbjct  299   AIDYQGSNLPSGGTNDGAFWIDLPTDGDARNNLKKGNIESAELYVHVKPALGGAFTDIVM  358

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             W+F PFNGP+T K+  +  I +  IGEH+GDWEH TLRISNF G L  VYFS+HSGG W+
Sbjct  359   WVFCPFNGPATLKVA-LMNIEMSKIGEHVGDWEHFTLRISNFTGELWSVYFSQHSGGGWI  417

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTGLRY  490
              A +LEF N  NK + YSS +GHA++  PG  LQG     IG+RND A+S  ++D+ ++Y
Sbjct  418   HAFDLEF-NKGNKPIVYSSKDGHASFPHPGTYLQGSSKLGIGVRNDAAQSKFIVDSSVKY  476

Query  489   SVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLLP  322
              +VA    G   I EP W++Y REWGP + Y S  +I+++ +LLP+  R   E L  L P
Sbjct  477   QIVAAEYLGEGVITEPCWLQYMREWGPTVVYDSRSEIEKIINLLPLFVRFSVENLFELFP  536

Query  321   NEFFGEEGPTGPNMKASWSGDE  256
              E +GEEGPTGP  K +W GDE
Sbjct  537   TELYGEEGPTGPKEKDNWLGDE  558



>gb|KHG12486.1| Vacuolar sorting-associated protein 62 [Gossypium arboreum]
Length=569

 Score =   392 bits (1008),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 210/444 (47%), Positives = 278/444 (63%), Gaps = 25/444 (6%)
 Frame = -2

Query  1551  YTLVWSSDSLPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFTDPCE  1372
             Y+L+WSSD   + ++G  + WLP  P GY A+G +VT + E+P  D +RCV    T+ C 
Sbjct  139   YSLIWSSD---LDRNGCGFFWLPNAPMGYKAMGILVTGTPEEPDDDEVRCVREDLTETCA  195

Query  1371  VEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSF----SGNVGTFACLKN  1204
             ++D +   G    DP  F ++  RP  RG   KGV VGTF  S            ACLKN
Sbjct  196   IKDTIHVAGA---DP--FQVWNTRPCKRGMCCKGVSVGTFFCSTYFVSENEELEIACLKN  250

Query  1203  NNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDETNPV  1024
              +      AMP+L+QI AL   Y   ++ HP +   PSSV WFF NGALLY  G E    
Sbjct  251   LDPTLH--AMPDLNQIHALINHYGATVFFHPDEDCLPSSVQWFFKNGALLYEDG-ELKGK  307

Query  1023  RIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTDIAI  844
              I   GSNLP GGTNDG +W++LP DNN +E VK+G+L+S+E+Y+++KP  GGTFTDI +
Sbjct  308   SIDYQGSNLPSGGTNDGAFWIDLPGDNNGRENVKKGNLESAELYVHVKPAVGGTFTDIVM  367

Query  843   WIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGGSWV  664
             WIF PFNGP+  K+G +  I +  +G+H+ DWEH TLRISNF G L +VYFS+HSGG WV
Sbjct  368   WIFCPFNGPANLKIG-LMNIQMNKLGQHVSDWEHFTLRISNFTGELWQVYFSQHSGGEWV  426

Query  663   DAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQG---IGDIGIRNDTAKSAAVLDTGLR  493
             DA +LE+I G NK + YSS +GHA++  PG  LQG   +G IGIRND A+S   +D+  R
Sbjct  427   DAFDLEYIEG-NKPIVYSSRHGHASFPHPGTYLQGSVKLG-IGIRNDAARSKYFVDSSTR  484

Query  492   YSVVA----GLQGIVEPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHLL  325
             Y ++A    G   + EP W+ Y REWGP I Y S  ++ R+ ++LP   R   E +  L 
Sbjct  485   YKIIAAEYLGDGVVTEPCWLNYMREWGPTIVYDSRSELDRIINMLPFFVRFSVENIFDLF  544

Query  324   PNEFFGEEGPTGPNMKASWSGDEK  253
             P E +GEEGPTGP  K +W GDE+
Sbjct  545   PTELYGEEGPTGPKEKDNWEGDER  568



>gb|KHN25608.1| hypothetical protein glysoja_018182 [Glycine soja]
Length=586

 Score =   392 bits (1008),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 217/445 (49%), Positives = 287/445 (64%), Gaps = 22/445 (5%)
 Frame = -2

Query  1551  YTLVWSSDS----LPITQSGPAYVWLPVPPQGYSAVGHVVTTSLEKPSGDRIRCVFSAFT  1384
             Y LVW S++    LPI   G AY W+P PP+GYSA+G +V    +KP+ D + CV +  T
Sbjct  151   YMLVWCSNAGSKELPI---GSAYFWVPQPPEGYSALGFLVANMPDKPNLDEMICVRADLT  207

Query  1383  DPCEVEDWVWGRGTSNNDPNGFNLYTLRPINRGTQAKGVKVGTFLGSFSGNVG---TFAC  1213
             D CE    +    +   +   F +++LRP +RG   KGV VGTF  +   N G   +  C
Sbjct  208   DKCEPYRLMLDAASVIPE-FPFQVWSLRPRDRGMPGKGVSVGTFFCTSCWNNGDELSVVC  266

Query  1212  LKNNNVAFSSSAMPNLSQIEALFREYSPILYLHPLDTYHPSSVNWFFSNGALLYTKGDET  1033
             LKN N      AMP L QI AL   Y P ++ HP + Y PSSV+WFF+NGALLY KG  T
Sbjct  267   LKNLNPVLP--AMPRLHQIHALIEHYGPTVFFHPEEVYLPSSVDWFFNNGALLYRKGVST  324

Query  1032  NPVRIGPDGSNLPQGGTNDGVYWVNLPVDNNEKERVKRGDLQSSEVYLNIKPMFGGTFTD  853
                 I   GSNLP GG NDG +W++LP D+ +++ VK GDL+S+++Y+++KP  GGTFTD
Sbjct  325   GEA-IDAAGSNLPGGGRNDGEFWIDLPSDD-KRDFVKHGDLKSAKLYVHVKPALGGTFTD  382

Query  852   IAIWIFYPFNGPSTAKLGQIERIPLGMIGEHIGDWEHLTLRISNFNGVLNKVYFSEHSGG  673
             IA+W+F PFNGPST K+G   R     +GEH+GDWEH TLRI NF+G L  +YFS+HSGG
Sbjct  383   IAMWVFCPFNGPSTLKIGITSRA-FSKVGEHVGDWEHFTLRICNFSGELWSIYFSQHSGG  441

Query  672   SWVDAPNLEFINGSNKSVAYSSLNGHANYSKPGLVLQGIGD--IGIRNDTAKSAAVLDTG  499
              WVDA  LE+I+G NK+V YSS NGHA+Y  PG  LQG     IGIRND  +S   +D+ 
Sbjct  442   KWVDAYELEYIDG-NKAVVYSSKNGHASYPHPGTYLQGSSKLGIGIRNDATRSNLYVDSS  500

Query  498   LRYSVVAG--LQGIV-EPPWVKYCREWGPKITYISEEDIKRVESLLPVEWRGVFETLIHL  328
             ++Y +VA   L  +V EP W+++ REWGPKI Y S+ ++ ++ + LP   R  F +LI  
Sbjct  501   VQYELVAAEYLGDVVREPQWLQFMREWGPKIVYDSKTELDKIINALPGGLRNSFGSLIKK  560

Query  327   LPNEFFGEEGPTGPNMKASWSGDEK  253
             LP E +GEEGPTGP  K +W GDE+
Sbjct  561   LPVELYGEEGPTGPKEKNNWIGDER  585



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4395422666844