BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8527_g1_i1 len=1782 path=[1:0-337 339:338-1781]

Length=1782
                                                                      Score     E

emb|CBI19549.3|  unnamed protein product                                473   1e-158   
ref|XP_002282366.2|  PREDICTED: patatin-like protein 2                  461   3e-154   Vitis vinifera
emb|CBI19560.3|  unnamed protein product                                464   6e-154   
emb|CBI19558.3|  unnamed protein product                                459   3e-153   
emb|CAN68798.1|  hypothetical protein VITISV_008805                     458   3e-153   Vitis vinifera
ref|XP_003589236.1|  Patatin-like protein                               459   4e-153   
ref|XP_010664933.1|  PREDICTED: patatin-like protein 2                  458   5e-153   
ref|XP_004499075.1|  PREDICTED: patatin-2-Kuras 3-like isoform X1       458   6e-153   
ref|XP_006354909.1|  PREDICTED: patatin-3-Kuras 1-like                  457   1e-152   
ref|XP_007136666.1|  hypothetical protein PHAVU_009G063500g             456   2e-152   
ref|XP_003589238.1|  Patatin-like protein                               454   3e-151   
ref|XP_002310732.1|  patatin family protein                             453   5e-151   Populus trichocarpa [western balsam poplar]
ref|XP_011008336.1|  PREDICTED: patatin-like protein 3                  452   8e-151   
gb|AFK35290.1|  unknown                                                 452   2e-150   
gb|KCW78409.1|  hypothetical protein EUGRSUZ_D02575                     449   9e-150   
ref|XP_009769117.1|  PREDICTED: patatin-like protein 2 isoform X1       450   1e-149   
ref|XP_003544452.1|  PREDICTED: patatin-3-Kuras 1-like                  449   1e-149   
ref|XP_002282432.1|  PREDICTED: patatin-like protein 2                  449   1e-149   Vitis vinifera
ref|XP_010054916.1|  PREDICTED: patatin-like protein 2                  449   1e-149   
ref|XP_010926367.1|  PREDICTED: patatin-like protein 2                  449   2e-149   
ref|XP_009797488.1|  PREDICTED: patatin-like protein 2 isoform X1       449   2e-149   
ref|XP_010064136.1|  PREDICTED: patatin-like protein 2                  450   2e-149   
gb|KCW88897.1|  hypothetical protein EUGRSUZ_A01223                     448   3e-149   
emb|CDP01332.1|  unnamed protein product                                449   3e-149   
ref|XP_010068219.1|  PREDICTED: patatin-like protein 2                  448   4e-149   
ref|XP_002282415.2|  PREDICTED: patatin-like protein 2                  447   6e-149   Vitis vinifera
ref|XP_010068174.1|  PREDICTED: patatin-like protein 2                  447   8e-149   
ref|XP_010664934.1|  PREDICTED: patatin-like protein 2                  447   8e-149   
ref|XP_002282440.1|  PREDICTED: patatin-like protein 2                  447   9e-149   Vitis vinifera
ref|XP_011007290.1|  PREDICTED: patatin-like protein 3                  446   2e-148   
ref|XP_004499076.1|  PREDICTED: patatin-2-Kuras 3-like isoform X2       445   2e-148   
ref|XP_003527713.1|  PREDICTED: patatin-like                            446   5e-148   
ref|XP_009797490.1|  PREDICTED: patatin-like protein 2                  445   6e-148   
ref|XP_010059972.1|  PREDICTED: patatin-like protein 2                  445   7e-148   
ref|XP_009612649.1|  PREDICTED: patatin-like protein 2                  445   8e-148   
ref|XP_010059970.1|  PREDICTED: patatin-like protein 2 isoform X1       445   8e-148   
ref|XP_006829694.1|  hypothetical protein AMTR_s00126p00050070          443   5e-147   
ref|XP_008808514.1|  PREDICTED: patatin-like protein 2                  445   7e-147   
ref|XP_009794733.1|  PREDICTED: patatin-like protein 2                  442   9e-147   
ref|XP_009367377.1|  PREDICTED: patatin-like protein 2                  442   1e-146   
gb|KHN04516.1|  Patatin group A-3                                       442   1e-146   
ref|XP_003549405.1|  PREDICTED: patatin-3-Kuras 1                       442   1e-146   
ref|XP_010064139.1|  PREDICTED: patatin-like protein 2                  442   2e-146   
ref|XP_006829702.1|  hypothetical protein AMTR_s00126p00063230          441   2e-146   
gb|KHN12765.1|  Patatin group A-3                                       441   3e-146   
ref|XP_006354908.1|  PREDICTED: patatin-3-Kuras 1-like                  441   3e-146   
ref|XP_010059967.1|  PREDICTED: patatin-like protein 2                  440   7e-146   
ref|XP_011081971.1|  PREDICTED: patatin-like protein 1                  439   8e-146   
ref|XP_010926529.1|  PREDICTED: patatin-like protein 2                  443   1e-145   
ref|XP_004501586.1|  PREDICTED: patatin-3-Kuras 1-like isoform X1       439   1e-145   
ref|XP_008228777.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    439   1e-145   
gb|KCW66178.1|  hypothetical protein EUGRSUZ_F00014                     439   2e-145   
ref|XP_007017303.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            440   2e-145   
ref|XP_008220177.1|  PREDICTED: patatin-like protein 2                  439   2e-145   
ref|XP_002277305.1|  PREDICTED: patatin-like protein 1                  438   2e-145   Vitis vinifera
gb|AAX99411.1|  patatin-like protein                                    439   3e-145   Gossypium hirsutum [American cotton]
ref|XP_003603015.1|  Patatin-like protein                               438   3e-145   
ref|XP_010664585.1|  PREDICTED: patatin-like protein 2 isoform X3       439   3e-145   
emb|CBI19552.3|  unnamed protein product                                440   4e-145   
ref|XP_006424637.1|  hypothetical protein CICLE_v10030027mg             438   4e-145   
ref|XP_002282481.1|  PREDICTED: patatin-like protein 2                  438   4e-145   Vitis vinifera
ref|XP_011099181.1|  PREDICTED: patatin-like protein 1                  437   4e-145   
ref|XP_010942708.1|  PREDICTED: patatin-like protein 2                  438   5e-145   
ref|XP_008801772.1|  PREDICTED: patatin-like protein 2                  437   5e-145   
ref|XP_006488153.1|  PREDICTED: patatin-3-Kuras 1-like                  437   7e-145   
ref|XP_009769118.1|  PREDICTED: patatin-like protein 2 isoform X2       437   7e-145   
ref|XP_006354913.1|  PREDICTED: patatin-3-Kuras 1-like                  437   7e-145   
ref|XP_010664584.1|  PREDICTED: patatin-like protein 2 isoform X2       437   2e-144   
ref|XP_002284571.1|  PREDICTED: patatin-like protein 2                  437   2e-144   Vitis vinifera
ref|XP_009380972.1|  PREDICTED: patatin-like protein 2                  436   2e-144   
ref|XP_010064187.1|  PREDICTED: patatin-like protein 2                  437   2e-144   
ref|XP_010064188.1|  PREDICTED: patatin-like protein 2                  436   3e-144   
ref|XP_008361010.1|  PREDICTED: patatin-like protein 2                  436   3e-144   
ref|XP_004501587.1|  PREDICTED: patatin-3-Kuras 1-like isoform X2       436   3e-144   
ref|XP_007227183.1|  hypothetical protein PRUPE_ppa019615mg             435   3e-144   
emb|CBI19544.3|  unnamed protein product                                438   3e-144   
ref|XP_007226655.1|  hypothetical protein PRUPE_ppa021897mg             436   3e-144   
ref|XP_002282391.3|  PREDICTED: uncharacterized protein LOC100264244    458   3e-144   Vitis vinifera
ref|XP_006434815.1|  hypothetical protein CICLE_v10001337mg             436   3e-144   
ref|XP_007017304.1|  Phospholipase A 2A, IIA,PLA2A isoform 2            436   4e-144   
emb|CBI21444.3|  unnamed protein product                                436   4e-144   
ref|XP_009801077.1|  PREDICTED: patatin-like protein 2                  435   4e-144   
ref|XP_002510258.1|  Patatin T5 precursor, putative                     436   4e-144   Ricinus communis
ref|XP_009370176.1|  PREDICTED: patatin-like protein 2                  434   8e-144   
ref|XP_010059969.1|  PREDICTED: patatin-like protein 2 isoform X2       434   1e-143   
ref|XP_010268994.1|  PREDICTED: patatin-like protein 2 isoform X1       434   1e-143   
ref|XP_010064132.1|  PREDICTED: patatin-like protein 2                  433   3e-143   
ref|XP_003603014.1|  Patatin-like protein                               433   3e-143   
gb|KCW66171.1|  hypothetical protein EUGRSUZ_F00007                     433   3e-143   
emb|CBI19557.3|  unnamed protein product                                447   4e-143   
ref|XP_004238176.1|  PREDICTED: patatin-like protein 2                  432   4e-143   
ref|NP_849511.1|  patatin-related phospholipase A                       433   5e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009617797.1|  PREDICTED: patatin-like protein 2 isoform X1       433   5e-143   
ref|XP_009139351.1|  PREDICTED: patatin-like protein 1 isoform X1       432   6e-143   
emb|CDX75619.1|  BnaA01g00830D                                          432   6e-143   
emb|CAA05628.1|  patatin-like protein                                   432   6e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007160832.1|  hypothetical protein PHAVU_001G020300g             432   8e-143   
ref|XP_010320346.1|  PREDICTED: patatin-like protein 2 isoform X1       432   9e-143   
ref|XP_007222710.1|  hypothetical protein PRUPE_ppa006466mg             432   9e-143   
ref|XP_009390266.1|  PREDICTED: patatin-like protein 2 isoform X2       432   1e-142   
ref|XP_008241530.1|  PREDICTED: patatin-like protein 2                  431   1e-142   
ref|XP_010098699.1|  Patatin group A-3                                  432   1e-142   
ref|XP_010065725.1|  PREDICTED: patatin-like protein 2                  431   2e-142   
gb|KCW66458.1|  hypothetical protein EUGRSUZ_F00254                     432   2e-142   
ref|XP_010064186.1|  PREDICTED: patatin-like protein 2                  432   2e-142   
ref|XP_010064137.1|  PREDICTED: patatin-like protein 2                  431   2e-142   
ref|XP_008777430.1|  PREDICTED: patatin-like protein 2                  431   3e-142   
ref|XP_008776828.1|  PREDICTED: patatin-like protein 2                  429   5e-142   
ref|XP_002281798.1|  PREDICTED: patatin-like protein 1                  430   6e-142   Vitis vinifera
ref|XP_006354907.1|  PREDICTED: patatin-2-Kuras 4-like                  429   6e-142   
gb|AAF98368.1|AF158027_1  patatin-like protein 1                        430   7e-142   Nicotiana tabacum [American tobacco]
ref|XP_009390265.1|  PREDICTED: patatin-like protein 2 isoform X1       430   7e-142   
ref|XP_010028264.1|  PREDICTED: patatin-like protein 1                  429   1e-141   
ref|XP_006434813.1|  hypothetical protein CICLE_v10001337mg             429   1e-141   
ref|XP_009370175.1|  PREDICTED: patatin-like protein 2                  429   2e-141   
ref|XP_010059968.1|  PREDICTED: patatin-like protein 2 isoform X1       429   2e-141   
emb|CDP07844.1|  unnamed protein product                                429   2e-141   
ref|NP_195423.1|  PATATIN-like protein 5                                429   2e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061770.1|  PREDICTED: patatin-like protein 2 isoform X1       428   3e-141   
ref|XP_004289234.1|  PREDICTED: patatin group A-3-like                  427   3e-141   
emb|CDX69269.1|  BnaC01g01840D                                          428   5e-141   
ref|XP_006354911.1|  PREDICTED: patatin-3-Kuras 1-like                  427   6e-141   
ref|XP_008777590.1|  PREDICTED: patatin-like protein 2                  427   8e-141   
emb|CAN71271.1|  hypothetical protein VITISV_001907                     428   9e-141   Vitis vinifera
ref|XP_009367378.1|  PREDICTED: patatin-like protein 2                  427   1e-140   
ref|XP_007156814.1|  hypothetical protein PHAVU_002G019800g             426   1e-140   
gb|KDO79282.1|  hypothetical protein CISIN_1g015720mg                   426   1e-140   
ref|XP_008393828.1|  PREDICTED: patatin-like protein 2 isoform X2       426   1e-140   
ref|XP_008337062.1|  PREDICTED: patatin-like protein 2                  426   2e-140   
ref|XP_006285520.1|  hypothetical protein CARUB_v10006962mg             426   2e-140   
ref|XP_009409669.1|  PREDICTED: patatin-like protein 1                  426   3e-140   
emb|CBI19553.3|  unnamed protein product                                426   4e-140   
ref|XP_006829697.1|  hypothetical protein AMTR_s00126p00052700          425   4e-140   
ref|XP_010548401.1|  PREDICTED: patatin-like protein 1                  424   4e-140   
ref|XP_007047215.1|  Uncharacterized protein TCM_000589                 425   5e-140   
ref|XP_008393827.1|  PREDICTED: patatin-like protein 2 isoform X1       425   5e-140   
ref|XP_008228776.1|  PREDICTED: patatin-like protein 2                  425   7e-140   
emb|CAN76066.1|  hypothetical protein VITISV_001725                     424   8e-140   Vitis vinifera
ref|XP_009370195.1|  PREDICTED: patatin-like protein 2                  430   8e-140   
ref|XP_009366776.1|  PREDICTED: patatin-like protein 2                  424   8e-140   
ref|XP_002869007.1|  PLA IVA/PLP1                                       424   8e-140   
ref|XP_010269035.1|  PREDICTED: patatin-like protein 2 isoform X1       424   9e-140   
emb|CDX72619.1|  BnaC07g46410D                                          424   1e-139   
ref|XP_009139093.1|  PREDICTED: patatin-like protein 3                  424   1e-139   
emb|CDX75621.1|  BnaA01g00810D                                          424   2e-139   
ref|XP_009367379.1|  PREDICTED: patatin-like protein 2                  423   2e-139   
ref|XP_011017230.1|  PREDICTED: patatin-like protein 2                  423   2e-139   
ref|XP_006660213.1|  PREDICTED: patatin-3-Kuras 1-like                  424   2e-139   
ref|XP_008384958.1|  PREDICTED: patatin-like protein 2                  423   2e-139   
ref|XP_003576611.1|  PREDICTED: patatin-like protein 2 isoform X1       422   3e-139   
ref|XP_010269056.1|  PREDICTED: patatin-like protein 2 isoform X1       422   4e-139   
gb|KFK30333.1|  hypothetical protein AALP_AA7G248300                    422   4e-139   
ref|XP_011038244.1|  PREDICTED: patatin-like protein 2 isoform X2       422   5e-139   
ref|XP_004291130.1|  PREDICTED: patatin group A-3-like                  423   5e-139   
ref|XP_006466737.1|  PREDICTED: patatin-14-like                         422   6e-139   
ref|XP_009367381.1|  PREDICTED: patatin-like protein 2                  422   6e-139   
ref|XP_004238177.1|  PREDICTED: patatin-like protein 2                  422   9e-139   
ref|XP_007156813.1|  hypothetical protein PHAVU_002G019700g             421   1e-138   
ref|XP_003611772.1|  Patatin-like protein                               421   1e-138   
ref|XP_010268755.1|  PREDICTED: patatin-like protein 2                  421   1e-138   
ref|XP_006374978.1|  hypothetical protein POPTR_0014s03290g             422   1e-138   
emb|CDP04311.1|  unnamed protein product                                421   1e-138   
ref|XP_006354914.1|  PREDICTED: patatin-3-Kuras 1-like                  421   2e-138   
ref|XP_006374982.1|  hypothetical protein POPTR_0014s03330g             421   4e-138   
ref|XP_011038243.1|  PREDICTED: patatin-like protein 2 isoform X1       420   4e-138   
ref|XP_011030324.1|  PREDICTED: patatin-like protein 2 isoform X1       420   5e-138   
ref|XP_009419098.1|  PREDICTED: patatin-like protein 2                  420   5e-138   
ref|XP_011030334.1|  PREDICTED: patatin-like protein 2 isoform X2       420   6e-138   
ref|XP_009138466.1|  PREDICTED: patatin-like protein 1 isoform X1       419   7e-138   
ref|XP_010437269.1|  PREDICTED: patatin-like protein 1 isoform X1       419   8e-138   
ref|XP_010268982.1|  PREDICTED: patatin-like protein 2                  419   8e-138   
ref|XP_006387188.1|  hypothetical protein POPTR_1581s00200g             419   1e-137   
ref|XP_004979713.1|  PREDICTED: patatin-3-Kuras 1-like                  419   1e-137   
emb|CDX69271.1|  BnaC01g01820D                                          419   1e-137   
ref|XP_010041051.1|  PREDICTED: patatin-like protein 2                  419   1e-137   
ref|XP_006659497.1|  PREDICTED: patatin-3-Kuras 1-like                  419   2e-137   
ref|XP_006374981.1|  hypothetical protein POPTR_0014s03320g             419   2e-137   
ref|XP_011038246.1|  PREDICTED: patatin-like protein 2 isoform X2       418   2e-137   
ref|XP_004152794.1|  PREDICTED: patatin group A-3-like                  418   2e-137   
ref|XP_011038242.1|  PREDICTED: patatin-like protein 2                  417   3e-137   
ref|XP_009139399.1|  PREDICTED: patatin-like protein 1 isoform X2       417   4e-137   
ref|XP_010432097.1|  PREDICTED: patatin-like protein 1                  418   4e-137   
gb|KFK30335.1|  hypothetical protein AALP_AA7G248500                    417   4e-137   
ref|NP_568015.1|  patatin-related phospholipase A                       416   6e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017310.1|  Phospholipase A 2A, IIA,PLA2A                      417   7e-137   
gb|AAM64566.1|  patatin-like protein                                    416   8e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009393655.1|  PREDICTED: patatin-like protein 2                  417   8e-137   
ref|XP_010320347.1|  PREDICTED: patatin-like protein 2 isoform X2       416   9e-137   
ref|XP_010446709.1|  PREDICTED: patatin-like protein 1 isoform X2       417   9e-137   
ref|XP_006473887.1|  PREDICTED: patatin-05-like                         416   1e-136   
ref|XP_006408594.1|  hypothetical protein EUTSA_v10002000mg             416   1e-136   
ref|XP_006339914.1|  PREDICTED: patatin-05-like                         416   1e-136   
ref|XP_003611771.1|  Patatin-like protein                               416   1e-136   
ref|XP_007017305.1|  Phospholipase A 2A, IIA,PLA2A                      416   1e-136   
ref|XP_008241846.1|  PREDICTED: patatin-like protein 1                  416   1e-136   
gb|KCW54973.1|  hypothetical protein EUGRSUZ_I00941                     416   2e-136   
ref|XP_009403085.1|  PREDICTED: patatin-like protein 2                  416   2e-136   
ref|XP_004979715.1|  PREDICTED: patatin-2-Kuras 1-like                  416   2e-136   
ref|XP_011038245.1|  PREDICTED: patatin-like protein 2 isoform X1       416   2e-136   
ref|XP_008779158.1|  PREDICTED: patatin-like protein 2                  416   2e-136   
ref|XP_010680418.1|  PREDICTED: patatin-like protein 1                  416   2e-136   
ref|XP_008444643.1|  PREDICTED: patatin-like protein 2                  416   3e-136   
ref|XP_009410116.1|  PREDICTED: patatin-like protein 2                  416   3e-136   
ref|XP_006374974.1|  hypothetical protein POPTR_0014s03260g             414   3e-136   
emb|CDP02483.1|  unnamed protein product                                415   5e-136   
ref|XP_002301194.1|  patatin-like family protein                        414   6e-136   Populus trichocarpa [western balsam poplar]
ref|XP_006411935.1|  hypothetical protein EUTSA_v10025343mg             414   8e-136   
ref|XP_002301195.2|  hypothetical protein POPTR_0002s12980g             414   9e-136   Populus trichocarpa [western balsam poplar]
ref|XP_004499077.1|  PREDICTED: patatin-2-Kuras 3-like isoform X3       412   9e-136   
ref|XP_002262942.1|  PREDICTED: patatin-like protein 2                  413   1e-135   Vitis vinifera
ref|XP_010238242.1|  PREDICTED: patatin-like protein 2 isoform X2       413   1e-135   
ref|XP_010061771.1|  PREDICTED: patatin-like protein 2 isoform X2       412   2e-135   
ref|XP_006488152.1|  PREDICTED: patatin-05-like                         413   2e-135   
emb|CBI25858.3|  unnamed protein product                                412   2e-135   
emb|CDX69270.1|  BnaC01g01830D                                          413   2e-135   
ref|XP_009139287.1|  PREDICTED: patatin-like protein 1                  413   2e-135   
ref|XP_006338216.1|  PREDICTED: patatin-3-Kuras 1-like                  413   3e-135   
ref|NP_001062043.1|  Os08g0477100                                       413   3e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006374977.1|  hypothetical protein POPTR_0014s03280g             413   3e-135   
ref|XP_006434817.1|  hypothetical protein CICLE_v10003658mg             412   4e-135   
gb|KDP38381.1|  hypothetical protein JCGZ_04306                         411   4e-135   
ref|XP_004288052.1|  PREDICTED: patatin group A-3-like                  412   4e-135   
ref|XP_010269013.1|  PREDICTED: patatin-like protein 2 isoform X1       412   5e-135   
emb|CDY42719.1|  BnaA03g53720D                                          422   5e-135   
gb|EAZ07350.1|  hypothetical protein OsI_29600                          413   6e-135   Oryza sativa Indica Group [Indian rice]
ref|XP_006354912.1|  PREDICTED: patatin-3-Kuras 1-like                  412   6e-135   
emb|CAN62059.1|  hypothetical protein VITISV_024099                     411   7e-135   Vitis vinifera
ref|XP_009603683.1|  PREDICTED: patatin-like protein 1                  412   7e-135   
ref|XP_006374976.1|  hypothetical protein POPTR_0014s03280g             412   8e-135   
ref|NP_001190942.1|  PATATIN-like protein 5                             412   8e-135   
ref|XP_010269043.1|  PREDICTED: patatin-like protein 2 isoform X2       410   1e-134   
ref|XP_009383171.1|  PREDICTED: patatin-like protein 2                  411   1e-134   
ref|XP_010446708.1|  PREDICTED: patatin-like protein 1 isoform X1       411   1e-134   
ref|XP_011071103.1|  PREDICTED: patatin-like protein 2                  410   2e-134   
ref|XP_006339912.1|  PREDICTED: patatin-05-like                         410   2e-134   
gb|KFK32501.1|  hypothetical protein AALP_AA6G250900                    409   2e-134   
gb|EAZ07347.1|  hypothetical protein OsI_29596                          411   2e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_002282597.1|  PREDICTED: patatin-like protein 2 isoform X1       410   2e-134   Vitis vinifera
ref|XP_006374973.1|  hypothetical protein POPTR_0014s03250g             410   3e-134   
ref|XP_007047189.1|  Phospholipase A 2A, IIA,PLA2A                      409   3e-134   
ref|XP_008813724.1|  PREDICTED: patatin-like protein 2 isoform X1       410   3e-134   
emb|CAN80453.1|  hypothetical protein VITISV_028107                     409   4e-134   Vitis vinifera
ref|XP_011017228.1|  PREDICTED: patatin-like protein 2                  409   6e-134   
ref|XP_010320535.1|  PREDICTED: patatin-like protein 2                  408   7e-134   
ref|XP_006354910.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    409   7e-134   
gb|AFJ92643.2|  phospholipase A2                                        409   9e-134   
gb|EMT13605.1|  Patatin group A-3                                       408   1e-133   
ref|XP_009792908.1|  PREDICTED: patatin-like protein 1                  409   1e-133   
ref|XP_010417357.1|  PREDICTED: patatin-like protein 2                  408   2e-133   
sp|Q6ZJD3.1|PLP2_ORYSJ  RecName: Full=Patatin-like protein 2; Sho...    408   2e-133   Oryza sativa Japonica Group [Japonica rice]
gb|EMS45954.1|  Patatin group A-3                                       407   2e-133   
ref|NP_001068268.1|  Os11g0614400                                       408   3e-133   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA42306.1|  TPA: patatin T5                                        407   3e-133   
gb|EAY88437.1|  hypothetical protein OsI_09902                          407   4e-133   Oryza sativa Indica Group [Indian rice]
ref|XP_002880810.1|  hypothetical protein ARALYDRAFT_481516             407   4e-133   
ref|XP_010064191.1|  PREDICTED: patatin-like protein 2                  407   6e-133   
ref|XP_010429587.1|  PREDICTED: patatin-like protein 2                  407   6e-133   
ref|XP_002510257.1|  Patatin T5 precursor, putative                     407   6e-133   Ricinus communis
ref|XP_007017306.1|  Phospholipase A 2A, IIA,PLA2A                      407   7e-133   
emb|CDP01337.1|  unnamed protein product                                406   8e-133   
ref|XP_008241529.1|  PREDICTED: patatin-like protein 3                  405   9e-133   
gb|KDP38383.1|  hypothetical protein JCGZ_04308                         406   1e-132   
gb|EMT18762.1|  Patatin group A-3                                       405   1e-132   
ref|XP_010270650.1|  PREDICTED: patatin-like protein 2                  405   2e-132   
emb|CDX72620.1|  BnaC07g46420D                                          405   3e-132   
ref|XP_009138468.1|  PREDICTED: patatin-like protein 3                  405   3e-132   
ref|XP_007226924.1|  hypothetical protein PRUPE_ppa015844mg             405   3e-132   
dbj|BAK02816.1|  predicted protein                                      406   3e-132   
ref|XP_010101004.1|  Patatin group A-3                                  405   3e-132   
ref|NP_180224.1|  phospholipase A 2A                                    405   3e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008457871.1|  PREDICTED: patatin-like protein 3                  404   4e-132   
ref|XP_008457873.1|  PREDICTED: patatin-like protein 2                  404   5e-132   
gb|KCW66463.1|  hypothetical protein EUGRSUZ_F00261                     403   7e-132   
ref|XP_010437270.1|  PREDICTED: patatin-like protein 1 isoform X2       403   8e-132   
ref|XP_007160830.1|  hypothetical protein PHAVU_001G020100g             404   8e-132   
ref|XP_004148052.1|  PREDICTED: patatin group A-3-like                  403   9e-132   
ref|XP_007017307.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            404   9e-132   
ref|XP_006466736.1|  PREDICTED: patatin-11-like                         403   1e-131   
ref|XP_003572284.1|  PREDICTED: patatin-like protein 2                  404   1e-131   
ref|XP_010472600.1|  PREDICTED: patatin-like protein 2                  403   1e-131   
ref|XP_004973688.1|  PREDICTED: patatin-2-Kuras 1-like isoform X2       404   1e-131   
ref|XP_002869006.1|  hypothetical protein ARALYDRAFT_490916             403   1e-131   
ref|XP_010030595.1|  PREDICTED: patatin-like protein 2                  403   1e-131   
ref|XP_004973692.1|  PREDICTED: patatin-3-Kuras 1-like                  402   2e-131   
ref|XP_002449852.1|  hypothetical protein SORBIDRAFT_05g024390          402   2e-131   
gb|AAM63157.1|  similar to latex allergen from Hevea brasiliensis       402   2e-131   
emb|CDM80597.1|  unnamed protein product                                403   3e-131   
ref|XP_002451118.1|  hypothetical protein SORBIDRAFT_05g024380          402   3e-131   
ref|XP_008220195.1|  PREDICTED: patatin-like protein 2 isoform X2       402   3e-131   
ref|XP_009589750.1|  PREDICTED: patatin-like protein 2                  403   4e-131   
ref|XP_006372536.1|  hypothetical protein POPTR_0017s02540g             400   5e-131   
ref|XP_007227189.1|  hypothetical protein PRUPE_ppa019532mg             402   5e-131   
ref|XP_006419185.1|  hypothetical protein CICLE_v10030450mg             400   6e-131   
ref|NP_001151996.1|  patatin T5                                         401   8e-131   
ref|XP_004958340.1|  PREDICTED: patatin-3-Kuras 1-like                  401   9e-131   
ref|XP_010446710.1|  PREDICTED: patatin-like protein 1 isoform X3       400   9e-131   
gb|EMT30617.1|  Patatin group A-3                                       401   1e-130   
tpg|DAA42305.1|  TPA: hypothetical protein ZEAMMB73_127435              406   1e-130   
ref|XP_009366768.1|  PREDICTED: patatin-like protein 2                  400   1e-130   
gb|EEC84713.1|  hypothetical protein OsI_31673                          400   1e-130   
ref|XP_006660710.1|  PREDICTED: patatin-2-Kuras 2-like isoform X2       400   1e-130   
gb|EMS66123.1|  Patatin group A-3                                       400   1e-130   
ref|XP_010942710.1|  PREDICTED: patatin-like protein 2                  404   2e-130   
ref|XP_009138467.1|  PREDICTED: patatin-like protein 1 isoform X2       400   2e-130   
gb|AAF98369.1|AF158253_1  patatin-like protein 3                        400   2e-130   
ref|NP_001063402.2|  Os09g0462400                                       399   2e-130   
ref|XP_010235203.1|  PREDICTED: patatin-like protein 2                  400   3e-130   
ref|XP_008220192.1|  PREDICTED: patatin-like protein 2                  400   3e-130   
ref|XP_009392030.1|  PREDICTED: patatin-like protein 2                  399   3e-130   
ref|XP_004511941.1|  PREDICTED: patatin-05-like                         399   3e-130   
ref|XP_010101001.1|  Patatin group A-3                                  400   3e-130   
ref|XP_010525997.1|  PREDICTED: patatin-like protein 2                  399   4e-130   
ref|XP_004288059.1|  PREDICTED: patatin group A-3-like                  399   4e-130   
ref|XP_008664528.1|  PREDICTED: patatin-like protein 2                  399   4e-130   
gb|EYU30123.1|  hypothetical protein MIMGU_mgv1a005982mg                401   5e-130   
ref|XP_003577355.1|  PREDICTED: patatin-like protein 1                  399   5e-130   
ref|XP_006663045.1|  PREDICTED: patatin-2-Kuras 1-like                  399   6e-130   
ref|XP_004973687.1|  PREDICTED: patatin-2-Kuras 1-like isoform X1       400   7e-130   
ref|XP_010548404.1|  PREDICTED: patatin-like protein 1 isoform X1       399   7e-130   
ref|XP_003538815.1|  PREDICTED: patatin group D-2-like                  399   7e-130   
ref|XP_008797306.1|  PREDICTED: patatin-like protein 2                  399   8e-130   
ref|XP_002445638.1|  hypothetical protein SORBIDRAFT_07g023200          400   8e-130   
ref|XP_010059758.1|  PREDICTED: patatin-like protein 2                  395   8e-130   
ref|XP_010503027.1|  PREDICTED: patatin-like protein 2                  399   9e-130   
ref|XP_009785774.1|  PREDICTED: patatin-17-like                         398   1e-129   
ref|XP_008656522.1|  PREDICTED: patatin-like protein 1                  399   1e-129   
gb|KHG27256.1|  Patatin group M-3                                       398   1e-129   
ref|XP_002277318.1|  PREDICTED: patatin-like protein 1                  398   1e-129   
ref|XP_004233636.1|  PREDICTED: patatin-like protein 1                  411   1e-129   
gb|AAB08428.1|  patatin homolog                                         397   1e-129   
ref|XP_002305891.2|  hypothetical protein POPTR_0004s08270g             398   1e-129   
ref|XP_007203278.1|  hypothetical protein PRUPE_ppa025529mg             397   1e-129   
ref|XP_009797489.1|  PREDICTED: patatin-like protein 2 isoform X2       395   2e-129   
ref|XP_010269022.1|  PREDICTED: patatin-like protein 2 isoform X2       396   3e-129   
ref|XP_004233432.1|  PREDICTED: patatin-like protein 1                  398   3e-129   
ref|XP_008220193.1|  PREDICTED: patatin-like protein 2 isoform X1       397   3e-129   
ref|XP_008668146.1|  PREDICTED: patatin T5 isoform X1                   397   4e-129   
ref|XP_010089434.1|  Patatin group A-3                                  397   4e-129   
ref|XP_004167584.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    396   4e-129   
ref|XP_006601293.1|  PREDICTED: patatin-11-like                         397   5e-129   
ref|XP_008367973.1|  PREDICTED: patatin-like protein 2                  396   5e-129   
ref|XP_009773110.1|  PREDICTED: patatin-like protein 2                  397   5e-129   
ref|XP_002467750.1|  hypothetical protein SORBIDRAFT_01g033380          397   6e-129   
ref|XP_008241509.1|  PREDICTED: patatin-like protein 3                  396   6e-129   
ref|XP_010028278.1|  PREDICTED: patatin-like protein 2 isoform X1       395   7e-129   
ref|XP_004310193.1|  PREDICTED: patatin group A-3-like                  396   8e-129   
ref|XP_004288058.1|  PREDICTED: patatin group A-3-like                  395   8e-129   
dbj|BAJ98020.1|  predicted protein                                      397   8e-129   
ref|XP_009368084.1|  PREDICTED: patatin-like protein 3                  395   9e-129   
gb|KCW66471.1|  hypothetical protein EUGRSUZ_F00268                     395   1e-128   
ref|XP_007224534.1|  hypothetical protein PRUPE_ppa024261mg             395   1e-128   
ref|XP_009780403.1|  PREDICTED: patatin-like protein 2                  396   1e-128   
ref|XP_006425860.1|  hypothetical protein CICLE_v10027314mg             394   2e-128   
ref|XP_008664527.1|  PREDICTED: patatin-like protein 2                  396   2e-128   
gb|AAK18751.1|  patatin-like protein                                    395   2e-128   
gb|KFK30330.1|  hypothetical protein AALP_AA7G247800                    395   2e-128   
ref|XP_009366807.1|  PREDICTED: patatin-like protein 2                  394   2e-128   
ref|XP_009781952.1|  PREDICTED: patatin-like protein 3                  395   2e-128   
ref|XP_004957049.1|  PREDICTED: patatin-05-like                         394   2e-128   
ref|XP_010509131.1|  PREDICTED: patatin-like protein 2                  395   2e-128   
gb|AAD22169.1|AF061282_23  patatin-like protein                         395   3e-128   
emb|CAA73328.1|  patatin-like protein                                   395   3e-128   
gb|AEF30538.1|  patatin-like phospholipase 1                            395   3e-128   
ref|XP_006291236.1|  hypothetical protein CARUB_v10017367mg             394   3e-128   
ref|NP_001140826.1|  uncharacterized protein LOC100272901               395   5e-128   
ref|XP_007203506.1|  hypothetical protein PRUPE_ppa024781mg             394   5e-128   
ref|XP_004973689.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-2-Ku...    395   5e-128   
ref|XP_006388385.1|  hypothetical protein POPTR_0202s00220g             393   7e-128   
gb|ACG31156.1|  patatin T5 precursor                                    394   7e-128   
ref|NP_001151190.1|  LOC100284823                                       394   7e-128   
ref|XP_004291128.1|  PREDICTED: patatin group A-3-like                  394   7e-128   
gb|EMT28251.1|  Patatin group A-3                                       394   8e-128   
ref|XP_009589625.1|  PREDICTED: patatin-like protein 3                  393   1e-127   
ref|XP_002449853.1|  hypothetical protein SORBIDRAFT_05g024430          393   1e-127   
emb|CAN81920.1|  hypothetical protein VITISV_021802                     393   1e-127   
ref|XP_006360228.1|  PREDICTED: patatin-3-Kuras 1-like                  394   1e-127   
ref|XP_010101003.1|  Patatin group A-3                                  393   1e-127   
ref|XP_004165471.1|  PREDICTED: patatin group A-3-like                  395   1e-127   
gb|ACN25198.1|  unknown                                                 393   1e-127   
gb|KFK30329.1|  hypothetical protein AALP_AA7G247700                    393   1e-127   
ref|XP_008457869.1|  PREDICTED: patatin-like protein 2 isoform X1       392   1e-127   
ref|XP_007202145.1|  hypothetical protein PRUPE_ppa007009mg             392   2e-127   
ref|XP_006425859.1|  hypothetical protein CICLE_v10027498mg             392   2e-127   
ref|XP_006651467.1|  PREDICTED: patatin-3-Kuras 1-like                  393   2e-127   
ref|XP_003574631.1|  PREDICTED: patatin-like protein 2                  393   2e-127   
ref|XP_008670247.1|  PREDICTED: patatin-like protein 2 isoform X2       392   2e-127   
ref|XP_002880809.1|  hypothetical protein ARALYDRAFT_344337             393   2e-127   
ref|XP_009589752.1|  PREDICTED: patatin-like protein 2                  392   3e-127   
ref|XP_009133998.1|  PREDICTED: patatin-like protein 2                  392   3e-127   
ref|XP_004160046.1|  PREDICTED: patatin group A-3-like                  392   4e-127   
ref|XP_002445639.1|  hypothetical protein SORBIDRAFT_07g023210          393   4e-127   
ref|XP_007202991.1|  hypothetical protein PRUPE_ppa019010mg             392   4e-127   
gb|EAZ07346.1|  hypothetical protein OsI_29595                          392   4e-127   
ref|XP_004167585.1|  PREDICTED: patatin group A-3-like                  391   4e-127   
ref|NP_001078506.1|  patatin-related phospholipase A                    390   5e-127   
ref|XP_008457877.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    391   5e-127   
emb|CDY21469.1|  BnaC03g27280D                                          391   5e-127   
ref|XP_010547841.1|  PREDICTED: patatin-like protein 2                  391   5e-127   
gb|EMS54202.1|  Patatin group A-3                                       398   5e-127   
dbj|BAK06341.1|  predicted protein                                      392   5e-127   
ref|XP_008444642.1|  PREDICTED: patatin-like protein 2 isoform X2       392   5e-127   
ref|XP_008444641.1|  PREDICTED: patatin-like protein 2 isoform X1       391   6e-127   
ref|XP_009367484.1|  PREDICTED: patatin-like protein 2                  391   8e-127   
emb|CDP07842.1|  unnamed protein product                                391   8e-127   
ref|XP_008241523.1|  PREDICTED: patatin-like protein 3 isoform X1       390   9e-127   
ref|XP_011070718.1|  PREDICTED: patatin-like protein 2                  392   9e-127   
ref|XP_009370192.1|  PREDICTED: patatin-like protein 2                  388   1e-126   
ref|XP_006659498.1|  PREDICTED: patatin-T5-like                         391   1e-126   
ref|XP_008354710.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    392   1e-126   
ref|XP_008220196.1|  PREDICTED: patatin-like protein 2 isoform X1       390   1e-126   
gb|ABK24853.1|  unknown                                                 390   1e-126   
ref|XP_010109903.1|  Patatin group A-3                                  390   2e-126   
ref|XP_010548410.1|  PREDICTED: patatin-like protein 3 isoform X1       390   2e-126   
ref|XP_010652820.1|  PREDICTED: patatin-like protein 1                  389   2e-126   
ref|XP_004148073.1|  PREDICTED: patatin group A-3-like                  389   3e-126   
ref|XP_003561574.1|  PREDICTED: patatin-like protein 1                  390   3e-126   
ref|XP_008378197.1|  PREDICTED: patatin-like protein 2                  389   4e-126   
ref|XP_010907851.1|  PREDICTED: patatin-like protein 2                  389   4e-126   
ref|XP_009370177.1|  PREDICTED: patatin-like protein 2                  389   4e-126   
ref|NP_195422.3|  PATATIN-like protein 4                                390   5e-126   
ref|XP_004152795.1|  PREDICTED: patatin group A-3-like                  389   5e-126   
emb|CDP01335.1|  unnamed protein product                                390   5e-126   
emb|CAN71554.1|  hypothetical protein VITISV_034739                     393   5e-126   
ref|XP_004291132.1|  PREDICTED: patatin group A-3-like                  389   6e-126   
ref|XP_002460354.1|  hypothetical protein SORBIDRAFT_02g026818          387   7e-126   
ref|XP_010680489.1|  PREDICTED: patatin-like protein 1                  388   8e-126   
ref|XP_006425839.1|  hypothetical protein CICLE_v10025791mg             388   1e-125   
ref|XP_008393826.1|  PREDICTED: patatin-like protein 2                  388   1e-125   
ref|XP_003574632.1|  PREDICTED: patatin-like protein 2                  387   2e-125   
ref|NP_001062042.1|  Os08g0476900                                       388   2e-125   
gb|EMS46263.1|  Patatin group A-3                                       387   2e-125   
ref|XP_004511942.1|  PREDICTED: patatin-05-like                         387   3e-125   
ref|XP_008670246.1|  PREDICTED: patatin-like protein 2 isoform X1       387   3e-125   
ref|XP_007047219.1|  Acyl transferase/acyl hydrolase/lysophosphol...    387   5e-125   
ref|XP_006425840.1|  hypothetical protein CICLE_v10025791mg             385   7e-125   
ref|XP_010269002.1|  PREDICTED: patatin-like protein 2 isoform X2       384   7e-125   
ref|XP_006360248.1|  PREDICTED: patatin-05-like                         386   8e-125   
ref|XP_008357460.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    392   9e-125   
emb|CDP01333.1|  unnamed protein product                                385   1e-124   
emb|CDX83197.1|  BnaA03g23090D                                          385   1e-124   
ref|XP_010514711.1|  PREDICTED: patatin-like protein 2                  385   1e-124   
sp|B8AQW7.1|PLP1_ORYSI  RecName: Full=Patatin-like protein 1            385   1e-124   
ref|XP_008457886.1|  PREDICTED: patatin-like protein 2                  385   1e-124   
ref|XP_009589751.1|  PREDICTED: patatin-like protein 1                  385   2e-124   
gb|EMT12540.1|  Patatin group A-3                                       384   2e-124   
ref|XP_010446706.1|  PREDICTED: patatin-like protein 3                  386   2e-124   
ref|XP_008378189.1|  PREDICTED: patatin-like protein 2                  384   2e-124   
ref|XP_004288050.1|  PREDICTED: patatin group A-3-like                  385   2e-124   
emb|CDY42720.1|  BnaA03g53730D                                          385   2e-124   
ref|XP_009349524.1|  PREDICTED: patatin-like protein 2                  385   2e-124   
gb|EMT32376.1|  Patatin group A-3                                       384   3e-124   
ref|XP_004234672.1|  PREDICTED: patatin-like protein 3 isoform X2       384   3e-124   
ref|XP_009370196.1|  PREDICTED: patatin-like protein 2                  384   3e-124   
ref|XP_002510255.1|  Patatin precursor, putative                        384   4e-124   
ref|XP_008241848.1|  PREDICTED: patatin-like protein 2                  383   4e-124   
ref|XP_006448680.1|  hypothetical protein CICLE_v10015510mg             384   4e-124   
ref|XP_006365363.1|  PREDICTED: patatin group M-2-like                  384   5e-124   
ref|XP_004962815.1|  PREDICTED: patatin-T5-like                         385   5e-124   
ref|XP_006285080.1|  hypothetical protein CARUB_v10006413mg             385   5e-124   
ref|XP_004232051.1|  PREDICTED: patatin-like protein 3                  384   7e-124   
ref|XP_003544453.1|  PREDICTED: patatin-05                              384   7e-124   
ref|XP_008339923.1|  PREDICTED: patatin-like protein 1 isoform X1       382   7e-124   
ref|XP_007227369.1|  hypothetical protein PRUPE_ppa026872mg             383   1e-123   
gb|KFK40701.1|  hypothetical protein AALP_AA2G030000                    382   1e-123   
ref|XP_010939456.1|  PREDICTED: patatin-like protein 2 isoform X1       383   1e-123   
ref|XP_008220198.1|  PREDICTED: patatin-like protein 2                  383   1e-123   
ref|XP_002510259.1|  Patatin T5 precursor, putative                     382   2e-123   
ref|XP_006411934.1|  hypothetical protein EUTSA_v10025319mg             382   2e-123   
ref|XP_010446707.1|  PREDICTED: patatin-like protein 3                  383   2e-123   
ref|XP_009605254.1|  PREDICTED: patatin-2-Kuras 1-like                  381   2e-123   
ref|NP_001050287.1|  Os03g0393900                                       383   2e-123   
tpg|DAA48470.1|  TPA: hypothetical protein ZEAMMB73_976536              383   3e-123   
ref|XP_003544451.1|  PREDICTED: patatin-05-like                         382   3e-123   
ref|XP_009366942.1|  PREDICTED: patatin-like protein 1 isoform X1       380   3e-123   
gb|AGS13487.1|  PLP protein                                             380   3e-123   
ref|XP_008393824.1|  PREDICTED: patatin-like protein 2                  379   4e-123   
ref|XP_004233945.1|  PREDICTED: patatin-like protein 2                  382   4e-123   
ref|XP_010028281.1|  PREDICTED: patatin-like protein 2                  381   4e-123   
ref|XP_002510260.1|  Patatin T5 precursor, putative                     381   5e-123   
ref|XP_009780402.1|  PREDICTED: patatin-like protein 2                  381   5e-123   
emb|CDP02475.1|  unnamed protein product                                381   6e-123   
ref|XP_010061769.1|  PREDICTED: patatin-like protein 2                  380   7e-123   
ref|XP_002523558.1|  Patatin precursor, putative                        380   7e-123   
ref|XP_002523557.1|  Patatin class 1 precursor, putative                380   7e-123   
ref|XP_004979723.1|  PREDICTED: uncharacterized protein LOC101762...    392   8e-123   
ref|XP_010548405.1|  PREDICTED: patatin-like protein 1 isoform X2       380   8e-123   
gb|KHN42072.1|  Patatin group A-3                                       382   9e-123   
emb|CDP11077.1|  unnamed protein product                                380   1e-122   
gb|EPS59074.1|  hypothetical protein M569_15736                         378   1e-122   
emb|CBI21441.3|  unnamed protein product                                393   2e-122   
tpg|DAA40258.1|  TPA: hypothetical protein ZEAMMB73_846494              379   2e-122   
ref|XP_002523555.1|  Patatin precursor, putative                        379   2e-122   
gb|EAZ06806.1|  hypothetical protein OsI_29050                          380   2e-122   
ref|XP_010094388.1|  Patatin group A-3                                  379   3e-122   
ref|XP_009799856.1|  PREDICTED: patatin-like protein 2                  379   4e-122   
ref|XP_010028265.1|  PREDICTED: patatin-like protein 3                  377   4e-122   
gb|EMS48649.1|  Patatin group A-3                                       383   5e-122   
tpg|DAA48471.1|  TPA: patatin class 1                                   379   6e-122   
ref|NP_001149326.1|  patatin class 1                                    379   8e-122   
ref|XP_004148466.1|  PREDICTED: patatin group A-3-like                  377   9e-122   



>emb|CBI19549.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   473 bits (1216),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 245/379 (65%), Positives = 294/379 (78%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDG GIRGIIPATILA LE+QLQELDG   RI DYFDVIAGTSTGGLVTAMLTA
Sbjct  17    LVTILSIDGRGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTGGLVTAMLTA  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+  KRPLFAAKDI PFY EHGPKIFP   G+FG I      + GP YDGKYLH +++E+
Sbjct  77    PNDEKRPLFAAKDIKPFYLEHGPKIFPHRRGIFGWIMNIFRSIVGPNYDGKYLHNLIKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG TRLHQTLT VVIPTFDIK+ QP +F++ E + SP LD  L+DICIGSSAAPTYFPA+
Sbjct  137   LGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADICIGSSAAPTYFPAY  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             +F+N+D +G   E NLIDGGV ANNP LVAIS VT+++  K +PDF    PMD  RF V+
Sbjct  197   FFKNQDKEGKARELNLIDGGVAANNPALVAISQVTKQVFDK-NPDFLPIKPMDYGRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS K  QKY AKMAA WG++GWL H    PL+DVF+ AS+DMVDFHI+ +F +L +
Sbjct  256   SIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQASADMVDFHISVVFQALHS  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G  A+VDVTT+ENL  L ++G+ LLKK VS+++L TG   P +  GT
Sbjct  316   EDNYLRIQDDTLHGTNATVDVTTKENLGNLVKIGERLLKKPVSRVNLETGLSVPVENCGT  375

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEALKRFAK+LS+ ++ R
Sbjct  376   NEEALKRFAKLLSDEKRLR  394



>ref|XP_002282366.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=411

 Score =   461 bits (1187),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 254/388 (65%), Positives = 300/388 (77%), Gaps = 4/388 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIPATILA LE+QLQELDG   RI DYFDVIAGTSTGGLVTAMLTA
Sbjct  22    LVTILSIDGGGIRGIIPATILALLESQLQELDGDDARIADYFDVIAGTSTGGLVTAMLTA  81

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD  KRPLFAAK+I+PFY EHGPKIFPQ  G+FG I   +  L GPKYDGKYL ++ +E+
Sbjct  82    PDDQKRPLFAAKEIMPFYLEHGPKIFPQTRGIFGWIMSIVRSLIGPKYDGKYLKRITKEK  141

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG TRLH+TLT VVIPTFDIK+ QP +F+  E + SP LD  L+DICIGSSAAPTYFP H
Sbjct  142   LGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAPTYFPGH  201

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+N+D +G T EFNLIDGGV ANNP LVAIS VT+++  K +PDF    PMD  RF V+
Sbjct  202   YFKNQDKEGKTQEFNLIDGGVAANNPALVAISQVTKQVFDK-NPDFFPIKPMDFGRFLVI  260

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS K  QKY AKMA+ WG++GWL H    PL+DVF  AS+DMVDFHI+ +F +L +
Sbjct  261   SIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQALHS  320

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G  ASVDV TEENL  L ++G+ LLKK VS+++L TG  +P +  GT
Sbjct  321   EDNYLRIQDDTLRGKDASVDVATEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENGGT  380

Query  1154  NEEALKRFAKVLSEN---RKNRLKNEAK  1228
             NEEALKRFAK+LS+    R+ RL N  K
Sbjct  381   NEEALKRFAKLLSDEKRLRETRLPNPKK  408



>emb|CBI19560.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   464 bits (1193),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 258/405 (64%), Positives = 307/405 (76%), Gaps = 9/405 (2%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIPATILA LE+QLQELDG   RI DYFDVIAGTSTGGLVTAMLTA
Sbjct  48    LVTILSIDGGGIRGIIPATILALLESQLQELDGDDARIADYFDVIAGTSTGGLVTAMLTA  107

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD  KRPLFAAK+I+PFY EHGPKIFPQ  G+FG I   +  L GPKYDGKYL ++ +E+
Sbjct  108   PDDQKRPLFAAKEIMPFYLEHGPKIFPQTRGIFGWIMSIVRSLIGPKYDGKYLKRITKEK  167

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG TRLH+TLT VVIPTFDIK+ QP +F+  E + SP LD  L+DICIGSSAAPTYFP H
Sbjct  168   LGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAPTYFPGH  227

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+N+D +G T EFNLIDGGV ANNP LVAIS VT+++  K +PDF    PMD  RF V+
Sbjct  228   YFKNQDKEGKTQEFNLIDGGVAANNPALVAISQVTKQVFDK-NPDFFPIKPMDFGRFLVI  286

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS K  QKY AKMA+ WG++GWL H    PL+DVF  AS+DMVDFHI+ +F +L +
Sbjct  287   SIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQALHS  346

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G  ASVDV TEENL  L ++G+ LLKK VS+++L TG  +P +  GT
Sbjct  347   EDNYLRIQDDTLRGKDASVDVATEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENGGT  406

Query  1154  NEEALKRFAKVLSEN---RKNRLKNEAKLSKL*NVKYSIQFFSYC  1279
             NEEALKRFAK+LS+    R+ RL N  K     ++K +I    YC
Sbjct  407   NEEALKRFAKLLSDEKRLRETRLPNPKK-----DLKSNISLNKYC  446



>emb|CBI19558.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   459 bits (1182),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 255/408 (63%), Positives = 307/408 (75%), Gaps = 4/408 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIPATILA LE+QLQ +DG   RI DYFDVIAGTSTGGLVTAMLTA
Sbjct  17    LVTILSIDGGGIRGIIPATILALLESQLQAVDGDDARIADYFDVIAGTSTGGLVTAMLTA  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD  KRPLFAAK+I+PFY EHGPKIFP+  G+FG I   +  L GPKYDGKYL ++++E+
Sbjct  77    PDDQKRPLFAAKEIMPFYLEHGPKIFPETRGIFGWIMSIVRSLIGPKYDGKYLKRIIKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG TRLH+TLT VVIPTFDIK+ QP +F+  E + SP LD  L+DICIGSSAAPTYFP H
Sbjct  137   LGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAPTYFPGH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+N+D +G T EFNLIDGGV ANNP LVAI+ VT+++  K +PDF    PMD  RF V+
Sbjct  197   YFKNQDKEGKTQEFNLIDGGVAANNPALVAITQVTKQVFDK-NPDFFPIKPMDFGRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS K  QKY AKMA+ WG++GWL H    PL+DVF  AS+DMVDFHI+ +F +L +
Sbjct  256   SIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQALHS  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G  ASVDVTTEENL  L ++G+ LLKK VS+++L TG  +P +  GT
Sbjct  316   EDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENGGT  375

Query  1154  NEEALKRFAKVLSEN---RKNRLKNEAKLSKL*NVKYSIQFFSYCCWL  1288
             NEEALKRFAK+LS+    R+ RL N  K  K  +V    +     C L
Sbjct  376   NEEALKRFAKLLSDEKRLRETRLPNPKKDLKYLDVTIGPKSLLIACIL  423



>emb|CAN68798.1| hypothetical protein VITISV_008805 [Vitis vinifera]
Length=400

 Score =   458 bits (1179),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 252/388 (65%), Positives = 299/388 (77%), Gaps = 4/388 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIPATILA LE+QLQ LDG   RI DYFDVIAGTSTGGLVTAMLTA
Sbjct  11    LVTILSIDGGGIRGIIPATILALLESQLQXLDGDDARIADYFDVIAGTSTGGLVTAMLTA  70

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD  KRPLFAAK+I+PFY EHGPKIFP+  G+FG I   +  L GPKYDGKYL ++ +E+
Sbjct  71    PDDQKRPLFAAKEIMPFYLEHGPKIFPZTRGIFGWIMSIVRSLIGPKYDGKYLKRITKEK  130

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG TRLH+TLT VVIPTFDIK+ QP +F+  E + SP LD  L+DICIGSSAAPTYFP H
Sbjct  131   LGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAPTYFPGH  190

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+N+D +G T EFNLIDGGV ANNP LVAIS VT+++  K +PDF    PMD  RF V+
Sbjct  191   YFKNQDKEGKTQEFNLIDGGVAANNPALVAISQVTKQVFDK-NPDFFPIKPMDFGRFLVI  249

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS K  QKY AKMA+ WG++GWL H    PL+DVF  AS+DMVDFHI+ +F +L +
Sbjct  250   SIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQALHS  309

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G  ASVDV TEENL  L ++G+ LLKK VS+++L TG  +P +  GT
Sbjct  310   EDNYLRIQDDTLRGKDASVDVATEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENGGT  369

Query  1154  NEEALKRFAKVLSEN---RKNRLKNEAK  1228
             NEEALKRFAK+LS+    R+ RL N  K
Sbjct  370   NEEALKRFAKLLSDEKRLRETRLPNPKK  397



>ref|XP_003589236.1| Patatin-like protein [Medicago truncatula]
 gb|AES59487.1| patatin-like phospholipase [Medicago truncatula]
Length=417

 Score =   459 bits (1180),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 231/381 (61%), Positives = 293/381 (77%), Gaps = 3/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRG+IPA I+ FLE+ LQELDG+  R+ DYFDVI+GTSTGGLVTAML A
Sbjct  20    LVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTGGLVTAMLAA  79

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQgggl-fgsikggLALLEGPKYDGKYLHKVVEE  430
             PDKN RPLFAAKDI PFY EH PKIFPQ  GL    +   +  L GPKYDGKYLH+VV E
Sbjct  80    PDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGATLLAKVMRSLGGPKYDGKYLHQVVRE  139

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LGD RLH+TLT +V+PTFDIK  QP++F++ + + SP LD KLSDICI +SAAPTY PA
Sbjct  140   KLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQLKRSPCLDAKLSDICISTSAAPTYLPA  199

Query  611   HYFENRDGK-GNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             H F N+D + G   EFNLIDGGVCANNP LVA++ VT+++  +  PDF    P++  RF 
Sbjct  200   HNFTNKDDEAGKEEEFNLIDGGVCANNPALVAMNEVTKQIINQ-SPDFFPIKPLEYGRFL  258

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             ++S+GTG++K  +K+TA+MAA WG++ WLT S  NPLIDVF+ +S DMVDFH++ +  +L
Sbjct  259   IISIGTGTAKNEEKFTAQMAAKWGLLDWLTQSGSNPLIDVFTQSSGDMVDFHLSAVTQAL  318

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + DNYLRIQ D+L G  +SVD+ TEENLKKL ++G+NLLKK VS+++L  G ++P    
Sbjct  319   HSADNYLRIQDDTLTGIDSSVDIATEENLKKLCQIGENLLKKPVSRVNLENGHFEPLTNG  378

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TNEEALKR AK+LS+ R+ R
Sbjct  379   ETNEEALKRLAKILSQERRLR  399



>ref|XP_010664933.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score =   458 bits (1179),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 238/380 (63%), Positives = 294/380 (77%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP T+L FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT 
Sbjct  17    LITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTSTGGLVTAMLTT  76

Query  254   PDKNK-RPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             P++N  RPLF+AKDI  FY +H PKIFPQ  G+FG I      + GP YDGKYLH +++E
Sbjct  77    PNENTGRPLFSAKDIKDFYLDHCPKIFPQHRGIFGWIMNIFRSIVGPNYDGKYLHNLIKE  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LG TRLHQTLT VVIPTFDIK+ QP +F++ E + SP LD  L+DICIGSSAAPTYFPA
Sbjct  137   KLGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADICIGSSAAPTYFPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             ++F+N+D +G   E NLIDGGV ANNP LVAIS VT+++  K +PDF    PMD  RF V
Sbjct  197   YFFKNQDKEGKARELNLIDGGVAANNPALVAISQVTKQVFDK-NPDFLPIKPMDYGRFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGS K  QKY AKMAA WG++GWL H    PL+DVF+ AS+DMVDFHI+ +F +L 
Sbjct  256   ISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQASADMVDFHISVVFQALH  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + DNYLRIQ D+L G  A+VDVTT+ENL  L ++G+ LLKK VS+++L TG   P +  G
Sbjct  316   SEDNYLRIQDDTLHGTNATVDVTTKENLGNLVKIGERLLKKPVSRVNLETGLSVPVENCG  375

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEEALKRFAK+LS+ ++ R
Sbjct  376   TNEEALKRFAKLLSDEKRLR  395



>ref|XP_004499075.1| PREDICTED: patatin-2-Kuras 3-like isoform X1 [Cicer arietinum]
Length=418

 Score =   458 bits (1179),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 231/380 (61%), Positives = 295/380 (78%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRG+IPATI+ FLE+QLQELDG+  R+ DYFDVI+GTSTGGLVTAM+ A
Sbjct  20    LVTILSIDGGGIRGLIPATIIEFLESQLQELDGEDARLADYFDVISGTSTGGLVTAMIAA  79

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLAL-LEGPKYDGKYLHKVVEE  430
             PDKN RPLFAAKDI PFY EH PKIFPQ  GL G +   +   L GPKYDGKYLH V+ E
Sbjct  80    PDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGGIMLAKVVRSLGGPKYDGKYLHDVIRE  139

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LGD RLH+T+T +VIPTFDIK+ QP++F++ + E SP LD KLSDICI +SAAPTY PA
Sbjct  140   KLGDIRLHETITNIVIPTFDIKSLQPIIFSSYQLEKSPCLDAKLSDICISTSAAPTYLPA  199

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             + F N+D   +  EFNLIDGGVCANNP LVA++ VT+++  +  PDF    P++  RF +
Sbjct  200   YNFTNKDPNNHEEEFNLIDGGVCANNPALVAMNEVTKQIINQ-SPDFFPIKPLEYGRFLI  258

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTG++K  +K++A +AA WG++GWLT+S  NPLIDVF+ +S DMVDFH++ +  +L 
Sbjct  259   ISLGTGTAKNEEKFSADIAAKWGLLGWLTNSGSNPLIDVFTQSSGDMVDFHLSCVTQALH  318

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + DNYLRIQ D+L GDV+SVD+ TEENL+KL E+G  LLKK VS+++L  G ++P     
Sbjct  319   SQDNYLRIQDDTLTGDVSSVDIATEENLEKLCEIGDKLLKKPVSRVNLENGHFEPVIDGE  378

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNE+ALKR AK LS+ R+ R
Sbjct  379   TNEQALKRLAKTLSQERRLR  398



>ref|XP_006354909.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=408

 Score =   457 bits (1176),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 232/397 (58%), Positives = 296/397 (75%), Gaps = 4/397 (1%)
 Frame = +2

Query  29    SQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVI  208
             S  S E+    N  KFITILSIDGGGIRG+IPATIL +LE+QLQELDG+  R+ DYFD+I
Sbjct  3     SSGSLELQPPING-KFITILSIDGGGIRGLIPATILEYLESQLQELDGEDARLADYFDII  61

Query  209   AGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikgg-LALLE  385
              GTSTGGLVTAMLTAP+K+ RPLFAAKDI PFY EHGPKIFPQ   +           L 
Sbjct  62    TGTSTGGLVTAMLTAPNKDNRPLFAAKDIKPFYLEHGPKIFPQNNMILIGSIIKGWTFLT  121

Query  386   GPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLS  565
             GPKY+GKYLH+V++E+LG+T+LH+TLT VVIPTFDIKN QP +F+  EA+    ++ KLS
Sbjct  122   GPKYNGKYLHQVIKEKLGETKLHETLTNVVIPTFDIKNIQPTIFSTFEAKKHSIMNAKLS  181

Query  566   DICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDD-  742
             DICIG+SAAPTY PAH F+ ++  G   EFNLIDG + ANNPT +AIS VT+++  ++  
Sbjct  182   DICIGTSAAPTYLPAHNFQTQNEDGKFHEFNLIDGAIAANNPTFIAISEVTKQICEQNPY  241

Query  743   -PDFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDA  919
               +F    P +  +F V+S+GTGS+K   KY AK+A+NWGI GWLT    NP+ID F+DA
Sbjct  242   FKNFDEMTPTNYGKFLVISIGTGSAKLEHKYDAKIASNWGIFGWLTGGGSNPIIDAFADA  301

Query  920   SSDMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksv  1099
             S DMVD+HI+ +F S+ +   YLRIQ D+L G  +SVD++T+EN+ KL E+G NLLKK V
Sbjct  302   SDDMVDYHISVVFQSISSQKQYLRIQDDTLSGADSSVDISTKENMDKLVEIGTNLLKKPV  361

Query  1100  skldllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             S+++L TG ++  D  GTNEEALKRFAK+LSE ++ R
Sbjct  362   SRVNLKTGLFEQLDTGGTNEEALKRFAKLLSEEKRIR  398



>ref|XP_007136666.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
 gb|ESW08660.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
Length=408

 Score =   456 bits (1174),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 233/394 (59%), Positives = 297/394 (75%), Gaps = 1/394 (0%)
 Frame = +2

Query  29    SQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVI  208
             S+SS            +TILSIDGGGIR IIPATILAFLEAQLQELDG+  R+ DYFDVI
Sbjct  4     SKSSLLQIQPPTYGNLVTILSIDGGGIRAIIPATILAFLEAQLQELDGEDARLADYFDVI  63

Query  209   AGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEG  388
             AGTSTGGLVTAML+AP+ ++RPLFAAKDI PFY +H PKIFPQ   ++G I+  L  L G
Sbjct  64    AGTSTGGLVTAMLSAPNDHQRPLFAAKDIRPFYLDHSPKIFPQRSSIWGWIQKLLRSLGG  123

Query  389   PKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSD  568
             PKYD KYL  VV E+LG+TRLH+TLT +VIPTFDIK  QP++F++ + + SP LD  LSD
Sbjct  124   PKYDAKYLQGVVREKLGETRLHETLTNIVIPTFDIKTLQPIIFSSYQIKRSPYLDAPLSD  183

Query  569   ICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPD  748
             ICI +SAAPTY P ++F+N D +G   EFNLIDGGVCANNP+LVAI+ VT+++   D+PD
Sbjct  184   ICISTSAAPTYLPPYHFKNSDSEGTMHEFNLIDGGVCANNPSLVAINQVTKQII-NDNPD  242

Query  749   FAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSD  928
             F    PM+  RF V+SLGTG+ K   K+ AKMAA WG+  WLT+S   PLIDV + +S+D
Sbjct  243   FFSIKPMEYGRFLVISLGTGTPKNEHKFNAKMAAKWGLFDWLTNSGSTPLIDVLTHSSAD  302

Query  929   MVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskl  1108
             MVDFH+AT+  +L + +NYLRIQ D+L G  AS+D+ T+EN++KL ++G  LLKK VS++
Sbjct  303   MVDFHLATVTQALHSKNNYLRIQDDTLTGVDASLDIATKENMEKLSQIGDRLLKKPVSQI  362

Query  1109  dllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             +L TG ++P     TNE+AL+RFAK+LS+ R  R
Sbjct  363   NLETGLFEPMGDGETNEDALRRFAKMLSDERSFR  396



>ref|XP_003589238.1| Patatin-like protein [Medicago truncatula]
 gb|AES59489.1| patatin-like phospholipase [Medicago truncatula]
Length=415

 Score =   454 bits (1167),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 231/381 (61%), Positives = 292/381 (77%), Gaps = 5/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRG+IPA I+ FLE+ LQELDG+  R+ DYFDVI+GTSTGGLVTAML A
Sbjct  20    LVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTGGLVTAMLAA  79

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQgggl-fgsikggLALLEGPKYDGKYLHKVVEE  430
             PDKN RPLFAAKDI PFY EH PKIFPQ  GL    +   +  L GPKYDGKYLH+VV E
Sbjct  80    PDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGATLLAKVMRSLGGPKYDGKYLHQVVRE  139

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LGD RLH+TLT +V+PTFDIK  QP++F++ +   SP LD KLSDICI +SAAPTY PA
Sbjct  140   KLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQR--SPCLDAKLSDICISTSAAPTYLPA  197

Query  611   HYFENRDGK-GNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             H F N+D + G   EFNLIDGGVCANNP LVA++ VT+++  +  PDF    P++  RF 
Sbjct  198   HNFTNKDDEAGKEEEFNLIDGGVCANNPALVAMNEVTKQIINQ-SPDFFPIKPLEYGRFL  256

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             ++S+GTG++K  +K+TA+MAA WG++ WLT S  NPLIDVF+ +S DMVDFH++ +  +L
Sbjct  257   IISIGTGTAKNEEKFTAQMAAKWGLLDWLTQSGSNPLIDVFTQSSGDMVDFHLSAVTQAL  316

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + DNYLRIQ D+L G  +SVD+ TEENLKKL ++G+NLLKK VS+++L  G ++P    
Sbjct  317   HSADNYLRIQDDTLTGIDSSVDIATEENLKKLCQIGENLLKKPVSRVNLENGHFEPLTNG  376

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TNEEALKR AK+LS+ R+ R
Sbjct  377   ETNEEALKRLAKILSQERRLR  397



>ref|XP_002310732.1| patatin family protein [Populus trichocarpa]
 gb|EEE91182.1| patatin family protein [Populus trichocarpa]
Length=407

 Score =   453 bits (1165),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 226/383 (59%), Positives = 292/383 (76%), Gaps = 1/383 (0%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             ITILSIDGGGIRGI+P  ILA+LEAQLQ LDG+  RI DYFDVI+GTSTGGL+TAML AP
Sbjct  19    ITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGGLITAMLAAP  78

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             ++ +RPLF AKDI+PFY  + PKIFPQ  G+F         + GPKYDGKYLHK+V + L
Sbjct  79    NEQQRPLFDAKDIVPFYLNNSPKIFPQTSGIFAWPTNVWKAISGPKYDGKYLHKLVRDIL  138

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
              DTRLHQTLT VVIPTFDIK  QP++F++ +  ++P  D  LSDICI +SAAPTYFP HY
Sbjct  139   KDTRLHQTLTNVVIPTFDIKKIQPVIFSSYQVPNNPIKDALLSDICIATSAAPTYFPPHY  198

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             F+N+D +GN  EFNLIDGG+ ANNPTLVAIS V ++M++K +PDF    PM+ +R+ V+S
Sbjct  199   FKNQDAQGNFEEFNLIDGGIAANNPTLVAISEVAKQMSKK-NPDFFPIKPMNYERYLVIS  257

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             +GTG++K    Y+AK A+ WG+IGWL H+   PLI  +++ASSDMVD+H + +F +  + 
Sbjct  258   IGTGANKNGTTYSAKAASEWGVIGWLFHNGRTPLITCYNNASSDMVDYHNSVVFQAFHSE  317

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             + YLRI  D L+GD++SVD+ T ENL+ L +VG++LLK  VS+++L TG Y+P +  GT 
Sbjct  318   NYYLRIDEDKLQGDLSSVDIATTENLENLVKVGEDLLKSPVSRINLDTGAYEPLEDGGTY  377

Query  1157  EEALKRFAKVLSENRKNRLKNEA  1225
             EEAL+RFAK+LSE RK R  N A
Sbjct  378   EEALQRFAKLLSEERKLRQSNSA  400



>ref|XP_011008336.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
 ref|XP_011015438.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score =   452 bits (1164),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 226/383 (59%), Positives = 294/383 (77%), Gaps = 1/383 (0%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             ITILSIDGGGIRGI+P  ILA+LEAQLQ LDG+  RI DYFDVI+GTSTGGL+TAML AP
Sbjct  19    ITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGGLITAMLAAP  78

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             ++ +RPLF AKDI+PFY  + PKIFPQ  G+F   K     + GPKYDGKYLHK+V + L
Sbjct  79    NEQQRPLFEAKDIVPFYLNNSPKIFPQTSGMFAWPKNVWKAISGPKYDGKYLHKLVRDIL  138

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
              DTRL QTLT VVIPTFDIK  QP++F++ +  +SP  D  LSDICI +SAAPTYFP HY
Sbjct  139   KDTRLQQTLTNVVIPTFDIKKIQPVIFSSYQVPNSPITDALLSDICIATSAAPTYFPPHY  198

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             F+N+D +GN  EFNLIDGG+ ANNPTLVAIS V+++M++K +PDF    P + +R+ V+S
Sbjct  199   FKNQDAQGNFEEFNLIDGGIAANNPTLVAISEVSKQMSKK-NPDFFPIKPTNYERYLVIS  257

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             +GTG+++    Y+AK+A+ WG+IGWL H+   PLI  +++ASSDMVD+H + +F +  + 
Sbjct  258   IGTGANRNGTTYSAKVASEWGVIGWLFHNGRTPLITCYNNASSDMVDYHNSVVFQAFHSE  317

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             + YLRI  D L+GD+ SVD+ T+ENL+ L +VG++LLK  VS+++L TG Y+P +  GTN
Sbjct  318   NYYLRIDEDKLQGDLYSVDIATKENLENLVKVGEDLLKSPVSRINLDTGGYEPVEDGGTN  377

Query  1157  EEALKRFAKVLSENRKNRLKNEA  1225
             EEAL+RFAK+LSE RK R  N A
Sbjct  378   EEALQRFAKLLSEERKLRQSNSA  400



>gb|AFK35290.1| unknown [Medicago truncatula]
Length=417

 Score =   452 bits (1163),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 227/381 (60%), Positives = 289/381 (76%), Gaps = 3/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRG+IPA I+ FLE+ LQELDG+  R+ DYFDVI+GTSTGGLVTAML A
Sbjct  20    LVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTGGLVTAMLAA  79

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQgg-glfgsikggLALLEGPKYDGKYLHKVVEE  430
             PDKN RPLFAAKDI PF  EH PKIFPQ        +   +  L GPKYDGKYLH+VV E
Sbjct  80    PDKNNRPLFAAKDIKPFCLEHCPKIFPQHRGLSATLLAKVMRSLGGPKYDGKYLHQVVRE  139

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LGD RLH+TLT +V+PTFDIK  QP++F++ + + SP LD KLSDI I +SAAPTY PA
Sbjct  140   KLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQLKRSPCLDAKLSDIRISTSAAPTYLPA  199

Query  611   HYFENRDGK-GNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             H F N+D + G   EFNLIDGGVCANNP LVA++ VT+++  +  PDF    P++  RF 
Sbjct  200   HNFTNKDDEAGKEEEFNLIDGGVCANNPALVAMNEVTKQIINQ-SPDFFPIKPLEYGRFL  258

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             ++S+GTG++K  +K+TA+MAA WG++ WLT S  NPLIDVF+ +S DMVDFH++ +  +L
Sbjct  259   IISIGTGAAKNEEKFTAQMAAKWGLLDWLTQSGSNPLIDVFTQSSGDMVDFHLSAVTQAL  318

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + DNYLRIQ D+L G  +SVD+ TEENLKKL ++G+NLLKK VS+++L  G ++P    
Sbjct  319   HSADNYLRIQDDTLTGIDSSVDIATEENLKKLYQIGENLLKKPVSRVNLENGHFEPLTNG  378

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TNEEALKR AK+LS+ R+ R
Sbjct  379   ETNEEALKRLAKILSQERRLR  399



>gb|KCW78409.1| hypothetical protein EUGRSUZ_D02575, partial [Eucalyptus grandis]
Length=399

 Score =   449 bits (1156),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 229/396 (58%), Positives = 289/396 (73%), Gaps = 3/396 (1%)
 Frame = +2

Query  26    LSQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDV  205
             + ++S  +    N    +TILSIDGGGIRGI+PATIL+FLE++LQ+LDGK  R+ DYFDV
Sbjct  1     MEETSISLRPPTNGN-LVTILSIDGGGIRGIVPATILSFLESELQKLDGKDARLADYFDV  59

Query  206   IAGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLE  385
             IAGTSTGGL+TAMLT+P++  RP+FAAKDI  FY E+GPKIFPQ           +  L 
Sbjct  60    IAGTSTGGLLTAMLTSPNEKNRPMFAAKDIEDFYLENGPKIFPQDSCPLAPFTKMMKTLT  119

Query  386   GPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLS  565
              P+YDGKYLH +V E+L DTRLHQTLT VVIPTFDIK  QP +F+  + ++ P +D  LS
Sbjct  120   RPRYDGKYLHSLVREKLRDTRLHQTLTHVVIPTFDIKRLQPTIFSTYQVKNKPSIDALLS  179

Query  566   DICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDP  745
             DICI +SAAPTY P HYF+  D  G   EFNLIDGGV ANNPTLVA+S VT+ ++R+  P
Sbjct  180   DICIATSAAPTYLPPHYFKTIDHSGAVREFNLIDGGVAANNPTLVAVSEVTEDISRR-SP  238

Query  746   DFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASS  925
             DF    PMD  RF V+SLGTGS K  + YTA  AANWGIIGWL      PL++VF+ AS+
Sbjct  239   DFFPIKPMDYGRFLVISLGTGSPKSEEGYTAHEAANWGIIGWLMSGGSTPLVNVFTQASA  298

Query  926   DMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvsk  1105
             DMVD H++ +F +L + ++YLRIQ D L G V+SVD+ T++N+  L +VG+ LLKK VS 
Sbjct  299   DMVDLHLSVVFQALHSRNSYLRIQDDRLSGLVSSVDIATKKNMNDLIKVGERLLKKPVSS  358

Query  1106  ldllTGQYKPDDARGTNEEALKRFAKVLSENRKNRL  1213
             ++L TG  +P + R TNEEALKRFAK+LSE +K RL
Sbjct  359   VNLDTGTLEPLN-RDTNEEALKRFAKLLSEEKKLRL  393



>ref|XP_009769117.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=410

 Score =   450 bits (1157),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 241/380 (63%), Positives = 292/380 (77%), Gaps = 1/380 (0%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K ITILSIDGGGIRGIIPATIL +LE+QLQELDG+  R+ DYFD+IAGTSTGGLVTAMLT
Sbjct  20    KLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAMLT  79

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             APDK+KRPLFAAKDI PFY EHGPKIFPQ   +FGSI   L  L GPKY+GKYLH+V+EE
Sbjct  80    APDKDKRPLFAAKDIKPFYLEHGPKIFPQKKMVFGSIVKTLKSLIGPKYNGKYLHQVIEE  139

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LG+T LH+TLT VVIPTFDIKN QP +F+  EA   P +D KLSDICI +SAAPTY PA
Sbjct  140   KLGETLLHETLTNVVIPTFDIKNLQPTIFSTFEARVKPLMDAKLSDICISTSAAPTYLPA  199

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF  +D  GN  EFNL+DGGV ANNP LVA S VT R     +PDF    P+D  RF V
Sbjct  200   HYFRTQDKDGNFHEFNLVDGGVAANNPALVATSQVT-RQIMTGNPDFFPIKPIDYGRFLV  258

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGS+K  QKY AK+A+ WGI+GWL +    P++DVF+ AS DMVD HI+ +F +L 
Sbjct  259   ISIGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDLHISVVFQALH  318

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + +NYLRIQ D+L G  +SVD++T+EN+ KL E+G+ LLKK VS+++L TG  +     G
Sbjct  319   SEENYLRIQDDTLTGTDSSVDISTKENMDKLVEIGKTLLKKPVSRVNLQTGLSEQSKNDG  378

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEE LKRFA +LSE ++ R
Sbjct  379   TNEETLKRFAMLLSEEKRLR  398



>ref|XP_003544452.1| PREDICTED: patatin-3-Kuras 1-like [Glycine max]
 gb|KHN46308.1| Patatin group A-3 [Glycine soja]
Length=408

 Score =   449 bits (1156),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 242/395 (61%), Positives = 307/395 (78%), Gaps = 2/395 (1%)
 Frame = +2

Query  29    SQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVI  208
             ++SS E          +TILSIDGGGIRGIIPATI+ FLE+QLQELDG + R+ DYFDVI
Sbjct  4     AESSIEQIQPPTYGNLVTILSIDGGGIRGIIPATIIGFLESQLQELDGPEARLADYFDVI  63

Query  209   AGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLAL-LE  385
             +GTSTGGLVTAM+TAPD N RPLFAAKDI PFY +H PKIFPQ  GL G+I   +   L 
Sbjct  64    SGTSTGGLVTAMITAPDNNNRPLFAAKDIKPFYMDHCPKIFPQHSGLGGTILAKMIRSLG  123

Query  386   GPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLS  565
             GPKYDGKYLH+VV+E+LGD RLH+TLT VVIPTFDIK+ QP++F++ + + SP +D KLS
Sbjct  124   GPKYDGKYLHEVVKEKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYKLKISPCMDAKLS  183

Query  566   DICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDP  745
             DICI +SAAPTY PAH F N+D KGN  EFNLIDGGVCANNPTLVA++ VT+++  + +P
Sbjct  184   DICISTSAAPTYLPAHNFNNQDSKGNVHEFNLIDGGVCANNPTLVAMNEVTKQIIMQ-NP  242

Query  746   DFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASS  925
             DF    PM+  RF ++S+GTG++K  +K+ A+MAA WG++ WLT S  NPLIDVFS +SS
Sbjct  243   DFFPIKPMEYGRFLIISIGTGTAKNEEKFNAQMAAKWGLLDWLTQSGSNPLIDVFSQSSS  302

Query  926   DMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvsk  1105
             DMVDFH++ +  +L + DNYLRIQ D+L G  +SVD+ T+ENL+KL  VG+ LLKK VS+
Sbjct  303   DMVDFHLSAVTQALHSEDNYLRIQDDTLTGTDSSVDIATKENLEKLCHVGEKLLKKPVSR  362

Query  1106  ldllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             ++L  G ++P   R TNE+ALKRFAK+LS+ R+ R
Sbjct  363   INLENGLFEPLKNRETNEDALKRFAKILSQERRLR  397



>ref|XP_002282432.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19556.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   449 bits (1156),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 245/379 (65%), Positives = 297/379 (78%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIPATILA LE +LQELDG   RI DYFDVIAGTSTGG+VTAMLTA
Sbjct  17    LVTILSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTGGIVTAMLTA  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD  KRPLFAAKDI PFY EHGPKIFPQ  G+FG I   L  + GPKYDGKYL ++++E+
Sbjct  77    PDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGKYLKRLIKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG TRLH+TLT VVIPTFDIK+ QP +F+  E + SP LD  L+DICIGSSAAPTYFPA+
Sbjct  137   LGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAPTYFPAY  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             +F+N+D +G T EF+LIDGGV ANNP LVAI+ VT+++  + +PDF    PMD  RF V+
Sbjct  197   FFKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDR-NPDFFPIKPMDFGRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS K  QKY AKMA+ WG++GWL H    PL+DVF  AS+DMVDFHI+ +F +L +
Sbjct  256   SIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQALHS  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G  ASVDVTTEENL  L ++G+ LLKK VS+++L TG  +P +  GT
Sbjct  316   EDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENGGT  375

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEALKRFA +LS+ ++ R
Sbjct  376   NEEALKRFATLLSDEKRLR  394



>ref|XP_010054916.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=412

 Score =   449 bits (1156),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 227/380 (60%), Positives = 283/380 (74%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGI+PATIL+FLE++LQ+LDGK  R+ DYFDVIAGTSTGGL+TAMLT+
Sbjct  16    LVTILSIDGGGIRGIVPATILSFLESELQKLDGKDARLADYFDVIAGTSTGGLLTAMLTS  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RP+FAAKDI  FY E+GPKIFPQ           +  L  P+YDGKYLH +V E+
Sbjct  76    PNEKNRPMFAAKDIEDFYLENGPKIFPQDSCPLAPFTKMMKTLTRPRYDGKYLHSLVREK  135

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             L DTRLHQTLT VVIPTFDIK  QP +F+  + ++ P +D  LSDICI +SAAPTY P H
Sbjct  136   LRDTRLHQTLTHVVIPTFDIKRLQPTIFSTYQVKNKPSIDALLSDICIATSAAPTYLPPH  195

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+  D  G   EFNLIDGGV ANNPTLVA+S VT+ ++R+  PDF    PMD  RF V+
Sbjct  196   YFKTIDHSGAVREFNLIDGGVAANNPTLVAVSEVTEDISRR-SPDFFPIKPMDYGRFLVI  254

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS K  + YTA  AANWGIIGWL      PL++VF+ AS+DMVD H++ +F +L +
Sbjct  255   SLGTGSPKSEEGYTAHEAANWGIIGWLMSGGSTPLVNVFTQASADMVDLHLSVVFQALHS  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              ++YLRIQ D L G V+SVD+ T++N+  L +VG+ LLKK VS ++L TG  +P + R T
Sbjct  315   RNSYLRIQDDRLSGLVSSVDIATKKNMNDLIKVGERLLKKPVSSVNLDTGTLEPLN-RDT  373

Query  1154  NEEALKRFAKVLSENRKNRL  1213
             NEEALKRFAK+LSE +K RL
Sbjct  374   NEEALKRFAKLLSEEKKLRL  393



>ref|XP_010926367.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=402

 Score =   449 bits (1155),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 229/388 (59%), Positives = 287/388 (74%), Gaps = 4/388 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K +TILSIDGGG+RGIIP TIL FLEA+LQELDG   RI DYFD+IAGTSTGGLVT MLT
Sbjct  17    KVVTILSIDGGGVRGIIPGTILEFLEAKLQELDGPDARIADYFDIIAGTSTGGLVTTMLT  76

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             AP+K+ RPLF+AKDI+ FY E+ PKIFPQ  GL          + GPKYDGK+LH  V+E
Sbjct  77    APNKDNRPLFSAKDIIQFYLENCPKIFPQRTGLLAGALNLFGAVSGPKYDGKFLHSKVKE  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LGDT+LHQTLT +VIP FDIK  QP++F+  E +  P  D  LSDICI +SAAPTY PA
Sbjct  137   LLGDTKLHQTLTNIVIPAFDIKLLQPVIFSTFETKTDPSKDALLSDICISTSAAPTYLPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE +D +G T  FNL+DGGV ANNP L+A S +T+++   ++ DF+   P D  +F V
Sbjct  197   HYFETKDSQGKTRSFNLVDGGVAANNPMLIATSQITKQIFWNNE-DFSKFKPTDFAKFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS K  QK+TA  +A WG++GWL +    P+ID+FS +S+DMVD H + +F +L 
Sbjct  256   VSLGTGSPKQEQKFTAPESAKWGLLGWLQNKGSTPIIDIFSQSSADMVDIHASILFQALR  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             +  NYLRIQ D+LEGD ASVDV+T ENL+KL +VGQ+LLKK VS+++L TG  +  D  G
Sbjct  316   SEKNYLRIQDDTLEGDTASVDVSTSENLRKLVQVGQDLLKKPVSRVNLETGVSEACDVEG  375

Query  1151  TNEEALKRFAKVLSENRKNRLKNEAKLS  1234
             TNE+AL RFAK+LS  RK+R    AK+S
Sbjct  376   TNEDALIRFAKMLSNERKSR---NAKMS  400



>ref|XP_009797488.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=409

 Score =   449 bits (1155),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 227/382 (59%), Positives = 286/382 (75%), Gaps = 3/382 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
             FITILSIDGGGIRG+IP TIL + E+QLQ LDG+  R+ DYFDVIAGTSTGGLVTAMLTA
Sbjct  21    FITILSIDGGGIRGLIPGTILEYFESQLQALDGEDARLADYFDVIAGTSTGGLVTAMLTA  80

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+K+KRPLFAAKDI PFY EHGP+IFPQ    +  I      + GPKY GKYLHKV++E+
Sbjct  81    PNKDKRPLFAAKDIKPFYLEHGPRIFPQNTFNWFGIGTMWKSVTGPKYGGKYLHKVIKEK  140

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+T LH+TLT VVIP FDIKN QP +F+  EA ++P +D KLSDICI +SAAPTY PAH
Sbjct  141   LGETHLHETLTNVVIPAFDIKNMQPTIFSTYEAMENPLMDAKLSDICISTSAAPTYLPAH  200

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              F+ +D  G   EFNLIDG + ANNPTL+A S VT+++   ++ DF    P D  RF V+
Sbjct  201   QFQTQDKDGKVQEFNLIDGAIAANNPTLIATSEVTKQI-YAENKDFFPIKPSDHGRFLVI  259

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  QK+ AKMAA WG++GWLT    NP+IDVF+    DMVD++ +  F +L +
Sbjct  260   SIGTGSAKLEQKFNAKMAAKWGLLGWLTKGGSNPIIDVFTQGGDDMVDYYNSVAFQALRS  319

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D+YLRIQ D+L G  +SVD+ T+EN+ KL E+G+NLLKK VS+++L  G ++P +  GT
Sbjct  320   QDHYLRIQDDTLSGIDSSVDIATKENMAKLVEIGENLLKKPVSRINLKKGIFEPHETGGT  379

Query  1154  NEEALKRFAKVLSENRKNRLKN  1219
             NEE LKRFA  LSE +  RL+N
Sbjct  380   NEETLKRFATKLSEEK--RLRN  399



>ref|XP_010064136.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=428

 Score =   450 bits (1157),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 234/404 (58%), Positives = 289/404 (72%), Gaps = 2/404 (0%)
 Frame = +2

Query  2     GIRGGKQTLSQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKV  181
             G  G +   S  +  +      +  IT+LSIDGGGIRG+IP T+L FLE++LQ+LDGK  
Sbjct  15    GTTGLRANKSDQASALKQEQERKHLITVLSIDGGGIRGLIPGTVLNFLESELQKLDGKDA  74

Query  182   RICDYFDVIAGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsi  361
             RI DYFDVI+GTSTGGLVTAMLT PD N RP+FAAKDI  FY  H PKIFPQ    F  +
Sbjct  75    RIVDYFDVISGTSTGGLVTAMLTTPDGNNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKPV  134

Query  362   kggLALLEGPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDS  541
                +  + GPKYDGKYLH VV E LGD RLHQTLT +VIPTFDIK+ QP +F++ + +  
Sbjct  135   TKIIKAVAGPKYDGKYLHDVVREELGDKRLHQTLTNIVIPTFDIKSLQPTIFSSYQVKKD  194

Query  542   PQLDVKLSDICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQ  721
             P +D  LSDICI +SAAPTY PAH FE +D  G   EFNLIDGGV ANNPTLVA+  VT+
Sbjct  195   PSVDALLSDICISTSAAPTYLPAHKFETKDFTGKVREFNLIDGGVAANNPTLVAMGEVTK  254

Query  722   RMARKDDPDFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLI  901
              +      DF    PMD +RF V+SLGTG+SK   KYTA  AA WG++GWLT S G+PLI
Sbjct  255   TIM-GGSSDFFAIKPMDYRRFLVISLGTGTSKVEGKYTAHEAAKWGVLGWLT-SGGSPLI  312

Query  902   DVFSDASSDMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQN  1081
             DVFS AS+DMVDFH++ +F +L+  DNYLRIQ D+L G ++SVDV T++NL  L + G+ 
Sbjct  313   DVFSQASADMVDFHLSAVFQALNLQDNYLRIQDDTLSGVLSSVDVATKKNLNDLVKTGEA  372

Query  1082  llkksvskldllTGQYKPDDARGTNEEALKRFAKVLSENRKNRL  1213
             LLKK VS+++L +G   P   + TNEEALKRFAK+LS+ R+ RL
Sbjct  373   LLKKPVSRVNLESGVCDPTSNQETNEEALKRFAKLLSQERQLRL  416



>gb|KCW88897.1| hypothetical protein EUGRSUZ_A01223, partial [Eucalyptus grandis]
Length=404

 Score =   448 bits (1153),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 226/379 (60%), Positives = 283/379 (75%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
             FITILSIDGGGIRGI+PATIL+FLE++LQ+LDGK  R+ DYFDVIAGTSTGGL+TAMLT+
Sbjct  16    FITILSIDGGGIRGIVPATILSFLESELQKLDGKDARLADYFDVIAGTSTGGLLTAMLTS  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RP+FAA+DI  FY ++GPKIFPQ       +   +  L GPKYDG YLH +V E+
Sbjct  76    PNEKNRPMFAAEDIKDFYLQNGPKIFPQDSCPLAPVAKMMKTLTGPKYDGNYLHSLVREK  135

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD RLHQTLT VVIPTFDIK  QP +F+    ++ P +D  LSDICI +SAAPTYFPAH
Sbjct  136   LGDIRLHQTLTHVVIPTFDIKRLQPTIFSTYRVKNKPSIDALLSDICIATSAAPTYFPAH  195

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+  D  G   EFNLIDGGV ANNPTLVAIS VT+ +  K  PDF    PMD  RF V+
Sbjct  196   YFKTEDHSGAVREFNLIDGGVAANNPTLVAISEVTKEII-KGSPDFFPIKPMDYGRFLVI  254

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS+K  ++Y A  AA WGIIGWLT     PL++V + A++DMVD H++ +F +L +
Sbjct  255   SLGTGSAKSEERYDAHEAAKWGIIGWLTSGGSTPLVNVVNQATADMVDLHLSVVFQALHS  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
             G +YLRIQ D L G  +SVDV T++N+  L +VG+ LLKK VS+++L TG ++P +   T
Sbjct  315   GKSYLRIQDDKLSGLTSSVDVATKKNMNDLVKVGEGLLKKLVSRVNLDTGIFEPLNQE-T  373

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEALKRFAK+LSE ++ R
Sbjct  374   NEEALKRFAKLLSEEKRLR  392



>emb|CDP01332.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   449 bits (1154),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 223/379 (59%), Positives = 282/379 (74%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP  IL +LE+QLQELDG+  R+ DYFDVIAGTSTGGL+T+ML A
Sbjct  19    LITILSIDGGGIRGLIPGVILEYLESQLQELDGEDARLADYFDVIAGTSTGGLITSMLAA  78

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+NKRPLFAAKDI PFY E+GPKIFPQ  G   S++  L  + GPKYDG+YLH+VV E+
Sbjct  79    PDENKRPLFAAKDIKPFYLENGPKIFPQKWGRLASVRSALKAVFGPKYDGRYLHQVVREK  138

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+ RLH+TLT +V+PTFDIKN  P +F+  EA++   +D +LSD+CI +SAAPTY PA+
Sbjct  139   LGEIRLHETLTNIVVPTFDIKNLHPTIFSTYEAKEKKSMDARLSDLCISTSAAPTYLPAY  198

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+N D  GN  EFNLIDGGV ANNP LVAI  VT+++ R  +PDF    P D  RF V+
Sbjct  199   YFQNHDELGNVQEFNLIDGGVAANNPALVAIGQVTKQIFR-GNPDFFPIKPTDYGRFLVI  257

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  ++Y A  AA WG+ GWL      PL+DVF+ AS+DMVD H++ +F +L +
Sbjct  258   SIGTGSAKVEERYNAAKAAKWGVFGWLISGHSTPLVDVFTQASADMVDLHLSEVFQALHS  317

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G V+SVD+ T++NL  L   G  LLKK VS+++   G  +     GT
Sbjct  318   EDNYLRIQDDTLIGTVSSVDIATKKNLDNLVITGTQLLKKPVSRVNQQNGAVETIANGGT  377

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEALKRFA++LSE R+ R
Sbjct  378   NEEALKRFARLLSEERRLR  396



>ref|XP_010068219.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=412

 Score =   448 bits (1153),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 226/379 (60%), Positives = 284/379 (75%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
             FITILSIDGGGIRGI+PATIL+FLE++LQ+LDGK  R+ DYFDVIAGTSTGGL+TAMLT+
Sbjct  16    FITILSIDGGGIRGIVPATILSFLESELQKLDGKDARLADYFDVIAGTSTGGLLTAMLTS  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RP+FAA+DI  FY ++GPKIFPQ       +   +  L GPKYDG YLH +V E+
Sbjct  76    PNEKNRPMFAAEDIKDFYLQNGPKIFPQDSCPLAPVAKMMKTLTGPKYDGNYLHSLVREK  135

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD RLHQTLT VVIPTFDIK  QP +F+    ++ P +D  LSDICI +SAAPTYFPAH
Sbjct  136   LGDIRLHQTLTHVVIPTFDIKRLQPTIFSTYRVKNKPSIDALLSDICIATSAAPTYFPAH  195

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+  D  G   EFNLIDGGV ANNPTLVAIS VT+ +  K  PDF    PMD  RF V+
Sbjct  196   YFKTEDHSGAVREFNLIDGGVAANNPTLVAISEVTKEII-KGSPDFFPIKPMDYGRFLVI  254

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS+K  ++Y A  AA WGIIGWLT     PL++V + A++DMVD H++ +F +L +
Sbjct  255   SLGTGSAKSEERYDAHEAAKWGIIGWLTSGGSTPLVNVVNQATADMVDLHLSVVFQALHS  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
             G +YLRIQ D L G  +SVDV T++N+  L +VG+ LLKK VS+++L TG ++P + + T
Sbjct  315   GKSYLRIQDDKLSGLTSSVDVATKKNMNDLVKVGEGLLKKLVSRVNLDTGIFEPLN-QET  373

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEALKRFAK+LSE ++ R
Sbjct  374   NEEALKRFAKLLSEEKRLR  392



>ref|XP_002282415.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=406

 Score =   447 bits (1151),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 244/379 (64%), Positives = 296/379 (78%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TI SIDGGGIRGIIPATILA LE +LQELDG   RI DYFDVIAGTSTGG+VTAMLTA
Sbjct  17    LVTIFSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTGGIVTAMLTA  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD  KRPLFAAKDI PFY EHGPKIFPQ  G+FG I   L  + GPKYDGKYL ++++E+
Sbjct  77    PDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGKYLKRLIKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG TRLH+TLT VVIPTFDIK+ QP +F+  E + SP LD  L+DICIGSSAAPTYFPA+
Sbjct  137   LGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAPTYFPAY  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             +F+N+D +G T EF+LIDGGV ANNP LVAI+ VT+++  + +PDF    PMD  RF V+
Sbjct  197   FFKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDR-NPDFFPIKPMDFGRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS K  QKY AKMA+ WG++GWL H    PL+DVF  AS+DMVDFHI+ +F +L +
Sbjct  256   SIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQALHS  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G  ASVDVTTEENL  L ++G+ LLKK VS+++L TG  +P +  GT
Sbjct  316   EDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENGGT  375

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEALKRFA +LS+ ++ R
Sbjct  376   NEEALKRFATLLSDEKRLR  394



>ref|XP_010068174.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW88861.1| hypothetical protein EUGRSUZ_A01188 [Eucalyptus grandis]
Length=412

 Score =   447 bits (1151),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 227/379 (60%), Positives = 283/379 (75%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
             FITILSIDGGGIRGI+PATIL+FLE++LQ+LDGK  R+ DYFDVIAGTST GL+TAMLT+
Sbjct  16    FITILSIDGGGIRGIVPATILSFLESELQKLDGKDARLADYFDVIAGTSTAGLLTAMLTS  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RP+FAAKDI  FY + GPKIFPQ       I   +  L GPKYDG YLH +V E+
Sbjct  76    PNEKNRPMFAAKDIKDFYLQDGPKIFPQDSCPLAPIAKMMKTLTGPKYDGNYLHSLVREK  135

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD RLHQTLT VVIPTFDIK  QP +F+  + ++ P +D  LSDICI +SAAPTYFPAH
Sbjct  136   LGDIRLHQTLTHVVIPTFDIKRLQPTIFSTFQVKNKPSIDALLSDICIATSAAPTYFPAH  195

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+  D  G   EFNLIDGGV ANNPTLVAIS VTQ +  K  PDF    PMD +RF V+
Sbjct  196   YFKTEDHSGAVREFNLIDGGVAANNPTLVAISEVTQEII-KGRPDFFPIKPMDYERFLVI  254

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS+K  ++Y A  AA WGIIGWLT     PL++V   A++DMVD H++ +F +L +
Sbjct  255   SLGTGSAKSEERYDAHEAAKWGIIGWLTSGGSTPLVNVVFQATADMVDLHLSVVFQALHS  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
             G +YLRIQ D L G  +S+DV T++N+  L +VG+ LLKK VS+++L TG ++P + + T
Sbjct  315   GKSYLRIQDDKLSGLTSSMDVATKKNMNDLVKVGEGLLKKPVSRVNLDTGIFEPLN-QET  373

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEALKRFAK+LSE ++ R
Sbjct  374   NEEALKRFAKLLSEEKRLR  392



>ref|XP_010664934.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score =   447 bits (1151),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 243/380 (64%), Positives = 292/380 (77%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIPATILA LE+QLQELDG   RI DYFDVIAGTSTGGLVTAMLTA
Sbjct  17    LVTILSIDGGGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTGGLVTAMLTA  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggL-ALLEGPKYDGKYLHKVVEE  430
             P+  KRPLFAAKDI PFY +HGPKIFPQ           +   + GP YDGKYLH +++E
Sbjct  77    PNDEKRPLFAAKDIKPFYLKHGPKIFPQRRWGIFGWIMNIFRSIVGPNYDGKYLHNLIKE  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LG TRLHQTLT VVIPTFDIK+ QP +F++ E + SP LD  L+DICIGSSAAPTYFPA
Sbjct  137   KLGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADICIGSSAAPTYFPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             ++F+N+D +G   E NLIDGGV ANNP LVAIS VT+++  K+ PDF    PMD  RF V
Sbjct  197   YFFKNQDKEGKARELNLIDGGVAANNPALVAISQVTKQVFDKN-PDFLPIKPMDYGRFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGS K  QKY AKMAA WG++GWL H    PL+DVF+ AS+DMVDFHI+ +F +L 
Sbjct  256   ISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQASADMVDFHISVVFQALH  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + DNYLRIQ D+L G  ASVDVTT+ENL  L ++G+ LLKK VS+++L TG   P +  G
Sbjct  316   SEDNYLRIQDDTLHGTDASVDVTTKENLGNLVKIGERLLKKPVSRVNLETGLSVPVENCG  375

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEEALKRFAK+LS+ ++ R
Sbjct  376   TNEEALKRFAKLLSDEKRLR  395



>ref|XP_002282440.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19555.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   447 bits (1150),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 246/379 (65%), Positives = 294/379 (78%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIPATILA LE+ LQELDG   RI DYFDVIAGTSTGGLV AMLTA
Sbjct  17    LVTILSIDGGGIRGIIPATILACLESHLQELDGDDARIADYFDVIAGTSTGGLVAAMLTA  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD  KRPLFAAKDI PFY EHGPKIFPQ  G+FG I   L  + GPKYDGKYL  +++E+
Sbjct  77    PDDQKRPLFAAKDIRPFYLEHGPKIFPQIRGIFGWIMSILRSIVGPKYDGKYLKSLIKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG T LH+TLT VVIPTFDIK+ QP +F+  E + SP LD  L+DICIGSSAAPTYFPA+
Sbjct  137   LGGTWLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPSLDAPLADICIGSSAAPTYFPAY  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+N+D +G T EF+LIDGGV ANNP LVAI+ VT+++  + +PDF     MD  RF V+
Sbjct  197   YFKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDR-NPDFFPIKYMDFGRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS K  QKY AKMAA WG++GWL H    PL+DVF  AS+DMVDFHI+ +F +L +
Sbjct  256   SIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQALHS  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G  ASVDVTTEENL  L ++G+ LLKK VS+++L TG  +P +  GT
Sbjct  316   EDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENGGT  375

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEALKRFAK+LS+ ++ R
Sbjct  376   NEEALKRFAKLLSDEKRLR  394



>ref|XP_011007290.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/383 (58%), Positives = 292/383 (76%), Gaps = 1/383 (0%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             ITILSIDGGGIRGI+P  ILA+LEAQLQ LDG+  RI DYFDVI+GTSTGGL+TAML AP
Sbjct  19    ITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGGLITAMLAAP  78

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             ++ +RPLF AKDI+PFY  + PKIFPQ  G+F   K     + GPKYDGKYLHK+V + L
Sbjct  79    NEQQRPLFEAKDIVPFYLNNSPKIFPQTSGMFAWPKNVWKAISGPKYDGKYLHKLVRDIL  138

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
              DTRL QTLT VVIPTFDIK  QP++F++ +  +SP  D  LSDICI +SAAPTYFP HY
Sbjct  139   KDTRLQQTLTNVVIPTFDIKKIQPVIFSSYQVPNSPITDALLSDICIATSAAPTYFPPHY  198

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             F+N+D +GN  EFNLIDGG+ ANNPTLVAIS V+++M++K +PDF    P + +R+ V+S
Sbjct  199   FKNQDAQGNFEEFNLIDGGIAANNPTLVAISEVSKQMSKK-NPDFFPIKPTNYERYLVIS  257

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             +GTG+++    Y+AK+A+ WG+IGWL H+   PLI  +++ASSDMVD+H + +F +  + 
Sbjct  258   IGTGANRNGTTYSAKVASEWGVIGWLFHNGRTPLITCYNNASSDMVDYHNSVVFQAFHSE  317

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             + YLRI  D L+GD+ SVD+ T+ENL+ L +VG++LLK  VS+++L TG Y+P +   T 
Sbjct  318   NYYLRIDEDKLQGDLYSVDIATKENLENLVKVGEDLLKSPVSRINLDTGGYEPVEDGVTY  377

Query  1157  EEALKRFAKVLSENRKNRLKNEA  1225
             EEAL+RFAK+LSE RK R  N A
Sbjct  378   EEALQRFAKLLSEERKLRQSNSA  400



>ref|XP_004499076.1| PREDICTED: patatin-2-Kuras 3-like isoform X2 [Cicer arietinum]
Length=386

 Score =   445 bits (1145),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 225/368 (61%), Positives = 287/368 (78%), Gaps = 2/368 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRG+IPATI+ FLE+QLQELDG+  R+ DYFDVI+GTSTGGLVTAM+ A
Sbjct  20    LVTILSIDGGGIRGLIPATIIEFLESQLQELDGEDARLADYFDVISGTSTGGLVTAMIAA  79

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLAL-LEGPKYDGKYLHKVVEE  430
             PDKN RPLFAAKDI PFY EH PKIFPQ  GL G +   +   L GPKYDGKYLH V+ E
Sbjct  80    PDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGGIMLAKVVRSLGGPKYDGKYLHDVIRE  139

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LGD RLH+T+T +VIPTFDIK+ QP++F++ + E SP LD KLSDICI +SAAPTY PA
Sbjct  140   KLGDIRLHETITNIVIPTFDIKSLQPIIFSSYQLEKSPCLDAKLSDICISTSAAPTYLPA  199

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             + F N+D   +  EFNLIDGGVCANNP LVA++ VT+++  +  PDF    P++  RF +
Sbjct  200   YNFTNKDPNNHEEEFNLIDGGVCANNPALVAMNEVTKQIINQ-SPDFFPIKPLEYGRFLI  258

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTG++K  +K++A +AA WG++GWLT+S  NPLIDVF+ +S DMVDFH++ +  +L 
Sbjct  259   ISLGTGTAKNEEKFSADIAAKWGLLGWLTNSGSNPLIDVFTQSSGDMVDFHLSCVTQALH  318

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + DNYLRIQ D+L GDV+SVD+ TEENL+KL E+G  LLKK VS+++L  G ++P     
Sbjct  319   SQDNYLRIQDDTLTGDVSSVDIATEENLEKLCEIGDKLLKKPVSRVNLENGHFEPVIDGE  378

Query  1151  TNEEALKR  1174
             TNE+ALKR
Sbjct  379   TNEQALKR  386



>ref|XP_003527713.1| PREDICTED: patatin-like [Glycine max]
 gb|KHN22305.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   446 bits (1146),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 237/379 (63%), Positives = 303/379 (80%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIPATILAFLEAQLQELDG+  R+ DYFDVIAGTSTGG+VTAML+A
Sbjct  19    LVTILSIDGGGIRGIIPATILAFLEAQLQELDGEDARLADYFDVIAGTSTGGIVTAMLSA  78

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+ N+RPLFAAKDI PFY EH PKIFPQ  GL+GS+   L  L GPKYDGKYL +VV E+
Sbjct  79    PNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSVGKLLGSLGGPKYDGKYLKEVVREK  138

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG TRLH+TLT +VIPTFDIK  QP++F++ + + SP LD +LSDICI +SAAPTY PA+
Sbjct  139   LGQTRLHETLTNIVIPTFDIKTLQPIIFSSYQIKRSPCLDARLSDICISTSAAPTYLPAY  198

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             +F+N+D +GNT EFNLIDGGVCANNPTLVA++ VT+++   ++PDF    PM+  RF ++
Sbjct  199   HFKNQDSQGNTHEFNLIDGGVCANNPTLVAMNQVTKQII-NENPDFFSIKPMEYGRFLII  257

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+ K  QK+ A+MAA WG++ WLT+S   PLIDVF+ +S+DMVDFH+AT+  +L +
Sbjct  258   SLGTGTPKNEQKFNAQMAAKWGLLDWLTNSGSTPLIDVFTQSSADMVDFHLATVTQALHS  317

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              +NYLRIQ D+L G  +SVD+ T+ENL+KL ++G+ LLKK VS+++L  G ++      T
Sbjct  318   ENNYLRIQDDTLTGTDSSVDIATKENLEKLSQIGERLLKKPVSQINLEDGLFESVGNGET  377

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NE ALKRFAK+LS+ R+ R
Sbjct  378   NENALKRFAKILSQERRLR  396



>ref|XP_009797490.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=412

 Score =   445 bits (1145),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 237/382 (62%), Positives = 292/382 (76%), Gaps = 3/382 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K ITILSIDGGGIRGIIPATIL +LE+QLQELDG+  R+ DYFD+IAGTSTGGLVTAMLT
Sbjct  20    KLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAMLT  79

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfg--sikggLALLEGPKYDGKYLHKVV  424
             AP K+KRPLFAAKDI PFY EHGPKIFPQ   +    S+   L  L GPKY+GKYLH+V+
Sbjct  80    APHKDKRPLFAAKDIKPFYLEHGPKIFPQKKSMILFGSVMKTLKSLMGPKYNGKYLHQVI  139

Query  425   EERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYF  604
             EE+LG+T+LH+TLT VVIPTFDIKN QP VF+  EA + P +D KLSDIC  +SAAPTY 
Sbjct  140   EEKLGETQLHETLTNVVIPTFDIKNLQPKVFSTFEAREKPLMDAKLSDICASTSAAPTYL  199

Query  605   PAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRF  784
             PAHYF+ +D  GN  EFNL+DGGV ANNP LVA S VTQ++    +PDF    P+D  RF
Sbjct  200   PAHYFQTQDKDGNFHEFNLVDGGVAANNPALVATSQVTQQIMT-GNPDFFPIKPIDYGRF  258

Query  785   RVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHS  964
              V+S+GTGS+K  QKY AK+A+ WGI+GWL +    P++DVF+ AS DMVD HI+ +F +
Sbjct  259   LVISIGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDLHISVVFQA  318

Query  965   LDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDA  1144
             L + +NYLRIQ D+L G  +SVD+ T+EN+ KL E+G+ LLKK VS+++L TG  +    
Sbjct  319   LHSEENYLRIQDDTLTGTNSSVDIATKENMNKLVEIGKTLLKKPVSRVNLQTGLSEQCKN  378

Query  1145  RGTNEEALKRFAKVLSENRKNR  1210
              GTNEE LKRF K+LSE ++ R
Sbjct  379   GGTNEETLKRFVKLLSEEKRLR  400



>ref|XP_010059972.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66467.1| hypothetical protein EUGRSUZ_F00264 [Eucalyptus grandis]
Length=409

 Score =   445 bits (1144),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 231/379 (61%), Positives = 282/379 (74%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP TILAFLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT+
Sbjct  17    LITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTS  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+N RPLFAAKDI  FY ++ PKIFPQ    F      +  + GPKYDGKYLHK+V+E+
Sbjct  77    PDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLHKLVQEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+ RLHQTLT VVIPTFDIK+ QP +F++ E +  P ++  LSDICI +SAAPTY PAH
Sbjct  137   LGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDICISTSAAPTYLPAH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D  G   EFNLIDGGV ANNPT VA+  VT+ +      DF    PMD +RF V+
Sbjct  197   YFETQDSTGKIREFNLIDGGVAANNPTFVAMGEVTKEIMGGSS-DFFPIKPMDYRRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS K   KY A+ AA WG++GWL+ + G+PL+DVF  AS+DMVDFH++ +F +L  
Sbjct  256   SLGTGSQKVEGKYDAREAAKWGVLGWLSSNGGSPLVDVFMQASADMVDFHLSAVFQALHL  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L G VASVD+ T++NL  L + G+ LLKK VSK+DL TGQY       T
Sbjct  316   EANYLRIQDDTLSGSVASVDIATKKNLNDLVKTGEALLKKPVSKVDLETGQYDACKLE-T  374

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL+RFAK+LS  R+ R
Sbjct  375   NEEALRRFAKLLSNERQLR  393



>ref|XP_009612649.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=413

 Score =   445 bits (1145),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 230/383 (60%), Positives = 285/383 (74%), Gaps = 5/383 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP TIL FLE+QLQ LDG   R+ DYFDVIAGTSTGGLVTAML A
Sbjct  21    LITILSIDGGGIRGLIPGTILEFLESQLQALDGVDARLADYFDVIAGTSTGGLVTAMLAA  80

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQgggl---fgsikggLALLEGPKYDGKYLHKVV  424
             P+K+KRPLFAAKDI PFY EHGP+IFPQ        G+I     L  GPKY GKYLHKV+
Sbjct  81    PNKDKRPLFAAKDIKPFYLEHGPRIFPQNTMNWFGIGTITNMWKLATGPKYAGKYLHKVI  140

Query  425   EERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYF  604
             +E+LG T LH+TLT VVIPTFDIKN QP +F++ EA  +P +D KLSDICI +SAAPTY 
Sbjct  141   KEKLGGTHLHETLTNVVIPTFDIKNMQPTIFSSYEARKNPLMDAKLSDICISTSAAPTYL  200

Query  605   PAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRF  784
             PAH F+ +D  GN  EFNLIDG + ANNPTL+A S VT+++   ++PDF    P D  RF
Sbjct  201   PAHQFQTQDRDGNFHEFNLIDGAIAANNPTLIATSEVTKQI-YAENPDFFPIKPSDHGRF  259

Query  785   RVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHS  964
              V+S+GTGS+K   K+ AKMAA WGI+GWLT+   NP+IDVF+    DMVD++I+  F +
Sbjct  260   LVISIGTGSAKLEHKFNAKMAAKWGILGWLTNGGSNPIIDVFTQGGDDMVDYYISVAFQA  319

Query  965   LDAG-DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDD  1141
             L +  D+YLRIQ D+L G  +SVD+ T+EN+ KL E+G+ LLKK VS+++L  G ++P +
Sbjct  320   LRSDEDHYLRIQDDTLSGTDSSVDIATKENMAKLVEIGETLLKKPVSRINLKKGIFEPHE  379

Query  1142  ARGTNEEALKRFAKVLSENRKNR  1210
               GTNEE LKRFA  LSE ++ R
Sbjct  380   IGGTNEETLKRFATKLSEEKRLR  402



>ref|XP_010059970.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW66464.1| hypothetical protein EUGRSUZ_F00262 [Eucalyptus grandis]
Length=406

 Score =   445 bits (1144),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 231/380 (61%), Positives = 280/380 (74%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRG+IP T+L FLE++LQ LDGK  RI DYFDVI+GTSTGGLVTAMLT 
Sbjct  17    LITVLSIDGGGIRGLIPGTVLNFLESELQRLDGKDARIVDYFDVISGTSTGGLVTAMLTT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD N RP+FAAKDI  FY  H PKIFPQ    F  +   +  + GPKYDGKYLH VV E 
Sbjct  77    PDGNNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKPVTKIIKAVAGPKYDGKYLHDVVREE  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD RLHQTLT +VIPTFDIK+ QP +F++ + +  P +D  LSDICI +SAAPTY PAH
Sbjct  137   LGDKRLHQTLTNIVIPTFDIKSLQPTIFSSYQVKKDPSVDALLSDICISTSAAPTYLPAH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              FE +D  G   EFNLIDGGV ANNPTLVA+  VT+ +      DF    PMD +RF V+
Sbjct  197   KFETKDFTGKVREFNLIDGGVAANNPTLVAMGEVTKTIMGGSS-DFFAIKPMDYRRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+SK   KYTA  AA WG++GWLT S G+PLIDVFS AS+DMVDFH++ +F +L+ 
Sbjct  256   SLGTGTSKVEGKYTAHEAAKWGVLGWLT-SGGSPLIDVFSQASADMVDFHLSAVFQALNL  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G ++SVDV T++NL  L + G+ LLKK VS+++L +G   P   + T
Sbjct  315   QDNYLRIQDDTLSGVLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLESGVCDPTSNQET  374

Query  1154  NEEALKRFAKVLSENRKNRL  1213
             NEEALKRFAK+LS+ R  RL
Sbjct  375   NEEALKRFAKLLSQERLLRL  394



>ref|XP_006829694.1| hypothetical protein AMTR_s00126p00050070 [Amborella trichopoda]
 gb|ERM97110.1| hypothetical protein AMTR_s00126p00050070 [Amborella trichopoda]
Length=405

 Score =   443 bits (1139),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 229/400 (57%), Positives = 294/400 (74%), Gaps = 7/400 (2%)
 Frame = +2

Query  14    GKQTLSQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICD  193
               +TLSQ+   +  +     FITILSIDGGG+RGIIP  IL+FLE+QLQ LDG++VR+ D
Sbjct  2     ANETLSQNVSPLYGD-----FITILSIDGGGVRGIIPGIILSFLESQLQALDGEEVRLVD  56

Query  194   YFDVIAGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggL  373
             YFDVIAGTSTGGLVT MLTAPD+NKRPL+AAKDI+PFY EH PKIFP   G F S    +
Sbjct  57    YFDVIAGTSTGGLVTTMLTAPDENKRPLYAAKDIVPFYLEHCPKIFPHPRGPFSSALKVI  116

Query  374   ALLEGPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAED-SPQL  550
             + + GPKYDGKYL ++  E L D RLH TLT VVIPTFDI   QP +F++ + +D +   
Sbjct  117   SAVIGPKYDGKYLRRLARETLKDKRLHDTLTNVVIPTFDINILQPTIFSSYQLKDGNTSQ  176

Query  551   DVKLSDICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMA  730
             D  LSDICIG+SAAPT+ PAHYFEN+   G    F+LIDGGV ANNPTLVAIS VT+ ++
Sbjct  177   DALLSDICIGTSAAPTFLPAHYFENKGSGGEVRFFDLIDGGVVANNPTLVAISEVTKEIS  236

Query  731   RKDDPDFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVF  910
             R+ +P+F  T P+D  RF V+SLGTGS+K    Y+AK AA WGIIGWL +   +PL++ F
Sbjct  237   RR-NPEFFKTKPLDYARFLVISLGTGSAKTQNTYSAKAAAGWGIIGWLYNKGNSPLVESF  295

Query  911   SDASSDMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllk  1090
             +  S+DMVDFH + +F +L++ DNYLRIQ D L  + ASVD++T+ENL+ L  +GQ LLK
Sbjct  296   TQGSADMVDFHNSVVFQALNSEDNYLRIQEDDLSNEAASVDISTKENLQNLVNIGQQLLK  355

Query  1091  ksvskldllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
               VS++++ TG ++P   + TNEEAL  FAK+LS+ R+ R
Sbjct  356   NPVSRVNVETGLFEPLKNQSTNEEALVIFAKLLSQERRLR  395



>ref|XP_008808514.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=477

 Score =   445 bits (1145),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 221/379 (58%), Positives = 286/379 (75%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +T+LSIDGGG+RGIIP TILAFLE++L +LDG+  RI DYFDV+AGTSTGGLVTAMLTA
Sbjct  93    LVTVLSIDGGGVRGIIPGTILAFLESKLHDLDGEDARIADYFDVVAGTSTGGLVTAMLTA  152

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+KN RPLFAA DI  FY E+ PKIFPQ  G+F S      ++ GPKYDGKYLH ++ E 
Sbjct  153   PNKNNRPLFAADDITKFYLENSPKIFPQKTGIFSSTCNLFTVVTGPKYDGKYLHSIIREL  212

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+TRLHQ LT +VIPTFDIK  QP +F+  EA  +P  D  LSDICI +SAAPTY PAH
Sbjct  213   LGETRLHQALTNIVIPTFDIKLLQPTIFSTFEARHAPLKDSLLSDICISTSAAPTYLPAH  272

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D  GNT  FNL+DGGV ANNPTL AIS VT+ + +K++ DF+   PMD  +F V+
Sbjct  273   YFETKDANGNTRSFNLVDGGVAANNPTLAAISEVTKEILKKNE-DFSPIKPMDYGKFLVI  331

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS+K  ++++A+ A+ WG++ WL ++   PLID+F+ AS+DMVD H + +F +L +
Sbjct  332   SLGTGSAKNEERFSAQKASKWGVLRWLYNNGAAPLIDIFTQASADMVDIHASVVFQALHS  391

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L G+ +SVD++TEENL KL ++G++LLKK VS+++L TG  +  +   T
Sbjct  392   TGNYLRIQDDNLTGNASSVDISTEENLLKLVQIGKDLLKKRVSRVNLETGLSEEVNGEVT  451

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL  FAK+LS  R+ R
Sbjct  452   NEEALIHFAKLLSNERRLR  470



>ref|XP_009794733.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=410

 Score =   442 bits (1137),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 248/408 (61%), Positives = 312/408 (76%), Gaps = 3/408 (1%)
 Frame = +2

Query  20    QTLSQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYF  199
             +T + +S +   +   +K +TILSIDGGGIRGIIPATIL +LE+QLQELDGK  R+ DYF
Sbjct  2     KTTTLASLQDLQSPTEEKLVTILSIDGGGIRGIIPATILEYLESQLQELDGKDARLADYF  61

Query  200   DVIAGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLAL  379
             DVIAGTSTGGLVTAMLTAPDK  RPLFAAKDI+PFY EHGPKIFP  GGL GSIK  L  
Sbjct  62    DVIAGTSTGGLVTAMLTAPDKEGRPLFAAKDIVPFYLEHGPKIFPHNGGLLGSIKRMLKS  121

Query  380   LEGPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVK  559
             L  PKYDGKYLHKV++E+LG+TRLH+TLT +VIPTFDIKN QP VFT  EA+++  +D +
Sbjct  122   LVRPKYDGKYLHKVIKEKLGETRLHETLTNIVIPTFDIKNLQPTVFTTFEAKENSLMDAR  181

Query  560   LSDICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKD  739
             L+DICI +SAAPTY PAHYF+N++  GN  EFNL+DGGV ANNP LVA S VT+++    
Sbjct  182   LTDICISTSAAPTYLPAHYFKNQEKDGNFQEFNLVDGGVAANNPALVATSQVTKQILH-G  240

Query  740   DPDFAGTNPMDCQRFRVLSLGTGSS-KYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSD  916
             +PDF    P D  RF ++SLGTGSS K   KY AK AA WGI  WL +   +P++D+ + 
Sbjct  241   NPDFFPVKPEDYGRFLMISLGTGSSTKMKPKYNAKTAAKWGICKWLLYGGSSPILDLLTH  300

Query  917   ASSDMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkks  1096
             AS DMVDFHI+ +  +L + +NYLRIQ D+L G  +SVD++T+ N+KKL E+G+ LLKK+
Sbjct  301   ASDDMVDFHISALLQALHSENNYLRIQDDTLNGTDSSVDISTKVNMKKLVEIGKILLKKT  360

Query  1097  vskldllTGQYKPDDARGTNEEALKRFAKVLSENRKNRLKNEAKLSKL  1240
             VS+++L TG  +P    G+NEEALKRFAK+LSE R+ R K++A L+ L
Sbjct  361   VSRINLQTGLLEPCQHSGSNEEALKRFAKLLSEERRLR-KSKAALTGL  407



>ref|XP_009367377.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=401

 Score =   442 bits (1136),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 227/381 (60%), Positives = 282/381 (74%), Gaps = 3/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRG+IP TILAFLE++LQ+LDG+  R+ DYFDVI+GTSTGGLVTAMLT 
Sbjct  17    LITVLSIDGGGIRGLIPGTILAFLESELQKLDGEDARLADYFDVISGTSTGGLVTAMLTT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVVEE  430
             PD+N RPLFAAKDI  FY    PKIFPQ        I   +  L GPKY+GKYLH +V +
Sbjct  77    PDENNRPLFAAKDIKDFYLTESPKIFPQKTRSLFPQIAKIIKRLTGPKYNGKYLHSLVRQ  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LG+ +LHQTLT VVIPTFDIKN QP +F++ EA+  P  D  +SDICI +SAAPTY PA
Sbjct  137   KLGEKKLHQTLTNVVIPTFDIKNLQPTIFSSFEAKHKPPFDALVSDICIATSAAPTYLPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE +D  GN  EFNLIDGGV ANNPTLVAI  VT+++  K  PDF    PMD  R+ V
Sbjct  197   HYFETKDHNGNVREFNLIDGGVAANNPTLVAIGEVTKQII-KGSPDFFPIKPMDYGRYLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGSSK   KY+A  AA WG++ WLT     P+IDVFS  S+DMVD +++ +F +L 
Sbjct  256   ISLGTGSSKVELKYSAHNAAKWGLLNWLTSGGSTPIIDVFSQGSADMVDLNLSVVFQALH  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             +  NYLRIQ D L GDV+SVD+ TE+NL  L +VG+ LLK+ VS+++L TG+++  +   
Sbjct  316   SEKNYLRIQDDKLRGDVSSVDIATEKNLDNLVKVGEGLLKQPVSRVNLDTGKFEACNHE-  374

Query  1151  TNEEALKRFAKVLSENRKNRL  1213
             TNEEAL RFAK+LSE ++ RL
Sbjct  375   TNEEALIRFAKLLSEEKRLRL  395



>gb|KHN04516.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   442 bits (1137),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 235/379 (62%), Positives = 302/379 (80%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIPATILAFLEAQLQELDG+  R+ DYFDVIAGTSTGG+VTAMLTA
Sbjct  19    LVTILSIDGGGIRGIIPATILAFLEAQLQELDGEDARLADYFDVIAGTSTGGIVTAMLTA  78

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+ N+RPLFAAKDI PFY EH PKIFPQ  GL+GS+   L  L GPKY+GKYL +VV E+
Sbjct  79    PNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSVGKLLRSLGGPKYNGKYLQEVVREK  138

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             +G+TRLH+TLT +VIPTFDIK  QP++F++ + + SP LD +LSDICI +SAAPTY PA+
Sbjct  139   VGETRLHETLTNIVIPTFDIKTLQPIIFSSYQIKRSPCLDARLSDICISTSAAPTYLPAY  198

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             +F N+D +GN  +FNLIDGGVCANNPTLVA++ VT+++   D+PDF    PM+  RF ++
Sbjct  199   HFNNKDSEGNMHQFNLIDGGVCANNPTLVAMNQVTKQIL-NDNPDFFSIKPMEYGRFLII  257

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+ K  QK+ A+MAA WG++ WLT+S   PLIDVF+ +S+DMVDFH+AT+  +L +
Sbjct  258   SLGTGTPKNEQKFNAQMAAKWGLLDWLTNSGSTPLIDVFTQSSADMVDFHLATVTQALHS  317

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              +NYLRIQ D+L G   SVD+ T+ENL+KL ++G+ LLKK VS+++L  G ++P     T
Sbjct  318   ENNYLRIQDDTLTGTDYSVDIATKENLEKLSQIGERLLKKPVSQINLEDGLFEPVGNGET  377

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NE+ALKRFAK+L + R+ R
Sbjct  378   NEDALKRFAKILLKERRLR  396



>ref|XP_003549405.1| PREDICTED: patatin-3-Kuras 1 [Glycine max]
Length=409

 Score =   442 bits (1136),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 235/396 (59%), Positives = 304/396 (77%), Gaps = 3/396 (1%)
 Frame = +2

Query  29    SQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVI  208
             ++SS E          +TILSIDGGGIRGIIPATI+ FLE+QLQELDG   R+ DYFDVI
Sbjct  4     AKSSIEQIQPPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPDARLADYFDVI  63

Query  209   AGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggL--ALL  382
             +GTSTGGLVTAM+TAPD N RPLFAAKDI PFY +H PKIFPQ  GL G+I   +  +LL
Sbjct  64    SGTSTGGLVTAMITAPDNNNRPLFAAKDIKPFYMDHSPKIFPQHSGLGGTILAKVVKSLL  123

Query  383   EGPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKL  562
              GPKYDGKYLH VV E+LGD RLH+TLT VVIPTFDIK+ QP++F++ + ++SP LD KL
Sbjct  124   GGPKYDGKYLHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYQIKNSPSLDAKL  183

Query  563   SDICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDD  742
             SDICI +SAAPTY PAH F N+D  G   EFNLIDGGVCANNPTLVA++ VT+++ +++ 
Sbjct  184   SDICISTSAAPTYLPAHNFNNQDSNGKVHEFNLIDGGVCANNPTLVAMNEVTKQIIKQNS  243

Query  743   PDFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDAS  922
              D     P++  RF ++S+GTG++K  +K+ A+MAA WG++ WLT S   PLIDVF+ +S
Sbjct  244   -DLFPIKPLEYGRFLIISIGTGTAKNEEKFNAQMAAKWGLLDWLTQSGSTPLIDVFTQSS  302

Query  923   SDMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvs  1102
             +DMVDFH++ +  +L + DNYLRIQ D+L G  +SVD+ T+ENL+KL ++G+ LLKK VS
Sbjct  303   ADMVDFHLSAVTQALHSQDNYLRIQDDTLTGTDSSVDIATKENLEKLSQIGEKLLKKPVS  362

Query  1103  kldllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             +++L  G ++P   R TNE+ALKRFAK+LS+ R+ R
Sbjct  363   RVNLENGLFEPLKNRETNEDALKRFAKILSQERRLR  398



>ref|XP_010064139.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=420

 Score =   442 bits (1136),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 229/379 (60%), Positives = 283/379 (75%), Gaps = 2/379 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             I ILSIDGGGIRG+IP TIL FLE++LQ+LDG+  R+ DYFDVI+GTSTGGLVTAMLT P
Sbjct  32    IFILSIDGGGIRGLIPGTILHFLESELQKLDGEDARLADYFDVISGTSTGGLVTAMLTTP  91

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             ++N RP+FAAKDI  FY  H PKIFPQ    F  +   +  + GPKYDGKYLH VV ++L
Sbjct  92    NENNRPVFAAKDIKDFYLNHCPKIFPQDSCSFKLVTKMIKAMAGPKYDGKYLHSVVRDKL  151

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             GD RLHQTLT VVIPTFDIK+ QP +F++ + +  P +D  LSDICI +SAAPTY PAH 
Sbjct  152   GDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDICISTSAAPTYLPAHK  211

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE +D      EFNLIDGGV ANNPTLVA+  VT+ +   +  DF    PMD +RF V+S
Sbjct  212   FETKDPTDQVREFNLIDGGVAANNPTLVAMGEVTKAIIGGNS-DFFPIKPMDYRRFLVIS  270

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG+ K   KYTA  AA WG++GWLT S G+PLIDVFS AS+DMVDFHI+ +F +L   
Sbjct  271   LGTGTRKAEGKYTAHEAAKWGVLGWLT-SGGSPLIDVFSQASADMVDFHISAVFQALHLH  329

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             DNYLRIQ D+L GD++SVDV T++NL  L + G+ LLKK VS+++L TG  +P   + TN
Sbjct  330   DNYLRIQDDTLTGDLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLETGACEPTPNQETN  389

Query  1157  EEALKRFAKVLSENRKNRL  1213
             EEAL+RFAK+LS+ R+ RL
Sbjct  390   EEALRRFAKLLSQERQLRL  408



>ref|XP_006829702.1| hypothetical protein AMTR_s00126p00063230 [Amborella trichopoda]
 gb|ERM97118.1| hypothetical protein AMTR_s00126p00063230 [Amborella trichopoda]
Length=407

 Score =   441 bits (1134),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 228/404 (56%), Positives = 287/404 (71%), Gaps = 8/404 (2%)
 Frame = +2

Query  5     IRGGKQTLSQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVR  184
             + GG+ +++Q            + ITILSIDGGGIRG IPATIL+FLE QLQ LDG+ VR
Sbjct  3     MEGGRWSMNQPP-------TYGEMITILSIDGGGIRGTIPATILSFLEHQLQILDGEDVR  55

Query  185   ICDYFDVIAGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsik  364
             I DYFDVIAGTSTGGLVTAML  P K+ RPL+AAKDI  FY EH PKIFPQ  G+  S  
Sbjct  56    IADYFDVIAGTSTGGLVTAMLATPGKDNRPLYAAKDIPTFYLEHCPKIFPQSSGVLASTT  115

Query  365   ggLALLEGPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSP  544
                 ++  PKYDGKYLH ++   LGD +LHQTLT +V+PTFDI+  QP VF+  +  D  
Sbjct  116   KLWGVVSRPKYDGKYLHDLIRRELGDKKLHQTLTNIVVPTFDIRIMQPAVFSTYQLRDYS  175

Query  545   QLDVKLSDICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQR  724
               D  LSDICI +SAAPTY PAHYFE     G    F+L+DGGV ANNPTLVA+  VT+ 
Sbjct  176   IKDALLSDICISTSAAPTYLPAHYFETMGSDGMVKNFHLVDGGVAANNPTLVAVGEVTRE  235

Query  725   MARKDDPDFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLID  904
             + RK +PDF    PMD  RF V+SLGTGS K +  Y+AK AA WG++GWL H+ G PLID
Sbjct  236   IFRK-NPDFFPIKPMDYGRFLVISLGTGSPKSTDNYSAKDAAKWGVLGWLYHNGGTPLID  294

Query  905   VFSDASSDMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNl  1084
              F+ ASSDMVDFH++ +F +L +  NYLRIQ D+L G  +SVD+ T+ENL+ L  +G +L
Sbjct  295   TFTHASSDMVDFHLSVVFRALHSERNYLRIQGDTLTGHASSVDIATKENLENLVMIGSDL  354

Query  1085  lkksvskldllTGQYKPDDARGTNEEALKRFAKVLSENRKNRLK  1216
             LKK VS+L++ TG ++P +  GTNE+AL RFAK+LS+ R+ R++
Sbjct  355   LKKPVSRLNMETGLFEPVEGEGTNEQALTRFAKLLSDERRLRMQ  398



>gb|KHN12765.1| Patatin group A-3 [Glycine soja]
Length=409

 Score =   441 bits (1134),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 235/396 (59%), Positives = 304/396 (77%), Gaps = 3/396 (1%)
 Frame = +2

Query  29    SQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVI  208
             ++SS E          +TILSIDGGGIRGIIPATI+ FLE+QLQELDG   R+ DYFDVI
Sbjct  4     AKSSIEQIQPPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPDARLADYFDVI  63

Query  209   AGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggL--ALL  382
             +GTSTGGLVTAM+TAPD N RPLFAAKDI PFY +H PKIFPQ  GL G+I   +  +LL
Sbjct  64    SGTSTGGLVTAMITAPDNNNRPLFAAKDIKPFYMDHCPKIFPQHSGLGGTILAKVVKSLL  123

Query  383   EGPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKL  562
              GPKYDGKYLH VV E+LGD RLH+TLT VVIPTFDIK+ QP++F++ + ++SP LD KL
Sbjct  124   GGPKYDGKYLHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYQIKNSPSLDAKL  183

Query  563   SDICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDD  742
             SDICI +SAAPTY PAH F N+D  G   EFNLIDGGVCANNPTLVA++ VT+++ +++ 
Sbjct  184   SDICISTSAAPTYLPAHNFNNQDSNGKVHEFNLIDGGVCANNPTLVAMNEVTKQIIKQNS  243

Query  743   PDFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDAS  922
              D     P++  RF ++S+GTG++K  +K+ A+MAA WG++ WLT S   PLIDVF+ +S
Sbjct  244   -DLFPIKPLEYGRFLIISIGTGTAKNEEKFNAQMAAKWGLLDWLTQSGSTPLIDVFTQSS  302

Query  923   SDMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvs  1102
             +DMVDFH++ +  +L + DNYLRIQ D+L G  +SVD+ T+ENL+KL ++G+ LLKK VS
Sbjct  303   ADMVDFHLSAVTQALHSQDNYLRIQDDTLTGTDSSVDIATKENLEKLSQIGEKLLKKPVS  362

Query  1103  kldllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             +++L  G ++P   R TNE+ALKRFAK+LS+ R+ R
Sbjct  363   RVNLENGLFEPLKNRETNEDALKRFAKILSQERRLR  398



>ref|XP_006354908.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=409

 Score =   441 bits (1134),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 232/398 (58%), Positives = 297/398 (75%), Gaps = 5/398 (1%)
 Frame = +2

Query  29    SQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVI  208
             S  SF++    N  KFITILSIDGGGIRG+IPATIL +LE+QLQELDG+  R+ DYFD+I
Sbjct  3     SSGSFKLQPPING-KFITILSIDGGGIRGLIPATILEYLESQLQELDGEDARLADYFDII  61

Query  209   AGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfg-sikggLALLE  385
             AGTSTGGLVTAMLTAP+K+ RPLFAAKDI PFY EHGPKIFPQ   +   SI  G   L 
Sbjct  62    AGTSTGGLVTAMLTAPNKDNRPLFAAKDIKPFYLEHGPKIFPQNNMILIGSIIKGWRFLT  121

Query  386   GPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLS  565
             GPKYDGKYL +V++E+LG+T+LH+TLT VVIPTFDIKN QP +F+  EA+   ++D KL 
Sbjct  122   GPKYDGKYLREVIKEKLGETKLHETLTNVVIPTFDIKNIQPTIFSTFEAKKYSRMDAKLF  181

Query  566   DICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDD-  742
             DICIG+SAAPTY PAH F+ ++  G   EFNLIDG + ANNPT +AI+ VT+++  +   
Sbjct  182   DICIGTSAAPTYLPAHNFQTQNEDGKFQEFNLIDGAIAANNPTFIAINEVTKQIFEQTPY  241

Query  743   -PDFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDA  919
               +F    P +  +F V+S+GTGS+K   KY AK+A+NWGI GWL+    NP+ID F+DA
Sbjct  242   FKNFDEMKPANYGKFLVISIGTGSAKLVHKYDAKIASNWGIFGWLSDGGSNPIIDAFADA  301

Query  920   SSDMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksv  1099
             S+DMVD+HI+ +F  + +   YLRIQ D+L G+  SVD++T+EN+ KL E+G NLLKK V
Sbjct  302   SNDMVDYHISVVFQCVCSQKQYLRIQDDTLSGEDFSVDISTKENMDKLVEIGTNLLKKPV  361

Query  1100  skldllTGQYKP-DDARGTNEEALKRFAKVLSENRKNR  1210
             S+++L T  ++P     GTNEEALK FAK+LSE +K R
Sbjct  362   SRVNLKTCLFEPLGTTGGTNEEALKEFAKLLSEEKKFR  399



>ref|XP_010059967.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66459.1| hypothetical protein EUGRSUZ_F00255 [Eucalyptus grandis]
Length=409

 Score =   440 bits (1131),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 228/379 (60%), Positives = 281/379 (74%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP TILAFLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT+
Sbjct  17    LITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTS  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+N RPLFAAKDI  FY ++ PKIFPQ    F      +  + GPKYDGKYLH++V+E+
Sbjct  77    PDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLHELVKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+ RLHQTLT VVIPTFDIK+ QP +F++ E +  P ++  LSDICI +SAAPTY PAH
Sbjct  137   LGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDICISTSAAPTYLPAH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D  G   EFNLIDGGV ANNPT VA+  VT+ +      DF    PMD +RF V+
Sbjct  197   YFETQDSTGKIREFNLIDGGVAANNPTFVAMGEVTKEIMGGSS-DFFPIKPMDYRRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS K    Y A+ AA WG++GWL+ + G+PL+DVF  AS+DMVDFH++ +F +L  
Sbjct  256   SLGTGSQKVEGNYDAREAAKWGVLGWLSSNGGSPLVDVFMQASADMVDFHLSAVFQALHL  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L G VASVD+ T++NL  L + G+ LLKK VSK+DL TGQ+       T
Sbjct  316   EANYLRIQDDTLSGSVASVDIATKKNLNDLVKTGEALLKKPVSKVDLETGQHNACKLE-T  374

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL+RFAK+LS  R+ R
Sbjct  375   NEEALRRFAKLLSNERQLR  393



>ref|XP_011081971.1| PREDICTED: patatin-like protein 1 [Sesamum indicum]
Length=403

 Score =   439 bits (1130),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 242/395 (61%), Positives = 300/395 (76%), Gaps = 1/395 (0%)
 Frame = +2

Query  26    LSQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDV  205
             ++ SSF       +   ITILSIDGGGIRGIIPA IL  LE++LQ+LDG+  RI DYFDV
Sbjct  1     MASSSFYKIGPPVNGNLITILSIDGGGIRGIIPAKILESLESELQKLDGQDARIADYFDV  60

Query  206   IAGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLE  385
             IAGTSTGGLVTAMLTAPD N RPL+AAKDI  FY +HGPKIFP  GG+ GS++  +  L 
Sbjct  61    IAGTSTGGLVTAMLTAPDANNRPLYAAKDIAAFYVKHGPKIFPHKGGVIGSLESMVVQLG  120

Query  386   GPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLS  565
              PKY GKYLHK++ + LG TRLH TLT VVIPTFDI+N QP VF++ E ++ P LD  LS
Sbjct  121   RPKYKGKYLHKLIRDNLGQTRLHDTLTNVVIPTFDIRNLQPTVFSSYEMKNMPYLDALLS  180

Query  566   DICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDP  745
             DICIG+SAAPT+FPAH+F N D  G +++FNLIDGGV ANNPTLVAIS VT+++ R +DP
Sbjct  181   DICIGTSAAPTFFPAHHFTNPDASGKSWDFNLIDGGVAANNPTLVAISEVTKQVLR-NDP  239

Query  746   DFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASS  925
             DF    PMD  R  V+SLGTGS+K  +KYTA+MAA WG+ GWL   +  P++DVF+ AS 
Sbjct  240   DFFPIQPMDYNRLLVISLGTGSAKQERKYTAEMAAKWGLFGWLIQGNNTPILDVFNQASK  299

Query  926   DMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvsk  1105
             DMVD+ +  IF SL + DNYLRIQ DSL G  ASVDVTT++NL +L ++G+NLLK  +S+
Sbjct  300   DMVDYFLCVIFQSLHSEDNYLRIQDDSLTGANASVDVTTKQNLSELAKIGENLLKGPISR  359

Query  1106  ldllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             ++LLTG  +P    GTNE+ALK+FAK+LS+ RK R
Sbjct  360   VNLLTGNSEPIPNGGTNEDALKKFAKLLSDERKLR  394



>ref|XP_010926529.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=514

 Score =   443 bits (1140),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 230/384 (60%), Positives = 282/384 (73%), Gaps = 3/384 (1%)
 Frame = +2

Query  68    QKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAML  247
             +K +TILSIDGGG+RGIIP TIL F EA+LQELDG   RI DYFD+IAGTSTGGLVT ML
Sbjct  17    KKVVTILSIDGGGVRGIIPGTILTFFEAKLQELDGLDARIADYFDIIAGTSTGGLVTTML  76

Query  248   TAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVE  427
             TAP+K+ RPLFAAKDI+ FY E  PKIFPQ  GL       L  + GPKYDGK+LH  V+
Sbjct  77    TAPNKDNRPLFAAKDIIQFYLESCPKIFPQRTGLLAGALNLLGAVSGPKYDGKFLHSKVK  136

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E LGDT+LHQTLT VVIP FDIK  QP++F+  E +  P  D  LSDICI + AAPTY P
Sbjct  137   ELLGDTKLHQTLTNVVIPAFDIKLLQPVIFSTFETKTDPSKDALLSDICISTCAAPTYLP  196

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYFE +D +G T  FNL+DGGV ANNP LVA S + +++   D+ DF+   P D  +F 
Sbjct  197   AHYFETKDSQGKTRSFNLVDGGVAANNPMLVATSQIIKQIFL-DNADFSKFKPTDFAKFL  255

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGS K+ +K+TA  +A WG++GWL +    P+ID+FS +S+DMVD H + +F +L
Sbjct  256   VISLGTGSPKHEEKFTAPESAKWGLLGWLHNQGSTPIIDIFSQSSADMVDIHASILFEAL  315

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              +  NYLRIQ DSLEGD ASVDV+T ENL KL +VGQ+LLKK VS+++L TG  +  D  
Sbjct  316   RSEKNYLRIQDDSLEGDAASVDVSTSENLLKLVQVGQDLLKKPVSRVNLETGVSEACDVE  375

Query  1148  GTNEEALKRFAKVLSENRKNRLKN  1219
             GTNEEAL RFA++LS  R  RLKN
Sbjct  376   GTNEEALIRFARMLSNER--RLKN  397



>ref|XP_004501586.1| PREDICTED: patatin-3-Kuras 1-like isoform X1 [Cicer arietinum]
Length=409

 Score =   439 bits (1129),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 232/394 (59%), Positives = 301/394 (76%), Gaps = 1/394 (0%)
 Frame = +2

Query  29    SQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVI  208
             +QSS          K +TILSIDGGGIRGIIPATIL +LE QLQELDG+  R+ DYFDVI
Sbjct  6     TQSSLLQIQPPTYGKLVTILSIDGGGIRGIIPATILEYLETQLQELDGESARLADYFDVI  65

Query  209   AGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEG  388
              GTSTGGLVTAMLTAP+ N+RPLFAAKDI PFY EH PKIFPQ   LFGS+      L G
Sbjct  66    TGTSTGGLVTAMLTAPNHNQRPLFAAKDIKPFYLEHCPKIFPQHKDLFGSVTKLFRSLAG  125

Query  389   PKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSD  568
             PKYDGKYLH +V E+LG+ R+H+TLT +VIPTFDIK  QP++F++ + + +P  D +LSD
Sbjct  126   PKYDGKYLHDMVREKLGEIRVHETLTNIVIPTFDIKTMQPIIFSSYKVKTTPCFDARLSD  185

Query  569   ICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPD  748
             ICIG+SAAPTY P + F+N+D  GNT EFNLIDGGVCANNPTLVA++ VT+++  +++ D
Sbjct  186   ICIGTSAAPTYLPGYNFKNQDEDGNTHEFNLIDGGVCANNPTLVAVNEVTKQIINQNN-D  244

Query  749   FAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSD  928
             F    PM+  RF ++SLGTG+ K  QK+ +K+AA WG++ WLTH    PLID+FS +S D
Sbjct  245   FDSIKPMEYSRFLIISLGTGTPKNEQKFDSKLAAKWGLLDWLTHGGSTPLIDMFSQSSGD  304

Query  929   MVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskl  1108
             MVD+++AT+  +L++ DNYLRIQ D+L G  +SVD+ T+ENL KL ++G+ LLKK +S +
Sbjct  305   MVDYNLATVTQALNSQDNYLRIQDDTLTGIDSSVDIATKENLDKLCQIGERLLKKPLSNV  364

Query  1109  dllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             +L TG ++P   R TN++ALKRFAK+LS+ R+ R
Sbjct  365   NLETGVFEPTQNRETNQDALKRFAKILSQERRLR  398



>ref|XP_008228777.1| PREDICTED: LOW QUALITY PROTEIN: patatin-like protein 2 [Prunus 
mume]
Length=406

 Score =   439 bits (1129),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 228/380 (60%), Positives = 281/380 (74%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRG+IP TILAFLE++LQ+LDG+  R+ DYFDVIAGTSTGGLVTAMLTA
Sbjct  17    LITVLSIDGGGIRGLIPGTILAFLESELQKLDGEDARLADYFDVIAGTSTGGLVTAMLTA  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+N RPLFAA DI  FY    PKIFPQ    F  +   +  L GPKY+GKYLH +V ++
Sbjct  77    PDENNRPLFAANDIKEFYLNECPKIFPQNTXWFPYVTKIIKALAGPKYNGKYLHSLVRQK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD +LHQTLT VVIPTFDI+N QP +F++ E    P  D  LSDICIG+SAAPTY PAH
Sbjct  137   LGDKKLHQTLTNVVIPTFDIRNLQPTIFSSFEVNHKPCFDALLSDICIGTSAAPTYLPAH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+ +DG+GN  EFNLIDGGV ANNPTL+AI  VT+ +  K   DF    PMD  RF V+
Sbjct  197   YFKTKDGEGNVKEFNLIDGGVAANNPTLLAIGEVTKAII-KGSSDFFPIKPMDYGRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS K   KY A  AA WG++ WLT     P+I+VFS +S+DMVD +++ +F +L +
Sbjct  256   SLGTGSPKDEVKYNAHDAAKWGMLNWLTSGGSTPIINVFSYSSADMVDLNLSVVFQALHS  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D L+GDVASVDV TE+NL  L +VG+ LLK+ VS+++L TG+++  +   T
Sbjct  316   EKNYLRIQDDKLQGDVASVDVATEKNLDSLVQVGEGLLKQPVSRVNLETGKFEACNHE-T  374

Query  1154  NEEALKRFAKVLSENRKNRL  1213
             NEEAL RFAK+LSE +  RL
Sbjct  375   NEEALTRFAKLLSEEKWLRL  394



>gb|KCW66178.1| hypothetical protein EUGRSUZ_F00014 [Eucalyptus grandis]
Length=409

 Score =   439 bits (1129),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 228/379 (60%), Positives = 281/379 (74%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP TILAFLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT+
Sbjct  17    LITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTS  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+N RPLFAAKDI  FY ++ PKIFPQ    F      +  + GPKYDGKYLHK+V+E+
Sbjct  77    PDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLHKLVKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+ RLHQTLT VVIPTFDIK+ QP +F++ E +  P ++  LSDICI +SAAPTY PAH
Sbjct  137   LGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDICISTSAAPTYLPAH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D  G   EFNLIDGGV ANNPT VA+  VT+ +      DF    PMD +RF V+
Sbjct  197   YFETQDSTGKIREFNLIDGGVAANNPTFVAMGEVTKEIMGGSS-DFFPIKPMDYRRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS K    Y A+ AA WG++GWL+ + G+PL+DVF  AS+DMVDFH++++F +L  
Sbjct  256   SLGTGSQKVEGNYDAREAAKWGVLGWLSSNGGSPLVDVFMQASADMVDFHLSSVFQALHL  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L   VASVD+ T++NL  L + G+ LLKK VSK+DL TGQ+       T
Sbjct  316   EANYLRIQDDTLSDSVASVDIATKKNLNDLVKTGEALLKKPVSKVDLETGQHNACKLE-T  374

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL+RFAK+LS  R+ R
Sbjct  375   NEEALRRFAKLLSNERQLR  393



>ref|XP_007017303.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
 gb|EOY14528.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
Length=437

 Score =   440 bits (1131),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 228/384 (59%), Positives = 284/384 (74%), Gaps = 6/384 (2%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRG+IP TILAFLE+QLQ+LDG++ R+ DYFDVIAGTSTGGLVTAMLT 
Sbjct  31    LITVLSIDGGGIRGLIPGTILAFLESQLQKLDGEQARLADYFDVIAGTSTGGLVTAMLTT  90

Query  254   PDKN--KRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVE  427
             P+     RPLFAAKDI+ FY EH PKIFPQ    F      +  L GPKYDGKYLH +V 
Sbjct  91    PNPEVGNRPLFAAKDIIDFYLEHCPKIFPQDSSPFAPAANVVKSLMGPKYDGKYLHDIVR  150

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+TRLHQTLT VVIPTFDIK  QP +F++ E + +P  D  LSDICIG+SAAPTY P
Sbjct  151   EKLGETRLHQTLTNVVIPTFDIKQLQPKIFSSYEVKSNPSKDALLSDICIGTSAAPTYLP  210

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AH+F+++D  G   EFNLIDGGV ANNP LVAI+ V++ + R  +P+F    P D  RF 
Sbjct  211   AHHFQSQDSTGKPIEFNLIDGGVAANNPALVAINEVSKEILR-GNPEFFPIKPTDYARFL  269

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGS K  +KY A +AA WGI+GWLT     PL+D+F  ASSDMVDFHIAT+F +L
Sbjct  270   VVSLGTGSPKSEEKYHANLAAKWGILGWLTSEHSTPLVDIFMQASSDMVDFHIATLFQAL  329

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + D+YLRIQ D+L   ++SVDV T+ENL+ L + G+ LLKK VS+++L  G+ +P    
Sbjct  330   QSEDSYLRIQDDTLSQQMSSVDVATKENLENLVKAGEELLKKPVSRVNLEDGKSEP-AGT  388

Query  1148  GTNEEALKRFAKVLSENRKNRLKN  1219
              TNE+AL R A+ LS  R+ RL++
Sbjct  389   VTNEKALIRLAEALS--REKRLRD  410



>ref|XP_008220177.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=406

 Score =   439 bits (1128),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 224/381 (59%), Positives = 284/381 (75%), Gaps = 3/381 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K ITILSIDGGGIRG+IPATIL+FLE++LQ+LDG+  RI DYFDV+AGTSTGGLVTAMLT
Sbjct  15    KMITILSIDGGGIRGLIPATILSFLESELQKLDGEDARIADYFDVVAGTSTGGLVTAMLT  74

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggg-lfgsikggLALLEGPKYDGKYLHKVVE  427
              P++  RPLF+AKDI  FY  H PKIFPQ    LF   +  +  L GPKYDGKYLH ++ 
Sbjct  75    TPNEKDRPLFSAKDISDFYMNHCPKIFPQKKFPLFRYTRKIIKALTGPKYDGKYLHGLIR  134

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             ++LGD ++HQTLT VVIPTFDIKN QP VF++      P  D  LSD+CIG+SAAPT+ P
Sbjct  135   QKLGDKKMHQTLTNVVIPTFDIKNLQPTVFSSFRVRHKPSYDALLSDVCIGTSAAPTFLP  194

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYFE +D  G T EFNLIDGG+ ANNPTL+AI  V+  + +K +PDF    P+D  RF 
Sbjct  195   AHYFETKDEFGQTREFNLIDGGIAANNPTLLAICEVSNEI-KKANPDFFPVKPVDYGRFL  253

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTG+SK   KY A  AA WG++ WLT     P+I+VFS AS+DMVD H++ +F +L
Sbjct  254   VISLGTGTSKAEVKYNAHTAAKWGLLNWLTSGGSTPIINVFSQASADMVDLHLSGVFQAL  313

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + D YLRIQ D+L G V+SVDV T++NL +L  VG+ LLK+ VS+++L +G+++  D R
Sbjct  314   HSEDYYLRIQDDTLRGTVSSVDVATKKNLSRLVTVGEGLLKERVSRVNLDSGRFEASD-R  372

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TNEEAL+R AK+LSE R+ R
Sbjct  373   ETNEEALRRVAKLLSEERRLR  393



>ref|XP_002277305.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
Length=407

 Score =   438 bits (1127),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 228/379 (60%), Positives = 290/379 (77%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGG+RGIIP  ILAFLE++LQ+LDG+  R+ DYFDVIAGTSTGGL+TAMLTA
Sbjct  20    LITILSIDGGGVRGIIPGIILAFLESELQKLDGEDARLADYFDVIAGTSTGGLITAMLTA  79

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPL+AA  I PFY E+ PKIFP   G+FG+I     +L GPKYDGKYLH +++  
Sbjct  80    PNQENRPLYAASGIKPFYLENCPKIFPPRSGIFGTIVNLFKVLTGPKYDGKYLHNLLKNV  139

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD RLHQTLT VVIPTFDIK  QP +F++ +   +P LD KLSDICIG+SAAPTY PAH
Sbjct  140   LGDKRLHQTLTNVVIPTFDIKKLQPTIFSSYQVAINPALDAKLSDICIGTSAAPTYLPAH  199

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFEN+D + N  EFNLIDGG+ ANNP LVAIS VT+++  K +PDF    PMD  RF V+
Sbjct  200   YFENQDDQENNEEFNLIDGGLAANNPCLVAISEVTKQVFNK-NPDFFPIKPMDYGRFLVI  258

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K   KYTAKMAA WG++GWL + +G+ L+     AS+DMVDFH   +F +L +
Sbjct  259   SVGTGSAKEEYKYTAKMAAKWGVLGWL-YDNGSTLLSPRVSASADMVDFHNCVVFEALHS  317

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              +NYLRI  D+L+G VASV++ T++NL  L ++G+ LLKK VS+++L TG+Y+P    GT
Sbjct  318   EENYLRIDDDTLKGTVASVNIATKKNLDSLVKLGEELLKKPVSRVNLDTGKYEPIKNGGT  377

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL RFAK+LS+ ++ R
Sbjct  378   NEEALIRFAKLLSDEKRLR  396



>gb|AAX99411.1| patatin-like protein [Gossypium hirsutum]
Length=434

 Score =   439 bits (1130),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 225/381 (59%), Positives = 280/381 (73%), Gaps = 4/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRG+IP T+LAFLE+QLQ+LDG++ R+ DYFD+I+GTSTGGLVTAMLT 
Sbjct  31    LITLLSIDGGGIRGLIPGTLLAFLESQLQKLDGEQARLADYFDIISGTSTGGLVTAMLTT  90

Query  254   PD--KNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVE  427
             PD  K  RPLFAAKDI  FY EH PKIFPQ    F      +  L GPKYDGKYLH +V 
Sbjct  91    PDPKKENRPLFAAKDINEFYLEHCPKIFPQDSSPFAPAANVVKSLMGPKYDGKYLHDIVR  150

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+T+LHQTLT VVIPTFDIK  QP +F+  E +  P  D  LSDICI +SAAPTY P
Sbjct  151   EKLGETKLHQTLTNVVIPTFDIKQLQPRIFSTYEVKSHPCTDALLSDICIATSAAPTYLP  210

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AH+F+ +D  G T EFNLIDGGV ANNPTLVA++ VT+ + R  +P+F    P D  RF 
Sbjct  211   AHHFQTQDSTGKTKEFNLIDGGVAANNPTLVAMNEVTKEILR-GNPEFFPIKPTDYARFL  269

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGS K   KY A M A WG++GWLT     PL+D+F  ASSDMVDFHIAT+F +L
Sbjct  270   VVSLGTGSPKSEGKYHANMTAKWGVLGWLTSEHSTPLVDIFMQASSDMVDFHIATVFQAL  329

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + ++YLRIQ D+L   ++SVD+ T+ENL+ L +VG+ LLKK VS+++L  GQ++P   +
Sbjct  330   QSENSYLRIQDDTLSQQISSVDIATKENLENLVKVGEELLKKPVSRVNLENGQFEP-AGK  388

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TN EAL R A VLS+ ++ R
Sbjct  389   ITNGEALIRLAAVLSKEKQLR  409



>ref|XP_003603015.1| Patatin-like protein [Medicago truncatula]
 gb|AES73266.1| patatin-like phospholipase [Medicago truncatula]
Length=409

 Score =   438 bits (1127),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 234/394 (59%), Positives = 299/394 (76%), Gaps = 1/394 (0%)
 Frame = +2

Query  29    SQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVI  208
             +QSS            +TILSIDGGGIRGIIPATIL FLE+QLQELDG+  R+ DYFDVI
Sbjct  4     TQSSLLQIQPPTYGNLVTILSIDGGGIRGIIPATILEFLESQLQELDGESARLADYFDVI  63

Query  209   AGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEG  388
              GTSTGGLVTAML+AP+  KRPLFAAKDI PFY EH PKIFPQ   LFGS       L G
Sbjct  64    TGTSTGGLVTAMLSAPNDKKRPLFAAKDIKPFYLEHSPKIFPQQKDLFGSFGKLFRSLVG  123

Query  389   PKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSD  568
             PKYDGKYLH+VV E+LG+ R+H+TLT +VIPTFDIK  QP++F++ + + +P +D +LSD
Sbjct  124   PKYDGKYLHEVVREKLGEIRVHETLTNIVIPTFDIKTMQPIIFSSYKIKKTPCMDARLSD  183

Query  569   ICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPD  748
             ICI +SAAPTY P + F+N+D +GNT EFNLIDGGVCANNPTLVA++ VT ++  +++ D
Sbjct  184   ICISTSAAPTYLPGYNFKNQDTEGNTHEFNLIDGGVCANNPTLVAMNEVTNQIINQNN-D  242

Query  749   FAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSD  928
             F    PM+  RF ++SLGTG+ K  QK+ AKMAA WG++ WLTH    PLID+FS +S+D
Sbjct  243   FYAIKPMEYSRFLIISLGTGTPKNEQKFNAKMAAKWGLLDWLTHGGSTPLIDMFSQSSAD  302

Query  929   MVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskl  1108
             MVDFH+A +  +L++  NYLRIQ D+L G  +SVD++T ENL+KL ++G  LLKK VSK+
Sbjct  303   MVDFHLAAVTRALNSQHNYLRIQDDTLTGTDSSVDISTTENLEKLCQIGDKLLKKPVSKV  362

Query  1109  dllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             +L  G ++P +   TNE+ALKRFAK+LS+ R+ R
Sbjct  363   NLENGMFEPMEKGETNEDALKRFAKILSQERRLR  396



>ref|XP_010664585.1| PREDICTED: patatin-like protein 2 isoform X3 [Vitis vinifera]
Length=413

 Score =   439 bits (1128),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 226/381 (59%), Positives = 279/381 (73%), Gaps = 4/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP T+L FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT 
Sbjct  17    LITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTSTGGLVTAMLTT  76

Query  254   PDKNK-RPLFAAKDILPFYKEHGPKIFPQggg-lfgsikggLALLEGPKYDGKYLHKVVE  427
             P++N  RPLF+AKDI  FY EHGPKIFPQ        +   +  L GPKYDGKYLH +V+
Sbjct  77    PNENTGRPLFSAKDIKDFYLEHGPKIFPQHSHDPIPRVTKVVTALSGPKYDGKYLHNLVK  136

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+TRLHQTLT VVIPTFDIK  QP +F+  + +  P LD  LSDICIG+SAAPTY P
Sbjct  137   EKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPCLDALLSDICIGTSAAPTYLP  196

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYFE +D  G   EFNLIDGGV ANNPTLVAI  VT+ + R   PDF    PMD  RF 
Sbjct  197   AHYFETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEIIR-GSPDFFPIKPMDYGRFL  255

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGSSK  +KY A  AA WG++GWLT     PL+ VF+ AS+DMVD H++  F +L
Sbjct  256   VISLGTGSSKAEEKYNADEAAKWGLLGWLTSGGSTPLVQVFTQASADMVDLHLSEAFQAL  315

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              +  +YLRIQ D+L G  +SVD+ T+ENL  L ++G+ LLKK VS+++L TG ++P +  
Sbjct  316   HSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEPSNHE  375

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TNEEAL  F ++LS+ ++ R
Sbjct  376   -TNEEALTSFTRLLSQEKQRR  395



>emb|CBI19552.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   440 bits (1132),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 225/381 (59%), Positives = 279/381 (73%), Gaps = 4/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP T+L FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT 
Sbjct  71    LITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTSTGGLVTAMLTT  130

Query  254   PDKNK-RPLFAAKDILPFYKEHGPKIFPQggg-lfgsikggLALLEGPKYDGKYLHKVVE  427
             P++N  RPLF+AKDI  FY +H PKIFPQ        +   +  L GPKYDGKYLH +V+
Sbjct  131   PNENTGRPLFSAKDIKDFYLDHCPKIFPQHSHDPIPHVTKVVTALSGPKYDGKYLHNLVK  190

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+TRLHQTLT VVIPTFDIK  QP +F+  + +  P LD  LSDICIG+SAAPTY P
Sbjct  191   EKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDICIGTSAAPTYLP  250

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYFE +D  G   EFNLIDGGV ANNPTLVAI  VT+ + R   PDF    PMD  RF 
Sbjct  251   AHYFETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEITR-GSPDFFPIKPMDYGRFL  309

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGSSK  +KY A  AA WG++GWLT     PL+ VF+ AS DM+D H++ IF +L
Sbjct  310   VISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQASGDMIDLHLSQIFQAL  369

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              +  +YLRIQ D+L G  +SVD+ T+ENL  L ++G+ LLKK VS+++L TG ++P +  
Sbjct  370   HSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEPSNHE  429

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TNEEAL  FA++LS+ ++ R
Sbjct  430   -TNEEALTSFARLLSQEKQRR  449



>ref|XP_006424637.1| hypothetical protein CICLE_v10030027mg [Citrus clementina]
 gb|ESR37877.1| hypothetical protein CICLE_v10030027mg [Citrus clementina]
Length=408

 Score =   438 bits (1126),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 225/379 (59%), Positives = 281/379 (74%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IPATILAFLE++LQ+LDG++ RI DYFDVI+GTSTGGLVTAMLTA
Sbjct  18    LITILSIDGGGIRGVIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPLFAAKDI  FY  H PKIFPQ  G FG     +  L GPKYDGKYLH++V+E+
Sbjct  78    PNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDGKYLHRLVKEK  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD +LH+TLT VVIPTFDIKN QP +F++ E + +P LD  LSDIC+ +SAAPTY PAH
Sbjct  138   LGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDICVATSAAPTYLPAH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              FE +D  G    F+LIDGGV ANNPTLVA++ VT+ + R    D+   N MD  RF V+
Sbjct  198   SFETKDSTGKVRSFDLIDGGVAANNPTLVALNEVTKEINRGSS-DYYAINAMDYTRFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+ K   KY A  AA WG++GWL+     PL+DVF  +SSDM DFHI+T F +L +
Sbjct  257   SLGTGAPKTEAKYDALKAAKWGVLGWLSSESSTPLVDVFMQSSSDMTDFHISTAFKALHS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              + YLRIQ D+L GD ASVDV T++NL+ L  +G+ LLKK V+K++  TG  +P   +GT
Sbjct  317   ENGYLRIQDDTLTGDEASVDVATKKNLESLVGIGERLLKKPVTKVNFETGLCEP-CGQGT  375

Query  1154  NEEALKRFAKVLSENRKNR  1210
             N+EAL R A+VLS  ++ R
Sbjct  376   NDEALIRLAEVLSREKRIR  394



>ref|XP_002282481.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=413

 Score =   438 bits (1126),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 225/381 (59%), Positives = 279/381 (73%), Gaps = 4/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP T+L FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT 
Sbjct  17    LITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTSTGGLVTAMLTT  76

Query  254   PDKNK-RPLFAAKDILPFYKEHGPKIFPQggg-lfgsikggLALLEGPKYDGKYLHKVVE  427
             P++N  RPLF+AKDI  FY +H PKIFPQ        +   +  L GPKYDGKYLH +V+
Sbjct  77    PNENTGRPLFSAKDIKDFYLDHCPKIFPQHSHDPIPHVTKVVTALSGPKYDGKYLHNLVK  136

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+TRLHQTLT VVIPTFDIK  QP +F+  + +  P LD  LSDICIG+SAAPTY P
Sbjct  137   EKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDICIGTSAAPTYLP  196

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYFE +D  G   EFNLIDGGV ANNPTLVAI  VT+ + R   PDF    PMD  RF 
Sbjct  197   AHYFETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEITR-GSPDFFPIKPMDYGRFL  255

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGSSK  +KY A  AA WG++GWLT     PL+ VF+ AS DM+D H++ IF +L
Sbjct  256   VISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQASGDMIDLHLSQIFQAL  315

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              +  +YLRIQ D+L G  +SVD+ T+ENL  L ++G+ LLKK VS+++L TG ++P +  
Sbjct  316   HSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEPSNHE  375

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TNEEAL  FA++LS+ ++ R
Sbjct  376   -TNEEALTSFARLLSQEKQRR  395



>ref|XP_011099181.1| PREDICTED: patatin-like protein 1 [Sesamum indicum]
Length=399

 Score =   437 bits (1125),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 224/386 (58%), Positives = 283/386 (73%), Gaps = 7/386 (2%)
 Frame = +2

Query  62    NSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTA  241
             N    ITILSIDGGG+RGIIPA +LA+LE+QLQELDG+ VRI DYFDVIAGTSTGGLVT 
Sbjct  16    NKGNLITILSIDGGGVRGIIPAVLLAYLESQLQELDGEDVRIADYFDVIAGTSTGGLVTT  75

Query  242   MLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKV  421
             MLTAPD N RPL+AAKDI+PFY EH PKIFPQ  G F  +   +    GPKYDGKYLH +
Sbjct  76    MLTAPDTNNRPLYAAKDIVPFYLEHSPKIFPQPRGPFAGLISMMRGFHGPKYDGKYLHSL  135

Query  422   VEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTY  601
               E LG+TRLHQTLT VV+ TFDIK  QP +F++  A +   +D  LSDICI +SAAPT+
Sbjct  136   TREMLGNTRLHQTLTNVVLTTFDIKKLQPAIFSSYTAPEDSTMDALLSDICISTSAAPTF  195

Query  602   FPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQR  781
              P HYFEN+  K     FNLIDGG+ ANNPTLVAIS VT R    ++PD     PMD  R
Sbjct  196   LPPHYFENQGAK-----FNLIDGGIVANNPTLVAISEVT-REVSNENPDLFPIKPMDFGR  249

Query  782   FRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFH  961
             F V+SLGTG+ K  + Y A+ AA+WG++ WL + + +PL+  ++ A++DMVDFH A +F 
Sbjct  250   FLVISLGTGARKNEETYDARRAAHWGVVRWL-YVNPSPLLKAYNQANADMVDFHNAVVFQ  308

Query  962   SLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDD  1141
             +L +  NYLRIQ ++L GD++S+D+ T+ENL+ L +VG+ LLKK V++++  TG Y+P +
Sbjct  309   ALHSQHNYLRIQDETLTGDLSSMDIATKENLENLVKVGEELLKKPVARMNCQTGAYEPIE  368

Query  1142  ARGTNEEALKRFAKVLSENRKNRLKN  1219
               GTN +ALK FAK+LSE RK RL N
Sbjct  369   NGGTNMDALKEFAKLLSEERKVRLSN  394



>ref|XP_010942708.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=411

 Score =   438 bits (1126),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 223/390 (57%), Positives = 287/390 (74%), Gaps = 1/390 (0%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             + +T+LSIDGGG+RGIIP TILAFLE++LQELDG+  RI DYFDVIAGTSTGGLVTAMLT
Sbjct  17    RLVTVLSIDGGGVRGIIPGTILAFLESKLQELDGEDARIVDYFDVIAGTSTGGLVTAMLT  76

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             AP+KN RPLFAAKDI  FY E+  KIFPQ  G+F SI      + GPKY GKYLH  ++E
Sbjct  77    APNKNNRPLFAAKDITKFYLENSSKIFPQKNGIFSSIFNLFTAVTGPKYSGKYLHSKIQE  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LG+TRLHQ LT +VIPTFDIK  QP +F+  EA  +P  D  LSDICIG+SAAPTY PA
Sbjct  137   LLGETRLHQVLTDIVIPTFDIKLLQPTIFSTFEARHAPLKDALLSDICIGTSAAPTYLPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE +D  GN   FNL+DGGV ANNPTL A+  +T+ + +++   F    P D  +F V
Sbjct  197   HYFETKDANGNIRSFNLVDGGVAANNPTLAAMGLITKEICKENKHLFP-IKPTDYGKFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS+K  +K++A+ A+ WGI+GWL      PLI+VF+ AS+DMVD H + +F +L 
Sbjct  256   ISLGTGSAKIEEKFSAQEASKWGILGWLYDHGATPLINVFTQASADMVDIHTSAVFQALY  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + +NYLRIQ D+L G  +SVD++T+ENL KL ++G +LLKK VS+++L TG ++  +  G
Sbjct  316   SKENYLRIQDDTLIGSTSSVDISTKENLLKLVQIGNDLLKKHVSRVNLETGLFELVEGEG  375

Query  1151  TNEEALKRFAKVLSENRKNRLKNEAKLSKL  1240
             TNEEAL  FAK+LSE R+ R   +   ++L
Sbjct  376   TNEEALTHFAKLLSEERRLRCGEKCSTTEL  405



>ref|XP_008801772.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=402

 Score =   437 bits (1125),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 218/379 (58%), Positives = 286/379 (75%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +T+LSIDGGG+RGIIP TILAFLE++LQ+LDG+  RI DYFDV+AGTSTGGLVTAMLTA
Sbjct  18    LVTVLSIDGGGVRGIIPGTILAFLESKLQDLDGEDARIADYFDVVAGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+KN RPLFAA+DI  FY E+ PKIFPQ  G+  S +   +++ GPKYDGKYL  ++ E 
Sbjct  78    PNKNNRPLFAAEDIPKFYLENSPKIFPQKAGICSSTRNLFSVVTGPKYDGKYLRSIIREL  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+TRLHQ LT +VIPTFDIK   P +F+  EA  +P  D  LSDICI +SAAPTY PAH
Sbjct  138   LGETRLHQALTDIVIPTFDIKLLHPTIFSTFEARHAPLKDSLLSDICISTSAAPTYLPAH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D KGNT  FNL+DGGV ANNPTLVAIS V + + +K++ DF+   PMD  +F V+
Sbjct  198   YFETKDAKGNTRSFNLVDGGVAANNPTLVAISEVMKEILKKNE-DFSPFKPMDYGKFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS+K  ++++A+ A+ WG++GWL ++   PLID+F  AS+DMVD H + +F +L +
Sbjct  257   SLGTGSAKNEERFSAQKASKWGVLGWLYNNGATPLIDIFKQASADMVDIHASVVFQALHS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L G  +SVD++T+ENL +L ++G++LLKK VS+++L TG  +      T
Sbjct  317   TGNYLRIQDDNLTGKASSVDISTDENLLRLMQIGKDLLKKRVSRVNLETGLSEEVSEDET  376

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEE L  FAK+LS+ R+ R
Sbjct  377   NEEELMHFAKLLSDERRLR  395



>ref|XP_006488153.1| PREDICTED: patatin-3-Kuras 1-like [Citrus sinensis]
Length=408

 Score =   437 bits (1125),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 225/379 (59%), Positives = 281/379 (74%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IPATILAFLE++LQ+LDG++ RI DYFDVI+GTSTGGLVTAMLTA
Sbjct  18    LITILSIDGGGIRGVIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPLFAAKDI  FY  H PKIFPQ    FGS    +  L GPKYDGKYLH++V+E+
Sbjct  78    PNEQNRPLFAAKDIKEFYLNHCPKIFPQSSCPFGSATKLIKSLTGPKYDGKYLHRLVKEK  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD +LH+TLT VVIPTFDIKN QP +F++ E + +P LD  LSDIC+ +SAAPTY PAH
Sbjct  138   LGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDICVATSAAPTYLPAH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              FE +D  G    F+LIDGGV ANNPTLVA++ VT+ + R    D+   N MD  RF V+
Sbjct  198   TFETKDSTGKVRSFDLIDGGVAANNPTLVALNEVTKEINRGSS-DYYAINAMDYTRFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+ K   KY A  AA WG++GWL+     PL+DVF  +SSDM DFHI+T F +L +
Sbjct  257   SLGTGAPKTEAKYDALKAAKWGVLGWLSSESSTPLVDVFMQSSSDMTDFHISTAFKALHS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              + YLRIQ D+L GD ASVDV T++NL+ L  +G+ LLKK V+K++  TG  +P   +GT
Sbjct  317   ENGYLRIQDDTLTGDEASVDVATKKNLESLVGIGERLLKKPVTKVNFETGLCEP-CGQGT  375

Query  1154  NEEALKRFAKVLSENRKNR  1210
             N+EAL R AK LS+ ++ R
Sbjct  376   NDEALIRLAKDLSKEKRIR  394



>ref|XP_009769118.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana sylvestris]
Length=386

 Score =   437 bits (1123),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 235/368 (64%), Positives = 283/368 (77%), Gaps = 1/368 (0%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K ITILSIDGGGIRGIIPATIL +LE+QLQELDG+  R+ DYFD+IAGTSTGGLVTAMLT
Sbjct  20    KLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAMLT  79

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             APDK+KRPLFAAKDI PFY EHGPKIFPQ   +FGSI   L  L GPKY+GKYLH+V+EE
Sbjct  80    APDKDKRPLFAAKDIKPFYLEHGPKIFPQKKMVFGSIVKTLKSLIGPKYNGKYLHQVIEE  139

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LG+T LH+TLT VVIPTFDIKN QP +F+  EA   P +D KLSDICI +SAAPTY PA
Sbjct  140   KLGETLLHETLTNVVIPTFDIKNLQPTIFSTFEARVKPLMDAKLSDICISTSAAPTYLPA  199

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF  +D  GN  EFNL+DGGV ANNP LVA S VT R     +PDF    P+D  RF V
Sbjct  200   HYFRTQDKDGNFHEFNLVDGGVAANNPALVATSQVT-RQIMTGNPDFFPIKPIDYGRFLV  258

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGS+K  QKY AK+A+ WGI+GWL +    P++DVF+ AS DMVD HI+ +F +L 
Sbjct  259   ISIGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDLHISVVFQALH  318

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + +NYLRIQ D+L G  +SVD++T+EN+ KL E+G+ LLKK VS+++L TG  +     G
Sbjct  319   SEENYLRIQDDTLTGTDSSVDISTKENMDKLVEIGKTLLKKPVSRVNLQTGLSEQSKNDG  378

Query  1151  TNEEALKR  1174
             TNEE LKR
Sbjct  379   TNEETLKR  386



>ref|XP_006354913.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   437 bits (1124),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 236/379 (62%), Positives = 290/379 (77%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRGIIPATIL+FLE+QLQELDG   R+ DYFDV+AGTSTGGLVTAMLTA
Sbjct  16    LITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVMAGTSTGGLVTAMLTA  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+N RPL+AAKDI PFY EH PKIFPQ  GLF  I+  +  L G KYDGKYLH+VV+E+
Sbjct  76    PDENNRPLYAAKDITPFYLEHCPKIFPQKSGLFAPIRNIVQTLIGSKYDGKYLHEVVKEK  135

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             L DTRL  T+T VVIPTFDIK  QP +F+  E + +   D KLSDICIG+SAAPTY PAH
Sbjct  136   LKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLSDICIGTSAAPTYLPAH  195

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+  DGK N  E +LIDGGV ANNP L+AIS V++ +  K++PDF    PM+  RF V+
Sbjct  196   YFKVEDGKNNVREHHLIDGGVVANNPGLIAISEVSKEIF-KNNPDFYPIKPMEYGRFLVI  254

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG++KY QKY + MAA WGI+ WL H   NPLI+VF+ +S+DMVD+H + +F +L +
Sbjct  255   SLGTGAAKYEQKYNSSMAAKWGIVEWLLHKGSNPLIEVFTQSSADMVDYHNSVVFQALRS  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D+YLRIQ D L G  ASVDV T+ENL++L E+G+NLLKK +S+++L TG  +P    GT
Sbjct  315   EDSYLRIQEDELSGTEASVDVATKENLERLVEIGENLLKKPLSRVNLETGLSEPIPKGGT  374

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEALKRFA +L   R+ R
Sbjct  375   NEEALKRFATLLVNERRLR  393



>ref|XP_010664584.1| PREDICTED: patatin-like protein 2 isoform X2 [Vitis vinifera]
 emb|CBI19548.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   437 bits (1123),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 224/381 (59%), Positives = 279/381 (73%), Gaps = 4/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP T+L FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT 
Sbjct  17    LITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTSTGGLVTAMLTT  76

Query  254   PDKNK-RPLFAAKDILPFYKEHGPKIFPQggg-lfgsikggLALLEGPKYDGKYLHKVVE  427
             P++N  RPLF+AKDI  FY +H PKIFPQ        +   +  L GPKYDGKYLH +V+
Sbjct  77    PNENTGRPLFSAKDIKDFYLDHCPKIFPQHSHDPIPHVTKVVTALSGPKYDGKYLHNLVK  136

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+TRLHQTLT VVIPTFDIK  QP +F+  + +  P LD  LSDICIG+SAAPTY P
Sbjct  137   EKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDICIGTSAAPTYLP  196

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYFE +D  G   EFNLIDGGV ANNPTLVAI  VT+ + R   PDF    PMD  RF 
Sbjct  197   AHYFETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEIIR-GSPDFFPIKPMDYGRFL  255

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGSSK  +KY A  AA WG++GWLT     PL+ VF+ AS DM+D H++ +F +L
Sbjct  256   VISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQASGDMIDLHLSELFQAL  315

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              +  +YLRIQ D+L G  +SVD+ T+ENL  L ++G+ LLKK VS+++L TG ++P +  
Sbjct  316   HSEKSYLRIQDDTLRGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEPSNHE  375

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TNEEAL  FA++LS+ ++ R
Sbjct  376   -TNEEALTSFARLLSQEKQRR  395



>ref|XP_002284571.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=425

 Score =   437 bits (1124),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 225/381 (59%), Positives = 279/381 (73%), Gaps = 4/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP T+L FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT 
Sbjct  29    LITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTSTGGLVTAMLTT  88

Query  254   PDKNK-RPLFAAKDILPFYKEHGPKIFPQggglfg-sikggLALLEGPKYDGKYLHKVVE  427
             P++N  RPLF+AKDI  FY EH P IFPQ   +    +   +  L GPKYDGKYLH +V+
Sbjct  89    PNENTGRPLFSAKDIKDFYLEHCPMIFPQHSYVPIPYVTKAVTSLSGPKYDGKYLHNLVK  148

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+T+LHQTLT VVIPTFDIK  QP +F+  + +  P LD  LSDICIG+SAAPTY P
Sbjct  149   EKLGETQLHQTLTNVVIPTFDIKCLQPTIFSTYQVKSRPSLDALLSDICIGTSAAPTYLP  208

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYFE +D  G   EFNLIDGGV ANNP LVAI  VTQ + R   PDF    PMD  RF 
Sbjct  209   AHYFETKDPTGRVREFNLIDGGVAANNPALVAIGEVTQEIIR-GSPDFFPIKPMDYGRFL  267

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGSSK  +KY A  AA WG++GWLT     PL+DVF+ AS DMVD H++ +F +L
Sbjct  268   VISLGTGSSKAEEKYNADQAAEWGLLGWLTSGGSTPLVDVFTQASGDMVDLHLSQVFQAL  327

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              +  +YLRIQ D+L G  +SVD+ T+ENL  L ++G+ LLKK VS+++L TG ++P +  
Sbjct  328   HSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGVFEPSNHE  387

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TNEEAL  FA++LS+ ++ R
Sbjct  388   -TNEEALTSFARLLSQEKQRR  407



>ref|XP_009380972.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=402

 Score =   436 bits (1121),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 221/381 (58%), Positives = 284/381 (75%), Gaps = 2/381 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K +T+LSIDGGG+RG+IPAT+LAFLE++LQELDG   RI DYFDVIAGTSTGGLVTAMLT
Sbjct  17    KLVTVLSIDGGGVRGLIPATLLAFLESKLQELDGADARIADYFDVIAGTSTGGLVTAMLT  76

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggL-ALLEGPKYDGKYLHKVVE  427
             APDK+KRPLF AK I+ FY ++ PKIFP+      +    L   + GPKYDGKYLH  V+
Sbjct  77    APDKDKRPLFTAKQIIQFYLDNCPKIFPRKKAGLLNPLLNLFGAVTGPKYDGKYLHSKVQ  136

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             + LGDT+L QTLT VVIPTFDIK  QP++F+  E + +P  D  LSD+C+ +SAAPTY P
Sbjct  137   QLLGDTKLSQTLTNVVIPTFDIKFLQPIIFSTFETKSTPLKDALLSDVCVSTSAAPTYLP  196

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
              H FE +D +G+T EFNLIDGGV ANNPTL A++ VT+ +   ++ DF    P+D  RF 
Sbjct  197   GHCFETKDDEGSTREFNLIDGGVAANNPTLTAMNQVTKEIFM-ENADFFPIKPVDYGRFL  255

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGS+K  ++++A+ +  WG++GWL +    P+ID+FS AS+DMVD H + +F +L
Sbjct  256   VISLGTGSNKQEERFSAEESGKWGLLGWLYNKGTTPIIDIFSQASADMVDIHASVLFQAL  315

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              +  +YLRIQ D+L GD ASVDV+T ENL+KL EVG NLLKK VS+++L  G ++P D  
Sbjct  316   HSEQHYLRIQEDALVGDTASVDVSTRENLEKLMEVGGNLLKKPVSRVNLENGTFEPCDGE  375

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
             GTNEEAL RFA+ LS  RK R
Sbjct  376   GTNEEALTRFARRLSSERKLR  396



>ref|XP_010064187.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66460.1| hypothetical protein EUGRSUZ_F00256 [Eucalyptus grandis]
Length=421

 Score =   437 bits (1123),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 234/394 (59%), Positives = 282/394 (72%), Gaps = 8/394 (2%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP TILAFLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT 
Sbjct  17    LITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD N RPLFAAKDI  FY ++ PKIFPQ    F      +  + GPKYDGKYLHK+V+E+
Sbjct  77    PDDNNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLHKLVKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+ RLHQTLT VVIPTFDIK  QP +F++ E + +P LD  LSDICI +SAAPTY PAH
Sbjct  137   LGNARLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKTPTLDALLSDICISTSAAPTYLPAH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D  G   EFNLIDGGV ANNPTLVA+  VT+ +      DF    PMD +RF V+
Sbjct  197   YFETQDSTGKLREFNLIDGGVAANNPTLVAMGEVTKEIIGGSS-DFFPIKPMDYRRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS     KY A  AA WG++ WLT + G+PLIDVF  AS+DMVDFH++ +F +L  
Sbjct  256   SLGTGSRNSEGKYDASEAAKWGVLNWLTCNGGSPLIDVFMQASADMVDFHLSAVFQALHL  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L G VASVD+ T++NL  L   G+ LLKK VSK+DL  G  +  +   T
Sbjct  316   EANYLRIQDDNLSGAVASVDIATKKNLNDLVRTGEALLKKPVSKVDLEKGGCEACNLE-T  374

Query  1154  NEEALKRFAKVLSENRKNRL------KNEAKLSK  1237
             NE+AL+RFAK+LS  R+ RL      +N A L +
Sbjct  375   NEQALRRFAKMLSNERQLRLARSPHGRNSANLKR  408



>ref|XP_010064188.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66466.1| hypothetical protein EUGRSUZ_F00263 [Eucalyptus grandis]
Length=407

 Score =   436 bits (1121),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 226/379 (60%), Positives = 277/379 (73%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP TIL FLE++LQ+LDG+  RI DYFDVI+GTSTGGLVTAMLT 
Sbjct  17    LITILSIDGGGIRGLIPGTILNFLESELQKLDGEDARIADYFDVISGTSTGGLVTAMLTT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RP+FAAKDI  FY +H PKIFPQ    F  +   +  + GPKYDGKYLHKVV E 
Sbjct  77    PNEKNRPVFAAKDIKDFYLKHCPKIFPQDSCPFKPVTKMIKAVAGPKYDGKYLHKVVREE  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD RLHQTLT VVIPTFDIK+ QP +F++ + +  P +D  LSDICI +SAAPTY PAH
Sbjct  137   LGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQVKKDPSVDALLSDICISTSAAPTYLPAH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              FE  D  G   EFNLIDGGV ANNPTLVA+  VT+ +      DF    PMD +RF V+
Sbjct  197   KFETEDPTGKVREFNLIDGGVAANNPTLVAMGEVTKTIVGGSS-DFFPIKPMDYRRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+ K   KYTA  AA WG++GWLT S G PLIDVF+ AS+DMVD+H++ +F +L  
Sbjct  256   SLGTGTGKVEGKYTAHEAAKWGVLGWLT-SGGTPLIDVFTQASADMVDYHLSAVFQALQL  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G ++SVDV T++NL  L + G+ LLKK  S+++L  G  +P   + T
Sbjct  315   HDNYLRIQDDTLSGVLSSVDVATKKNLTDLVKTGEALLKKPASRVNLENGVCEPTPNQET  374

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL RFAK+LS+ R+ R
Sbjct  375   NEEALIRFAKLLSQERQLR  393



>ref|XP_008361010.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=401

 Score =   436 bits (1120),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 226/381 (59%), Positives = 281/381 (74%), Gaps = 3/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              I++LSIDGGGIRG+IP TILAFLE++LQ+LDG+  R+ DYFDVI+GTSTGGLVTAMLT 
Sbjct  17    LISVLSIDGGGIRGLIPGTILAFLESELQKLDGEDARLADYFDVISGTSTGGLVTAMLTT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVVEE  430
             PD+N RPLFAAKDI  FY    PKIFPQ  G     I   +  L GPKY+G YLH +V +
Sbjct  77    PDENNRPLFAAKDIKDFYLTESPKIFPQKTGSLFPHIAKIIKRLTGPKYNGNYLHSLVRQ  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LG+ +LHQTLT VVIPTFDIKN QP +F++ EA+  P  D  +SDICI +SAAPTY PA
Sbjct  137   KLGEKKLHQTLTNVVIPTFDIKNLQPTIFSSFEAKHKPPFDALVSDICIATSAAPTYLPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE +D  GN  EFNLIDGGV ANNPTLVAI  VT+++  K  PDF    PMD  R+ V
Sbjct  197   HYFETKDHNGNVREFNLIDGGVAANNPTLVAIGEVTKQII-KGSPDFFPIKPMDYGRYLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGSSK   KY+A  AA WG++ WLT     P+IDVFS  S+DMVD +++ +F +L 
Sbjct  256   ISLGTGSSKVELKYSAHNAAKWGLLNWLTSGGSTPIIDVFSQGSADMVDLNLSVVFQALH  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             +  NYLRIQ D L GDV+SVD+ TE+NL  L +VG+ LLK+ VS+++L TG+++  +   
Sbjct  316   SEKNYLRIQDDKLHGDVSSVDIATEKNLDNLVKVGEGLLKQPVSRVNLETGKFEVCNHE-  374

Query  1151  TNEEALKRFAKVLSENRKNRL  1213
             TNEEAL RFAK+LSE +  RL
Sbjct  375   TNEEALIRFAKLLSEEKWLRL  395



>ref|XP_004501587.1| PREDICTED: patatin-3-Kuras 1-like isoform X2 [Cicer arietinum]
Length=402

 Score =   436 bits (1120),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 231/394 (59%), Positives = 299/394 (76%), Gaps = 8/394 (2%)
 Frame = +2

Query  29    SQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVI  208
             +QSS          K +TILSIDGGGIRGIIPATIL +LE QLQELDG+  R+ DYFDVI
Sbjct  6     TQSSLLQIQPPTYGKLVTILSIDGGGIRGIIPATILEYLETQLQELDGESARLADYFDVI  65

Query  209   AGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEG  388
              GTSTGGLVTAMLTAP+ N+RPLFAAKDI PFY EH PKIFPQ   LF S       L G
Sbjct  66    TGTSTGGLVTAMLTAPNHNQRPLFAAKDIKPFYLEHCPKIFPQHKYLFRS-------LAG  118

Query  389   PKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSD  568
             PKYDGKYLH +V E+LG+ R+H+TLT +VIPTFDIK  QP++F++ + + +P  D +LSD
Sbjct  119   PKYDGKYLHDMVREKLGEIRVHETLTNIVIPTFDIKTMQPIIFSSYKVKTTPCFDARLSD  178

Query  569   ICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPD  748
             ICIG+SAAPTY P + F+N+D  GNT EFNLIDGGVCANNPTLVA++ VT+++  +++ D
Sbjct  179   ICIGTSAAPTYLPGYNFKNQDEDGNTHEFNLIDGGVCANNPTLVAVNEVTKQIINQNN-D  237

Query  749   FAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSD  928
             F    PM+  RF ++SLGTG+ K  QK+ +K+AA WG++ WLTH    PLID+FS +S D
Sbjct  238   FDSIKPMEYSRFLIISLGTGTPKNEQKFDSKLAAKWGLLDWLTHGGSTPLIDMFSQSSGD  297

Query  929   MVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskl  1108
             MVD+++AT+  +L++ DNYLRIQ D+L G  +SVD+ T+ENL KL ++G+ LLKK +S +
Sbjct  298   MVDYNLATVTQALNSQDNYLRIQDDTLTGIDSSVDIATKENLDKLCQIGERLLKKPLSNV  357

Query  1109  dllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             +L TG ++P   R TN++ALKRFAK+LS+ R+ R
Sbjct  358   NLETGVFEPTQNRETNQDALKRFAKILSQERRLR  391



>ref|XP_007227183.1| hypothetical protein PRUPE_ppa019615mg [Prunus persica]
 gb|EMJ28382.1| hypothetical protein PRUPE_ppa019615mg [Prunus persica]
Length=383

 Score =   435 bits (1118),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 221/379 (58%), Positives = 282/379 (74%), Gaps = 9/379 (2%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IPATIL+FLE++LQ+LDG+  RI DYFDV+AGTSTGGLVTAMLT 
Sbjct  1     MITILSIDGGGIRGLIPATILSFLESELQKLDGEDARIADYFDVVAGTSTGGLVTAMLTT  60

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++N RPLF+AKDI  FY  H PKIFPQ   +       +  L GPKYDGKYLH ++ ++
Sbjct  61    PNENDRPLFSAKDISDFYMNHCPKIFPQKKKI-------IKALGGPKYDGKYLHGLIRQK  113

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGDT++ QTLT VVIPTFDIKN QP VF++      P  +  LSD+CIG+SAAPT+ PAH
Sbjct  114   LGDTKMDQTLTNVVIPTFDIKNLQPTVFSSFRVRHKPSYNALLSDVCIGTSAAPTFLPAH  173

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D  G T EFNLIDGGV ANNPTL+AI  VT  + +K +PDF    P+D  RF V+
Sbjct  174   YFETKDEFGQTREFNLIDGGVAANNPTLLAICEVTNEI-KKANPDFFPVKPVDYGRFLVI  232

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+SK   KY +  AA WG++ WLT     P+I+VFS AS+DMVD H++ +F +L +
Sbjct  233   SLGTGTSKAELKYNSHTAAKWGLLNWLTSGGTTPIINVFSQASADMVDLHLSGVFQALHS  292

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRIQ D+L G V+SVDV T++NL +L  VG+ LLK+ VS+++L +G+++  D R T
Sbjct  293   EDYYLRIQDDTLRGTVSSVDVATKKNLSRLVTVGEGLLKERVSRVNLDSGRFEASD-RET  351

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL+R AK+LSE ++ R
Sbjct  352   NEEALRRVAKLLSEEKRLR  370



>emb|CBI19544.3| unnamed protein product [Vitis vinifera]
Length=460

 Score =   438 bits (1126),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 225/381 (59%), Positives = 279/381 (73%), Gaps = 4/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP T+L FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT 
Sbjct  64    LITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTSTGGLVTAMLTT  123

Query  254   PDKNK-RPLFAAKDILPFYKEHGPKIFPQggglfg-sikggLALLEGPKYDGKYLHKVVE  427
             P++N  RPLF+AKDI  FY EH P IFPQ   +    +   +  L GPKYDGKYLH +V+
Sbjct  124   PNENTGRPLFSAKDIKDFYLEHCPMIFPQHSYVPIPYVTKAVTSLSGPKYDGKYLHNLVK  183

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+T+LHQTLT VVIPTFDIK  QP +F+  + +  P LD  LSDICIG+SAAPTY P
Sbjct  184   EKLGETQLHQTLTNVVIPTFDIKCLQPTIFSTYQVKSRPSLDALLSDICIGTSAAPTYLP  243

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYFE +D  G   EFNLIDGGV ANNP LVAI  VTQ + R   PDF    PMD  RF 
Sbjct  244   AHYFETKDPTGRVREFNLIDGGVAANNPALVAIGEVTQEIIR-GSPDFFPIKPMDYGRFL  302

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGSSK  +KY A  AA WG++GWLT     PL+DVF+ AS DMVD H++ +F +L
Sbjct  303   VISLGTGSSKAEEKYNADQAAEWGLLGWLTSGGSTPLVDVFTQASGDMVDLHLSQVFQAL  362

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              +  +YLRIQ D+L G  +SVD+ T+ENL  L ++G+ LLKK VS+++L TG ++P +  
Sbjct  363   HSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGVFEPSNHE  422

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TNEEAL  FA++LS+ ++ R
Sbjct  423   -TNEEALTSFARLLSQEKQRR  442



>ref|XP_007226655.1| hypothetical protein PRUPE_ppa021897mg [Prunus persica]
 gb|EMJ27854.1| hypothetical protein PRUPE_ppa021897mg [Prunus persica]
Length=407

 Score =   436 bits (1120),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 228/381 (60%), Positives = 280/381 (73%), Gaps = 3/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRG+IP TILAFLE++LQ+LDG+  R+ DYFDVIAGTSTGGLVTAMLTA
Sbjct  17    LITVLSIDGGGIRGLIPGTILAFLESELQKLDGEDARLADYFDVIAGTSTGGLVTAMLTA  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVVEE  430
             PD+N RPLFAA DI  FY    PKIFPQ        +   +  L GPKY+GKYLH +V +
Sbjct  77    PDENNRPLFAANDIKEFYLNECPKIFPQNTCPLFPHVTKIIKALTGPKYNGKYLHSLVRQ  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LGD +LHQTLT VVIPTFDI+N QP +F++ E    P  D  LSDICIG+SAAPTY PA
Sbjct  137   KLGDKKLHQTLTNVVIPTFDIRNLQPTIFSSFEVNHKPCFDALLSDICIGTSAAPTYLPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE +DG+GN  EFNLIDGGV ANNPTL+AI  VT+ +  K   DF    PMD  RF V
Sbjct  197   HYFETKDGEGNVKEFNLIDGGVAANNPTLLAIGEVTKAII-KGSSDFFPIKPMDYGRFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS K   KY A  AA WG++ WLT     P+I+VFS +S+DMVD +++ +F +L 
Sbjct  256   ISLGTGSPKDEVKYNAHDAAKWGMLNWLTSGGSTPIINVFSYSSADMVDLNLSVVFQALH  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             +  NYLRIQ D L+GDVASVDV TE+NL  L +VG+ LLK+ VS+++L TG+++  +   
Sbjct  316   SEKNYLRIQDDKLQGDVASVDVATEKNLDSLVKVGEGLLKQPVSRVNLETGKFEACNHE-  374

Query  1151  TNEEALKRFAKVLSENRKNRL  1213
             TNEEAL RFAK+LSE +  RL
Sbjct  375   TNEEALTRFAKLLSEEKWLRL  395



>ref|XP_002282391.3| PREDICTED: uncharacterized protein LOC100264244 [Vitis vinifera]
Length=1152

 Score =   458 bits (1179),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 251/388 (65%), Positives = 301/388 (78%), Gaps = 4/388 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIPATILA LE+QLQ +DG   RI DYFDVIAGTSTGGLVTAMLTA
Sbjct  17    LVTILSIDGGGIRGIIPATILALLESQLQAVDGDDARIADYFDVIAGTSTGGLVTAMLTA  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD  KRPLFAAK+I+PFY EHGPKIFP+  G+FG I   +  L GPKYDGKYL ++++E+
Sbjct  77    PDDQKRPLFAAKEIMPFYLEHGPKIFPETRGIFGWIMSIVRSLIGPKYDGKYLKRIIKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG TRLH+TLT VVIPTFDIK+ QP +F+  E + SP LD  L+DICIGSSAAPTYFP H
Sbjct  137   LGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAPTYFPGH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+N+D +G T EFNLIDGGV ANNP LVAI+ VT+++  K +PDF    PMD  RF V+
Sbjct  197   YFKNQDKEGKTQEFNLIDGGVAANNPALVAITQVTKQVFDK-NPDFFPIKPMDFGRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS K  QKY AKMA+ WG++GWL H    PL+DVF  AS+DMVDFHI+ +F +L +
Sbjct  256   SIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQALHS  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G  ASVDVTTEENL  L ++G+ LLKK VS+++L TG  +P +  GT
Sbjct  316   EDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENGGT  375

Query  1154  NEEALKRFAKVLSEN---RKNRLKNEAK  1228
             NEEALKRFAK+LS+    R+ RL N  K
Sbjct  376   NEEALKRFAKLLSDEKRLRETRLPNPKK  403



>ref|XP_006434815.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
 gb|ESR48055.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
Length=408

 Score =   436 bits (1120),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 225/379 (59%), Positives = 281/379 (74%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IPATILAFLE++LQ+LDG++ RI DYFDVI+GTSTGGLVTAMLTA
Sbjct  18    LITILSIDGGGIRGVIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPLFAAKDI  FY  H PKIFPQ    FGS    +  L GPKYDGKYLH++V+E+
Sbjct  78    PNEQNRPLFAAKDIKEFYLNHCPKIFPQSSCPFGSATKLIKSLTGPKYDGKYLHRLVKEK  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD +LH+TLT VVIPTFDIKN QP +F++ E + +P LD  LSDIC+ +SAAPTY PAH
Sbjct  138   LGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDICVATSAAPTYLPAH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              FE +D  G    F+LIDGGV ANNPTLVA++ VT+ + R    D+   N MD  RF V+
Sbjct  198   SFETKDCTGKVRSFDLIDGGVAANNPTLVALNEVTKEINRGSS-DYYAINAMDYTRFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+ K   KY A  AA WG++GWL+     PL+DVF  +SSDM DFHI+T F +L +
Sbjct  257   SLGTGAPKTEVKYDAIKAAKWGVLGWLSSESSTPLVDVFMQSSSDMTDFHISTAFKALHS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              + YLRIQ D+L GD ASVDV T++NL+ L  +G+ LLKK V+K++  TG  +P   +GT
Sbjct  317   ENGYLRIQDDTLTGDEASVDVATKKNLESLVGIGERLLKKPVTKVNFETGLCEP-CGQGT  375

Query  1154  NEEALKRFAKVLSENRKNR  1210
             N+EAL R AK LS+ ++ R
Sbjct  376   NDEALIRLAKDLSKEKRIR  394



>ref|XP_007017304.1| Phospholipase A 2A, IIA,PLA2A isoform 2 [Theobroma cacao]
 gb|EOY14529.1| Phospholipase A 2A, IIA,PLA2A isoform 2 [Theobroma cacao]
Length=438

 Score =   436 bits (1122),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 284/385 (74%), Gaps = 7/385 (2%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRG+IP TILAFLE+QLQ+LDG++ R+ DYFDVIAGTSTGGLVTAMLT 
Sbjct  31    LITVLSIDGGGIRGLIPGTILAFLESQLQKLDGEQARLADYFDVIAGTSTGGLVTAMLTT  90

Query  254   PDKN--KRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVE  427
             P+     RPLFAAKDI+ FY EH PKIFPQ    F      +  L GPKYDGKYLH +V 
Sbjct  91    PNPEVGNRPLFAAKDIIDFYLEHCPKIFPQDSSPFAPAANVVKSLMGPKYDGKYLHDIVR  150

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+TRLHQTLT VVIPTFDIK  QP +F++ E + +P  D  LSDICIG+SAAPTY P
Sbjct  151   EKLGETRLHQTLTNVVIPTFDIKQLQPKIFSSYEVKSNPSKDALLSDICIGTSAAPTYLP  210

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AH+F+++D  G   EFNLIDGGV ANNP LVAI+ V++ + R  +P+F    P D  RF 
Sbjct  211   AHHFQSQDSTGKPIEFNLIDGGVAANNPALVAINEVSKEILR-GNPEFFPIKPTDYARFL  269

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGS K  +KY A +AA WGI+GWLT     PL+D+F  ASSDMVDFHIAT+F +L
Sbjct  270   VVSLGTGSPKSEEKYHANLAAKWGILGWLTSEHSTPLVDIFMQASSDMVDFHIATLFQAL  329

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + D+YLRIQ D+L   ++SVDV T+ENL+ L + G+ LLKK VS+++L  G+ +P    
Sbjct  330   QSEDSYLRIQDDTLSQQMSSVDVATKENLENLVKAGEELLKKPVSRVNLEDGKSEP-AGT  388

Query  1148  GTNEEAL-KRFAKVLSENRKNRLKN  1219
              TNE+AL  R A+ LS  R+ RL++
Sbjct  389   VTNEKALISRLAEALS--REKRLRD  411



>emb|CBI21444.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   436 bits (1122),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 228/379 (60%), Positives = 287/379 (76%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGG+RGIIP  ILAFLE++LQ+LDG+  R+ DYFDVIAGTSTGGL+TAMLTA
Sbjct  20    LITILSIDGGGVRGIIPGIILAFLESELQKLDGEDARLADYFDVIAGTSTGGLITAMLTA  79

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPL+AA  I PFY E+ PKIFP   G+FG+I     +L GPKYDGKYLH +++  
Sbjct  80    PNQENRPLYAASGIKPFYLENCPKIFPPRSGIFGTIVNLFKVLTGPKYDGKYLHNLLKNV  139

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD RLHQTLT VVIPTFDIK  QP +F++ +   +P LD KLSDICIG+SAAPTY PAH
Sbjct  140   LGDKRLHQTLTNVVIPTFDIKKLQPTIFSSYQVAINPALDAKLSDICIGTSAAPTYLPAH  199

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFEN+D + N  EFNLIDGG+ ANNP LVAIS VT+++  K +PDF    PMD  RF V+
Sbjct  200   YFENQDDQENNEEFNLIDGGLAANNPCLVAISEVTKQVFNK-NPDFFPIKPMDYGRFLVI  258

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K   KYTAKMAA WG++GWL  +    L    S AS+DMVDFH   +F +L +
Sbjct  259   SVGTGSAKEEYKYTAKMAAKWGVLGWLYDNGSTLLSPRVSGASADMVDFHNCVVFEALHS  318

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              +NYLRI  D+L+G VASV++ T++NL  L ++G+ LLKK VS+++L TG+Y+P    GT
Sbjct  319   EENYLRIDDDTLKGTVASVNIATKKNLDSLVKLGEELLKKPVSRVNLDTGKYEPIKNGGT  378

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL RFAK+LS+ ++ R
Sbjct  379   NEEALIRFAKLLSDEKRLR  397



>ref|XP_009801077.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=403

 Score =   435 bits (1119),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 234/380 (62%), Positives = 285/380 (75%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRGIIPATIL+FLEAQLQELDG   R+ DYFDVIAGTSTGGLVTAMLTA
Sbjct  16    LITVLSIDGGGIRGIIPATILSFLEAQLQELDGNDARLADYFDVIAGTSTGGLVTAMLTA  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA-LLEGPKYDGKYLHKVVEE  430
             PD+N RPL+AAKDI PFY EH PKIFPQ      +  G +   + GPKYDGKYLH+VV+E
Sbjct  76    PDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYLHEVVKE  135

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +L DTRL  T+T VVIPTFDIK  QP +F+  E + S   D KLSDICI +SAAPTY PA
Sbjct  136   KLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKLSDICISTSAAPTYLPA  195

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF+  DGKGN  E +LIDGGV ANNP L+A+S V++ +  KD+PDF    PMD  RF V
Sbjct  196   HYFKVEDGKGNVKEHHLIDGGVAANNPALIAVSEVSKEIL-KDNPDFFPIKPMDYGRFLV  254

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGS+K+  KY A M A WGI+ WL H    PLI+VF+ +S+D+VD+H + +F +L 
Sbjct  255   ISIGTGSAKWEHKYNASMTAKWGIVDWLFHKGSTPLIEVFTQSSADLVDYHNSVVFQALR  314

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
               DNYLRIQ D L G  ASVD+ T+ENL++L E+GQNLLKK +S+++L TG  +P    G
Sbjct  315   CDDNYLRIQEDELNGTEASVDIATKENLERLVEIGQNLLKKPLSRVNLETGLAEPIPKGG  374

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEEALKRFA++L   R+ R
Sbjct  375   TNEEALKRFARLLVNERRLR  394



>ref|XP_002510258.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF52445.1| Patatin T5 precursor, putative [Ricinus communis]
Length=411

 Score =   436 bits (1120),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 222/380 (58%), Positives = 284/380 (75%), Gaps = 4/380 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             +TILSIDGGGIRG+IP TIL+FLE++LQ+LDG++ RI DYFDVIAGTSTGGLVTAMLTAP
Sbjct  20    VTILSIDGGGIRGLIPTTILSFLESELQKLDGEEARIADYFDVIAGTSTGGLVTAMLTAP  79

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLAL-LEGPKYDGKYLHKVVEER  433
             D+N RPLFAAKDI  FY  H PKIFPQ      S    +   + GPKY+GKYLH +V E+
Sbjct  80    DENNRPLFAAKDIKDFYLNHCPKIFPQPKWPLFSQVKKVVKGISGPKYNGKYLHGLVREK  139

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG  RLH+TLT +VIPTFDIK  QP +F++ E +  P LD  LSDICI +SAAPTY PAH
Sbjct  140   LGKRRLHETLTNIVIPTFDIKQLQPTIFSSYEVKKQPSLDALLSDICISTSAAPTYLPAH  199

Query  614   YFENRDGK-GNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             YFE ++ + G   EFNLIDGGV ANNP LVAI  VT+ +   +  DF    PMD  RF V
Sbjct  200   YFETKEKQTGKVREFNLIDGGVAANNPALVAIGEVTKEILGGNS-DFFPIKPMDYGRFLV  258

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGS K ++KY A  A+ WG++GWL      PL+DVF+ ASSDMVD+H++ +F +L 
Sbjct  259   ISIGTGSPKAARKYNAIKASKWGVLGWLNSGGSTPLVDVFTQASSDMVDYHLSAVFQALH  318

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             +  +YLRIQ D+L G  +SVD+ T+ NLK L ++G+ LLKK VS+++L TG+++P D +G
Sbjct  319   SEQHYLRIQDDTLNGKESSVDIATKSNLKNLVKIGERLLKKPVSRVNLETGRFEPID-QG  377

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEEAL+RFA++LSE ++ R
Sbjct  378   TNEEALERFARILSEEKRLR  397



>ref|XP_009370176.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=406

 Score =   434 bits (1117),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 222/381 (58%), Positives = 280/381 (73%), Gaps = 3/381 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K +TILSIDGGGIRG++PATILAFLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAML 
Sbjct  15    KIVTILSIDGGGIRGLLPATILAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLA  74

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVVE  427
             AP++N RPLFAAKDI+ FY    PKIFPQ            +  L GPKY+GKYLH+++ 
Sbjct  75    APNENNRPLFAAKDIIDFYLNQCPKIFPQKTWPIFPYTTKIIKALAGPKYNGKYLHRLIR  134

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             ERLG+ +LH TLT VVIPTFDIKN QP +F++ + +  P  D  LSDICIG+SAAPTY P
Sbjct  135   ERLGNKKLHDTLTNVVIPTFDIKNLQPAIFSSFKVKKKPSYDALLSDICIGTSAAPTYLP  194

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYFE ++  G T EFNLIDGGV ANNPT +A+S VT  + RK +PD     PMD  RF 
Sbjct  195   AHYFETKNAAGRTREFNLIDGGVAANNPTSLAVSEVTTEI-RKANPDVFPIKPMDYGRFL  253

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGSSK   KY A+ AA WG++ WLT     P+I+VFS AS+DMVD H+++ F +L
Sbjct  254   VISLGTGSSKAEMKYHARSAAKWGLLNWLTSGGSTPIINVFSQASADMVDLHLSSAFQAL  313

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + +NYLRIQ D+L G + SVD  T++NL  L +VG+ LLKK VS+++L +G+++     
Sbjct  314   HSEENYLRIQDDTLIGTITSVDRATKKNLTNLVKVGEGLLKKPVSRVNLDSGRFEATKHE  373

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TN EAL RFAK+LSE ++ R
Sbjct  374   -TNAEALIRFAKLLSEEKRRR  393



>ref|XP_010059969.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
Length=407

 Score =   434 bits (1117),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 219/380 (58%), Positives = 280/380 (74%), Gaps = 1/380 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGG+RG++P  ILAFLE++LQ+LDG+  R+ DYFDVIAGTSTGGLVTAMLT+
Sbjct  17    LITILSIDGGGMRGLVPGAILAFLESELQKLDGEDARLADYFDVIAGTSTGGLVTAMLTS  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PDK+ RPLF AKDI  F+  + PKIFPQ    F      +  + GPKYDGKYLHK+++E+
Sbjct  77    PDKHNRPLFTAKDIKDFFLNNCPKIFPQDSCPFAPATNMIKAVTGPKYDGKYLHKLIKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+TRL+QTLT VVIPTFD K  QP +F++ E +  P +D  LSD+CI +SAAPTY PAH
Sbjct  137   LGNTRLNQTLTNVVIPTFDAKQLQPTIFSSYEVKKKPSIDALLSDVCISTSAAPTYLPAH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D  G   EFNLI GGV ANNPTLVA+  V + +      DF   NPMD +RF V+
Sbjct  197   YFETQDPTGKVREFNLIVGGVAANNPTLVAMGEVRKEIIGGSS-DFFPINPMDYRRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS+K   KY A  AA WG++ WL+ + G+PLIDV   AS+DMVDFH++ +F +L  
Sbjct  256   SLGTGSAKVEGKYNASEAAKWGVLSWLSSNGGSPLIDVLMQASADMVDFHLSVVFQALLI  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L G VASVD+  ++N+  L + G+ LLKK VS+++L TG+Y+P   + T
Sbjct  316   EANYLRIQDDTLSGAVASVDIAMKKNMNDLVKTGEALLKKPVSRVNLETGRYEPTPNQET  375

Query  1154  NEEALKRFAKVLSENRKNRL  1213
             NEEAL+RFAK+LS+ R+ RL
Sbjct  376   NEEALRRFAKLLSQERQLRL  395



>ref|XP_010268994.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=409

 Score =   434 bits (1117),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 236/379 (62%), Positives = 293/379 (77%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIP TILAFLE+QLQ+LDG+  R+ DYFDVIAGTSTGGLVTAMLTA
Sbjct  18    LVTILSIDGGGIRGIIPGTILAFLESQLQKLDGEDARLADYFDVIAGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++N RPLFAAKDI+PFY E  PKIFPQ  G+FGS    + L+ GPKYDGKYLH +VE++
Sbjct  78    PNENNRPLFAAKDIVPFYLEDCPKIFPQTSGIFGSALNLIKLMNGPKYDGKYLHSLVEKK  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+TRLHQTLT +VIPTFDIK  QP +F++ E + S  +D +LSDICI +SAAPTY PA+
Sbjct  138   LGETRLHQTLTNIVIPTFDIKRLQPTIFSSYEVKKSSTMDARLSDICISTSAAPTYLPAY  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+ +D  GN  EFNLIDGGV ANNP LVAIS VT+++  K++PDF    PMD  RF V+
Sbjct  198   YFKTQDQDGNEREFNLIDGGVTANNPALVAISEVTKQIT-KENPDFFPIKPMDYGRFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTG++K  QKY A MA  WGII WL +    PL+DVF+ AS DMVD+H A +F +L +
Sbjct  257   SIGTGTAKMEQKYNANMATKWGIIQWLVNGGSTPLVDVFTQASGDMVDYHNAVVFQALKS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
             G +YLRIQ D+L G+++SVD+ T+ENL  L + G+ LLKK VS ++L TG ++P    GT
Sbjct  317   GSSYLRIQDDTLVGEISSVDIATKENLDNLVKAGEALLKKPVSGVNLQTGIFEPITNGGT  376

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEALK+FAK LS  R+ R
Sbjct  377   NEEALKKFAKQLSVERRLR  395



>ref|XP_010064132.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=406

 Score =   433 bits (1114),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 223/378 (59%), Positives = 278/378 (74%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             ITILSIDGGGIRG+IP TIL  LE++LQ+LDG+  RI DYFDVI+GTSTGGLVTAML  P
Sbjct  18    ITILSIDGGGIRGLIPGTILHLLESELQKLDGEDARIVDYFDVISGTSTGGLVTAMLATP  77

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             D+N RP+ AAKDI  FY  H PKIFPQ    F  +   +  + GPKY+GKYLH VV E L
Sbjct  78    DENNRPVVAAKDIKDFYLNHCPKIFPQDSCPFKPVTKRIKAMAGPKYNGKYLHSVVREEL  137

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             GD RLHQTLT VVIPTFDIK+ QP +F++ + +  P +D  LSDICI +SAAPTY PAH 
Sbjct  138   GDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDICISTSAAPTYLPAHQ  197

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE  D  G   EFNLIDGGV ANNPTLVA+  VT+ +      DF    PMD +RF ++S
Sbjct  198   FETEDSTGKVREFNLIDGGVAANNPTLVAMGEVTKAIVGGSS-DFFPIKPMDYRRFLMIS  256

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG++K   KYTA  AA WG++ WLT S G+PLIDVFS AS+DMVD+H++ +F +L   
Sbjct  257   LGTGTTKAEGKYTAPEAAKWGVLRWLT-SGGSPLIDVFSHASADMVDYHLSAVFQALQLH  315

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             DNYLRIQ D+L G ++SVDV T++NL  L ++G+ LLKK VS+++L T   +P  ++ TN
Sbjct  316   DNYLRIQDDTLSGVLSSVDVATKKNLNDLVKIGEALLKKPVSRVNLETSVSEPTSSQETN  375

Query  1157  EEALKRFAKVLSENRKNR  1210
             EEAL+RFAK+LS+ R+ R
Sbjct  376   EEALRRFAKLLSQERQLR  393



>ref|XP_003603014.1| Patatin-like protein [Medicago truncatula]
 gb|AES73265.1| patatin-like phospholipase [Medicago truncatula]
Length=408

 Score =   433 bits (1114),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 229/394 (58%), Positives = 297/394 (75%), Gaps = 1/394 (0%)
 Frame = +2

Query  29    SQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVI  208
             +QSS            +TILSIDGGGIRGIIPATIL FLE+QLQELDG+  R+ DYFDVI
Sbjct  4     TQSSLLQIQPPTYGNLVTILSIDGGGIRGIIPATILEFLESQLQELDGESARLADYFDVI  63

Query  209   AGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEG  388
              GTSTGGLVTAML+AP+  +RPLFAAKDI PFY EH PKIFPQ   + GS+      L G
Sbjct  64    TGTSTGGLVTAMLSAPNDKQRPLFAAKDIKPFYLEHCPKIFPQQKHMLGSVGKLFKSLAG  123

Query  389   PKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSD  568
             PKYDG YLH VV E+LG+ R+H+TLT +VIPTFDIK  QP++F++ + +++P +D +LSD
Sbjct  124   PKYDGNYLHSVVREKLGEIRVHETLTNIVIPTFDIKTSQPIIFSSYKIKNAPCMDARLSD  183

Query  569   ICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPD  748
             ICI +SAAPTY P + F+N+D +GN  EFNLIDGGVCANNP LVA++ VT ++  +++ D
Sbjct  184   ICISTSAAPTYLPGYNFKNQDTEGNVREFNLIDGGVCANNPALVAVNEVTTQIINENN-D  242

Query  749   FAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSD  928
             F    PM+  RF ++SLGTG+ K  QK+ +K+AA WG++ WLTH    PLID+FS +S D
Sbjct  243   FYAIKPMEYSRFLIISLGTGTPKNEQKFDSKLAAKWGLLDWLTHGGSTPLIDIFSQSSGD  302

Query  929   MVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskl  1108
             MVDFH+AT+  +L+  DNYLRIQ D+L G  +SVD++T+ENL+KL ++G  LLKK VSK+
Sbjct  303   MVDFHLATVTQALNCQDNYLRIQDDTLTGTDSSVDISTKENLEKLCQIGDRLLKKPVSKV  362

Query  1109  dllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             +L  G ++P +   TN+EALKRFAK+LS+ RK R
Sbjct  363   NLENGMFEPIENGETNQEALKRFAKILSQERKLR  396



>gb|KCW66171.1| hypothetical protein EUGRSUZ_F00007, partial [Eucalyptus grandis]
Length=403

 Score =   433 bits (1113),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 223/378 (59%), Positives = 278/378 (74%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             ITILSIDGGGIRG+IP TIL  LE++LQ+LDG+  RI DYFDVI+GTSTGGLVTAML  P
Sbjct  15    ITILSIDGGGIRGLIPGTILHLLESELQKLDGEDARIVDYFDVISGTSTGGLVTAMLATP  74

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             D+N RP+ AAKDI  FY  H PKIFPQ    F  +   +  + GPKY+GKYLH VV E L
Sbjct  75    DENNRPVVAAKDIKDFYLNHCPKIFPQDSCPFKPVTKRIKAMAGPKYNGKYLHSVVREEL  134

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             GD RLHQTLT VVIPTFDIK+ QP +F++ + +  P +D  LSDICI +SAAPTY PAH 
Sbjct  135   GDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDICISTSAAPTYLPAHQ  194

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE  D  G   EFNLIDGGV ANNPTLVA+  VT+ +      DF    PMD +RF ++S
Sbjct  195   FETEDSTGKVREFNLIDGGVAANNPTLVAMGEVTKAIVGGSS-DFFPIKPMDYRRFLMIS  253

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG++K   KYTA  AA WG++ WLT S G+PLIDVFS AS+DMVD+H++ +F +L   
Sbjct  254   LGTGTTKAEGKYTAPEAAKWGVLRWLT-SGGSPLIDVFSHASADMVDYHLSAVFQALQLH  312

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             DNYLRIQ D+L G ++SVDV T++NL  L ++G+ LLKK VS+++L T   +P  ++ TN
Sbjct  313   DNYLRIQDDTLSGVLSSVDVATKKNLNDLVKIGEALLKKPVSRVNLETSVSEPTSSQETN  372

Query  1157  EEALKRFAKVLSENRKNR  1210
             EEAL+RFAK+LS+ R+ R
Sbjct  373   EEALRRFAKLLSQERQLR  390



>emb|CBI19557.3| unnamed protein product [Vitis vinifera]
Length=849

 Score =   447 bits (1151),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 244/379 (64%), Positives = 296/379 (78%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TI SIDGGGIRGIIPATILA LE +LQELDG   RI DYFDVIAGTSTGG+VTAMLTA
Sbjct  17    LVTIFSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTGGIVTAMLTA  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD  KRPLFAAKDI PFY EHGPKIFPQ  G+FG I   L  + GPKYDGKYL ++++E+
Sbjct  77    PDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGKYLKRLIKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG TRLH+TLT VVIPTFDIK+ QP +F+  E + SP LD  L+DICIGSSAAPTYFPA+
Sbjct  137   LGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAPTYFPAY  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             +F+N+D +G T EF+LIDGGV ANNP LVAI+ VT+++  + +PDF    PMD  RF V+
Sbjct  197   FFKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDR-NPDFFPIKPMDFGRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS K  QKY AKMA+ WG++GWL H    PL+DVF  AS+DMVDFHI+ +F +L +
Sbjct  256   SIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQALHS  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G  ASVDVTTEENL  L ++G+ LLKK VS+++L TG  +P +  GT
Sbjct  316   EDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENGGT  375

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEALKRFA +LS+ ++ R
Sbjct  376   NEEALKRFATLLSDEKRLR  394



>ref|XP_004238176.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=405

 Score =   432 bits (1112),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 234/380 (62%), Positives = 289/380 (76%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRGIIPATIL+FLE+QLQELDGK+ R+ DYFDVIAGTSTGGLVTAMLTA
Sbjct  16    LITVLSIDGGGIRGIIPATILSFLESQLQELDGKEARLADYFDVIAGTSTGGLVTAMLTA  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA-LLEGPKYDGKYLHKVVEE  430
             PD+N RPL+AAKDI PFY EH PKIFPQ      +  G +   L GPKYDGKYLH+VV+E
Sbjct  76    PDENNRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNIVQTLIGPKYDGKYLHQVVKE  135

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +L DTRL  T+T VVIPTFDIK  QP +F+  E + +   D KLSDICI +SAAPTY PA
Sbjct  136   KLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLSDICISTSAAPTYLPA  195

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF+  D KGN  E +LIDGGV ANNP L+AIS V++ +  K++PDF    PM+  RF V
Sbjct  196   HYFKVEDTKGNFKEHHLIDGGVAANNPGLIAISEVSKEIF-KNNPDFYPIKPMEYGRFLV  254

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTG++KY QKY + MAA WGI+ WL +   NPLI+VF+ +S+DMVD+H + +F +L 
Sbjct  255   ISLGTGAAKYEQKYNSSMAAKWGILEWLLNKGSNPLIEVFTQSSADMVDYHNSVVFQALR  314

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + D+YLRIQ D L G  ASVDV T+ENL++L E+G+NLLKK +S+++L TG  +P    G
Sbjct  315   SEDSYLRIQEDELSGTEASVDVATKENLERLVEIGENLLKKPLSRVNLETGLSEPIPKGG  374

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEEALKRFA +L   R+ R
Sbjct  375   TNEEALKRFATLLVNERRLR  394



>ref|NP_849511.1| patatin-related phospholipase A [Arabidopsis thaliana]
 sp|O23179.2|PLP1_ARATH RecName: Full=Patatin-like protein 1; Short=AtPLP1; AltName: 
Full=Patatin-related phospholipase A IIgamma; Short=pPLAIIg; 
AltName: Full=Phospholipase A IVA; Short=AtPLAIVA [Arabidopsis 
thaliana]
 emb|CAB16787.1| patatin-like protein [Arabidopsis thaliana]
 emb|CAB80373.1| patatin-like protein [Arabidopsis thaliana]
 gb|ABM06020.1| At4g37070 [Arabidopsis thaliana]
 gb|AEE86744.1| patatin-related phospholipase A [Arabidopsis thaliana]
Length=414

 Score =   433 bits (1113),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 209/379 (55%), Positives = 279/379 (74%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RGII   ILAFLE QLQELDG++ R+ DYFDVIAGTSTGGLVTAMLT 
Sbjct  18    LVTILSLDGGGVRGIIAGVILAFLEKQLQELDGEEARLADYFDVIAGTSTGGLVTAMLTV  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+  RP FAAKDI+PFY EH PKIFPQ  G+   +     LL GPKY GKYL  ++ + 
Sbjct  78    PDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPKLLSGPKYSGKYLRNLLSKL  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+TRLHQTLT +VIPTFDIK  QP +F++ +    P LDVK+SDICIG+SAAPT+FP H
Sbjct  138   LGETRLHQTLTNIVIPTFDIKKLQPTIFSSYQLLVDPSLDVKVSDICIGTSAAPTFFPPH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF N D +GN  EFNL+DG V ANNPTLVA++ V++++  K++PD     P+   RF V+
Sbjct  198   YFSNEDSQGNKTEFNLVDGAVTANNPTLVAMTAVSKQIV-KNNPDMGKLKPLGFDRFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +KY+AK AA WGII WL      P++D+  ++S DM+ +H + +F +L +
Sbjct  257   SIGTGSTKREEKYSAKKAAKWGIISWLYDDGSTPILDITMESSRDMIHYHSSVVFKALQS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+LEGDV+++D+ T+ NL+ L+++G+ +L   V ++++ TG Y+P     T
Sbjct  317   EDKYLRIDDDTLEGDVSTMDLATKSNLENLQKIGEKMLTNRVMQMNIDTGVYEPVAENIT  376

Query  1154  NEEALKRFAKVLSENRKNR  1210
             N+E LKR+AK+LS+ RK R
Sbjct  377   NDEQLKRYAKILSDERKLR  395



>ref|XP_009617797.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana tomentosiformis]
Length=420

 Score =   433 bits (1113),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 237/397 (60%), Positives = 295/397 (74%), Gaps = 3/397 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRGIIPATIL+FLE+QLQELDG   R+ DYFDVIAGTSTGGLVTAMLTA
Sbjct  22    LITVLSIDGGGIRGIIPATILSFLESQLQELDGNDARLADYFDVIAGTSTGGLVTAMLTA  81

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA-LLEGPKYDGKYLHKVVEE  430
             PD+N RPL+AAKDI PFY EH PKIFPQ      +  G +   + GPKYDGKYLH+VV+E
Sbjct  82    PDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYLHEVVKE  141

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +L DTRL  T+T VVIPTFDIK  QP +F+  E + S   D KLSDICI +SAAPTY PA
Sbjct  142   KLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKLSDICISTSAAPTYLPA  201

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF+  D KGN  E +LIDGGV ANNP L+AIS V++ +  KD+PDF    PMD  RF V
Sbjct  202   HYFKVEDTKGNVKEHHLIDGGVAANNPALIAISEVSKEIL-KDNPDFFPIKPMDYGRFLV  260

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGS+K+  KY A MAA WGI+ WL H    PLI+VF  +S+D+VD+H + +F +L 
Sbjct  261   ISIGTGSAKWEHKYNASMAAKWGIVNWLFHKGSTPLIEVFFQSSADLVDYHNSVVFQALH  320

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + +NYLRIQ D L G  ASVD+ T+ENL++L E+GQNLLKK +S+++L TG  +P    G
Sbjct  321   SDNNYLRIQEDELSGTEASVDIATKENLERLVEIGQNLLKKPLSRVNLETGLTEPIPKGG  380

Query  1151  TNEEALKRFAKVLSENRKNRLKNEAKLSKL*NVKYSI  1261
             TNEEAL RFA++L   R+ R ++ + L+K  + KYS+
Sbjct  381   TNEEALIRFARLLVNERRLR-ESRSPLTKKVSKKYSL  416



>ref|XP_009139351.1| PREDICTED: patatin-like protein 1 isoform X1 [Brassica rapa]
Length=408

 Score =   432 bits (1112),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 212/380 (56%), Positives = 281/380 (74%), Gaps = 1/380 (0%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K +TILS+DGGG+RGII   ILA+LE QLQE+DG+ VR+ DYFDV++GTSTGGL+TAMLT
Sbjct  17    KLVTILSLDGGGVRGIIAGVILAYLEKQLQEIDGEDVRLADYFDVVSGTSTGGLMTAMLT  76

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
              P KN RP  AAKDI+PFY EH PKIFPQ  GL   +     LL GPKY GKYL K++ +
Sbjct  77    VPGKNGRPQLAAKDIVPFYLEHCPKIFPQPEGLAALLPKLPKLLSGPKYSGKYLRKLLSK  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LG+T+LHQT+T VVIPTFD+K  QP +F++ +A   P LDVK+SDIC+G+SAAPT+FP 
Sbjct  137   LLGETKLHQTVTNVVIPTFDMKKLQPTIFSSYQALVDPSLDVKISDICLGTSAAPTFFPP  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF N D +G T EFNL+DG V ANNPTLVA++ VT+++  K++PD     P+   +F V
Sbjct  197   HYFSNEDSQGKTTEFNLVDGAVTANNPTLVAMTAVTKQIL-KNNPDMGKLKPLGYDKFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGSSK  +KY+AK AA WGII WL +    P++D+ SD+  DM+ FH + +F +L 
Sbjct  256   ISIGTGSSKNEEKYSAKKAAKWGIISWLYNDGSTPILDMVSDSGRDMIHFHSSVLFKALQ  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + D YLRI  D+LEGDV+S+D+ T+ NL+ L ++G+ +LK  V  +++ TG Y+P     
Sbjct  316   SEDKYLRIDDDTLEGDVSSMDLATKSNLENLVKIGEKVLKNRVMHMNIDTGVYEPITENI  375

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEE LKRFAK+LS+ R+ R
Sbjct  376   TNEEELKRFAKILSDERRLR  395



>emb|CDX75619.1| BnaA01g00830D [Brassica napus]
Length=408

 Score =   432 bits (1112),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 212/380 (56%), Positives = 281/380 (74%), Gaps = 1/380 (0%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K +TILS+DGGG+RGII   ILA+LE QLQE+DG+ VR+ DYFDV++GTSTGGL+TAMLT
Sbjct  17    KLVTILSLDGGGVRGIIAGVILAYLEKQLQEIDGEDVRLADYFDVVSGTSTGGLMTAMLT  76

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
              P KN RP  AAKDI+PFY EH PKIFPQ  GL   +     LL GPKY GKYL K++ +
Sbjct  77    VPGKNGRPQLAAKDIVPFYLEHCPKIFPQPEGLGALLPKLPKLLSGPKYSGKYLRKLLSK  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LG+T+LHQT+T VVIPTFD+K  QP +F++ +A   P LDVK+SDIC+G+SAAPT+FP 
Sbjct  137   LLGETKLHQTVTNVVIPTFDMKKLQPTIFSSYQALIDPSLDVKISDICLGTSAAPTFFPP  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF N D +G T EFNL+DG V ANNPTLVA++ VT+++  K++PD     P+   +F V
Sbjct  197   HYFSNEDNQGKTTEFNLVDGAVTANNPTLVAMTAVTKQIL-KNNPDMGKLKPLGYDKFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGSSK  +KY+AK AA WGII WL +    P++D+ SD+  DM+ FH + +F +L 
Sbjct  256   ISIGTGSSKNEEKYSAKKAAKWGIISWLYNDGSTPILDMVSDSGRDMIHFHSSVLFKALQ  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + D YLRI  D+LEGDV+S+D+ T+ NL+ L ++G+ +LK  V  +++ TG Y+P     
Sbjct  316   SEDKYLRIDDDTLEGDVSSMDLATKSNLENLVKIGEKVLKNRVMHMNIDTGVYEPITENI  375

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEE LKRFAK+LS+ R+ R
Sbjct  376   TNEEELKRFAKILSDERRLR  395



>emb|CAA05628.1| patatin-like protein [Arabidopsis thaliana]
Length=410

 Score =   432 bits (1112),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 209/379 (55%), Positives = 279/379 (74%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RGII   ILAFLE QLQELDG++ R+ DYFDVIAGTSTGGLVTAMLT 
Sbjct  14    LVTILSLDGGGVRGIIAGVILAFLEKQLQELDGEEARLADYFDVIAGTSTGGLVTAMLTV  73

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+  RP FAAKDI+PFY EH PKIFPQ  G+   +     LL GPKY GKYL  ++ + 
Sbjct  74    PDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPKLLSGPKYSGKYLRNLLSKL  133

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+TRLHQTLT +VIPTFDIK  QP +F++ +    P LDVK+SDICIG+SAAPT+FP H
Sbjct  134   LGETRLHQTLTNIVIPTFDIKKLQPTIFSSYQLLVDPSLDVKVSDICIGTSAAPTFFPPH  193

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF N D +GN  EFNL+DG V ANNPTLVA++ V++++  K++PD     P+   RF V+
Sbjct  194   YFSNEDSQGNKTEFNLVDGAVTANNPTLVAMTAVSKQIV-KNNPDMGKLKPLGFDRFLVI  252

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +KY+AK AA WGII WL      P++D+  ++S DM+ +H + +F +L +
Sbjct  253   SIGTGSTKREEKYSAKKAAKWGIISWLYDDGSTPILDITMESSRDMIHYHSSVVFKALQS  312

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+LEGDV+++D+ T+ NL+ L+++G+ +L   V ++++ TG Y+P     T
Sbjct  313   EDKYLRIDDDTLEGDVSTMDLATKSNLENLQKIGEKMLTNRVMQMNIDTGVYEPVAENIT  372

Query  1154  NEEALKRFAKVLSENRKNR  1210
             N+E LKR+AK+LS+ RK R
Sbjct  373   NDEQLKRYAKILSDERKLR  391



>ref|XP_007160832.1| hypothetical protein PHAVU_001G020300g [Phaseolus vulgaris]
 gb|ESW32826.1| hypothetical protein PHAVU_001G020300g [Phaseolus vulgaris]
Length=413

 Score =   432 bits (1111),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 232/395 (59%), Positives = 301/395 (76%), Gaps = 2/395 (1%)
 Frame = +2

Query  29    SQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVI  208
             S+SS E          +TILSIDGGGIRGIIPATI+ FLE+QLQELDG + R+ DYFDVI
Sbjct  4     SKSSVEQIQPPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPEARLADYFDVI  63

Query  209   AGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLAL-LE  385
             +GTSTGGLVTAMLTAPD N RPLFAAKDI PFY EHGPKIFP   GL G+I   L   L 
Sbjct  64    SGTSTGGLVTAMLTAPDNNHRPLFAAKDIKPFYLEHGPKIFPHHSGLGGTIIANLVRSLG  123

Query  386   GPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLS  565
             GPKYDGKYLH+VV E+LG+ RLH TLT VVIPTFDIK+ QP++F++ + +    +D KLS
Sbjct  124   GPKYDGKYLHEVVREKLGEIRLHDTLTNVVIPTFDIKSMQPILFSSYQMKKCSYMDAKLS  183

Query  566   DICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDP  745
             DICIG+SAAPTY PAH F N+D +GN  +FNLIDGGVCANNPTLVA++ VT+++ +++  
Sbjct  184   DICIGTSAAPTYLPAHTFTNQDSQGNLHQFNLIDGGVCANNPTLVAMNEVTKQIIKQNS-  242

Query  746   DFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASS  925
             DF    P++  RF ++S+GTG+++  +K+  + AA WG++ WLT++   PL DVF+ +S+
Sbjct  243   DFFPIKPLEYSRFLIISIGTGTARNEEKFNGETAAKWGLLDWLTYNGSTPLTDVFTQSSA  302

Query  926   DMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvsk  1105
             DMVDFH++ +  +L + DNYLRIQ D+L G  +SVD+ T+ENL+KL E+GQNLLKKSVS+
Sbjct  303   DMVDFHLSAVTQALHSEDNYLRIQDDTLSGTESSVDIATKENLQKLSEIGQNLLKKSVSR  362

Query  1106  ldllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             ++L  G ++P     TN+ AL RFAK+LS+ R+ R
Sbjct  363   VNLENGLFEPLANGETNQHALTRFAKILSQERRLR  397



>ref|XP_010320346.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
Length=412

 Score =   432 bits (1111),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 236/381 (62%), Positives = 296/381 (78%), Gaps = 2/381 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K ITILSIDGGGIRGIIPA IL +LE+QLQELDG+  R+ DYFD+IAGTSTGGLVTAMLT
Sbjct  21    KLITILSIDGGGIRGIIPAIILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAMLT  80

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfg-sikggLALLEGPKYDGKYLHKVVE  427
             AP+K+KRP+FAAKDI PFY EHGPKIFPQ G LF  SI   L  L GPKY+GKYLH+V++
Sbjct  81    APNKDKRPIFAAKDIKPFYLEHGPKIFPQKGMLFFGSIIKTLKSLIGPKYNGKYLHQVIK  140

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+T LH+TLT VVIPTFDIKN QP +F+  EA++ P +D KLSDICI +S APTY P
Sbjct  141   EKLGETHLHETLTNVVIPTFDIKNLQPTIFSTFEAKEKPLMDAKLSDICISTSGAPTYLP  200

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYF+ +D   N  EFNL+DGGV ANNP LVA S VT+++    +PDF    P+D  RF 
Sbjct  201   AHYFKTQDRDDNFHEFNLVDGGVAANNPALVATSQVTKQIM-AGNPDFFPIKPIDYGRFL  259

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+S+GTGS+K  QKY AK+A+ WGI+GWL +    P++DVF+ AS DMVDFHI+ +F +L
Sbjct  260   VISVGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDFHISVVFQAL  319

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + +NYLR+Q D+L G  +SVD++T+EN+ KL E+G NLLKK VS+++L TG ++     
Sbjct  320   HSEENYLRVQDDTLSGTDSSVDISTKENMNKLVEIGTNLLKKPVSRVNLQTGLFEECKKD  379

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TNEE LKRFAK+LSE ++ R
Sbjct  380   DTNEETLKRFAKLLSEEKRLR  400



>ref|XP_007222710.1| hypothetical protein PRUPE_ppa006466mg [Prunus persica]
 gb|EMJ23909.1| hypothetical protein PRUPE_ppa006466mg [Prunus persica]
Length=410

 Score =   432 bits (1111),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 226/381 (59%), Positives = 276/381 (72%), Gaps = 3/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRG+IP TIL +LEA+LQ+LDG+  RI DYFDVIAGTSTGGLVTAML  
Sbjct  17    LITVLSIDGGGIRGLIPGTILGYLEAELQKLDGEDARIADYFDVIAGTSTGGLVTAMLAT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVVEE  430
             PD+N RP+FAAKDI  FY  H PKIFPQ            +  L GPKYDGKYLH +V +
Sbjct  77    PDENNRPVFAAKDIKDFYLTHCPKIFPQKHCPIFPYTTKIIKALAGPKYDGKYLHDLVGQ  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LGD +LHQTLT VVIPTFDIK  QP +F++ E +  P  D KLSDICI +SAAPTY PA
Sbjct  137   KLGDKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKHKPGFDAKLSDICIATSAAPTYLPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE  D +GN  EFNLIDGGV ANNPTL+AI  VT+ +  K   DF    PMD  RF V
Sbjct  197   HYFETMDPEGNVREFNLIDGGVAANNPTLLAIGEVTKTII-KGSSDFFPIKPMDYARFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS+K   KY A  AA WG++ WLT   G P+IDVFS +S+DMVD+H++ +F +L 
Sbjct  256   ISLGTGSAKAEFKYHALSAAKWGLLDWLTSGGGTPIIDVFSQSSADMVDYHLSVVFQALH  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + +NYLRIQ D+L G V+SVD+  ++NL  L  VG+ LLKK VS+++L TG+ +P     
Sbjct  316   SENNYLRIQDDTLTGHVSSVDIADKKNLDDLLIVGEGLLKKPVSRVNLETGRVEPSKHE-  374

Query  1151  TNEEALKRFAKVLSENRKNRL  1213
             +NEEAL RFAK+LSE +  RL
Sbjct  375   SNEEALTRFAKLLSEEKWLRL  395



>ref|XP_009390266.1| PREDICTED: patatin-like protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   432 bits (1111),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 214/381 (56%), Positives = 281/381 (74%), Gaps = 2/381 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K +T+L IDGGG+RG+IPATI+AFLEA+LQ+LDG + RI DYFDVIAGTSTGGLVTAMLT
Sbjct  24    KRVTVLCIDGGGVRGLIPATIIAFLEAELQKLDGPEARIADYFDVIAGTSTGGLVTAMLT  83

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA-LLEGPKYDGKYLHKVVE  427
             AP+K KRPLFAAKDI+ FY ++ PKIFPQ      +    L   + GPKYDGKYLH ++ 
Sbjct  84    APNKEKRPLFAAKDIVQFYLDNSPKIFPQKNAGLFNSALNLVGAVSGPKYDGKYLHAIIR  143

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             + LGDTRL QTLT VVIPTFDIK  QP +F+  + + +P  D  LSDICIG+SAAPTY P
Sbjct  144   QLLGDTRLSQTLTNVVIPTFDIKFLQPTIFSTYQTKSTPLKDALLSDICIGTSAAPTYLP  203

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
              HYFE +D  GN   FNL+DGGV ANNPTL A++ V++ +    +PDF    P++  RF 
Sbjct  204   GHYFETKDDNGNKRSFNLVDGGVAANNPTLTAMTEVSKEILLS-NPDFFSYQPVEYDRFL  262

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTG+ K  +K+TA+ +A WG++GWL +    PLID+F+ AS+DMVD H + +F +L
Sbjct  263   VISLGTGAPKQEEKFTAQESAKWGVLGWLLNKGTTPLIDIFTQASADMVDIHASVLFQAL  322

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
             + G NYLRI+ D+L G  +SVDV+T++NL+ L ++G +LLKK VS++++ TG  +  D  
Sbjct  323   NKGKNYLRIEDDTLTGQTSSVDVSTKKNLQDLVDIGNSLLKKPVSRVNIETGHSEAVDGE  382

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
             GTNE AL  FAK LS+ ++ R
Sbjct  383   GTNEAALTGFAKKLSDEKRRR  403



>ref|XP_008241530.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=384

 Score =   431 bits (1107),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 215/390 (55%), Positives = 283/390 (73%), Gaps = 8/390 (2%)
 Frame = +2

Query  47    MASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTG  226
             M+++   +K +T+LSIDGGG+RGIIP TILAFLE++LQ+LDG   RI DYFD+IAGTSTG
Sbjct  1     MSTDLVKRKMVTVLSIDGGGVRGIIPGTILAFLESKLQQLDGPDARIADYFDIIAGTSTG  60

Query  227   GLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLAL--LEGPKYD  400
             GLVT MLTAP+K+ RP++ AKDI  FY +  PKIFPQ             +  ++GPKYD
Sbjct  61    GLVTTMLTAPNKDNRPMYEAKDINKFYLDQSPKIFPQSSQNNLLRSIKSTVDEVKGPKYD  120

Query  401   GKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIG  580
             GKYL  +    LGD  L QTLT VVIP FDIK  QP+VF+  +A++S   + KLSD+C+ 
Sbjct  121   GKYLRTLTHGLLGDLTLKQTLTNVVIPAFDIKYLQPVVFSTIDAKESSLKNAKLSDVCVS  180

Query  581   SSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGT  760
             +SAAPT+ PAHYFE +D  G T  FNL+DGGV ANNPT++AIS + + M + +      +
Sbjct  181   TSAAPTFLPAHYFEVKDDGGRTRSFNLVDGGVAANNPTMMAISHINREMLKHN------S  234

Query  761   NPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDF  940
             +PMD  R +VLSLGTG++K  +KY+A +A+ WG+I WL H+   PL+D F+DASSDMVDF
Sbjct  235   DPMDATRLQVLSLGTGAAKLEEKYSAAIASKWGLINWLFHNGSTPLVDFFADASSDMVDF  294

Query  941   HIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllT  1120
             H++T+F  L A DNYLRIQ DSL GD AS+D+ TE+NL++L E+G  LLKK VS++ L T
Sbjct  295   HVSTLFQCLQAKDNYLRIQDDSLTGDEASLDIATEKNLRRLVEIGNALLKKPVSRVQLDT  354

Query  1121  GQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             G+Y+  +  GT E+AL +FAK +SE RK R
Sbjct  355   GKYEVCEGEGTYEDALIKFAKTISEGRKLR  384



>ref|XP_010098699.1| Patatin group A-3 [Morus notabilis]
 gb|EXB75602.1| Patatin group A-3 [Morus notabilis]
Length=434

 Score =   432 bits (1112),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 234/391 (60%), Positives = 295/391 (75%), Gaps = 4/391 (1%)
 Frame = +2

Query  62    NSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTA  241
             N    IT+LSIDGGGIRGIIPATIL+F E+QLQELDG++ R+ DYFDVIAGTSTGGL+ A
Sbjct  44    NYGNLITVLSIDGGGIRGIIPATILSFFESQLQELDGEEARLADYFDVIAGTSTGGLIAA  103

Query  242   MLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKV  421
             ML APD+NKRP  AAKDI PFY EH  KIF Q  G   S++  L  L GPKYD KYLH +
Sbjct  104   MLAAPDENKRPCIAAKDITPFYLEHASKIFQQTSGFLKSVRSFLGNLAGPKYDEKYLHGL  163

Query  422   VEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTY  601
             + ++LG+TRLH T+T +VIPTFDIK  QP VF++ E   SP LDVKLSDICIG+SAAPTY
Sbjct  164   MRDKLGETRLHDTVTNLVIPTFDIKRLQPTVFSSYEVRSSPDLDVKLSDICIGTSAAPTY  223

Query  602   FPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQR  781
              PA+YF N+D  GN  EF+L+DGGV ANNPTL+AIS VT+++  K + DF+   PMD  R
Sbjct  224   LPAYYFTNQDANGNVREFDLVDGGVAANNPTLIAISEVTKQI-YKQNRDFSPLKPMDYSR  282

Query  782   FRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFH  961
             F V+S+GTGS+K  QKYTA MAA WGII WL ++   P++DV+S ASSDMVD H++ IF 
Sbjct  283   FLVISIGTGSAKIEQKYTASMAAEWGIIKWLFNNGDVPIVDVYSQASSDMVDLHMSVIFQ  342

Query  962   SLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDD  1141
             +L + D YLRIQ D L G+ + VD+ T+ENL KL ++G+ LLKK +++++L TG  +P +
Sbjct  343   ALHSQDRYLRIQDDELAGEESLVDIATKENLDKLVQIGEQLLKKPLARVNLETGLSEPLE  402

Query  1142  ARGTNEEALKRFAKVLSENRKNRLKNEAKLS  1234
                TN++ALKRFAK+LS  ++ R   EAKLS
Sbjct  403   NGVTNKDALKRFAKLLSSEKRLR---EAKLS  430



>ref|XP_010065725.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW88150.1| hypothetical protein EUGRSUZ_A00540 [Eucalyptus grandis]
Length=406

 Score =   431 bits (1108),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 226/379 (60%), Positives = 275/379 (73%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP TIL FLE +LQ+LDG+  RI DYFDVI+GTSTGGLVTAML  
Sbjct  17    LITILSIDGGGIRGLIPGTILNFLECELQKLDGEDARIADYFDVISGTSTGGLVTAMLAT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RP+FAAKDI  FY EH PKIFPQ    F  +   +  + GPKYDGKYLH VV E 
Sbjct  77    PNEKNRPVFAAKDIKDFYLEHCPKIFPQDSCPFKPVTKMIKAVAGPKYDGKYLHNVVREE  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD RLHQTLT VVIPTFDIK+ QP +F++ + +    +D  LSDICI +SAAPTY PAH
Sbjct  137   LGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQVKKDRSVDALLSDICISTSAAPTYLPAH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              FE +D  G   EFNLIDGGV ANNPTLVA+  VT+ +      DF    PMD +RF V+
Sbjct  197   KFETKDPTGKVREFNLIDGGVAANNPTLVAMGEVTKTIMGGSS-DFFPIKPMDYRRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+ K   KYTA  AA WG++GWLT S G PLIDVF+ AS+DMVD+H+  +F +L  
Sbjct  256   SLGTGTGKVEGKYTAHEAAKWGVLGWLT-SGGTPLIDVFTQASADMVDYHLCAVFQALQL  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G ++SVDV T++NL  L + G+ LLKK VS+++L TG  +P   + T
Sbjct  315   HDNYLRIQDDTLSGVLSSVDVATKKNLTDLVKTGEALLKKPVSRVNLETGVGEPTTNQET  374

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL RFAK+LS+ R+ R
Sbjct  375   NEEALIRFAKLLSQERQLR  393



>gb|KCW66458.1| hypothetical protein EUGRSUZ_F00254 [Eucalyptus grandis]
Length=423

 Score =   432 bits (1110),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 230/380 (61%), Positives = 275/380 (72%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP TIL FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT 
Sbjct  17    LITILSIDGGGIRGLIPGTILDFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD N RPLFAAKDI  FY ++ PKIFPQ    F      +  + GPKYDGKYLH +V+E+
Sbjct  77    PDDNNRPLFAAKDIKNFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLHNLVKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+ RLHQTLT VVIPTFDIK  QP +F++ E + +P LD  LSDICI +SAAPTY PAH
Sbjct  137   LGNARLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKTPTLDALLSDICISTSAAPTYLPAH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D K    EFNLIDGGV ANNPTLVA+  VT+ +      DF    PMD +RF V+
Sbjct  197   YFETQDSKRKLREFNLIDGGVAANNPTLVAMGEVTKEIMGGSS-DFFPIKPMDYRRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS     KY A  AA WG++ WLT + G+PLIDVF  AS+DMVDFH++ +F +L  
Sbjct  256   SLGTGSRNSEGKYDASEAAKWGVLNWLTCNGGSPLIDVFMQASADMVDFHLSAVFQALHL  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L G VASVD+ T++NL  L   G+ LLKK VSK+DL  G  +  +   T
Sbjct  316   EANYLRIQDDNLSGAVASVDIATKKNLNDLVRTGEALLKKPVSKVDLEKGGCEACNPE-T  374

Query  1154  NEEALKRFAKVLSENRKNRL  1213
             NEEAL+RFAK+LS  R+ RL
Sbjct  375   NEEALRRFAKMLSNERQLRL  394



>ref|XP_010064186.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=431

 Score =   432 bits (1110),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 230/380 (61%), Positives = 275/380 (72%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP TIL FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT 
Sbjct  17    LITILSIDGGGIRGLIPGTILDFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD N RPLFAAKDI  FY ++ PKIFPQ    F      +  + GPKYDGKYLH +V+E+
Sbjct  77    PDDNNRPLFAAKDIKNFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLHNLVKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+ RLHQTLT VVIPTFDIK  QP +F++ E + +P LD  LSDICI +SAAPTY PAH
Sbjct  137   LGNARLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKTPTLDALLSDICISTSAAPTYLPAH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D K    EFNLIDGGV ANNPTLVA+  VT+ +      DF    PMD +RF V+
Sbjct  197   YFETQDSKRKLREFNLIDGGVAANNPTLVAMGEVTKEIMGGSS-DFFPIKPMDYRRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS     KY A  AA WG++ WLT + G+PLIDVF  AS+DMVDFH++ +F +L  
Sbjct  256   SLGTGSRNSEGKYDASEAAKWGVLNWLTCNGGSPLIDVFMQASADMVDFHLSAVFQALHL  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L G VASVD+ T++NL  L   G+ LLKK VSK+DL  G  +  +   T
Sbjct  316   EANYLRIQDDNLSGAVASVDIATKKNLNDLVRTGEALLKKPVSKVDLEKGGCEACNPE-T  374

Query  1154  NEEALKRFAKVLSENRKNRL  1213
             NEEAL+RFAK+LS  R+ RL
Sbjct  375   NEEALRRFAKMLSNERQLRL  394



>ref|XP_010064137.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66176.1| hypothetical protein EUGRSUZ_F00012 [Eucalyptus grandis]
Length=406

 Score =   431 bits (1107),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 224/379 (59%), Positives = 277/379 (73%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP TIL FLE++LQ+LDG+  RI DYFDVI+GTSTGGL+TAMLT 
Sbjct  17    LITILSIDGGGIRGLIPGTILNFLESELQKLDGEDARIADYFDVISGTSTGGLITAMLTT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RP+FAAKD+  FY +H PKIFPQ    F  +   +  + GPKYDGKYLHKVV E 
Sbjct  77    PNEKNRPVFAAKDVKDFYLKHCPKIFPQDSCPFKPVTKMIKAVAGPKYDGKYLHKVVREE  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD RLHQTLT VVIPTFDIK+ QP +F++ + +  P +D  L DICI +SAAPTY PAH
Sbjct  137   LGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQVKRDPSVDALLWDICISTSAAPTYLPAH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              FE +D  G   EFNLIDGGV ANNPTLVA+  VT+ +      DF    P D +RF V+
Sbjct  197   KFETKDPTGKVREFNLIDGGVAANNPTLVAMGEVTKTIVGGSS-DFFPIKPTDYRRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+ K   KYTA  AA WG++GWLT S G PLIDVF+ AS+DMVD+H+  +F +L  
Sbjct  256   SLGTGTGKVEGKYTAHEAAKWGVLGWLT-SGGTPLIDVFTQASADMVDYHLFAVFQALQL  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ D+L G ++SVDV T++NL  L + G+ LLKK VS+++L TG  +P   + T
Sbjct  315   HDNYLRIQDDTLSGVLSSVDVATKKNLTDLVKTGEALLKKPVSRVNLETGVCEPTPNQET  374

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL RFAK+LS+ R+ R
Sbjct  375   NEEALMRFAKLLSQERQLR  393



>ref|XP_008777430.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=402

 Score =   431 bits (1107),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 219/381 (57%), Positives = 279/381 (73%), Gaps = 1/381 (0%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             + +T+LSIDGGG+RGIIP TILAFLE++LQ+LDGK  RI DYFD+IAGTSTGGLVTAMLT
Sbjct  17    RLVTVLSIDGGGVRGIIPGTILAFLESKLQDLDGKDARIADYFDIIAGTSTGGLVTAMLT  76

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
              P+K+ RPLFAAKDI  FY EH PKIFPQ  G+  SI      + GPKYDGKYLH  V E
Sbjct  77    TPNKDNRPLFAAKDITKFYLEHCPKIFPQKTGILSSITKLFTAVTGPKYDGKYLHLKVRE  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LG++RLHQ LT +VIP FDIK  QP VF+  EA ++P  +  LSDICI +SAAPTY PA
Sbjct  137   LLGESRLHQALTNIVIPAFDIKFLQPTVFSTFEARNTPLKNPLLSDICISTSAAPTYLPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE +D +GN   FNL+DGGV ANNPTL A+S + + +   ++ DF    P+D  +F V
Sbjct  197   HYFETKDAQGNKQSFNLVDGGVAANNPTLAAMSQIAKEVCV-ENKDFHSIKPVDYSKFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS+K  +K+TA+ A+ WG++GWL  S   PLI+ F+ AS+DMVD H+  +F +L 
Sbjct  256   ISLGTGSAKLEEKFTAQEASKWGVLGWLYDSGDTPLINAFTQASADMVDIHLCAMFQALA  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
               +NYLRIQ D+L G  +SVDV+T+ENL KL ++G +LLKK VS+++L TG ++      
Sbjct  316   CRENYLRIQDDNLIGSTSSVDVSTKENLLKLVQIGSDLLKKHVSRVNLETGLFEEVKGDV  375

Query  1151  TNEEALKRFAKVLSENRKNRL  1213
             TNEEAL R AK LS+ R+ R 
Sbjct  376   TNEEALTRLAKRLSDERRLRF  396



>ref|XP_008776828.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=386

 Score =   429 bits (1103),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 225/381 (59%), Positives = 280/381 (73%), Gaps = 2/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +T+LSIDGGG+RGIIP TILAFLE++LQELDG+ VRI DYFDV+AGTSTGGLVTAML A
Sbjct  1     MVTVLSIDGGGVRGIIPGTILAFLESKLQELDGEDVRIADYFDVVAGTSTGGLVTAMLAA  60

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfg-sikggLALLEGPKYDGKYLHKVVEE  430
             PD+N RPLFAAK+I  FY E+ PKIFP+ G     S+K  L  + GPKYDGKYLH  V++
Sbjct  61    PDENNRPLFAAKEINDFYLENCPKIFPKNGNGILGSVKSLLGSIAGPKYDGKYLHSKVKQ  120

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LG  RLHQTLT +VIPTFDIK  QP +F+  E +     D  LSDICI +SAAPTY PA
Sbjct  121   LLGGIRLHQTLTNIVIPTFDIKLLQPTIFSTFETKKEVSKDALLSDICISTSAAPTYLPA  180

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF+ +D    +  FNLIDGG+ ANNPTL+A++ VT+   +++D DF    P D  +F V
Sbjct  181   HYFQTKDFNRKSRSFNLIDGGIAANNPTLLALNEVTKESFKQND-DFFPIKPADYGKFLV  239

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             LSLGTGS+K  +K+ A MA+ WG++GWL +S   PLID FS ASSDMVD H + IF +L 
Sbjct  240   LSLGTGSAKQEKKFNASMASKWGVLGWLYNSGMTPLIDSFSQASSDMVDIHASVIFQALH  299

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
                NYLRIQ D+L GD ASVDV+++ENL KL ++G+ LLKK VS+++L +G Y+     G
Sbjct  300   CESNYLRIQDDTLIGDTASVDVSSKENLLKLVQIGKELLKKPVSRVNLESGMYEAVQMAG  359

Query  1151  TNEEALKRFAKVLSENRKNRL  1213
             TNEE L RFAK+LS  R+ RL
Sbjct  360   TNEEELIRFAKMLSSERQLRL  380



>ref|XP_002281798.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
 emb|CBI21445.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   430 bits (1105),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 219/382 (57%), Positives = 286/382 (75%), Gaps = 1/382 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGG+RGII   ILA LE++LQ+LDG+  R+ DYFDVIAGTS+GGL+T ML A
Sbjct  19    LITILSIDGGGVRGIISGIILASLESELQKLDGEDARLSDYFDVIAGTSSGGLITTMLAA  78

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++N RPL+AA +I PF  EH PKIFP   G+ GS+     +L GPKYDGKYLH  + + 
Sbjct  79    PNQNNRPLYAASEIKPFLFEHSPKIFPPRSGIIGSVVNFFKILTGPKYDGKYLHSQINKL  138

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+T+L QTLT VVIPTFDIKN QP +F++ +   +P LD KLSDICIG+SAAPTY PA+
Sbjct  139   LGNTKLDQTLTNVVIPTFDIKNLQPTIFSSYQMAATPSLDAKLSDICIGTSAAPTYLPAY  198

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              F N+D +G+T EFNLIDGG+ A+NPTLVAIS VT+++  K +PDF+   P+D     V+
Sbjct  199   CFVNQDDQGSTREFNLIDGGLAASNPTLVAISEVTKQVTNK-NPDFSPFKPIDYGSLLVI  257

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+G+GS K   KY AKMAA WGI+GWL ++   PL+D F+ AS+DMVD+H A +F +L  
Sbjct  258   SVGSGSPKQEHKYNAKMAAKWGILGWLYNNGSTPLVDSFTQASADMVDYHNAVVFQALGC  317

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              +NYLRI   +L GD+AS D+ T++N+ +L +VG+ LLKK VS+++L TG+Y+     GT
Sbjct  318   QENYLRIDEATLTGDLASTDIATKKNMNELVKVGEELLKKPVSRVNLDTGEYEAIKNGGT  377

Query  1154  NEEALKRFAKVLSENRKNRLKN  1219
             NEEAL+RFAK+LS+ RK R  N
Sbjct  378   NEEALRRFAKLLSDERKLRESN  399



>ref|XP_006354907.1| PREDICTED: patatin-2-Kuras 4-like [Solanum tuberosum]
Length=384

 Score =   429 bits (1103),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 231/369 (63%), Positives = 287/369 (78%), Gaps = 2/369 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K ITILSIDGGGIRGIIPATIL +LE+QLQELDG+  R+ DYFD+IAGTSTGGLVTAMLT
Sbjct  17    KLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAMLT  76

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfg-sikggLALLEGPKYDGKYLHKVVE  427
             AP+K+KRP+FAAKDI PFY EHGPKIFPQ G LF  SI   L  L GPKY+GKYLH+V++
Sbjct  77    APNKDKRPMFAAKDIKPFYLEHGPKIFPQKGMLFFGSIVKTLKSLIGPKYNGKYLHQVIK  136

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+T +H+TLT VVIPTFDIKN QP +F+  EA + P +D KLSDICI +SAAPTY P
Sbjct  137   EKLGETYIHETLTNVVIPTFDIKNLQPTIFSTFEAREKPLMDAKLSDICISTSAAPTYLP  196

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYF+ +D   N  EFNL+DGGV ANNP LVA S VT+++    +PDF    P+D  RF 
Sbjct  197   AHYFKTQDKDDNFHEFNLVDGGVAANNPALVATSQVTKQIM-AGNPDFFPIKPIDYGRFL  255

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+S+GTGS+K  QKY AK+A+ WGI+GWL +    P++DVF+ AS DMVDFHI+ +F +L
Sbjct  256   VISVGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDFHISVVFQAL  315

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + +NYLRIQ D+L G  +SVD++T+EN+ KL E+G NLLKK VS+++L TG ++     
Sbjct  316   HSEENYLRIQDDTLSGTDSSVDISTKENMNKLVEIGTNLLKKPVSRVNLQTGLFEQSKKD  375

Query  1148  GTNEEALKR  1174
              TNEE LKR
Sbjct  376   DTNEETLKR  384



>gb|AAF98368.1|AF158027_1 patatin-like protein 1 [Nicotiana tabacum]
Length=420

 Score =   430 bits (1106),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 236/397 (59%), Positives = 294/397 (74%), Gaps = 3/397 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRGIIPATIL+FLE+QLQELDG   R+ DYFDVIAGTSTGGLVTAMLTA
Sbjct  22    LITVLSIDGGGIRGIIPATILSFLESQLQELDGNDARLADYFDVIAGTSTGGLVTAMLTA  81

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA-LLEGPKYDGKYLHKVVEE  430
             PD+N RPL+AAKDI PFY EH PKIFPQ      +  G +   + GPKYDGKYLH+VV+E
Sbjct  82    PDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYLHEVVKE  141

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +L DTRL  T+T VVIPTFDIK  QP +F+  E + S   D KLSDICI +SAAPTY PA
Sbjct  142   KLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKLSDICISTSAAPTYLPA  201

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF+  D KGN  E +LIDGGV ANNP L+AIS V++ +  KD+ DF    PMD  RF V
Sbjct  202   HYFKVEDTKGNVKEHHLIDGGVAANNPALIAISEVSKEIL-KDNSDFFPIKPMDYGRFLV  260

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGS+K+  KY A MAA WGI+ WL H    PLI+VF  +S+D+VD+H + +F +L 
Sbjct  261   ISIGTGSAKWEHKYNASMAAKWGIVNWLFHKGSTPLIEVFFQSSADLVDYHNSVVFQALH  320

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + +NYLRIQ D L G  ASVD+ T+ENL++L E+GQNLLKK +S+++L TG  +P    G
Sbjct  321   SDNNYLRIQEDELSGTEASVDIATKENLERLVEIGQNLLKKPLSRVNLETGLTEPIPKGG  380

Query  1151  TNEEALKRFAKVLSENRKNRLKNEAKLSKL*NVKYSI  1261
             TNEEAL RFA++L   R+ R ++ + L+K  + KYS+
Sbjct  381   TNEEALIRFARLLVNERRLR-ESRSPLTKKVSKKYSL  416



>ref|XP_009390265.1| PREDICTED: patatin-like protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   430 bits (1106),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 215/385 (56%), Positives = 282/385 (73%), Gaps = 6/385 (2%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K +T+L IDGGG+RG+IPATI+AFLEA+LQ+LDG + RI DYFDVIAGTSTGGLVTAMLT
Sbjct  24    KRVTVLCIDGGGVRGLIPATIIAFLEAELQKLDGPEARIADYFDVIAGTSTGGLVTAMLT  83

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLAL-----LEGPKYDGKYLH  415
             AP+K KRPLFAAKDI+ FY ++ PKIFPQ      +     AL     + GPKYDGKYLH
Sbjct  84    APNKEKRPLFAAKDIVQFYLDNSPKIFPQKKFGCSAGLFNSALNLVGAVSGPKYDGKYLH  143

Query  416   KVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAP  595
              ++ + LGDTRL QTLT VVIPTFDIK  QP +F+  + + +P  D  LSDICIG+SAAP
Sbjct  144   AIIRQLLGDTRLSQTLTNVVIPTFDIKFLQPTIFSTYQTKSTPLKDALLSDICIGTSAAP  203

Query  596   TYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDC  775
             TY P HYFE +D  GN   FNL+DGGV ANNPTL A++ V++ +    +PDF    P++ 
Sbjct  204   TYLPGHYFETKDDNGNKRSFNLVDGGVAANNPTLTAMTEVSKEILLS-NPDFFSYQPVEY  262

Query  776   QRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATI  955
              RF V+SLGTG+ K  +K+TA+ +A WG++GWL +    PLID+F+ AS+DMVD H + +
Sbjct  263   DRFLVISLGTGAPKQEEKFTAQESAKWGVLGWLLNKGTTPLIDIFTQASADMVDIHASVL  322

Query  956   FHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKP  1135
             F +L+ G NYLRI+ D+L G  +SVDV+T++NL+ L ++G +LLKK VS++++ TG  + 
Sbjct  323   FQALNKGKNYLRIEDDTLTGQTSSVDVSTKKNLQDLVDIGNSLLKKPVSRVNIETGHSEA  382

Query  1136  DDARGTNEEALKRFAKVLSENRKNR  1210
              D  GTNE AL  FAK LS+ ++ R
Sbjct  383   VDGEGTNEAALTGFAKKLSDEKRRR  407



>ref|XP_010028264.1| PREDICTED: patatin-like protein 1 [Eucalyptus grandis]
 gb|KCW54972.1| hypothetical protein EUGRSUZ_I00938 [Eucalyptus grandis]
Length=407

 Score =   429 bits (1103),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 221/381 (58%), Positives = 287/381 (75%), Gaps = 2/381 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K ITILSIDGGG+RGIIP  IL +LEAQLQELDG+  R+ DYFDVIAGTSTGGL+TAML+
Sbjct  17    KLITILSIDGGGVRGIIPGVILGYLEAQLQELDGEGARLADYFDVIAGTSTGGLITAMLS  76

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             APD + RPLFAAKDI+PFY E+ PKIFPQG G  GS+   +  L GPKY+G YLHK++ +
Sbjct  77    APDAHNRPLFAAKDIVPFYLENCPKIFPQGCGSLGSVLNTIKSLTGPKYNGVYLHKLIRK  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LG TRLH TLT +VIPTFDIK  QP++F++ E      LD ++SDICIG+SAAPTYFPA
Sbjct  137   LLGSTRLHDTLTSLVIPTFDIKKLQPVLFSSYEVSKHSFLDAQVSDICIGTSAAPTYFPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGT-NPMDCQRFR  787
             +YF+  D  G   EFNLIDGG+ ANNPTL+AIS VT+++  K+DPDF    +P+D  R  
Sbjct  197   YYFKTEDKDGRVHEFNLIDGGLAANNPTLIAISEVTRQIL-KEDPDFFDIKSPIDYTRLL  255

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGS     K+ AK A+ WG+  WL     +PLID ++  S+D+VD+H +  F + 
Sbjct  256   VISLGTGSDTSELKFDAKKASKWGLFSWLYEDGSSPLIDAYTQGSADLVDYHNSVAFKTY  315

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + DNYLRI  D+L+G ++SVD +T++NL+ L +VG++LL+K+VS+++L TG Y+P    
Sbjct  316   QSEDNYLRINDDTLKGTLSSVDTSTKKNLEDLVKVGEDLLRKAVSRVNLDTGHYEPIPNA  375

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
             GTNEEALKRFAK+LS+ +K R
Sbjct  376   GTNEEALKRFAKLLSDEKKLR  396



>ref|XP_006434813.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
 gb|ESR48053.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
Length=403

 Score =   429 bits (1102),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 221/371 (60%), Positives = 275/371 (74%), Gaps = 2/371 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IPATILAFLE++LQ+LDG++ RI DYFDVI+GTSTGGLVTAMLTA
Sbjct  18    LITILSIDGGGIRGVIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPLFAAKDI  FY  H PKIFPQ    FGS    +  L GPKYDGKYLH++V+E+
Sbjct  78    PNEQNRPLFAAKDIKEFYLNHCPKIFPQSSCPFGSATKLIKSLTGPKYDGKYLHRLVKEK  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD +LH+TLT VVIPTFDIKN QP +F++ E + +P LD  LSDIC+ +SAAPTY PAH
Sbjct  138   LGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDICVATSAAPTYLPAH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              FE +D  G    F+LIDGGV ANNPTLVA++ VT+ + R    D+   N MD  RF V+
Sbjct  198   SFETKDCTGKVRSFDLIDGGVAANNPTLVALNEVTKEINRGSS-DYYAINAMDYTRFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+ K   KY A  AA WG++GWL+     PL+DVF  +SSDM DFHI+T F +L +
Sbjct  257   SLGTGAPKTEVKYDAIKAAKWGVLGWLSSESSTPLVDVFMQSSSDMTDFHISTAFKALHS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              + YLRIQ D+L GD ASVDV T++NL+ L  +G+ LLKK V+K++  TG  +P   +GT
Sbjct  317   ENGYLRIQDDTLTGDEASVDVATKKNLESLVGIGERLLKKPVTKVNFETGLCEP-CGQGT  375

Query  1154  NEEALKRFAKV  1186
             N+EAL R+  V
Sbjct  376   NDEALIRYVTV  386



>ref|XP_009370175.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=406

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 217/381 (57%), Positives = 277/381 (73%), Gaps = 3/381 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K +T+LSIDGGGIRG+IPATIL FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAML 
Sbjct  15    KIVTVLSIDGGGIRGLIPATILTFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLA  74

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVVE  427
             AP+++ RPLFAAKDI+ FY    PKIFPQ       +    +  L GPKY+GKYLH+++ 
Sbjct  75    APNESNRPLFAAKDIIDFYLNQCPKIFPQNTWPIFPNTTKIIKALAGPKYNGKYLHRLIR  134

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             ERLG+ +LH TLT VVIPTFDIKN    +F+N + +  P  D  LSDICIG+SAAPTY P
Sbjct  135   ERLGNKKLHDTLTNVVIPTFDIKNLHTTIFSNFKMKKKPSYDALLSDICIGTSAAPTYLP  194

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYFE ++  G T EFNLIDGGV ANNPTL+A+      + RK +PD     PMD  RF 
Sbjct  195   AHYFEAKNAAGRTREFNLIDGGVAANNPTLLAVCEAINEI-RKVNPDVFPAKPMDYGRFL  253

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGSSK   KY A+ +A WG++ WLT     P+I+VFS AS+DMVD H++ +  +L
Sbjct  254   VISLGTGSSKTEMKYHARSSAKWGLLDWLTSGGSTPIINVFSQASNDMVDLHLSAVLQAL  313

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + +NYLRIQ D+L G +ASVD+ T++NL  L +VG+ LLKK VS+++L +G++K     
Sbjct  314   HSEENYLRIQDDTLRGTIASVDIATKKNLTNLVKVGEGLLKKPVSRVNLDSGRFKATKHE  373

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TN EAL RFAK+LSE ++ R
Sbjct  374   -TNAEALTRFAKLLSEEKRRR  393



>ref|XP_010059968.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
Length=411

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 219/384 (57%), Positives = 280/384 (73%), Gaps = 5/384 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGG+RG++P  ILAFLE++LQ+LDG+  R+ DYFDVIAGTSTGGLVTAMLT+
Sbjct  17    LITILSIDGGGMRGLVPGAILAFLESELQKLDGEDARLADYFDVIAGTSTGGLVTAMLTS  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PDK+ RPLF AKDI  F+  + PKIFPQ    F      +  + GPKYDGKYLHK+++E+
Sbjct  77    PDKHNRPLFTAKDIKDFFLNNCPKIFPQDSCPFAPATNMIKAVTGPKYDGKYLHKLIKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+TRL+QTLT VVIPTFD K  QP +F++ E +  P +D  LSD+CI +SAAPTY PAH
Sbjct  137   LGNTRLNQTLTNVVIPTFDAKQLQPTIFSSYEVKKKPSIDALLSDVCISTSAAPTYLPAH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D  G   EFNLI GGV ANNPTLVA+  V + +      DF   NPMD +RF V+
Sbjct  197   YFETQDPTGKVREFNLIVGGVAANNPTLVAMGEVRKEIIGGSS-DFFPINPMDYRRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS+K   KY A  AA WG++ WL+ + G+PLIDV   AS+DMVDFH++ +F +L  
Sbjct  256   SLGTGSAKVEGKYNASEAAKWGVLSWLSSNGGSPLIDVLMQASADMVDFHLSVVFQALLI  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQY----KPDD  1141
               NYLRIQ D+L G VASVD+  ++N+  L + G+ LLKK VS+++L TG+Y    +P  
Sbjct  316   EANYLRIQDDTLSGAVASVDIAMKKNMNDLVKTGEALLKKPVSRVNLETGRYEAFCEPTP  375

Query  1142  ARGTNEEALKRFAKVLSENRKNRL  1213
              + TNEEAL+RFAK+LS+ R+ RL
Sbjct  376   NQETNEEALRRFAKLLSQERQLRL  399



>emb|CDP07844.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 232/379 (61%), Positives = 292/379 (77%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRGIIPA IL FLE+QLQELDG+  RI DYFDVIAGTSTGGL+TAMLTA
Sbjct  19    LITILSIDGGGIRGIIPAAILDFLESQLQELDGEDARIADYFDVIAGTSTGGLITAMLTA  78

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPL+AAK+I PFY  +GPKIFPQ  G+ G IK     + GP YDGKYLHK+++E+
Sbjct  79    PNEKNRPLYAAKEIKPFYLGNGPKIFPQKSGILGLIKPVQNFIPGPLYDGKYLHKILKEK  138

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG TRL QTLT VVIPTFD+K  QP +F+  E + SP LD  LSDICIG+SAAPTYFP H
Sbjct  139   LGQTRLRQTLTNVVIPTFDVKYLQPTIFSTYEVKASPLLDALLSDICIGTSAAPTYFPVH  198

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF N+D KGN ++FNL DGGV ANNPT++A+S VT++M  K+DPDF+   P D  RF V+
Sbjct  199   YFTNQDDKGNVWDFNLTDGGVAANNPTILAMSQVTKQMI-KNDPDFSQMKPTDYARFLVI  257

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +K++A+M   W  +GW+ +    PL+++F+ AS DMVD+ I+ IF +L +
Sbjct  258   SIGTGSAKIEKKFSAEMVNKWNPLGWVLNGTVPPLVEMFAQASGDMVDYQISVIFQALHS  317

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L G  ASVDV T+EN++KL E+G NLLKK VS+++LLTG  +  +  GT
Sbjct  318   EANYLRIQDDTLTGQSASVDVATKENMEKLGEIGSNLLKKPVSRVNLLTGAVEQVENGGT  377

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEALKRFAK+LS+ R+ R
Sbjct  378   NEEALKRFAKLLSDERRLR  396



>ref|NP_195423.1| PATATIN-like protein 5 [Arabidopsis thaliana]
 sp|O23180.2|PLP5_ARATH RecName: Full=Patatin-like protein 5; Short=AtPLP5; AltName: 
Full=Patatin-related phospholipase A IIdelta; Short=pPLAIId; 
AltName: Full=Phospholipase A IVB; Short=AtPLAIVB [Arabidopsis 
thaliana]
 emb|CAB16788.1| patatin-like protein [Arabidopsis thaliana]
 emb|CAB80372.1| patatin-like protein [Arabidopsis thaliana]
 gb|AEE86742.1| PATATIN-like protein 5 [Arabidopsis thaliana]
Length=414

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 211/388 (54%), Positives = 282/388 (73%), Gaps = 1/388 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RGII   ILA+LE QLQELDG+ VR+ DYFDVIAGTSTGGLVTAMLTA
Sbjct  18    LVTILSLDGGGVRGIIAGVILAYLEKQLQELDGEHVRVADYFDVIAGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+N RP FAAK+I+PFY EH PKIFPQ  G+   +     LL GPKY G YL   + + 
Sbjct  78    PDENGRPRFAAKEIVPFYLEHCPKIFPQPTGVLALLPKLPKLLSGPKYSGNYLRTTLGKL  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+T+L QTLT VVIPTFDIK  QP +F++ +A   P LDVK+SDICIG+SAAPTYFP +
Sbjct  138   LGETKLRQTLTNVVIPTFDIKTLQPTIFSSYQALTDPSLDVKVSDICIGTSAAPTYFPPY  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF N D +G T  FNL+DGGV ANNPTLVA++ VT+++   ++PD    NP+   +F V+
Sbjct  198   YFSNEDSQGKTRHFNLVDGGVTANNPTLVAMTAVTKQIV-NNNPDMGTLNPLGYDQFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  ++Y+AK AA WGII WL      P++D+  ++S D+V +H + +F +L +
Sbjct  257   SIGTGSAKKEERYSAKKAAKWGIISWLYEDGTTPILDITFESSRDIVHYHSSVVFKALQS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+LEGD +++D++T+ NL+ L ++G+ +L   V ++++ TG Y+P      
Sbjct  317   EDKYLRIDDDTLEGDASTLDLSTKSNLENLIKLGEKMLTNRVMQMNIDTGTYEPAAENIN  376

Query  1154  NEEALKRFAKVLSENRKNRLKNEAKLSK  1237
             N+E LKRFAK+LSE RK R K   K++K
Sbjct  377   NDEQLKRFAKILSEERKLRRKRSDKMTK  404



>ref|XP_010061770.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW68765.1| hypothetical protein EUGRSUZ_F02366 [Eucalyptus grandis]
Length=404

 Score =   428 bits (1100),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 221/383 (58%), Positives = 278/383 (73%), Gaps = 2/383 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG++P  ILAFLE++LQ+LDG+  RI DYFDVIAGTSTG L+TAMLTA
Sbjct  16    LITILSIDGGGIRGVVPGVILAFLESELQKLDGEDARIADYFDVIAGTSTGALLTAMLTA  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPLFAAK I  FY ++GPKIFPQ   LF SI     L+ GPKYDGKYLH ++  +
Sbjct  76    PNEENRPLFAAKGIKSFYFDNGPKIFPQKSCLFSSITQSAKLVFGPKYDGKYLHSLLRAK  135

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+ RLHQTLT VVIPTFDIK  QP++F++ E +   +LD  LSDICIGSSAAPTY PAH
Sbjct  136   LGNLRLHQTLTNVVIPTFDIKQLQPIIFSSFEEKRKTRLDALLSDICIGSSAAPTYLPAH  195

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             +F+  D  G   ++NLIDGG+ ANNPTL+AIS VT+ + RK  P F   N  +  RF V+
Sbjct  196   FFQTSDSTGALRDYNLIDGGMAANNPTLIAISEVTREITRK-SPAFNSINASEFGRFLVI  254

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +KY AK  A WG+ GWL  ++  PLID F   S+DMVD H++ +F +L++
Sbjct  255   SVGTGSAKIEEKYEAKSVAKWGVFGWLMGANSVPLIDAFMQGSADMVDIHLSVVFKALNS  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L G V++VD +T+ENL  L  VG+ LLKK VSK++L TG  +      T
Sbjct  315   ESNYLRIQDDTLSGTVSTVDTSTKENLNNLVGVGEKLLKKPVSKVNLETGNLEASKME-T  373

Query  1154  NEEALKRFAKVLSENRKNRLKNE  1222
             NE+ALKRFAK+L E R+ R  N 
Sbjct  374   NEQALKRFAKLLVEERRRRHANH  396



>ref|XP_004289234.1| PREDICTED: patatin group A-3-like [Fragaria vesca subsp. vesca]
Length=385

 Score =   427 bits (1098),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/384 (55%), Positives = 279/384 (73%), Gaps = 6/384 (2%)
 Frame = +2

Query  68    QKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAML  247
             +K +T+LSIDGGG+RGIIP+TIL FLE++LQ+LDG   RI DYFD+IAGTSTGGLVT ML
Sbjct  8     RKMVTVLSIDGGGVRGIIPSTILGFLESKLQDLDGANARIADYFDIIAGTSTGGLVTTML  67

Query  248   TAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVE  427
             TAP+KN RP++ AKDI  FY EH P+IFPQ            A+ +GPKYDGK+L  +  
Sbjct  68    TAPNKNSRPMYEAKDINNFYFEHCPQIFPQKRRKNFFTSMTDAMKQGPKYDGKHLRSMTN  127

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
               LGD  L QTLT VVIPTFDIK+ QP+VFT  +A+++P  + KLSD+C+ +SAAP+Y P
Sbjct  128   GLLGDLTLKQTLTNVVIPTFDIKHLQPVVFTTIDAKENPLKNAKLSDVCVSTSAAPSYLP  187

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
              HYFE +D +GN   ++L+DGGV ANNPT++AIS + + M + +      + PMD  R +
Sbjct  188   PHYFEVKDDQGNIRTYDLVDGGVAANNPTMMAISHINREMLKNN------SEPMDATRLQ  241

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             VLSLGTG +K+++KY+A  A+ W ++ W+  +   PL+D+F DASSDMVDFH++T+F SL
Sbjct  242   VLSLGTGCAKFAEKYSAVAASKWSLVNWMFDNGSTPLLDIFGDASSDMVDFHVSTLFQSL  301

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
             +  +NYLRIQ D+L GD +SVD+ TE NLK L E+G  LLKK VS+++L TG+Y+  +  
Sbjct  302   NVKENYLRIQDDTLSGDASSVDIATETNLKSLVEIGNGLLKKPVSRVNLDTGRYEKCEGE  361

Query  1148  GTNEEALKRFAKVLSENRKNRLKN  1219
              T EEAL RFA  LS+ RK R  N
Sbjct  362   ATYEEALVRFAIQLSKGRKLRQTN  385



>emb|CDX69269.1| BnaC01g01840D [Brassica napus]
Length=415

 Score =   428 bits (1100),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 209/380 (55%), Positives = 280/380 (74%), Gaps = 1/380 (0%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K +TILS+DGGG+RGII   ILA+LE QLQE+DG+ VR+ DYFDV++GTSTGGL+TAMLT
Sbjct  17    KLVTILSLDGGGVRGIIAGVILAYLEKQLQEIDGEDVRLADYFDVVSGTSTGGLMTAMLT  76

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
              P +N RP  AAKDI+PFY EH PKIFPQ  GL   +     LL GPKY GKYL K++ +
Sbjct  77    VPGENGRPQLAAKDIVPFYLEHCPKIFPQPEGLAALLPKLPKLLSGPKYSGKYLRKLLSK  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LG+T+LHQT+T VVIPTFD+K  QP +F++ +A   P LDVK+SDIC+G+SAAPT+FP 
Sbjct  137   LLGETKLHQTVTNVVIPTFDMKKLQPTIFSSYQALVDPSLDVKISDICLGTSAAPTFFPP  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF N D +G T EFNL+DG V ANNPTLVA++ VT+++  K++PD     P+   +F V
Sbjct  197   HYFSNEDSQGKTTEFNLVDGAVTANNPTLVAMTAVTKQIL-KNNPDMGKLKPLGYDKFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTG+SK   KY+AK AA WGII WL +    P++D+ SD+  DM+ FH + +F +L 
Sbjct  256   ISIGTGTSKKEMKYSAKKAAKWGIISWLYNDGSTPILDMVSDSGRDMIHFHSSVLFKALQ  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + D YLRI  D+LEGDV+S+D+ T+ NL+ L ++G+ +LK  V  +++ TG Y+P     
Sbjct  316   SEDKYLRIDDDTLEGDVSSMDLATKSNLENLVKIGEKVLKNRVMHMNIDTGVYEPITENI  375

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNE+ LKRFAK+LS+ R+ R
Sbjct  376   TNEDQLKRFAKILSDERRLR  395



>ref|XP_006354911.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   427 bits (1098),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 233/379 (61%), Positives = 288/379 (76%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRGIIPATIL+FLE+QLQELDG   R+ DYFDV+AGTSTGGLVTAMLTA
Sbjct  16    LITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVMAGTSTGGLVTAMLTA  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+N RPL+AAKDI PFY E+ PKIFPQ  GLF  I+  +  L G K DGKYLH+VV+E+
Sbjct  76    PDENNRPLYAAKDITPFYLENCPKIFPQKSGLFTPIRNIVQTLIGSKCDGKYLHEVVKEK  135

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             L DTRL  T+T VVIPTFDIK  QP +F+  E + +   D KLSDICIG+SAAPTY PAH
Sbjct  136   LKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLSDICIGTSAAPTYLPAH  195

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+  DGK N  E +LIDGGV ANNP L+AIS V++ +  K++PDF    PM+  RF V+
Sbjct  196   YFKVEDGKDNVREHHLIDGGVAANNPGLIAISEVSKEIF-KNNPDFYPIKPMEYGRFLVI  254

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG++KY QKY + MAA WGI+ WL H   NPLI+VF+ +S+DMVD+H + +F +L +
Sbjct  255   SLGTGAAKYEQKYNSSMAAKWGIVEWLLHKGSNPLIEVFTQSSADMVDYHNSVVFQALRS  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D+YLRIQ D L G  ASVDV T+ENL++L E+G+NLLKK +S+++L TG  +P    GT
Sbjct  315   EDSYLRIQEDELSGTEASVDVATKENLERLVEIGENLLKKPLSRINLETGLTEPIPKGGT  374

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL RFA +L   R+ R
Sbjct  375   NEEALTRFATLLVNERRLR  393



>ref|XP_008777590.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=403

 Score =   427 bits (1097),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 216/381 (57%), Positives = 277/381 (73%), Gaps = 0/381 (0%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             + +T+LSIDGGG+RGIIP TILAFLE++LQ+LDGK  RI DYFD+IAGTSTGGLVTAMLT
Sbjct  17    RLVTVLSIDGGGVRGIIPGTILAFLESKLQDLDGKDARIADYFDIIAGTSTGGLVTAMLT  76

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
              P+K+ RPLFAAKDI  FY EH PKIFPQ  G+  SI      + GPKYDGKYLH  V E
Sbjct  77    TPNKDNRPLFAAKDITKFYLEHCPKIFPQKTGILSSITKLFTAVTGPKYDGKYLHLKVRE  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LG++RLHQ LT +VIP FDIK  QP VF+  EA ++P  +  LSDICI +SAAPTY PA
Sbjct  137   LLGESRLHQALTNIVIPAFDIKFLQPTVFSTFEARNTPLKNPLLSDICISTSAAPTYLPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE +D  GN   FNL+DGGV ANNPTL A+S + + +   ++ DF    P+D ++F V
Sbjct  197   HYFETKDAHGNKRSFNLVDGGVAANNPTLAAMSQIAKEVVCVENKDFHSIKPVDYRKFLV  256

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS+K  +K+TA  A+ WG+ GWL  S   PLI+ F+ AS+DM D H+  +F +L 
Sbjct  257   ISLGTGSAKMEEKFTAHEASKWGVRGWLYDSGDTPLINAFTQASADMDDIHLCAMFQALA  316

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
               +NYLRIQ D+L G  +SVDV+T++NL KL ++G +LLKK VS+++L TG ++    + 
Sbjct  317   CRENYLRIQDDNLIGGTSSVDVSTKKNLLKLVQIGSDLLKKHVSRVNLETGSFEEVKGKV  376

Query  1151  TNEEALKRFAKVLSENRKNRL  1213
             TN+EAL R AK LS+ R+ R 
Sbjct  377   TNDEALSRLAKRLSDERRLRF  397



>emb|CAN71271.1| hypothetical protein VITISV_001907 [Vitis vinifera]
Length=446

 Score =   428 bits (1101),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 246/419 (59%), Positives = 294/419 (70%), Gaps = 41/419 (10%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIPATILA LE+ LQELDG   RI DYFDVIAGTSTGGLV AMLTA
Sbjct  17    LVTILSIDGGGIRGIIPATILACLESHLQELDGDDARIADYFDVIAGTSTGGLVAAMLTA  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD  KRPLFAAKDI PFY EHGPKIFPQ  G+FG I   L  + GPKYDGKYL  +++E+
Sbjct  77    PDDQKRPLFAAKDIRPFYLEHGPKIFPQIRGIFGWIMSILRSIVGPKYDGKYLKSLIKEK  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEA---------------------------  532
             LG T LH+TLT VVIPTFDIK+ QP +F+  E                            
Sbjct  137   LGGTWLHETLTSVVIPTFDIKSLQPTIFSTYEVALALSLWLYPFGPRFNRVWVVAAQLMG  196

Query  533   -------------EDSPQLDVKLSDICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGG  673
                          + SP LD  L+DICIGSSAAPTYFPA+YF+N+D +G T EF+LIDGG
Sbjct  197   KGCSSRLILTAMVKRSPSLDAPLADICIGSSAAPTYFPAYYFKNQDKEGKTQEFDLIDGG  256

Query  674   VCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAAN  853
             V ANNP LVAI+ VT+++  ++ PDF     MD  RF V+S+GTGS K  QKY AKMAA 
Sbjct  257   VAANNPALVAITQVTKQVFDRN-PDFFPIKYMDFGRFLVISIGTGSPKSEQKYNAKMAAK  315

Query  854   WGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVD  1033
             WG++GWL H    PL+DVF  AS+DMVDFHI+ +F +L + DNYLRIQ D+L G  ASVD
Sbjct  316   WGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQALHSEDNYLRIQDDTLRGKDASVD  375

Query  1034  VTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             VTTEENL  L ++G+ LLKK VS+++L TG  +P +  GTNEEALKRFAK+LS+ ++ R
Sbjct  376   VTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFAKLLSDEKRLR  434



>ref|XP_009367378.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=407

 Score =   427 bits (1097),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 223/381 (59%), Positives = 274/381 (72%), Gaps = 3/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP TIL +LE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAML  
Sbjct  17    LITILSIDGGGIRGLIPGTILGYLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLAT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVVEE  430
             PD N RP+FAAKDI  FY  H PKIFPQ        +   +  L GPKYDGKYLH +V +
Sbjct  77    PDDNNRPVFAAKDIKDFYLTHCPKIFPQKHCPLFPKMTKIIKALSGPKYDGKYLHDLVGQ  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LG  +LHQTLT VVIPTFDIK  QP +F++ E +  P  D  LSDICI +SAAPTY PA
Sbjct  137   KLGSKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKSKPSFDALLSDICIATSAAPTYLPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE  D +GN  +FNLIDGGV ANNPTL+AI  VT+ +    + DF    PMD  RF V
Sbjct  197   HYFETIDPEGNVKDFNLIDGGVAANNPTLLAIGEVTKTIISGSE-DFFPIKPMDYGRFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS K   KY A  AA WG++ WLT   G P+IDVFS +SSDMVD+H++ +F +L 
Sbjct  256   ISLGTGSPKAEFKYRAHSAAKWGLLDWLTSGGGTPIIDVFSQSSSDMVDYHLSVVFQALH  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + +NYLRIQ D+L G V+SVD+  ++NL  L +VG+ LLKK VS+++L TG+ +P     
Sbjct  316   SENNYLRIQDDTLTGQVSSVDIADKKNLDDLLKVGEGLLKKPVSRVNLETGRVEPSKHE-  374

Query  1151  TNEEALKRFAKVLSENRKNRL  1213
             +NEEAL RFAK+LSE +  RL
Sbjct  375   SNEEALTRFAKLLSEEKWLRL  395



>ref|XP_007156814.1| hypothetical protein PHAVU_002G019800g [Phaseolus vulgaris]
 gb|ESW28808.1| hypothetical protein PHAVU_002G019800g [Phaseolus vulgaris]
Length=401

 Score =   426 bits (1096),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 231/384 (60%), Positives = 289/384 (75%), Gaps = 5/384 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             IT+LSIDGGGIRGIIP  +LA+LE++LQELDG   R+ DYFDV+ GTSTGGLV +ML AP
Sbjct  17    ITVLSIDGGGIRGIIPGVVLAYLESELQELDGDNARLADYFDVMTGTSTGGLVASMLAAP  76

Query  257   D--KNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             D   N RPLF+AKDI+PFY ++ P+IFPQ  G+F  +      L GPKYDGKYLH+++ +
Sbjct  77    DPKANNRPLFSAKDIVPFYLKNSPQIFPQKRGIFTPLVNIGKALMGPKYDGKYLHELIRK  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LGDT LHQTLT VVIPTFD+K  QP +F++ + E  P LDV LSDICI +SAAPT+ PA
Sbjct  137   NLGDTMLHQTLTNVVIPTFDVKKLQPTIFSSYQLETEPALDVPLSDICIATSAAPTFLPA  196

Query  611   HYFENRDGKGNTF-EFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             HYF  +D +G    EFNLIDGG+ ANNPTLVAI  VT++  RK  PD    +P+D  RF 
Sbjct  197   HYFTKQDAEGKVIKEFNLIDGGLAANNPTLVAIREVTKQTIRK--PDETTISPLDYDRFL  254

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             VLSLGTGS+    KY AKM +NWGI+ WL +S   P+ID FS+AS+DMVD+H   +F SL
Sbjct  255   VLSLGTGSNMSEHKYNAKMVSNWGILTWLFNSGSTPIIDCFSEASTDMVDYHNVVVFSSL  314

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + DNYLRIQ ++L+GD+ASVD+ T ENL  L +VG+NLLKK+V++++L TG Y+P   +
Sbjct  315   QSEDNYLRIQENTLKGDLASVDIATTENLNNLVKVGENLLKKTVTRVNLDTGLYEPAPDK  374

Query  1148  GTNEEALKRFAKVLSENRKNRLKN  1219
             GTNEEALKRFAK LSE RKN+  N
Sbjct  375   GTNEEALKRFAKSLSEARKNKKSN  398



>gb|KDO79282.1| hypothetical protein CISIN_1g015720mg [Citrus sinensis]
Length=402

 Score =   426 bits (1096),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 233/382 (61%), Positives = 288/382 (75%), Gaps = 5/382 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRGIIP  ILA+LE+QLQELDG+  R+ DYFDVIAGTSTGGL+TAMLTA
Sbjct  17    LITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARLADYFDVIAGTSTGGLLTAMLTA  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA-LLEGPKYDGKYLHKVVEE  430
             P +  RP++AAKDI+PFY  HGPKIFPQ  G+  +    L   L G KYDGKYLHKV++E
Sbjct  77    PSEQNRPMYAAKDIVPFYIRHGPKIFPQLRGMLANSVVNLVRALMGTKYDGKYLHKVIKE  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              L DT+LHQTLT V IPTFDIK  QP +F++ +   SP LD +L+DI IG+SAAPTYFPA
Sbjct  137   NLKDTKLHQTLTNVAIPTFDIKKLQPTIFSSFQVAASPDLDAQLADIAIGTSAAPTYFPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF+N D  G   EFNLIDGGV ANNPTLVAIS +T+ + +  +PDF   NP+D  RF V
Sbjct  197   HYFKNPDEHGTLKEFNLIDGGVAANNPTLVAISEMTKHILK--NPDFCPINPLDYTRFLV  254

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGS K   KY AKMA+ WGII WL  +   PL+D +  A  DMVD+HI+ +F +L 
Sbjct  255   ISIGTGSKKSEHKYNAKMASKWGIISWLYDNGDTPLLDCYGRAIGDMVDYHISVVFQALQ  314

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKP--DDA  1144
             + DNYLRI+ D+L+GDV S+D+TT+EN + L   G+ LLKK VS+++L TG Y+P  + +
Sbjct  315   SEDNYLRIEDDTLQGDVTSIDLTTKENFENLVRAGETLLKKPVSRINLDTGLYEPIENGS  374

Query  1145  RGTNEEALKRFAKVLSENRKNR  1210
              GTNEEALKRFAK+LS+ RK R
Sbjct  375   AGTNEEALKRFAKMLSDERKLR  396



>ref|XP_008393828.1| PREDICTED: patatin-like protein 2 isoform X2 [Malus domestica]
Length=408

 Score =   426 bits (1096),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 222/381 (58%), Positives = 276/381 (72%), Gaps = 3/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP TIL +LE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAML  
Sbjct  17    LITILSIDGGGIRGLIPGTILGYLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLAT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVVEE  430
             PD N RP+F+AKDI  FY  H PKIFPQ        +   +  L GPKYDGKYLH +V +
Sbjct  77    PDDNNRPVFSAKDIKDFYLTHCPKIFPQKHCPLFPKMTKIIKALSGPKYDGKYLHDLVGQ  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LG  +LHQTLT VVIPTFDIK  QP +F++ E +  P  D  LSDICI +SAAPTY PA
Sbjct  137   KLGSKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKSKPFFDALLSDICIATSAAPTYLPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE  D +GN  +FNLIDGGV ANNPTL+AI  VT+ +    + DF    PMD  RF V
Sbjct  197   HYFETIDPEGNVKDFNLIDGGVAANNPTLLAIGEVTKTIISGSE-DFFPIKPMDYGRFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS+K   KY A  AA WG++ WLT   G P+IDVFS +SSDMVD+H++ +F +L 
Sbjct  256   ISLGTGSAKAEFKYRAHSAAKWGLLDWLTSGGGTPIIDVFSQSSSDMVDYHLSVVFQALH  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + +NYLRIQ D+L G V+SVD+  ++NL  L +VG+ LLKK VS+++L TG+ +P     
Sbjct  316   SENNYLRIQDDTLTGQVSSVDIADKKNLDDLLKVGEGLLKKPVSRVNLETGRVEPSKHE-  374

Query  1151  TNEEALKRFAKVLSENRKNRL  1213
             +NEEAL RFAK+LSE ++ RL
Sbjct  375   SNEEALTRFAKLLSEEKRLRL  395



>ref|XP_008337062.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=406

 Score =   426 bits (1095),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 213/381 (56%), Positives = 279/381 (73%), Gaps = 3/381 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K + +LSIDGGGIRG+IPATILAFLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAML 
Sbjct  15    KMVRVLSIDGGGIRGLIPATILAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLA  74

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVVE  427
             AP++N RPLFAAKDI+ FY  H PKIFPQ            +  L GPKY+GKYLH ++ 
Sbjct  75    APNENNRPLFAAKDIIDFYFHHCPKIFPQNTCPIFRYTIKIIKALAGPKYNGKYLHSLIR  134

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E++G+ +LH+TLT VVIPTFDIKN QP VF+N   +  P  +  LSDI I +SAAPTY P
Sbjct  135   EKMGNKKLHETLTNVVIPTFDIKNLQPTVFSNHRVKRKPSYBALLSDIXIATSAAPTYLP  194

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYF+ +D  G   EFNLIDGGV ANNPTL+A+  +T  + +K++P      P+D  RF 
Sbjct  195   AHYFKTKDAAGRDKEFNLIDGGVAANNPTLLAVCEMTNEI-KKENPVLFPVKPVDYGRFL  253

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGSSK   KY A+ AA WG++ WLT     P+IDVFS AS+DMVD H++ +F +L
Sbjct  254   VISLGTGSSKAELKYHARSAAKWGLLNWLTSGGSTPIIDVFSQASADMVDLHLSGVFQAL  313

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              +  NYLRIQ D+L G ++SVD+ T++NL  L +VG+ LLK+ VS+++L +G+++  +  
Sbjct  314   HSEKNYLRIQDDTLHGTISSVDIATKKNLANLVKVGEGLLKQQVSRVNLDSGKFEASNHE  373

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TN EAL RFAK+LS+ +++R
Sbjct  374   -TNAEALIRFAKLLSKEKRSR  393



>ref|XP_006285520.1| hypothetical protein CARUB_v10006962mg [Capsella rubella]
 gb|EOA18418.1| hypothetical protein CARUB_v10006962mg [Capsella rubella]
Length=414

 Score =   426 bits (1096),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 211/397 (53%), Positives = 289/397 (73%), Gaps = 2/397 (1%)
 Frame = +2

Query  35    SSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAG  214
             SSF+     +    +TILS+DGGG+RGII   +LA+LE QLQELDG+  R+ DYFDVIAG
Sbjct  5     SSFKNNKPPSCGSLVTILSLDGGGVRGIIAGVVLAYLEKQLQELDGEDARLADYFDVIAG  64

Query  215   TSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPK  394
             TSTGGLVTAMLT PD   RP FAAKDI+PFY EH PKIFPQ  G+F  +     LL GPK
Sbjct  65    TSTGGLVTAMLTVPDGTGRPYFAAKDIVPFYLEHCPKIFPQPSGVFALLPKLPKLLSGPK  124

Query  395   YDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDIC  574
             Y GKYL  ++ + LG+ +LHQTLT VVIPTFDIK  QP VF++ +A   P L+VK+SDIC
Sbjct  125   YSGKYLRNLLSKLLGEAKLHQTLTNVVIPTFDIKKLQPTVFSSYQALVDPSLNVKVSDIC  184

Query  575   IGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFA  754
             +G+SAAPT+FP HYF N D +GNT EFNL+DG + ANNPTLVA++ V++++  K++PD  
Sbjct  185   VGTSAAPTFFPPHYFSNEDSQGNTTEFNLVDGAITANNPTLVAMTAVSKQIV-KNNPDMG  243

Query  755   GTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMV  934
                P+   +F V+S+GTGS+K  +KY+AK AA WGII WL  +   P++D+  ++S DM+
Sbjct  244   DIKPLGYDQFLVISIGTGSTKKEEKYSAKKAAKWGIISWLYDNGSTPILDITMESSRDMI  303

Query  935   DFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldl  1114
              FH + +F +L + D YLRI  D+L+G+V+S+D+ T+ NL+ L ++G+ +LK  V ++++
Sbjct  304   HFHSSVVFKALQSEDKYLRIDDDTLDGNVSSMDLATKSNLENLVKIGEKILKNRVVQMNI  363

Query  1115  lTGQYKPDDARGTNEEALKRFAKVLSENRK-NRLKNE  1222
              TG Y+P     TN+E LKR+AK+LS+ RK  R+++E
Sbjct  364   DTGVYEPVTENVTNDEQLKRYAKILSDERKLRRMRSE  400



>ref|XP_009409669.1| PREDICTED: patatin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=433

 Score =   426 bits (1096),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 216/382 (57%), Positives = 282/382 (74%), Gaps = 3/382 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K ITILSIDGGGIRG+IPATIL+FLE++LQ+LDG  VRI DYFDVIAGTSTGGLVTAML 
Sbjct  16    KLITILSIDGGGIRGVIPATILSFLESELQKLDGDDVRIADYFDVIAGTSTGGLVTAMLA  75

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             APD+N RPLFAAKD+  FY EH PKIFPQ GG    ++     L GPKY G YLH ++ E
Sbjct  76    APDENNRPLFAAKDMKSFYLEHSPKIFPQIGGFLAPVRRMFRSLWGPKYSGTYLHSLIRE  135

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LG  RLH+TLT V+IPTFDIK   P +F++ E +    LD  LSDICIG++AAPTYFPA
Sbjct  136   KLGGVRLHETLTNVIIPTFDIKQLHPTIFSSYEVKRKSSLDACLSDICIGTTAAPTYFPA  195

Query  611   HYFENRDGKGNTF-EFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             HYFE +D +G++  EF+LIDGG+ ANNP LVA+  VT+ + +K +PD      +D ++F 
Sbjct  196   HYFETKDSEGSSSREFHLIDGGIAANNPALVAVGEVTKEVHKK-NPDHFNREAVDYRKFL  254

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             ++SLGTGS+K   KY AK A+ WG+ GWL      PL+DV   + +D+VD H++ +F +L
Sbjct  255   LISLGTGSAKVEGKYRAKSASRWGVFGWLLGGGSTPLVDVLMQSCADIVDIHLSVVFKAL  314

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKP-DDA  1144
              +  NYLRI+ D+L G V+S D++TEENL  L  VG+ LLKK VS+++L TG ++P  + 
Sbjct  315   RSESNYLRIEDDTLTGAVSSADISTEENLDDLVSVGERLLKKPVSRVNLETGVFEPVGNG  374

Query  1145  RGTNEEALKRFAKVLSENRKNR  1210
              GTNE+AL+RFA++LS+ R+ R
Sbjct  375   EGTNEDALRRFARLLSDERRLR  396



>emb|CBI19553.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   426 bits (1096),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 237/379 (63%), Positives = 284/379 (75%), Gaps = 17/379 (4%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIPATILA LE+QLQELDG   RI DYFDVIAGTSTGGLVTAMLTA
Sbjct  63    LVTILSIDGGGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTGGLVTAMLTA  122

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+  KRPLFAAKDI PFY +HGPKIFPQ  G+FG I      + GP YDGKYLH +++E+
Sbjct  123   PNDEKRPLFAAKDIKPFYLKHGPKIFPQRRGIFGWIMNIFRSIVGPNYDGKYLHNLIKEK  182

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG TRLHQTLT VVIPTFDIK+ QP +F++ E + SP LD  L+DICIGSSAAPTYFPA+
Sbjct  183   LGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADICIGSSAAPTYFPAY  242

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             +F+N+D +G   E NLIDGGV ANNP LVAIS VT+++  K +PDF    PMD  RF V+
Sbjct  243   FFKNQDKEGKARELNLIDGGVAANNPALVAISQVTKQVFDK-NPDFLPIKPMDYGRFLVI  301

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS K  QKY AKMAA WG++GWL H    PL+DVF+ AS+DMVDFHI+ +F +L +
Sbjct  302   SIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQASADMVDFHISVVFQALHS  361

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRIQ                ENL  L ++G+ LLKK VS+++L TG   P +  GT
Sbjct  362   EDNYLRIQ----------------ENLGNLVKIGERLLKKPVSRVNLETGLSVPVENCGT  405

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEALKRFAK+LS+ ++ R
Sbjct  406   NEEALKRFAKLLSDEKRLR  424



>ref|XP_006829697.1| hypothetical protein AMTR_s00126p00052700 [Amborella trichopoda]
 gb|ERM97113.1| hypothetical protein AMTR_s00126p00052700 [Amborella trichopoda]
Length=404

 Score =   425 bits (1093),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 229/381 (60%), Positives = 291/381 (76%), Gaps = 1/381 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRGIIPATIL+FLE++LQ LDG++VR+ DYFDV+AGTSTGGLVTAM+TA
Sbjct  17    LITILSIDGGGIRGIIPATILSFLESELQNLDGEEVRLVDYFDVMAGTSTGGLVTAMITA  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P  N RPL+AAKDI  FY +H PKIF Q  GL GS++  ++ + GPKYDGKYLHK+V ++
Sbjct  77    PGDNNRPLYAAKDITSFYLDHCPKIFSQTSGLLGSVRKFVSAVTGPKYDGKYLHKLVRKQ  136

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD RLHQTLT+VVIPTFDI+  QP +F++ + +     D  LSDICI +SAAPTY PAH
Sbjct  137   LGDKRLHQTLTKVVIPTFDIRLLQPTIFSSYQMKADKSKDALLSDICISTSAAPTYLPAH  196

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFEN    G    F+LIDGG+ ANNPTLVA+  +T R   K++PDF    PMD  RF V+
Sbjct  197   YFENEGNDGKIKSFHLIDGGIAANNPTLVAMGEIT-REVHKENPDFFPIKPMDYGRFLVI  255

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS+K +  YTAK AA WG++GWL ++ G PLID F  AS+DMVD HI+ +F +L +
Sbjct  256   SLGTGSAKSTDNYTAKDAAKWGVLGWLYNNGGTPLIDTFQQASADMVDIHISNVFQALHS  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               +YLRIQ D+L GD +SVD+ TE+NLK L +VG  LL+K VS+++L TG+++P    GT
Sbjct  316   EQSYLRIQDDTLTGDTSSVDIATEKNLKDLVKVGTELLQKQVSRVNLETGKFEPVPNEGT  375

Query  1154  NEEALKRFAKVLSENRKNRLK  1216
             NE+AL RFAK+LS+ R+ RL+
Sbjct  376   NEQALIRFAKLLSKERRTRLQ  396



>ref|XP_010548401.1| PREDICTED: patatin-like protein 1 [Tarenaya hassleriana]
Length=395

 Score =   424 bits (1091),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 210/380 (55%), Positives = 279/380 (73%), Gaps = 1/380 (0%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K +TILS+DGGG+RGII   ILA LE +LQELDG+  R+ DYFDV+AGTSTGGLVTAMLT
Sbjct  10    KLVTILSLDGGGVRGIIAGVILARLEKELQELDGEGARLADYFDVMAGTSTGGLVTAMLT  69

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             AP++  RPLFAAK+I+PFY EH PKIF Q GG    +     LL GPKYDGKYLH+++ +
Sbjct  70    APNELGRPLFAAKEIVPFYMEHSPKIFSQPGGWLSVLPMPPRLLSGPKYDGKYLHELLRK  129

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LGD RLHQTLT +VIPTFDIK   P +F++ +    P LD KLSDICI +SAAPT+ P+
Sbjct  130   LLGDKRLHQTLTNIVIPTFDIKKLNPTIFSSYKILTDPTLDAKLSDICISTSAAPTFLPS  189

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF N D  G   EFNLIDGGV ANNPTLVA++ V++++   ++PD    NP+    F V
Sbjct  190   HYFVNEDINGKKTEFNLIDGGVTANNPTLVAMTAVSKQIIM-NNPDMGNMNPLGYDHFLV  248

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGS+K  +KY A  ++ WGI+ WL     +P+ID +S++SSDMV +HI+  F +LD
Sbjct  249   VSIGTGSAKKEEKYNATKSSKWGILSWLYEDGSSPIIDCYSESSSDMVHYHISVAFQALD  308

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + +NYLRI  D+LEGD +S+D++T+ NL+ L ++G+ +LK  V K+++ TG+Y+P     
Sbjct  309   SQENYLRIDDDTLEGDTSSLDISTKANLENLVKIGEKMLKNRVEKMNIETGKYEPVPDDI  368

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNE+ LKRFAK+LS+  K R
Sbjct  369   TNEQELKRFAKILSDEMKLR  388



>ref|XP_007047215.1| Uncharacterized protein TCM_000589 [Theobroma cacao]
 gb|EOX91372.1| Uncharacterized protein TCM_000589 [Theobroma cacao]
Length=401

 Score =   425 bits (1092),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 213/379 (56%), Positives = 285/379 (75%), Gaps = 6/379 (2%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGG+RGIIP  ILA LE++LQ +DG+  R+ DYFDVIAGTSTGGL+T M+ A
Sbjct  18    LITILSIDGGGVRGIIPGVILAKLESELQNIDGEDARLADYFDVIAGTSTGGLITTMVAA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++N RPL+AAKDI+PFY E+ PKIFPQ  G+ G     L  L GP+YDGKYL K++   
Sbjct  78    PNENDRPLYAAKDIVPFYLENSPKIFPQMSGVLGWAAKLLKALTGPRYDGKYLRKLIRGI  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG T+LHQTLT V IPTFDI   QP +F+  +   +P +D  L+DICIG+SAAPTYFP +
Sbjct  138   LGTTKLHQTLTSVAIPTFDITKLQPTIFSTYQIPINPDMDAPLADICIGTSAAPTYFPPY  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+N     N  EFNLIDGG+ ANNPTLVAI  VT+++  K++P+F+  +P+D  RF V+
Sbjct  198   YFKN-----NEEEFNLIDGGIAANNPTLVAIREVTKQIM-KENPNFSDMDPLDYTRFLVI  251

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLG GS++  +KY AK A+ WG+I WL  ++  P+ID +S+AS DMVD+H + +F +L +
Sbjct  252   SLGGGSNRLEKKYNAKEASKWGVICWLFENNHTPIIDCYSEASKDMVDYHNSVVFEALHS  311

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+L G++ASVDV T+EN+  L +VG++LLKK+V++++L TG Y+P +  GT
Sbjct  312   EDKYLRIDDDTLRGELASVDVATKENMDNLVKVGEDLLKKTVTRINLDTGLYEPIENGGT  371

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL+RFAK+LS+ +K R
Sbjct  372   NEEALRRFAKLLSDEKKVR  390



>ref|XP_008393827.1| PREDICTED: patatin-like protein 2 isoform X1 [Malus domestica]
Length=407

 Score =   425 bits (1092),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 222/381 (58%), Positives = 275/381 (72%), Gaps = 3/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP TIL +LE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAML  
Sbjct  17    LITILSIDGGGIRGLIPGTILGYLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLAT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVVEE  430
             PD N RP+F+AKDI  FY  H PKIFPQ        +   +  L GPKYDGKYLH +V +
Sbjct  77    PDDNNRPVFSAKDIKDFYLTHCPKIFPQKHCPLFPKMTKIIKALSGPKYDGKYLHDLVGQ  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LG  +LHQTLT VVIPTFDIK  QP +F++ E +  P  D  LSDICI +SAAPTY PA
Sbjct  137   KLGSKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKSKPFFDALLSDICIATSAAPTYLPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE  D +GN  +FNLIDGGV ANNPTL+AI  VT+ +    + DF    PMD  RF V
Sbjct  197   HYFETIDPEGNVKDFNLIDGGVAANNPTLLAIGEVTKTIISGSE-DFFPIKPMDYGRFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS+K   KY A  AA WG++ WLT   G P+IDVFS +SSDMVD+H++ +F +L 
Sbjct  256   ISLGTGSAKAEFKYRAHSAAKWGLLDWLTSGGGTPIIDVFSQSSSDMVDYHLSVVFQALH  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + +NYLRIQ D+L G V+SVD+  ++NL  L +VG+ LLKK VS+++L TG+ +P     
Sbjct  316   SENNYLRIQDDTLTGQVSSVDIADKKNLDDLLKVGEGLLKKPVSRVNLETGRVEPSKHE-  374

Query  1151  TNEEALKRFAKVLSENRKNRL  1213
             +NEEAL RFAK+LSE +  RL
Sbjct  375   SNEEALTRFAKLLSEEKWLRL  395



>ref|XP_008228776.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=428

 Score =   425 bits (1093),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 228/409 (56%), Positives = 284/409 (69%), Gaps = 9/409 (2%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRG+IP TIL +LEA+LQ+LDG+  RI DYFDVIAGTSTGGLVTAML  
Sbjct  17    LITVLSIDGGGIRGLIPGTILGYLEAELQKLDGEDARIADYFDVIAGTSTGGLVTAMLAT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVVEE  430
             PD+N RP+FAAKDI  FY  H PKIFPQ            +  L GPKYDGKYLH +V +
Sbjct  77    PDENNRPVFAAKDIKDFYLTHCPKIFPQKHCPIFPYATKIIKALAGPKYDGKYLHDLVGQ  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LGD +LHQTLT VVIPTFDIK  QP +F++ E +  P  D KLSDICI +SAAPTY PA
Sbjct  137   KLGDKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKHKPGFDAKLSDICIATSAAPTYLPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE  D +GN  EFNLIDGGV ANNPTL+AI  VT+ +  K   DF    PMD  RF V
Sbjct  197   HYFETMDPEGNVREFNLIDGGVAANNPTLLAIGEVTKTII-KGSSDFFPIKPMDYTRFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS+K   KY A  AA WG++ WLT   G P+IDVFS +S+DMVD+H++ +F +L 
Sbjct  256   ISLGTGSAKAEFKYHALSAAKWGLLDWLTSGGGTPIIDVFSQSSADMVDYHLSVVFQALR  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + +NYLRIQ D+L G V+SVD+  ++NL  L  VG+ LLKK VS+++L TG+ +P     
Sbjct  316   SENNYLRIQDDTLTGHVSSVDIADKQNLDDLLLVGERLLKKPVSRVNLETGRVEPSKHE-  374

Query  1151  TNEEALKRFAKVLSE------NRKNRLKNEAKLSKL*NVKYSIQFFSYC  1279
             +NEEAL RFAK+L        + K+  +N+   +    +  S  FF +C
Sbjct  375   SNEEALTRFAKLLRSGFALQGHPKDIPQNQNPTTDSFVLPLSFLFFVFC  423



>emb|CAN76066.1| hypothetical protein VITISV_001725 [Vitis vinifera]
Length=413

 Score =   424 bits (1091),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 220/367 (60%), Positives = 269/367 (73%), Gaps = 4/367 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP T+L FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT 
Sbjct  17    LITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTSTGGLVTAMLTT  76

Query  254   PDKNK-RPLFAAKDILPFYKEHGPKIFPQggg-lfgsikggLALLEGPKYDGKYLHKVVE  427
             P++N  RPLF+AKDI  FY +H PKIFPQ        +   +  L GPKYDGKYLH +V+
Sbjct  77    PNENTGRPLFSAKDIKDFYLDHCPKIFPQHSHDPIPHVTKVVTALSGPKYDGKYLHNLVK  136

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+TRLHQTLT VVIPTFDIK  QP +F+  + +  P LD  LSDICIG+SAAPTY P
Sbjct  137   EKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDICIGTSAAPTYLP  196

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYFE +D  G   EFNLIDGGV ANNPTLVAI  VT+ + R   PDF    PMD  RF 
Sbjct  197   AHYFETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEITR-GSPDFFPIKPMDYGRFL  255

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGSSK  +KY A  AA WG++GWLT     PL+ VF+ AS DM+D H++ IF +L
Sbjct  256   VISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQASGDMIDLHLSZIFQAL  315

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              +  +YLRIQ D+L G  +SVD+ T+ENL  L ++G+ LLKK VS+++L TG ++P +  
Sbjct  316   HSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEPSNHE  375

Query  1148  GTNEEAL  1168
              TNEEAL
Sbjct  376   -TNEEAL  381



>ref|XP_009370195.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=560

 Score =   430 bits (1105),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 221/381 (58%), Positives = 281/381 (74%), Gaps = 3/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRG+IP TILAFLE++LQ+LDG+  R+ DYFDVI+GTSTGGLVTAMLT 
Sbjct  17    LITVLSIDGGGIRGLIPGTILAFLESELQKLDGEDARLADYFDVISGTSTGGLVTAMLTT  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVVEE  430
             PD+N RP+F+AKDI  FY    PKIFPQ        I   +  L GPKY+GKYLH +V +
Sbjct  77    PDENNRPVFSAKDIKDFYLTESPKIFPQNTCWLFPYITKIIKSLTGPKYNGKYLHSLVRQ  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LG+ +LHQTLT VVIPTFDIKN QP +F++ E +  P  D  +SDICI +SAAPTYFPA
Sbjct  137   KLGEIKLHQTLTNVVIPTFDIKNLQPTIFSSFEVKHKPFFDALVSDICIATSAAPTYFPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE +D  GN  EFNLIDGGV ANNPTLVAI  VT+++  K  PDF    PMD  RF V
Sbjct  197   HYFETKDHNGNVREFNLIDGGVAANNPTLVAIGEVTKQII-KGSPDFFPIKPMDYGRFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS K   KY A  A+ WG++ WLT     P+I+VFS A++DMVD +++ +F +L 
Sbjct  256   ISLGTGSPKAELKYNAHDASKWGLLNWLTSGGSTPIINVFSHATADMVDLNLSVVFQALH  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             +  NYLRIQ D L GD++S+D+ TE+NL  L +VG++LLK+ VS+++L TG+++  +   
Sbjct  316   SEKNYLRIQDDKLHGDISSMDIATEKNLDNLVKVGEDLLKQPVSRVNLETGKFEACNHE-  374

Query  1151  TNEEALKRFAKVLSENRKNRL  1213
             TNEEAL RFAK+LSE +  RL
Sbjct  375   TNEEALIRFAKLLSEEKWLRL  395


 Score =   122 bits (307),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 85/144 (59%), Gaps = 7/144 (5%)
 Frame = +2

Query  161  ELDGKKVRICDYFDVIAGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQg  340
            +LD +  RI DYFDVIAGTSTG LVTAML  PD+N  P    + +        PK  P+ 
Sbjct  411  KLDVEDARIADYFDVIAGTSTGVLVTAMLATPDENNHPCLLPRILRNSTSLTAPKSSPRN  470

Query  341  gglfg-------sikggLALLEGPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKN  499
              ++         +   +  L GPKYDG YLH +V ++LG  +LHQTLT +VIPTFDIK 
Sbjct  471  SNVYMFICPLFPKMTKIIKALSGPKYDGMYLHDLVGQKLGSKKLHQTLTNIVIPTFDIKQ  530

Query  500  FQPLVFTNCEAEDSPQLDVKLSDI  571
             QP +F++ E +  P  D  LSD+
Sbjct  531  LQPTIFSSYEVKSKPCFDALLSDM  554



>ref|XP_009366776.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=386

 Score =   424 bits (1089),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 218/389 (56%), Positives = 284/389 (73%), Gaps = 9/389 (2%)
 Frame = +2

Query  47    MASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTG  226
             M++    +K +T+LSIDGGGI+G+IP+T+LAFLE++LQ+LDG   RI DYF++IAGTSTG
Sbjct  1     MSTCMTKRKTVTVLSIDGGGIKGLIPSTLLAFLESKLQDLDGPDARIADYFNIIAGTSTG  60

Query  227   GLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQg--gglfgsikggLALLEGPKYD  400
             GL+T MLTAP+K+ RP++ AKDI  FY  H PKIFPQ     L  SIK  +  + GPKYD
Sbjct  61    GLITTMLTAPNKDNRPMYQAKDITTFYLNHCPKIFPQNRGKNLLTSIKSLVGAVMGPKYD  120

Query  401   GKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIG  580
             GKYL  ++   LGD  L  TLT V+IP+FDIK  QP+VF+  +A+D P  + KLSD C+ 
Sbjct  121   GKYLRTLLSGLLGDLTLKDTLTNVLIPSFDIKYLQPVVFSTIDAKDHPLKNAKLSDTCVS  180

Query  581   SSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGT  760
             +SAAPTY PAHYF+ +D KG T  F+L+DGGV ANNPT++AIS + + M RK      G+
Sbjct  181   TSAAPTYLPAHYFDVKDDKGRTRTFDLVDGGVAANNPTMMAISHINREMLRK------GS  234

Query  761   NPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDF  940
             +PMD +R  VLSLGTG++K+ +KY A  A+ WG+I W+ H+   PL+D+FSDASSDMVD 
Sbjct  235   DPMDAKRLLVLSLGTGTAKFEEKYNAATASKWGLINWVLHNGNTPLVDIFSDASSDMVDI  294

Query  941   HIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllT  1120
             H++T+F  + A  NYLRIQ DSL GD ASVD+ TE+NL +L E+G  LLKK VS++ L T
Sbjct  295   HVSTLFQCVHAKHNYLRIQDDSLTGDEASVDIATEKNLMRLIEIGNALLKKPVSRVQLDT  354

Query  1121  GQY-KPDDARGTNEEALKRFAKVLSENRK  1204
             G+Y KP+   GT EEAL  FAK LSE +K
Sbjct  355   GRYEKPEGEEGTYEEALIDFAKRLSEVKK  383



>ref|XP_002869007.1| PLA IVA/PLP1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45266.1| PLA IVA/PLP1 [Arabidopsis lyrata subsp. lyrata]
Length=411

 Score =   424 bits (1091),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 209/387 (54%), Positives = 284/387 (73%), Gaps = 2/387 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RGII   ILA+LE QLQELDG+ VR+ DYFDVIAGTSTGGLVTAMLTA
Sbjct  18    LVTILSLDGGGVRGIIAGVILAYLEKQLQELDGENVRLADYFDVIAGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD   RP +AAKDI+PFY EH PKIFPQ  G+   +     LL GPKY G YL  +V   
Sbjct  78    PDGTGRPRYAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPKLLSGPKYSGNYLRTLVGTL  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+T+LHQTLT +VIPTFDIK  QP  F++ +A   P L+VK+SDIC+G+SAAPT+ PAH
Sbjct  138   LGETKLHQTLTNIVIPTFDIKTLQPTFFSSYQALADPSLNVKVSDICLGTSAAPTFLPAH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF   D +G T EFNL+DGGV ANNPTLVAI+ V++++  K++PD     P+   +F V+
Sbjct  198   YFSIEDSQGKTREFNLVDGGVTANNPTLVAITAVSKQIV-KNNPDMGTLKPLGFDKFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +KY+AK AA WGII WL      P++D+  ++S D+V +H + +F +L++
Sbjct  257   SIGTGSAKKEEKYSAKKAAKWGIISWLYEDGSTPILDITMESSRDIVHYHSSVLFKALES  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+LEGDV+++D+ T+ NL+ L+++G+ +L   V+++++ TG Y+P     T
Sbjct  317   EDKYLRIDDDTLEGDVSNMDLATKSNLENLKKIGEKMLTNRVAQMNIDTGAYEPITENIT  376

Query  1154  NEEALKRFAKVLSENRK-NRLKNEAKL  1231
             N+E LKRFAK+LS+ RK  RL+++  +
Sbjct  377   NDEQLKRFAKILSDERKLRRLRSDTMM  403



>ref|XP_010269035.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=405

 Score =   424 bits (1090),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 231/394 (59%), Positives = 286/394 (73%), Gaps = 4/394 (1%)
 Frame = +2

Query  29    SQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVI  208
             ++SS +  +  N    ITILSIDGGGIRGIIP  IL +LE+QLQELDGK  R+ DYFDVI
Sbjct  4     TKSSLQPPTYGN---LITILSIDGGGIRGIIPGIILGYLESQLQELDGKDARLADYFDVI  60

Query  209   AGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEG  388
             AGTSTGGLVTAMLTAP++  RPLF+A+DI  FY E  P+IFPQ           +  L G
Sbjct  61    AGTSTGGLVTAMLTAPNEKNRPLFSAEDIKAFYLEQCPRIFPQLSCPLAPAAKVMKALIG  120

Query  389   PKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSD  568
             PKYDGKYLH+VV+E+L  TRLHQTLT VV+PTFDIKN QP +F++ E +  P LD  LSD
Sbjct  121   PKYDGKYLHRVVKEKLETTRLHQTLTNVVVPTFDIKNLQPTIFSSYEVKSKPSLDAFLSD  180

Query  569   ICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPD  748
             ICI +SAAPTY PAHYF+ +D  G   EFNLIDGGV ANNPTLVA+  VT+ +  K  PD
Sbjct  181   ICISTSAAPTYLPAHYFQTQDPDGKVREFNLIDGGVAANNPTLVAMREVTKEIT-KGSPD  239

Query  749   FAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSD  928
             F    PMD  RF V+SLGTG+ K ++KY+A  AA WG++GWL      PL+DVF+ AS D
Sbjct  240   FFPIKPMDYGRFLVISLGTGAPKAAEKYSAHQAAKWGVMGWLLEGGSTPLVDVFTHASGD  299

Query  929   MVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskl  1108
             MVD HI+ +F +L + DNYLRIQ D+L   V+SVDV T+ENL  L +VG+ LLK  VS++
Sbjct  300   MVDLHISVVFQALRSEDNYLRIQDDTLGSTVSSVDVATKENLDNLVKVGEALLKNPVSRV  359

Query  1109  dllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             +L TG Y+P   +GTNEE L+RFAK+LS+ ++ R
Sbjct  360   NLDTGIYEPSKTKGTNEEELRRFAKLLSDEKRLR  393



>emb|CDX72619.1| BnaC07g46410D [Brassica napus]
Length=408

 Score =   424 bits (1090),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 212/384 (55%), Positives = 279/384 (73%), Gaps = 2/384 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGGIRG I   ILA LE QLQE+DG+ VR+ DYFDV+AGTSTGGL+TAMLT 
Sbjct  18    LVTILSLDGGGIRGTISGVILACLEKQLQEIDGEDVRLADYFDVVAGTSTGGLITAMLTV  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD + RP FAAKDI+PFY EH PKIFPQ  GL   +     LL GPKYDGKYL  ++   
Sbjct  78    PDASGRPHFAAKDIVPFYLEHCPKIFPQPEGLAALLPKLPKLLSGPKYDGKYLRSLLSNL  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+T+LHQT+T VVIPTFD+K  QP +F++ +A   P LDVKLSDICIG+SAAPT+FP H
Sbjct  138   LGETKLHQTITNVVIPTFDMKKLQPAIFSSYQALFDPSLDVKLSDICIGTSAAPTFFPPH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF N D +G T EF+L+DGGV A+NPTLVA++ VT+++  K++PD     P+   +F V+
Sbjct  198   YFSNVDSQGKTSEFHLVDGGVTASNPTLVAMTAVTKQIV-KNNPDMGKLKPLGYDKFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +KY+AK AA WGII WL      P++D+  ++S DM+ FH + +F +L +
Sbjct  257   SIGTGSTKKVEKYSAKKAAKWGIISWLYDDGSTPILDITMESSRDMIHFHSSVLFKALQS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+L+GD  S D+ T+ NL+ L ++G+ +LK  V  +++ TG Y+P     T
Sbjct  317   EDKYLRIDDDTLDGDAGSTDLATKSNLENLVKIGEKVLKNRVVHMNIDTGAYEPIPENVT  376

Query  1154  NEEALKRFAKVLSENRK-NRLKNE  1222
             NEE LKRFAK+LSE RK  R+++E
Sbjct  377   NEEELKRFAKILSEERKLRRMRSE  400



>ref|XP_009139093.1| PREDICTED: patatin-like protein 3 [Brassica rapa]
Length=407

 Score =   424 bits (1089),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 214/392 (55%), Positives = 288/392 (73%), Gaps = 6/392 (2%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             + +TILSIDGGG+RGIIP  +LA+LE+QLQELDG++ R+ DYFDVI+GTSTGGL+ AMLT
Sbjct  18    QHVTILSIDGGGVRGIIPGIVLAYLESQLQELDGEEARLVDYFDVISGTSTGGLIVAMLT  77

Query  251   APDKNKR--PLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVV  424
             APDK  R  PLFAAK+I+PFY++H PKIFP   G F   +  + L+ GPKY+GKYL +V+
Sbjct  78    APDKTNRNRPLFAAKEIVPFYRKHCPKIFPHPRGAFAWAQILVRLVRGPKYNGKYLREVI  137

Query  425   EERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYF  604
             E+ LGDTRL QTLT VVIP FDIK  QP++F++ +A      D K+SDIC+ +SAAPTY 
Sbjct  138   EDFLGDTRLTQTLTNVVIPCFDIKKLQPVIFSSYQAVSRRVTDAKISDICLSTSAAPTYL  197

Query  605   PAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRF  784
             PAH F N D +GN  E+NLIDGG+ ANNPTL AI+ VT+++ +K +P     +P+D  R 
Sbjct  198   PAHRFTNEDNEGNKHEYNLIDGGIAANNPTLCAIAEVTKQIVKK-NPAMGDISPLDYTRV  256

Query  785   RVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHS  964
              V+SLGTGS +  +KY A MA+ WG++ W+     +P+ID +++A  D+VD+    +F +
Sbjct  257   VVISLGTGSIRNEEKYDAIMASKWGLVSWICADGSSPIIDCYNEAIQDIVDYQSCVVFQA  316

Query  965   LDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDA  1144
             L +  NYLRI  D+L+GD+ SVD++TE+N+  L EVG+ LLKK+VS+++L TG Y+P   
Sbjct  317   LHSETNYLRIDDDTLKGDIGSVDISTEKNMDGLVEVGKALLKKNVSRVNLETGHYEPISD  376

Query  1145  RGTNEEALKRFAKVLSENRKNRLKNEAKLSKL  1240
               TNEEALKR AK+LSE RK R   E++  KL
Sbjct  377   HVTNEEALKRVAKILSEERKLR---ESRYHKL  405



>emb|CDX75621.1| BnaA01g00810D [Brassica napus]
Length=407

 Score =   424 bits (1089),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 214/392 (55%), Positives = 288/392 (73%), Gaps = 6/392 (2%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             + +TILSIDGGG+RGIIP  +LA+LE+QLQELDG++ R+ DYFDVI+GTSTGGL+ AMLT
Sbjct  18    QHVTILSIDGGGVRGIIPGIVLAYLESQLQELDGEEARLVDYFDVISGTSTGGLIVAMLT  77

Query  251   APDKNKR--PLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVV  424
             APDK  R  PLFAAK+I+PFY++H PKIFP   G F   +  + L+ GPKY+GKYL +V+
Sbjct  78    APDKTNRNRPLFAAKEIVPFYRKHCPKIFPHPRGAFAWAQILVRLVRGPKYNGKYLREVI  137

Query  425   EERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYF  604
             E+ LGDTRL QTLT VVIP FDIK  QP++F++ +A      D K+SDIC+ +SAAPTY 
Sbjct  138   EDFLGDTRLTQTLTNVVIPCFDIKKLQPVIFSSYQAVSRRVTDAKISDICLSTSAAPTYL  197

Query  605   PAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRF  784
             PAH F N D +GN  E+NLIDGG+ ANNPTL AI+ VT+++ +K +P     +P+D  R 
Sbjct  198   PAHRFTNEDNEGNKHEYNLIDGGIAANNPTLCAIAEVTKQIVKK-NPAMGDISPLDYTRV  256

Query  785   RVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHS  964
              V+SLGTGS +  +KY A MA+ WG++ W+     +P+ID +++A  D+VD+    +F +
Sbjct  257   VVISLGTGSIRNEEKYDAIMASKWGLVSWICADGSSPIIDCYNEAIQDIVDYQSCVVFQA  316

Query  965   LDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDA  1144
             L +  NYLRI  D+L+GD+ SVD++TE+N+  L EVG+ LLKK+VS+++L TG Y+P   
Sbjct  317   LHSETNYLRIDDDTLKGDIGSVDISTEKNMDGLVEVGKALLKKNVSRVNLETGHYEPISD  376

Query  1145  RGTNEEALKRFAKVLSENRKNRLKNEAKLSKL  1240
               TNEEALKR AK+LSE RK R   E++  KL
Sbjct  377   HVTNEEALKRVAKILSEERKLR---ESRYHKL  405



>ref|XP_009367379.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=397

 Score =   423 bits (1088),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 216/382 (57%), Positives = 276/382 (72%), Gaps = 3/382 (1%)
 Frame = +2

Query  65    SQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAM  244
             S+K IT+LSIDGGGIRG+IPATIL FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAM
Sbjct  5     SRKLITVLSIDGGGIRGLIPATILGFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAM  64

Query  245   LTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVV  424
             LT P++N RPLFAAKD+  FY    PKIFPQ      + K   AL  GPKY+GKYLH ++
Sbjct  65    LTTPNENDRPLFAAKDLKDFYLSECPKIFPQKIWFSYTRKIMKAL-TGPKYNGKYLHGLI  123

Query  425   EERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYF  604
              ++LG+ +LH TLT VVIPTFDI+N QP+VF++C  E  P  D  LSDICI +SAAPTY 
Sbjct  124   RQKLGNNKLHNTLTNVVIPTFDIRNLQPVVFSSCGVEKKPCTDALLSDICIATSAAPTYL  183

Query  605   PAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRF  784
             PAHYFE +   G   E+NLIDGGV ANNPT VAI  V   +  K++ D      +D  RF
Sbjct  184   PAHYFETKYAAGTVREYNLIDGGVAANNPTFVAICEVVNEI-EKENSDIVSVKRVDYGRF  242

Query  785   RVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHS  964
              V+SLGTGSSK  ++Y A  AA WG++ WLT     P+IDVFS AS+DMVD H++ +F +
Sbjct  243   LVISLGTGSSKAEREYHASAAAKWGLLNWLTSGGSTPIIDVFSQASADMVDLHLSRVFQA  302

Query  965   LDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDA  1144
              ++ +NYLRIQ D+L G ++SVDV T++NL  L +VG+ LLK+ VS+++L +G+++    
Sbjct  303   FNSEENYLRIQDDTLHGTISSVDVATKKNLANLVKVGEGLLKQPVSRVNLDSGRFEASKH  362

Query  1145  RGTNEEALKRFAKVLSENRKNR  1210
               TN EAL RFAK+LSE +  R
Sbjct  363   E-TNAEALTRFAKLLSEEKLFR  383



>ref|XP_011017230.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
 ref|XP_011013052.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
Length=408

 Score =   423 bits (1088),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 221/381 (58%), Positives = 277/381 (73%), Gaps = 4/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRG+IP TI+ FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT 
Sbjct  17    LITVLSIDGGGIRGLIPGTIINFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTC  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVVEE  430
             PD+N RP+FAAKDI  FY    PKIFPQ        +K  +  L GPKYDGKYLH +V+E
Sbjct  77    PDENSRPMFAAKDIKDFYLNQCPKIFPQPRCSLFTQVKKVIKALTGPKYDGKYLHGLVKE  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LG+ RLH TLT VVIPTFDIK FQP +F++ EA+ +  LD  LSDICI +SAAPTY PA
Sbjct  137   LLGNRRLHHTLTNVVIPTFDIKTFQPTIFSSFEAKKNHSLDALLSDICIATSAAPTYLPA  196

Query  611   HYFENRDGK-GNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             HYFE +D + G   EFNLIDGGV ANNP L+AIS VT+ +  K  PDF    PMD  RF 
Sbjct  197   HYFETKDEQTGEVREFNLIDGGVAANNPALIAISEVTKEIV-KGSPDFFPIKPMDYGRFL  255

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             ++SLGTGS K  +KY A  AA WG++GWLT     P+ID FS AS+DMVD HI+ +  +L
Sbjct  256   LISLGTGSPKAQEKYKATEAAKWGLLGWLTSGGSTPVIDAFSHASADMVDLHISVVLQAL  315

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + +NYLR+Q D+L  +  SVD+ T+ NL+ L +VG+ LLKK VS+++L +G ++    +
Sbjct  316   HSENNYLRVQDDTLSREECSVDIATKTNLEDLVKVGERLLKKPVSRVNLESGLFE-QSVK  374

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TNEEAL RFAK+LS+ ++ R
Sbjct  375   ETNEEALARFAKILSQEKQLR  395



>ref|XP_006660213.1| PREDICTED: patatin-3-Kuras 1-like, partial [Oryza brachyantha]
Length=412

 Score =   424 bits (1089),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 220/380 (58%), Positives = 276/380 (73%), Gaps = 4/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +T+LSIDGGG+RGIIP TILAFLE +LQE+DG + RI DYFDV+AGTSTGG+VTAMLTA
Sbjct  30    IVTVLSIDGGGVRGIIPGTILAFLEEKLQEIDGPEARIADYFDVVAGTSTGGVVTAMLTA  89

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD   RPLFAAK I  FY EH PKIFP      G IK   +L+ GPKYDGKYLH VV++ 
Sbjct  90    PDDQGRPLFAAKGINDFYLEHSPKIFPPRRSNLGLIK---SLMSGPKYDGKYLHSVVQKL  146

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD R++QTLT VVIPTFDIK  QP+ F+  +A++    +  LSD+CI +SAAPTY P H
Sbjct  147   LGDKRVNQTLTNVVIPTFDIKLLQPITFSRFDAQNDESKNALLSDVCISTSAAPTYLPGH  206

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              FE +D  GN+  FNLIDGGV ANNPTL+A++ V++++   +  DF    P D  +F +L
Sbjct  207   RFETKDKDGNSRAFNLIDGGVAANNPTLLAMTHVSKQILLGNK-DFFPIKPTDYGKFMIL  265

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS+K  QKY A  ++ WGI+ WL H    PLID FS AS+D+VD H + +F +L  
Sbjct  266   SLGTGSAKIEQKYDATQSSKWGILDWLYHDGSTPLIDSFSQASADLVDIHASVLFQALRC  325

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               +YLRIQ D L GD ASVDV+T ENL++L +VG+ LLKK   K+++ TG+ +PD  RGT
Sbjct  326   QRSYLRIQDDELTGDAASVDVSTPENLRRLVDVGRALLKKPACKVNVETGRNEPDMDRGT  385

Query  1154  NEEALKRFAKVLSENRKNRL  1213
             NEE LK FA++LSE RK RL
Sbjct  386   NEEELKHFAEMLSEERKARL  405



>ref|XP_008384958.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=397

 Score =   423 bits (1087),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 220/382 (58%), Positives = 277/382 (73%), Gaps = 3/382 (1%)
 Frame = +2

Query  65    SQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAM  244
             S+K IT+LSIDGGGIRG+IPATIL FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAM
Sbjct  5     SRKLITVLSIDGGGIRGLIPATILGFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAM  64

Query  245   LTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVV  424
             LT P++N RPLFAA+DI  FY    PKIFPQ   L  + K   AL  GPKYDGKYLH ++
Sbjct  65    LTTPNENDRPLFAAEDIKDFYLXECPKIFPQKIWLPYTRKIMKAL-TGPKYDGKYLHGLI  123

Query  425   EERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYF  604
              ++LG+ +LH TLT VVIPTFDI+N QP+VF++   E  P  D  LSDICI +SAAPTY 
Sbjct  124   RQKLGNNKLHBTLTNVVIPTFDIRNLQPVVFSSLRVEKKPCTDALLSDICIATSAAPTYL  183

Query  605   PAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRF  784
             PAHYFE +   G   E+NLIDGGV ANNPT VAI  V   +  K++ D       D  RF
Sbjct  184   PAHYFETKYAAGTVREYNLIDGGVAANNPTFVAICEVMNEI-EKENSDIVPVKXXDYGRF  242

Query  785   RVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHS  964
              V+SLGTGSSK  +KY A  AA WG++ WLT     P+IDVFS AS+DMVD H++ +F +
Sbjct  243   LVISLGTGSSKAERKYXAPAAAKWGLLNWLTSGGSTPIIDVFSQASADMVDLHLSGVFQA  302

Query  965   LDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDA  1144
             L++ +NYLRIQ D+L G V+SVDV T++NL  L +VG+ LLK+ VS+++L +G+++  + 
Sbjct  303   LNSEENYLRIQDDTLHGTVSSVDVATKKNLANLVKVGEGLLKQPVSRVNLDSGRFEASNH  362

Query  1145  RGTNEEALKRFAKVLSENRKNR  1210
               TN EAL RFAK+LSE +  R
Sbjct  363   E-TNAEALTRFAKLLSEEKLLR  383



>ref|XP_003576611.1| PREDICTED: patatin-like protein 2 isoform X1 [Brachypodium distachyon]
Length=404

 Score =   422 bits (1086),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 234/382 (61%), Positives = 288/382 (75%), Gaps = 4/382 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRGII A  LAFLE +LQ+LDG++ R+ DYFDVIAGTSTGGLVTAMLTA
Sbjct  18    LITVLSIDGGGIRGIIAAVALAFLETELQKLDGEEARLADYFDVIAGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+K++RPLFAAKDI  FY +H PKIFPQ  G FG I   L  L GP YDGKYLH+VV ++
Sbjct  78    PNKDRRPLFAAKDIQAFYMDHAPKIFPQLRGAFGRIMKVLRSLSGPSYDGKYLHEVVRKK  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQ-LDVKLSDICIGSSAAPTYFPA  610
             LG  RLHQTLT VVIPTFDIK  QP +F++ E +     +D  LSDICI +SAAPTY PA
Sbjct  138   LGSIRLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKKRNTMDALLSDICISTSAAPTYLPA  197

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF+  D  GN  EFNLIDGGV ANNP LVAI  VT+++  K++PDF    PMD  RF V
Sbjct  198   HYFKTEDLHGNIKEFNLIDGGVAANNPALVAIGEVTKQIF-KENPDFFPIKPMDYGRFLV  256

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGSSK+ +KY A+ A +WG++ WL  S   PL+D+F+ AS+DMVD HIA +F +L 
Sbjct  257   ISLGTGSSKFEEKYNAQKAKSWGVLDWLLSSGSTPLVDIFTRASADMVDIHIAAVFKALH  316

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPD--DA  1144
             +  NYLRIQ D+L+G ++SVDV T++NL+KL  VG+ LLKKSVS+ +L TGQ  P   D+
Sbjct  317   SEQNYLRIQDDTLQGTLSSVDVATKDNLEKLVNVGEMLLKKSVSRANLETGQMVPTCGDS  376

Query  1145  RGTNEEALKRFAKVLSENRKNR  1210
               TNE+AL+RFA +LSE R+ R
Sbjct  377   EMTNEKALERFANLLSEERRIR  398



>ref|XP_010269056.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010269064.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=408

 Score =   422 bits (1086),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 236/380 (62%), Positives = 286/380 (75%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRGIIPA IL FLE+QLQELDG+  R+ DYFDVIAGTSTGGLVTAMLTA
Sbjct  16    LITILSIDGGGIRGIIPAAILNFLESQLQELDGEDARLADYFDVIAGTSTGGLVTAMLTA  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PDK+ RPLFAAKDI  FY EH PKIFPQ  G F S K  +  L GPKY+GKYLH +V+E+
Sbjct  76    PDKDNRPLFAAKDIQAFYLEHCPKIFPQCKGPFSSAKKIIRQLAGPKYNGKYLHGLVKEK  135

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG +RL  TLT VVIPTFDIK+ QP +F++ E +  P LD +LSDICI ++AAPTY PAH
Sbjct  136   LGASRLRDTLTNVVIPTFDIKHLQPTIFSSYEVKKKPFLDAQLSDICISTAAAPTYLPAH  195

Query  614   YFENRDGKGNTF-EFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             +FE +   G    +FNLIDGGV ANNPT+VAIS VT+ +  K +PDF    PMD  RF V
Sbjct  196   HFETKGSHGTKVRKFNLIDGGVAANNPTIVAISEVTKEIL-KGNPDFFPIKPMDYGRFLV  254

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS K  +KY+AKMAA WGI+GWL      PL+DVF+ AS DMVDF I+ +F +L 
Sbjct  255   ISLGTGSPKKDEKYSAKMAAKWGILGWLLSRGSTPLVDVFTQASGDMVDFQISVVFQALH  314

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             +  NYLRIQ D+L   +ASVD+ T+ENL+ L +VG+ LLKK VS+++L TG     ++ G
Sbjct  315   SEINYLRIQDDTLNETLASVDIATKENLENLVKVGEALLKKPVSRVNLETGSCVHIESEG  374

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNE+ALKRFAK+LS  R+ R
Sbjct  375   TNEQALKRFAKLLSNERRVR  394



>gb|KFK30333.1| hypothetical protein AALP_AA7G248300 [Arabis alpina]
Length=411

 Score =   422 bits (1086),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 210/390 (54%), Positives = 284/390 (73%), Gaps = 2/390 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RGII   ILA+LE QLQELDG+ +R+ DYFDV+AGTSTGGL+TAMLT 
Sbjct  18    LVTILSLDGGGVRGIIAGVILAYLEKQLQELDGEDMRLADYFDVVAGTSTGGLMTAMLTV  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+  RP FAAKDI+P Y EH PKIFPQ  GLF  +     LL GPKYDGKYL  ++ + 
Sbjct  78    PDETGRPQFAAKDIVPVYLEHSPKIFPQPEGLFARLPKLPKLLSGPKYDGKYLKNLLSKV  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+T+LHQTLT +VIPTFDIK  QP +F++ ++   P LDVKLSDICIG+SAAPT+FP H
Sbjct  138   LGETKLHQTLTNIVIPTFDIKKLQPTIFSSYQSLVYPSLDVKLSDICIGTSAAPTFFPPH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF N D  GN  EF+LIDGG+ ANNPTLVA++ VT+++  K++PD     P+   +F V+
Sbjct  198   YFSNEDILGNNSEFHLIDGGITANNPTLVAMTAVTKQIV-KNNPDMGELKPLGYNKFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +KY AK AA WGII WL      P++D+  D+S D+V FH + +F +L +
Sbjct  257   SIGTGSAKKEEKYNAKKAAKWGIISWLYDDGSTPILDIAMDSSHDIVHFHSSVVFTALQS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              + YLRI  D+LEG  +S+D+ T+ NL+ L ++G+ +LK  V  +++ TG Y+P     T
Sbjct  317   EEKYLRIDDDTLEGVASSMDLATKPNLENLVKIGEKMLKNKVVHMNIDTGVYEPVAKNVT  376

Query  1154  NEEALKRFAKVLSENRK-NRLKNEAKLSKL  1240
             N++ LKRFAK+LS+ RK  R++++  ++ L
Sbjct  377   NDQELKRFAKILSDERKLRRMRSDTMVTDL  406



>ref|XP_011038244.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   422 bits (1085),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 231/378 (61%), Positives = 288/378 (76%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             IT+LSIDGGGIRGIIP TILAFLE++LQ+LDG   R+ DYFDVI+GTSTGGLVTAML AP
Sbjct  20    ITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVISGTSTGGLVTAMLAAP  79

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             +K  RPLFAAKDI  FY E+ PKIFPQ    F S    +  L GPKYDGK+LH +V+E+L
Sbjct  80    NKQNRPLFAAKDINEFYLENCPKIFPQDSSKFASAANLVKTLRGPKYDGKFLHGIVKEKL  139

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             GDT L QTLT +VIPTFDIK  QP +F++C  +++P  D  LSDICIG+SAAPTY PAHY
Sbjct  140   GDTWLQQTLTNIVIPTFDIKRLQPTIFSSCNVKNNPSTDALLSDICIGTSAAPTYLPAHY  199

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE +D  G   EFNLIDGGV ANNPTLVAIS V+Q + R + PD    NPM+  RF VLS
Sbjct  200   FETKDPSGKVREFNLIDGGVAANNPTLVAISEVSQAINR-EGPDSYHMNPMEYGRFLVLS  258

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG++K  +KY A+ AA WG++GWLT     PL+DVF+ AS DMVDFHI+T+F +L++ 
Sbjct  259   LGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQALNSE  318

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             +NYLRIQ D+L G ++SVDV T ENL+ L +VG+ LLKK VS+++L TG ++P + + TN
Sbjct  319   ENYLRIQDDTLTGTLSSVDVATNENLENLGKVGEELLKKPVSRVNLATGIFEPIN-KMTN  377

Query  1157  EEALKRFAKVLSENRKNR  1210
             EEAL++ AK+LS  +  R
Sbjct  378   EEALRKLAKLLSREKHLR  395



>ref|XP_004291130.1| PREDICTED: patatin group A-3-like [Fragaria vesca subsp. vesca]
Length=419

 Score =   423 bits (1087),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 226/383 (59%), Positives = 272/383 (71%), Gaps = 5/383 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRG+IPA IL FLE++LQ+LDGK  R+ DYFDVIAGTSTGGLVTAM+  
Sbjct  17    LVTILSIDGGGIRGLIPAAILDFLESELQKLDGKDARLADYFDVIAGTSTGGLVTAMIAT  76

Query  254   PDKNK--RPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVV  424
             PD+N   RP+FAAKDI  FY  H PKIFPQ            +  L GPKYDGKYLH +V
Sbjct  77    PDENNNNRPVFAAKDIKDFYLTHCPKIFPQRHCPLFPHAVKIIKALAGPKYDGKYLHNLV  136

Query  425   EERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYF  604
              E+LGD +L++TLT VVIPTFDIK  QP +F++ E +  P  D  L DICI +SAAPTY 
Sbjct  137   REKLGDKKLNKTLTNVVIPTFDIKQLQPTIFSSLEVKSKPCSDAFLRDICIATSAAPTYL  196

Query  605   PAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRF  784
             PAHYFE  D +G   EFNLIDGGVCANNPTLVAI  VT+ +  K   DF    PMD  RF
Sbjct  197   PAHYFETEDVQGKVREFNLIDGGVCANNPTLVAIGEVTKTIL-KGSSDFFPIKPMDYGRF  255

Query  785   RVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHS  964
              V+SLGTGS K   KY A  AA WG++ WLT   G PLIDVFS +SSDMVDF+++ +F +
Sbjct  256   LVISLGTGSPKIELKYHAHAAAKWGLLDWLTSGGGTPLIDVFSQSSSDMVDFNLSVVFQA  315

Query  965   LDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDA  1144
             L + +NYLRIQ D+L G V+SVD+  E+NL  L +VG+ LLKK VS+++L TG Y+    
Sbjct  316   LHSKENYLRIQDDTLTGQVSSVDIAEEKNLDDLLKVGEGLLKKPVSRVNLETGNYEAFTE  375

Query  1145  RGTNEEALKRFAKVLSENRKNRL  1213
               TN EAL RFAK+LSE +  RL
Sbjct  376   E-TNAEALTRFAKLLSEEKWLRL  397



>ref|XP_006466737.1| PREDICTED: patatin-14-like [Citrus sinensis]
Length=402

 Score =   422 bits (1085),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 235/391 (60%), Positives = 292/391 (75%), Gaps = 8/391 (2%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRGIIP  ILA+LE+QLQELDG+  R+ DYFDVIAGTSTGGL+TAMLTA
Sbjct  17    LITILSIDGGGIRGIIPGVILAYLESQLQELDGQDARLADYFDVIAGTSTGGLITAMLTA  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQgg-glfgsikggLALLEGPKYDGKYLHKVVEE  430
             P +  RP+ AAKDI+PFY  HGP+IFPQ    L  S+   +  L G KYDGKYLHKV++E
Sbjct  77    PKEQNRPMSAAKDIVPFYIRHGPQIFPQLRGMLANSVVNRVRALMGSKYDGKYLHKVIKE  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              L DT+LHQTLT VVIPTFDIK  QP +F++ +   SP LD +L+DI IG+SAAPTYFPA
Sbjct  137   NLKDTKLHQTLTNVVIPTFDIKKLQPTIFSSFQVAASPDLDAQLADIAIGTSAAPTYFPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             +YFEN D  G   EFNLIDGGV ANNPTLVAI  VT+ + +  +PDF   NP+D  RF V
Sbjct  197   YYFENPDDHGTLKEFNLIDGGVAANNPTLVAICEVTKHILK--NPDFCQINPLDYTRFLV  254

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS +   KY AKMA+ WG+I WL  +   PL+D +  A  DMVD+HI+ +FH+L 
Sbjct  255   ISLGTGSKRSEHKYNAKMASRWGVINWLYDNGDTPLLDCYGQAIGDMVDYHISVVFHALQ  314

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKP--DDA  1144
             + DNYLRI  D+L+GD++S+D+TT EN + L   G+ LLKK VS+++L TG Y+P  + +
Sbjct  315   SEDNYLRIDDDTLQGDLSSIDLTTPENSENLVRAGEALLKKPVSRINLDTGLYEPIENGS  374

Query  1145  RGTNEEALKRFAKVLSENRKNRLKNEAKLSK  1237
              GTNEEALKRFAK+LS+ RK R   E+K S+
Sbjct  375   AGTNEEALKRFAKMLSDERKLR---ESKSSR  402



>ref|XP_009367381.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=397

 Score =   422 bits (1084),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 216/382 (57%), Positives = 276/382 (72%), Gaps = 3/382 (1%)
 Frame = +2

Query  65    SQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAM  244
             S+K IT+LSIDGGGIRG+IPATIL FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAM
Sbjct  5     SRKLITVLSIDGGGIRGLIPATILGFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAM  64

Query  245   LTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVV  424
             LT P++N RPLFAAKD+  FY    PKIFPQ      + K   AL  GPKY+GKYLH ++
Sbjct  65    LTTPNENDRPLFAAKDLKDFYLSECPKIFPQKIWFPYTRKIMKAL-TGPKYNGKYLHGLI  123

Query  425   EERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYF  604
              ++LG+ +LH TLT VVIPTFDI+N QP+VF++C  E  P  D  LSDICI +SAAPTY 
Sbjct  124   RQKLGNNKLHNTLTNVVIPTFDIRNLQPVVFSSCRVEKKPCTDALLSDICIATSAAPTYL  183

Query  605   PAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRF  784
             PAHYFE +   G   E+NLIDGGV ANNPT VAI  V   +  K++ D      +D  RF
Sbjct  184   PAHYFETKYAAGTVREYNLIDGGVAANNPTFVAICEVVNEI-EKENSDIVPVKRVDYGRF  242

Query  785   RVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHS  964
              V+SLGTGSSK  ++Y A  AA WG++ WLT     P+IDVFS AS+DMVD H++ +F +
Sbjct  243   LVISLGTGSSKAEREYHASAAAKWGLLNWLTSGGSTPIIDVFSQASADMVDLHLSGVFQA  302

Query  965   LDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDA  1144
              ++ +NYLRIQ D+L G ++SVDV T++NL  L +VG+ LLK+ VS+++L +G+++    
Sbjct  303   FNSEENYLRIQDDTLHGTISSVDVATKKNLANLVKVGEGLLKQPVSRVNLDSGRFEASKH  362

Query  1145  RGTNEEALKRFAKVLSENRKNR  1210
               TN EAL RFAK+LSE +  R
Sbjct  363   E-TNAEALTRFAKLLSEEKLLR  383



>ref|XP_004238177.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=406

 Score =   422 bits (1084),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 230/380 (61%), Positives = 283/380 (74%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
             FITILSIDGGGIRGIIPATIL FLE+QLQELDGK  RI DYFDVIAGTSTGGLV AMLTA
Sbjct  16    FITILSIDGGGIRGIIPATILTFLESQLQELDGKNARIADYFDVIAGTSTGGLVAAMLTA  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA-LLEGPKYDGKYLHKVVEE  430
             PD+N RPL+AAKDI PFY EH PKIFPQ      +  G +   L GPKYDGKYLH+VV+E
Sbjct  76    PDENHRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGKMVQALIGPKYDGKYLHEVVKE  135

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +L D  +  T+T VVIPTFDIK  QP +F+  E + S   D KLSDICI +SAAPTY PA
Sbjct  136   KLKDICISNTITNVVIPTFDIKKLQPTIFSTYETKRSTCCDAKLSDICISTSAAPTYLPA  195

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF+  DGKGN  E +LIDGGV ANNP L+AIS V++ +  K++PDF    PMD  RF V
Sbjct  196   HYFKVEDGKGNVKEHHLIDGGVAANNPGLIAISEVSKEIF-KNNPDFFPIKPMDYGRFLV  254

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTG++K  QKY + M A WGI+ WL H    PL++VF+ +S+DMVD+H + +F +L 
Sbjct  255   ISLGTGAAKCEQKYNSLMGAKWGIVDWLIHKGSTPLVEVFTQSSADMVDYHNSIVFQALR  314

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + ++YLRIQ D L G  ASVDV T++NL++L E+G+ LLKK +S+++L TG  +P    G
Sbjct  315   SENSYLRIQEDELIGTEASVDVATKKNLERLVEIGEQLLKKPLSRVNLETGLSEPTPKGG  374

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEEALKRFA++L   R+ R
Sbjct  375   TNEEALKRFARLLVNERRLR  394



>ref|XP_007156813.1| hypothetical protein PHAVU_002G019700g [Phaseolus vulgaris]
 gb|ESW28807.1| hypothetical protein PHAVU_002G019700g [Phaseolus vulgaris]
Length=406

 Score =   421 bits (1083),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 232/387 (60%), Positives = 294/387 (76%), Gaps = 5/387 (1%)
 Frame = +2

Query  68    QKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAML  247
             + FIT+LSIDGGGIRGIIP+ +LA+LE+QLQELDG+  R+ DYFDVIAGTSTGGLV AML
Sbjct  15    ENFITVLSIDGGGIRGIIPSVLLAYLESQLQELDGEDARLADYFDVIAGTSTGGLVAAML  74

Query  248   TAPD--KNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKV  421
             TAP+   NK PLFAA +I+PFY ++ P+IFPQ  GLFG +K  +  L GPKYDGKYLH++
Sbjct  75    TAPNPNANKHPLFAANEIVPFYLQNSPQIFPQTRGLFGWLKNIVKALTGPKYDGKYLHEL  134

Query  422   VEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTY  601
             + ++LGDT+ HQTLT VVIPTFDIK  QP +F++ +      LDV+LSDICI +SAAPT+
Sbjct  135   IRKKLGDTKFHQTLTNVVIPTFDIKTLQPTIFSSFKIATEATLDVELSDICIATSAAPTF  194

Query  602   FPAHYFENRDGKGNTF-EFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQ  778
              PAHYF  +D +GN   EFNLIDGGV ANNPTLVAI  VT+++ RK  P+   ++P++  
Sbjct  195   LPAHYFTKQDEQGNVVREFNLIDGGVAANNPTLVAIREVTKQIIRK--PNEISSSPLNYD  252

Query  779   RFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIF  958
             RF VLSLGTGS+K   KY AKM + WGI+ W+  S   P+ID FS+ASSDMVD+H   +F
Sbjct  253   RFLVLSLGTGSNKNEHKYDAKMVSKWGILTWVFRSGLTPIIDCFSEASSDMVDYHNCVVF  312

Query  959   HSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPD  1138
              +L + DNYLRIQ D+L+GD+ASV + T ENL  L  VG+ LLKK V++++L TG Y+P 
Sbjct  313   RALQSEDNYLRIQDDTLKGDLASVHIATTENLNNLVNVGKQLLKKRVTRVNLDTGLYEPV  372

Query  1139  DARGTNEEALKRFAKVLSENRKNRLKN  1219
               +GTNEEALKRFAK LS+ RK +  N
Sbjct  373   PDKGTNEEALKRFAKSLSDVRKKKKSN  399



>ref|XP_003611772.1| Patatin-like protein [Medicago truncatula]
 gb|AES94730.1| patatin-like phospholipase [Medicago truncatula]
Length=396

 Score =   421 bits (1082),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 216/385 (56%), Positives = 283/385 (74%), Gaps = 5/385 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
             FIT+LSIDGGG+RGIIP  ILA+LE+QLQE+DG+  RI DYFDVIAGTSTGGL+T ML  
Sbjct  9     FITVLSIDGGGVRGIIPGVILAYLESQLQEIDGEDARIADYFDVIAGTSTGGLITTMLAT  68

Query  254   PDK--NKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVE  427
             P++  N RPLFAAK+I+PFY ++ P IFPQ  G+F  +      L G KY+G+YLHK++ 
Sbjct  69    PNRKANNRPLFAAKEIVPFYLQNLPNIFPQQSGIFAPLISTTKALTGSKYNGEYLHKLIR  128

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
                 DT L QTLT VVIP+FD++  QP +F++ + E  P LDV LSDICI +SAAPTY P
Sbjct  129   NMTQDTLLSQTLTNVVIPSFDVQKLQPTIFSSYQIEAEPALDVLLSDICIATSAAPTYLP  188

Query  608   AHYFENRDGKGNTF-EFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRF  784
             AHYFE +D  GN   E+NLIDGGV ANNP++VAI  VT+ + RK  PD +G N +   RF
Sbjct  189   AHYFEKKDEHGNVIKEYNLIDGGVAANNPSMVAIREVTKHIIRK--PDGSGDNGIGYDRF  246

Query  785   RVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHS  964
              V+SLGTGS+K  +KY AKM A WG + WL ++   P++D F++AS+DMVD+H A +F +
Sbjct  247   IVISLGTGSNKSERKYNAKMVAKWGALTWLFNNGSTPILDCFNEASNDMVDYHNAVLFTA  306

Query  965   LDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDA  1144
             L + DNYLRIQ D+L+G++ASVD++T+ENL  L +VG+ LLKK  ++++L TG Y+    
Sbjct  307   LQSQDNYLRIQDDTLQGELASVDISTKENLNNLVKVGEQLLKKKFTRVNLDTGIYEIVPY  366

Query  1145  RGTNEEALKRFAKVLSENRKNRLKN  1219
             +GT EE LKRFA +LSE RK +  N
Sbjct  367   KGTIEEELKRFANLLSEIRKCKKSN  391



>ref|XP_010268755.1| PREDICTED: patatin-like protein 2 [Nelumbo nucifera]
Length=392

 Score =   421 bits (1081),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 209/381 (55%), Positives = 275/381 (72%), Gaps = 2/381 (1%)
 Frame = +2

Query  65    SQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAM  244
             S++ +T+LSIDGGG+RGIIP TILAFLE++ QELDG+  RI +YFD++AGTST GL+T M
Sbjct  5     SERMVTVLSIDGGGVRGIIPGTILAFLESKFQELDGQNARIANYFDLVAGTSTVGLLTVM  64

Query  245   LTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA-LLEGPKYDGKYLHKV  421
             LTAPD+N  PL+ AKDI  FY EH PKIFPQ           L  +L GPKYDGKY+  +
Sbjct  65    LTAPDENNLPLYPAKDINDFYLEHCPKIFPQRRTAGIDRIVKLCRVLSGPKYDGKYIRSL  124

Query  422   VEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTY  601
              E  LG T L QTLT V+IPTFD+K  QP +FT  EA+ +   + +LSDICI +SAAPTY
Sbjct  125   TEGLLGKTTLSQTLTNVIIPTFDVKLLQPTIFTTKEAKTNALKNSRLSDICISTSAAPTY  184

Query  602   FPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQR  781
              PAH+FE  D KGNT  FNLIDGGV ANNPTL+A++ +++ +   +DPDF    PMD  +
Sbjct  185   LPAHHFETNDSKGNTRSFNLIDGGVAANNPTLLALTHISKDIL-INDPDFLHIKPMDASK  243

Query  782   FRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFH  961
             F VLSLGTG++ + +KY+A++A+NWG++ W  +    PLID F  +SSD+VD H +T+F 
Sbjct  244   FLVLSLGTGAANHEEKYSAEIASNWGLLEWTYNDGATPLIDAFMHSSSDVVDIHASTLFQ  303

Query  962   SLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDD  1141
              L A  NYLRIQ D+L G  +SVD+ TEENL+ L  +G+ LLKK +S ++L TG+++   
Sbjct  304   VLHAQKNYLRIQDDTLTGAASSVDIATEENLQNLVRIGKELLKKPMSMVNLETGKFEQLH  363

Query  1142  ARGTNEEALKRFAKVLSENRK  1204
               GTNEEAL RFA++LS+ R+
Sbjct  364   GEGTNEEALIRFARLLSQQRR  384



>ref|XP_006374978.1| hypothetical protein POPTR_0014s03290g [Populus trichocarpa]
 gb|ERP52775.1| hypothetical protein POPTR_0014s03290g [Populus trichocarpa]
Length=417

 Score =   422 bits (1084),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 230/378 (61%), Positives = 289/378 (76%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             IT+LSIDGGGIRGIIP TILAFLE++LQ+LDG + R+ DYFDVI+GTSTGGLVTAML  P
Sbjct  27    ITVLSIDGGGIRGIIPGTILAFLESELQKLDGAEARLADYFDVISGTSTGGLVTAMLATP  86

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             ++  RPLFAAKDI  FY E+ PKIFPQ G    S    +  L GPKYDGK+LH +V+E+L
Sbjct  87    NEQNRPLFAAKDINDFYLENCPKIFPQDGSPLASAGKLIKSLRGPKYDGKFLHSIVQEKL  146

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             GD RLHQT+T +VIPTFDIK  QP++F++ + ++ P  D  LSDICIG+SAAPTY PAHY
Sbjct  147   GDKRLHQTMTNIVIPTFDIKRLQPIIFSSYQVKNDPSTDALLSDICIGTSAAPTYLPAHY  206

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE +D  G   EFNLIDGGV ANNPTLVA+S V++ + RK +PDF  T PMD  RF VLS
Sbjct  207   FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRK-NPDFFPTAPMDYGRFLVLS  265

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG++K  +KY A  AA WG++GWLT  +  PL+DVF++AS DMVD HI+T+F +L + 
Sbjct  266   LGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQALHSE  325

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             +NYLRIQ D+L G ++SVDV T+ENL+ L +VG+ LLKK VS++DL TG + P D + TN
Sbjct  326   ENYLRIQDDTLSGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVD-KMTN  384

Query  1157  EEALKRFAKVLSENRKNR  1210
             EEAL + AK+LS  +  R
Sbjct  385   EEALIKMAKLLSREKHLR  402



>emb|CDP04311.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   421 bits (1082),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 223/378 (59%), Positives = 294/378 (78%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             +TILSIDGGGIRGIIP+ IL FLE++LQ+LDGK  R+ DYFDVIAGTSTGGLVTAML AP
Sbjct  18    VTILSIDGGGIRGIIPSVILGFLESELQKLDGKDARLADYFDVIAGTSTGGLVTAMLAAP  77

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             ++N RPL+AAKDI  FY E+ PKIFPQ     G  +  L LL GPKYDGKYLH ++++++
Sbjct  78    NENNRPLYAAKDIKDFYLENCPKIFPQESNFLGQAQQELRLLSGPKYDGKYLHNLLQQKV  137

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             G T+LHQTLT VVIPTFDIK  QP +F++   ++ P LD  LSDICIG+SAAPT+ PAH+
Sbjct  138   GKTKLHQTLTNVVIPTFDIKLLQPTIFSSYAIKNEPSLDGVLSDICIGTSAAPTFLPAHH  197

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE ++  G+  EFNL+DGGV ANNPTLVA++ VT+ ++ K + DF+   P++  RF VLS
Sbjct  198   FETKNSDGSKREFNLVDGGVAANNPTLVAMNQVTREIS-KGNSDFSPMKPLEFDRFLVLS  256

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG++K  QKY A  AA WGI+ WL +   +PL+DVF++ASSDMVDFH+ATIF +L   
Sbjct  257   LGTGTAKIEQKYDADNAAKWGILAWLVNGGSSPLVDVFTEASSDMVDFHLATIFQTLQCE  316

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
              NYLRIQ D+L GD++SVD+ T+ NL+ L +VG+ LLKK VS+++L +G ++P + +GTN
Sbjct  317   ANYLRIQDDTLTGDLSSVDIATKTNLENLVQVGEKLLKKPVSRVNLQSGVFEPLN-QGTN  375

Query  1157  EEALKRFAKVLSENRKNR  1210
             E+ALK+FA+ LS+ ++ R
Sbjct  376   EDALKKFAETLSKEKRLR  393



>ref|XP_006354914.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   421 bits (1081),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 231/380 (61%), Positives = 283/380 (74%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
             FITILSIDGGGIRGIIPATIL+FLE QLQELDGK   + DYFDVIAGTSTGGLVTAMLT+
Sbjct  16    FITILSIDGGGIRGIIPATILSFLELQLQELDGKDATLADYFDVIAGTSTGGLVTAMLTS  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA-LLEGPKYDGKYLHKVVEE  430
             PD+N RPL+AAKDI PFY EH PKIFPQ      +  G +   L GPKYDGKYLHKVV+E
Sbjct  76    PDENHRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGKMVQALIGPKYDGKYLHKVVKE  135

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +L DT +  T+T VVIPTFDIK  QP +F+  E + S   D KLSDICI +SAAPTY PA
Sbjct  136   KLKDTCISNTITNVVIPTFDIKKLQPTIFSTYETKRSTCCDAKLSDICISTSAAPTYLPA  195

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF+  DGKGN  E NLIDGGV ANNP L+AIS V++ +  K++PDF    PMD  RF V
Sbjct  196   HYFKVEDGKGNVKEHNLIDGGVAANNPGLIAISEVSKEIF-KNNPDFFPIKPMDYGRFLV  254

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTG++K  QKY + M A WGI+ WL H    PL++VF+ +S+DMVD+H + +F +L 
Sbjct  255   ISLGTGAAKCEQKYNSLMGAKWGIVDWLFHKGSTPLVEVFTQSSADMVDYHNSVVFQALR  314

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + ++YLRIQ D L G  ASVDV T++NL++L E+G+ LLKK +S+++L TG  +P    G
Sbjct  315   SENSYLRIQEDELIGTEASVDVATKKNLERLVEIGEKLLKKPLSRVNLETGLTEPIPKGG  374

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEEALKRFA +L   R+ R
Sbjct  375   TNEEALKRFATLLVNERRLR  394



>ref|XP_006374982.1| hypothetical protein POPTR_0014s03330g [Populus trichocarpa]
 gb|ERP52779.1| hypothetical protein POPTR_0014s03330g [Populus trichocarpa]
Length=417

 Score =   421 bits (1081),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 228/378 (60%), Positives = 290/378 (77%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             IT+LSIDGGGIRGIIP TILAFLE++LQ+LDG   R+ DYFDVI+GTSTGGLVTAML AP
Sbjct  29    ITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGGLVTAMLAAP  88

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             ++  RPLF+AKDI+ FY E+ PKIFPQ G  F S    +  L GPKYDGK+LH + +E++
Sbjct  89    NEQNRPLFSAKDIIDFYLENCPKIFPQDGSPFASAGKLITSLRGPKYDGKFLHSIAKEKM  148

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             GD RLHQT+T +VIPTFDIK  QP +F++ + ++ P +D  LSDICIG+SAAPTYFPAHY
Sbjct  149   GDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSMDALLSDICIGTSAAPTYFPAHY  208

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE +   G   EFNLIDGGV ANNPTLVA+S V++ + RK +PDF  T PMD  RF VLS
Sbjct  209   FETKGPSGKVREFNLIDGGVAANNPTLVAVSEVSKEITRK-NPDFFPTAPMDYGRFLVLS  267

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG++K  +KY A  AA WGI+GWLT  +  PL+DVF++AS DMVD H++T+F +L + 
Sbjct  268   LGTGTAKSEEKYDADEAAKWGILGWLTSDNSTPLVDVFTEASGDMVDLHVSTVFQALHSE  327

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             +NYLRIQ D+L G ++S+DV T+ENL+ L +VG+ LLKK VS++DL TG + P D + TN
Sbjct  328   ENYLRIQDDTLTGTLSSMDVATKENLENLVKVGEKLLKKPVSRVDLGTGIFTPTD-KMTN  386

Query  1157  EEALKRFAKVLSENRKNR  1210
             EEAL + AK+LS  +  R
Sbjct  387   EEALIKMAKLLSREKHLR  404



>ref|XP_011038243.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   420 bits (1079),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 230/379 (61%), Positives = 287/379 (76%), Gaps = 3/379 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             IT+LSIDGGGIRGIIP TILAFLE++LQ+LDG   R+ DYFDVI+GTSTGGLVTAML AP
Sbjct  20    ITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVISGTSTGGLVTAMLAAP  79

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA-LLEGPKYDGKYLHKVVEER  433
             +K  RPLFAAKDI  FY E+ PKIFPQ      +    L   L GPKYDGK+LH +V+E+
Sbjct  80    NKQNRPLFAAKDINEFYLENCPKIFPQDSSSKFASAANLVKTLRGPKYDGKFLHGIVKEK  139

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGDT L QTLT +VIPTFDIK  QP +F++C  +++P  D  LSDICIG+SAAPTY PAH
Sbjct  140   LGDTWLQQTLTNIVIPTFDIKRLQPTIFSSCNVKNNPSTDALLSDICIGTSAAPTYLPAH  199

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D  G   EFNLIDGGV ANNPTLVAIS V+Q + R + PD    NPM+  RF VL
Sbjct  200   YFETKDPSGKVREFNLIDGGVAANNPTLVAISEVSQAINR-EGPDSYHMNPMEYGRFLVL  258

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG++K  +KY A+ AA WG++GWLT     PL+DVF+ AS DMVDFHI+T+F +L++
Sbjct  259   SLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQALNS  318

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              +NYLRIQ D+L G ++SVDV T ENL+ L +VG+ LLKK VS+++L TG ++P + + T
Sbjct  319   EENYLRIQDDTLTGTLSSVDVATNENLENLGKVGEELLKKPVSRVNLATGIFEPIN-KMT  377

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL++ AK+LS  +  R
Sbjct  378   NEEALRKLAKLLSREKHLR  396



>ref|XP_011030324.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=417

 Score =   420 bits (1080),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 231/378 (61%), Positives = 288/378 (76%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             IT+LSIDGGGIRGIIP TILAFLE++LQ+LDG   R+ DYFDVI+GTSTGGLVTAML  P
Sbjct  29    ITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGGLVTAMLATP  88

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             ++  RPLFAAKDI  FY E+ PKIFPQ G    S    +  L GPKYDGK+LH +V+E+L
Sbjct  89    NEQNRPLFAAKDINDFYLENCPKIFPQDGSPLASAGKLIRSLRGPKYDGKFLHSIVKEKL  148

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             GD RLHQT+T +VIPTFDIK  QP +F++ + +++P  D  LSDICIG+SAAPTY PAHY
Sbjct  149   GDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNNPSTDALLSDICIGTSAAPTYLPAHY  208

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE +D  G   EFNLIDGGV ANNPTLVA+S V++ + RK +PDF  T PMD  RF VLS
Sbjct  209   FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRK-NPDFFPTAPMDYGRFLVLS  267

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG++K  +KY A  AA WGI+GWLT  +  PL+DVF++AS DMVD HI+T+F +L + 
Sbjct  268   LGTGTAKSEEKYDADEAAKWGILGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQALHSE  327

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             +NYLRIQ D+L G ++SVDV T+ENL+ L +VG+ LLKK VS++DL TG + P D + TN
Sbjct  328   ENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVD-KMTN  386

Query  1157  EEALKRFAKVLSENRKNR  1210
             EEAL + AK+LS  +  R
Sbjct  387   EEALIKMAKLLSREKHLR  404



>ref|XP_009419098.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   420 bits (1079),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 221/380 (58%), Positives = 292/380 (77%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRGIIPATIL+FLE++LQ+LDG+  RI DYFDVI+GTSTGGLVTAMLTA
Sbjct  19    LITILSIDGGGIRGIIPATILSFLESELQKLDGEDARIADYFDVISGTSTGGLVTAMLTA  78

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD N RPLFAAKDI  FY EH  KIFPQ GGL   ++     + GPKY+GKYLH +++E+
Sbjct  79    PDDNNRPLFAAKDIKSFYLEHSSKIFPQIGGLLAGVRRMFQAVWGPKYNGKYLHSLIKEK  138

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG  RLHQTLT V+IPTFDIK   P++F++ E + +  LD +LSDICIG++AAPTY PAH
Sbjct  139   LGGVRLHQTLTNVIIPTFDIKQLHPIIFSSYEVKRNRILDARLSDICIGTTAAPTYLPAH  198

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+ +  KG++ EF+L+DGGV ANNP LV++  VT+ + +K +PD+    PMD ++  ++
Sbjct  199   YFQTKCSKGSSREFHLVDGGVAANNPALVSVGEVTKELHKK-NPDYFPYKPMDYRKILLI  257

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS+K   K++AK A+ WG++GWL  S  NPL DVF  +S+DMVD H++ +F +L +
Sbjct  258   SLGTGSAKVEGKFSAKRASKWGVLGWLLSSGSNPLFDVFMQSSADMVDIHLSVVFQALQS  317

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKP-DDARG  1150
               NYLRI+ D+L G V+SVD++T+ENL  L  VG+ LLKK VS+++L TG Y+P  +  G
Sbjct  318   KSNYLRIEDDTLSGTVSSVDISTKENLADLVNVGEQLLKKPVSRVNLETGIYEPVGNGEG  377

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNE+ALKRFA++LS+ R+ R
Sbjct  378   TNEDALKRFARILSDERRLR  397



>ref|XP_011030334.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=415

 Score =   420 bits (1079),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 231/378 (61%), Positives = 288/378 (76%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             IT+LSIDGGGIRGIIP TILAFLE++LQ+LDG   R+ DYFDVI+GTSTGGLVTAML  P
Sbjct  27    ITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGGLVTAMLATP  86

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             ++  RPLFAAKDI  FY E+ PKIFPQ G    S    +  L GPKYDGK+LH +V+E+L
Sbjct  87    NEQNRPLFAAKDINDFYLENCPKIFPQDGSPLASAGKLIRSLRGPKYDGKFLHSIVKEKL  146

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             GD RLHQT+T +VIPTFDIK  QP +F++ + +++P  D  LSDICIG+SAAPTY PAHY
Sbjct  147   GDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNNPSTDALLSDICIGTSAAPTYLPAHY  206

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE +D  G   EFNLIDGGV ANNPTLVA+S V++ + RK +PDF  T PMD  RF VLS
Sbjct  207   FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRK-NPDFFPTAPMDYGRFLVLS  265

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG++K  +KY A  AA WGI+GWLT  +  PL+DVF++AS DMVD HI+T+F +L + 
Sbjct  266   LGTGTAKSEEKYDADEAAKWGILGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQALHSE  325

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             +NYLRIQ D+L G ++SVDV T+ENL+ L +VG+ LLKK VS++DL TG + P D + TN
Sbjct  326   ENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVD-KMTN  384

Query  1157  EEALKRFAKVLSENRKNR  1210
             EEAL + AK+LS  +  R
Sbjct  385   EEALIKMAKLLSREKHLR  402



>ref|XP_009138466.1| PREDICTED: patatin-like protein 1 isoform X1 [Brassica rapa]
Length=408

 Score =   419 bits (1078),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 210/388 (54%), Positives = 277/388 (71%), Gaps = 1/388 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGGIRG I   ILA LE QLQE+DG+ VR+ DYFDV+AGTSTGGL+TAMLT 
Sbjct  18    LVTILSLDGGGIRGTISGVILACLEKQLQEIDGEDVRLADYFDVVAGTSTGGLITAMLTV  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD + RP FAAKDI+PFY EH PKIFPQ  GL   +     LL GPKYDGKYL  ++   
Sbjct  78    PDASGRPHFAAKDIVPFYLEHCPKIFPQPEGLAALLPKLPKLLSGPKYDGKYLRNLLSNL  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+T+LHQT+T VVIPTFD+K  QP +F++ +A   P LDVKLSDICIG+SAAPT+FP H
Sbjct  138   LGETKLHQTITNVVIPTFDMKKLQPAIFSSYQALFDPSLDVKLSDICIGTSAAPTFFPPH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             Y  N D +G T EF+L+DGGV A+NPTLVA++ VT+++  K++PD     P+   +F V+
Sbjct  198   YLSNVDSQGKTSEFHLVDGGVTASNPTLVAMTAVTKQIV-KNNPDMGKLKPLGYDKFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +KY+AK AA WGII WL      P++D+  ++S DM+ FH + +F +L +
Sbjct  257   SIGTGSTKKVEKYSAKKAAKWGIISWLYDDGSTPILDITMESSRDMIHFHSSVLFKALQS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+L+ D  S D+ T+ NL+ L ++G+ +LK  V  +++ TG Y+P     T
Sbjct  317   EDKYLRIDDDTLDNDAGSTDLATKSNLENLVKIGEKVLKNRVVHMNIDTGAYEPIPENVT  376

Query  1154  NEEALKRFAKVLSENRKNRLKNEAKLSK  1237
             NEE LKRFAK+LSE RK R  +   ++K
Sbjct  377   NEEELKRFAKILSEERKLRRMSSDTMTK  404



>ref|XP_010437269.1| PREDICTED: patatin-like protein 1 isoform X1 [Camelina sativa]
Length=415

 Score =   419 bits (1078),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 202/388 (52%), Positives = 280/388 (72%), Gaps = 1/388 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RG+I   ILA+LE QLQELDG+  R+ DYFDVIAGTSTGGLVTAMLT 
Sbjct  19    LVTILSLDGGGVRGVIAGVILAYLEKQLQELDGEDARLADYFDVIAGTSTGGLVTAMLTV  78

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+  RP FAAKDI+PFY EH PKIFPQ  G+   +     LL GPKY GKYL  ++ + 
Sbjct  79    PDETGRPHFAAKDIVPFYLEHCPKIFPQPAGVLALLPKLPKLLSGPKYSGKYLRNLLSKL  138

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+T+LHQTLT VVIPT+DIK  QP +F++ +A   P L+VK+SDIC+G+S+APT+FP H
Sbjct  139   LGETKLHQTLTNVVIPTYDIKKLQPTIFSSYQALADPSLNVKVSDICVGTSSAPTFFPPH  198

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF N D +G T EFNL+DG + ANNPTLVA++ V++++  K++PD     P+   +F V+
Sbjct  199   YFSNEDSQGKTTEFNLVDGAITANNPTLVAMTAVSKQIV-KNNPDMGDIKPLGYDQFLVI  257

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +KY+AK AA WGII WL  +   P++D+  ++S DM+ +H + +F +L +
Sbjct  258   SIGTGSTKREEKYSAKKAAKWGIISWLYDNGSTPILDITMESSRDMIHYHSSVVFKALQS  317

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+L+GDV+ +D+ T+ NL+ L +VG+ +L   V ++++ TG Y+P      
Sbjct  318   EDKYLRIDDDTLDGDVSVMDLATKSNLENLVKVGEKILSSRVVQMNIDTGAYEPVPENIN  377

Query  1154  NEEALKRFAKVLSENRKNRLKNEAKLSK  1237
             N+E LKR+AK+LS+ RK R      ++K
Sbjct  378   NDEQLKRYAKILSDERKLRRMRSDTMTK  405



>ref|XP_010268982.1| PREDICTED: patatin-like protein 2 [Nelumbo nucifera]
Length=407

 Score =   419 bits (1077),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 231/380 (61%), Positives = 293/380 (77%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRGIIP TILAFLE+QLQELDG+  RI DYFDVI GTSTGGLVTAMLTA
Sbjct  20    LITVLSIDGGGIRGIIPGTILAFLESQLQELDGEDARIADYFDVIGGTSTGGLVTAMLTA  79

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggL-ALLEGPKYDGKYLHKVVEE  430
             P++N RPLFAA+D+  FY ++ PKIFPQ  G+FGS+   L ++  GPKY+GKYLH ++ E
Sbjct  80    PNENNRPLFAAQDVTAFYLDNCPKIFPQMCGIFGSVAKTLRSIFVGPKYNGKYLHGILRE  139

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LG+TRLHQ LT VVIPTFD+K  QP++F++ EA+ +  +D +LSDICI +SAAPTY PA
Sbjct  140   KLGETRLHQALTNVVIPTFDVKQLQPIIFSSFEAKTTSAMDARLSDICIATSAAPTYLPA  199

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             +YF+N    G+  EFNLIDGGV ANNP L+AI  +T+R+   ++PDF    PMD  RF V
Sbjct  200   YYFKNEGEDGDVREFNLIDGGVAANNPALIAIRELTKRVF-GENPDFFPIKPMDYCRFLV  258

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS K   KY+AKMAA WG++GWL +    PL+DVF+ A +DMVDFHIA +F +L 
Sbjct  259   ISLGTGSPKKEMKYSAKMAAKWGVMGWLLNGSSTPLVDVFTQAGADMVDFHIAVVFQALK  318

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             +  NYLRIQ D+L G VASVD+ T++NL+ L +VG+ LLKK VS+++L TG  +P    G
Sbjct  319   SESNYLRIQDDTLTGAVASVDIATKKNLENLVKVGEELLKKPVSRINLETGLSEPVANGG  378

Query  1151  TNEEALKRFAKVLSENRKNR  1210
              NEEALK+FAK+LS+ RK R
Sbjct  379   INEEALKKFAKLLSDERKLR  398



>ref|XP_006387188.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
 gb|ERP46102.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
Length=403

 Score =   419 bits (1076),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 229/378 (61%), Positives = 290/378 (77%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             IT+LSIDGGGIRGIIP TILAFLE++LQ+LDG   R+ DYFDVI+GTSTGGLVTAML AP
Sbjct  20    ITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGGLVTAMLAAP  79

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             +K  RPLFAAKDI  FY E+ PKIFPQ    F S    +  L GPKYDGK+LH +V+E+L
Sbjct  80    NKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKTLGGPKYDGKFLHSIVKEKL  139

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             GDT LHQTLT +VIPTFDIK  QP +F++   +++P  D  LSDICIG+SAAPTY PAHY
Sbjct  140   GDTWLHQTLTNIVIPTFDIKRLQPTIFSSYNVKNNPSTDALLSDICIGTSAAPTYLPAHY  199

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE +D  G   +FNLIDGGV ANNPTLVAIS V++ + R + PD    NPM+  RF VLS
Sbjct  200   FETKDPSGKVRDFNLIDGGVAANNPTLVAISEVSKAINR-EGPDSYRMNPMEYGRFLVLS  258

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG++K  +KY A+ AA WG++GWLT     PL+DVF+ AS+DMVDFHI+T+F +L++ 
Sbjct  259   LGTGTAKSEEKYDAEEAAKWGLLGWLTSDHSTPLVDVFTQASADMVDFHISTVFQALNSE  318

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             +NYLRIQ D+L G ++SVDV T+ENL+ L +VG+ LLKK VS+++L TG ++P + + TN
Sbjct  319   ENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEELLKKPVSRVNLATGVFEPIN-KMTN  377

Query  1157  EEALKRFAKVLSENRKNR  1210
             EEAL++ AK+LS  +  R
Sbjct  378   EEALRKLAKLLSREKHLR  395



>ref|XP_004979713.1| PREDICTED: patatin-3-Kuras 1-like [Setaria italica]
Length=408

 Score =   419 bits (1077),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 208/384 (54%), Positives = 278/384 (72%), Gaps = 2/384 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             + IT+LSIDGGGIRG+IPATI+A LEA+LQELDG   RI DYFDVIAGTSTG L+T+ML 
Sbjct  22    RLITVLSIDGGGIRGLIPATIIACLEAKLQELDGPDARIADYFDVIAGTSTGALLTSMLA  81

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA-LLEGPKYDGKYLHKVVE  427
             APD+NKRPL+AAKD+  FY E+GPKIFPQ    + +    L   + GPKYDG +LH  ++
Sbjct  82    APDENKRPLYAAKDLTTFYLENGPKIFPQRKLGWLTSAMNLVGTMRGPKYDGVFLHDKIK  141

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
                 D R+  T+T VV+P FD+K  QP++FT  EA+  P  +  LSDICI +SAAPTYFP
Sbjct  142   SLTHDVRVADTVTNVVVPAFDVKFLQPVIFTTYEAKADPLKNAHLSDICISTSAAPTYFP  201

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AH+F   DGKG + E++L+DGGV ANNPT++A+S +T+ + R++ PDF    P + + + 
Sbjct  202   AHFFTTDDGKGGSREYHLVDGGVAANNPTMIAMSMLTKEVLRRN-PDFNPGKPTEYRNYL  260

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             ++S+GTGS+K ++KYTA   A WG+I WL      P+ID+FS AS+DMVD H A +F SL
Sbjct  261   IISVGTGSAKLAEKYTAPQCAKWGLIQWLYEGGFTPIIDIFSHASADMVDIHAAVLFESL  320

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
                 NYLRIQ DSL GD +SVD+ T+EN++ L  +G+ LL+K V+++++ TG Y+     
Sbjct  321   HCQKNYLRIQDDSLTGDASSVDIATKENMEALIGIGKELLRKPVARVNIDTGMYEAVAGE  380

Query  1148  GTNEEALKRFAKVLSENRKNRLKN  1219
             GTNE+AL RFA++LSE RK R KN
Sbjct  381   GTNEDALARFARMLSEERKLRNKN  404



>emb|CDX69271.1| BnaC01g01820D [Brassica napus]
Length=407

 Score =   419 bits (1076),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 213/396 (54%), Positives = 289/396 (73%), Gaps = 14/396 (4%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             + +TILSIDGGG+RGIIP  +LA+LE+QLQELDG++ R+ DYFDVI+GTSTGGL+ AMLT
Sbjct  18    QHVTILSIDGGGVRGIIPGIVLAYLESQLQELDGEEARLVDYFDVISGTSTGGLIVAMLT  77

Query  251   APDKNK----RPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHK  418
             APDK      RPLFAAK+I+PFY++H PKIFP    +  +     AL+ GPKY+GKYL +
Sbjct  78    APDKTNPNRNRPLFAAKEIVPFYRKHCPKIFPHPRYVPSA----FALVRGPKYNGKYLRE  133

Query  419   VVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDS--PQLDVKLSDICIGSSAA  592
             V+E+ LGDTRL QTLT VVIP FDIK  QP++F++ +   +  P  D K+SDIC+ +SAA
Sbjct  134   VIEDFLGDTRLTQTLTNVVIPCFDIKKLQPVIFSSYQVYTNIDPVTDAKISDICLSTSAA  193

Query  593   PTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMD  772
             PTY PAH F N D +GN  E+NLIDGG+ ANNPTL AI+ VT+++ +K+ P     +P+D
Sbjct  194   PTYLPAHRFTNEDNEGNKHEYNLIDGGIAANNPTLCAIAEVTKQIVKKN-PAMGDISPLD  252

Query  773   CQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIAT  952
               R  V+SLGTGS +  +KY A MA+ WG++ W+     +P+ID +++A  D+VD+    
Sbjct  253   YTRVVVISLGTGSIRNEEKYDAIMASKWGLVSWICADGSSPIIDCYNEAIQDIVDYQSCV  312

Query  953   IFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYK  1132
             +F +L +  NYLRI  D+L+GD+ SVD++TE+N++ L EVG+ LLKK+VS+++L TG Y+
Sbjct  313   VFQALHSETNYLRIDDDTLKGDIGSVDISTEKNMEGLVEVGKALLKKNVSRVNLETGHYE  372

Query  1133  PDDARGTNEEALKRFAKVLSENRKNRLKNEAKLSKL  1240
             P     TNEEALKR AK+LSE RK R   E++  KL
Sbjct  373   PISDHVTNEEALKRVAKILSEERKLR---ESRYHKL  405



>ref|XP_010041051.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW44683.1| hypothetical protein EUGRSUZ_L01783 [Eucalyptus grandis]
Length=405

 Score =   419 bits (1076),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 220/379 (58%), Positives = 278/379 (73%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGG+RGII ATILA LE++L+ELDG+  R+ DYFDVI GTSTGGLVTAMLTA
Sbjct  15    IITILSIDGGGVRGIIAATILASLESELEELDGEDARLADYFDVIGGTSTGGLVTAMLTA  74

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPLFAAKDI  FY EH PKIFPQ  GL+G ++  +  L GPKYDGKYLH +++++
Sbjct  75    PNEKNRPLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYDGKYLHGLIKDK  134

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+ RLH TLT V+IPTFDI+  QP +F++ E   SP LD +LSDICIG+SAAPTY P H
Sbjct  135   LGEARLHDTLTHVIIPTFDIERLQPTIFSSYEVVRSPCLDARLSDICIGTSAAPTYLPPH  194

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              F+N+D +G T EF+LIDG V ANNP LVAI+ V++ +A   +PDF      +  RF V+
Sbjct  195   CFKNQDDRGCTREFHLIDGSVAANNPVLVAIAQVSKEIANA-NPDFFPIGATNYGRFLVI  253

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS K  +KY A MAA WG + WL H    PL+DVF+ AS+DMVDF+I+  F +L  
Sbjct  254   SIGTGSPKRERKYNATMAAKWGTLDWLLHGGSVPLVDVFTKASADMVDFYISAAFQALHF  313

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              DNYLRI  D+L G  +SVD+ T+ENL+ L  +G+ LLKK VS+++L  G  +P     T
Sbjct  314   EDNYLRIHDDTLTGKDSSVDIATKENLENLVRIGERLLKKPVSRVNLEMGLSEPIAKGIT  373

Query  1154  NEEALKRFAKVLSENRKNR  1210
             N +ALKRFAK LSE R+ R
Sbjct  374   NADALKRFAKKLSEERRFR  392



>ref|XP_006659497.1| PREDICTED: patatin-3-Kuras 1-like [Oryza brachyantha]
Length=433

 Score =   419 bits (1078),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 219/404 (54%), Positives = 280/404 (69%), Gaps = 6/404 (1%)
 Frame = +2

Query  14    GKQTLSQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICD  193
             GK  LS S+   A        + +LSIDGGG+RGIIP TILAFLE +LQE+DG + R+ D
Sbjct  29    GKSLLSPST-PRAPPPAYGGIVPVLSIDGGGVRGIIPGTILAFLEEKLQEMDGPEARLAD  87

Query  194   YFDVIAGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggL  373
             YFDVIAGTSTGGLVTAMLTAPD   RPLFAA+DI  FY EH PKIFP        +   L
Sbjct  88    YFDVIAGTSTGGLVTAMLTAPDDQGRPLFAARDINEFYLEHCPKIFPPVSKGPLGLIKSL  147

Query  374   ALLEGPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLD  553
             A   GPKYDG++LH VV+E L   R+H+T+T +V+PTFDIK  QP +F+  EA+     D
Sbjct  148   A---GPKYDGRHLHSVVQELLAGKRVHETITNIVVPTFDIKLLQPTIFSTYEAKKDVSKD  204

Query  554   VKLSDICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMAR  733
               LSD+CI +SAAPTY P H FE +D  G   EFNLIDGGV ANNPTL+A++ VT+++  
Sbjct  205   ALLSDVCISTSAAPTYLPGHRFETKDKDGKPREFNLIDGGVAANNPTLLAMTHVTKQILL  264

Query  734   KDDPDFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDG-NPLIDVF  910
               +PDF    P D  +F +LSLGTGS+K  +K+ A  +A WG++GWL +  G  PLID F
Sbjct  265   -GNPDFFPIKPADYGKFMILSLGTGSAKVEEKFDAVESARWGVLGWLYNKGGATPLIDSF  323

Query  911   SDASSDMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllk  1090
             S AS+D+VD H + +F +L     YLR+Q D L GD ASVDV+T ENL++L  VG+ LL+
Sbjct  324   SQASADLVDIHASVLFQALRCERRYLRVQDDELTGDAASVDVSTPENLRRLVGVGRALLQ  383

Query  1091  ksvskldllTGQYKPDDARGTNEEALKRFAKVLSENRKNRLKNE  1222
             +   K+++ TG+ +PD  RGTNEE L+RFAK+LSE RK RL+ +
Sbjct  384   RPACKVNVETGRNEPDMDRGTNEEELERFAKMLSEERKARLQRK  427



>ref|XP_006374981.1| hypothetical protein POPTR_0014s03320g [Populus trichocarpa]
 gb|ERP52778.1| hypothetical protein POPTR_0014s03320g [Populus trichocarpa]
Length=417

 Score =   419 bits (1076),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 228/378 (60%), Positives = 286/378 (76%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             IT+LSIDGGGIRGIIP TILAFLE++LQ+LDG   R+ DYFDVI+GTSTGGLVTAML  P
Sbjct  29    ITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGGLVTAMLATP  88

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             ++  RPLFAAKDI  FY E+ PKIFPQ G    S    +  L GPKYDGK+LH +V+E+L
Sbjct  89    NEQNRPLFAAKDINEFYLENCPKIFPQDGSPLASAGKLIKSLRGPKYDGKFLHSIVKEKL  148

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             GD RLHQT+T +VIPTFDIK  QP +F++ + ++ P  D  LSDICIG+SAAPTY PAHY
Sbjct  149   GDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSTDALLSDICIGTSAAPTYLPAHY  208

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE +D  G   EFNLIDGGV ANNPTLVA+S V++ + RK +PDF  T PMD  RF VLS
Sbjct  209   FETKDPSGKVREFNLIDGGVAANNPTLVAVSEVSKEITRK-NPDFFPTAPMDYGRFLVLS  267

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG++K  +KY A  AA WG++GWLT  +  PL+DVF++AS DMVD H++T+F +L + 
Sbjct  268   LGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVFTEASGDMVDLHVSTVFQALHSE  327

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             +NYLRIQ D+L G ++SVDV T+ENL+ L +VG+ LLKK V+++DL TG + P D + TN
Sbjct  328   ENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVARVDLGTGIFTPVD-KMTN  386

Query  1157  EEALKRFAKVLSENRKNR  1210
             EEAL + AK LS  +  R
Sbjct  387   EEALIKMAKSLSREKHLR  404



>ref|XP_011038246.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   418 bits (1075),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 229/378 (61%), Positives = 290/378 (77%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             IT+LSIDGGGIRGIIP TILAFLE++LQ+LDG   R+ DYFDVI+GTSTGGLVTAML AP
Sbjct  20    ITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVISGTSTGGLVTAMLAAP  79

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             +K  RPLFAAKDI  FY E+ PKIFPQ    F S    +  L GPKYDGK+LH +V+E+L
Sbjct  80    NKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKTLRGPKYDGKFLHSIVKEKL  139

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             GDT L QTLT +VIPTFDIK+ QP +F++ + +++P  DV LSDICIG+SAAPTY PAHY
Sbjct  140   GDTWLQQTLTNIVIPTFDIKHLQPTIFSSYKVKNNPSTDVLLSDICIGTSAAPTYLPAHY  199

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE +D  G   +FNLIDGGV ANNPTLVAIS V++ + R + PD    NPM+  RF VLS
Sbjct  200   FETKDPSGKVRDFNLIDGGVAANNPTLVAISEVSKAINR-EGPDSYHMNPMEYGRFLVLS  258

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG++K  +KY A+ AA WG++GWLT     PL+DVF+ AS DMVDFHI+T+F +L + 
Sbjct  259   LGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQALSSE  318

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             +NYLRIQ D+L G ++SVDV T+ENL+ L +VG+ LLKK VS+++L TG ++P + + TN
Sbjct  319   ENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEELLKKPVSRVNLATGVFEPIN-KMTN  377

Query  1157  EEALKRFAKVLSENRKNR  1210
             EEAL++ AK+LS  +  R
Sbjct  378   EEALRKLAKLLSREKHLR  395



>ref|XP_004152794.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
 ref|XP_004160047.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=416

 Score =   418 bits (1075),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 234/382 (61%), Positives = 295/382 (77%), Gaps = 7/382 (2%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRGIIP TIL FLE++LQ+LDGK+VR+ DYFDVIAGTSTGGLVTAM++A
Sbjct  16    LITILSIDGGGIRGIIPGTILNFLESELQKLDGKEVRVADYFDVIAGTSTGGLVTAMISA  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+N RPLF+AKDI  FY +H PKIFPQ       I   + LL GPKYDGKYL K+V+E+
Sbjct  76    PDQNNRPLFSAKDINQFYLDHCPKIFPQ--NRIWPIGRIVKLLSGPKYDGKYLRKLVKEK  133

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGDT+LHQTLT VVIPTFDIK  QP +F++ E +++P LD  LSDICI +SAAPTY P+H
Sbjct  134   LGDTKLHQTLTNVVIPTFDIKLLQPTIFSSYEMKNTPSLDAYLSDICISTSAAPTYLPSH  193

Query  614   YFENRDGKGNTF-EFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
              F+  D    T  EFNLIDGGV ANNPTLVAI  VT+ +  K +PDF    PMD +RF V
Sbjct  194   SFKTEDTAAKTTREFNLIDGGVAANNPTLVAIGEVTKEVI-KQNPDFFAIKPMDYRRFLV  252

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTG+ K  ++YTA++AA WG++ WLT+    P+IDVFS ASSDMVDFH++ IF +L 
Sbjct  253   ISLGTGAPKAEKRYTAELAAEWGMLDWLTNGGSTPIIDVFSQASSDMVDFHLSVIFQALH  312

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYK--PDDA  1144
               DNYLRIQ D+L GD++SVDV T++NL  L +VG++LLKK VS+++L TG ++  P ++
Sbjct  313   CEDNYLRIQDDTLSGDLSSVDVATQKNLNDLVKVGESLLKKPVSRVNLQTGVFEDCPSNS  372

Query  1145  RGTNEEALKRFAKVLSENRKNR  1210
               TN++AL RFAK+LS+ R+ R
Sbjct  373   E-TNDQALTRFAKLLSDERRLR  393



>ref|XP_011038242.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
Length=403

 Score =   417 bits (1073),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 229/378 (61%), Positives = 288/378 (76%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             ITILSIDGGGIRGIIP +ILAFLE++LQ+LDG   R+ DYFDVI+GTSTGGLVTAML AP
Sbjct  20    ITILSIDGGGIRGIIPGSILAFLESELQKLDGAAARLADYFDVISGTSTGGLVTAMLAAP  79

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             +K  RPLFAAKDI  FY E+ PKIFPQ G  F S    +  L GPKYDGK+LH +V+E+L
Sbjct  80    NKQNRPLFAAKDINDFYLENCPKIFPQDGSPFASAANLVKTLRGPKYDGKFLHSIVKEKL  139

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             G+ +LHQTLT +VIPTFDIK  QP +F+  + +++P  D  LSDICIG+SAAPTY PAHY
Sbjct  140   GNIQLHQTLTNIVIPTFDIKRLQPTIFSTYQVKNNPSTDTLLSDICIGTSAAPTYLPAHY  199

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE +D  G   EFNLIDGGV ANNPTLVAIS V++ + R + PD    NPM+  RF VLS
Sbjct  200   FETKDPSGKVREFNLIDGGVAANNPTLVAISEVSKAINR-EGPDSYHMNPMEYGRFLVLS  258

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG++K  +KY A+ AA WG++GWLT     PL+DVF+ AS DMVDFHI+T+F +L + 
Sbjct  259   LGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQALSSE  318

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             +NYLRIQ D+L G ++SVDV T+ENL+ L +VG  LLKK VS+++L TG ++P + + TN
Sbjct  319   ENYLRIQDDTLTGKLSSVDVATKENLENLVKVGVELLKKPVSRVNLATGVFEPIN-KMTN  377

Query  1157  EEALKRFAKVLSENRKNR  1210
             EEAL++ AK+LS  +  R
Sbjct  378   EEALRKLAKLLSREKHLR  395



>ref|XP_009139399.1| PREDICTED: patatin-like protein 1 isoform X2 [Brassica rapa]
Length=383

 Score =   417 bits (1071),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 205/368 (56%), Positives = 271/368 (74%), Gaps = 1/368 (0%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K +TILS+DGGG+RGII   ILA+LE QLQE+DG+ VR+ DYFDV++GTSTGGL+TAMLT
Sbjct  17    KLVTILSLDGGGVRGIIAGVILAYLEKQLQEIDGEDVRLADYFDVVSGTSTGGLMTAMLT  76

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
              P KN RP  AAKDI+PFY EH PKIFPQ  GL   +     LL GPKY GKYL K++ +
Sbjct  77    VPGKNGRPQLAAKDIVPFYLEHCPKIFPQPEGLAALLPKLPKLLSGPKYSGKYLRKLLSK  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LG+T+LHQT+T VVIPTFD+K  QP +F++ +A   P LDVK+SDIC+G+SAAPT+FP 
Sbjct  137   LLGETKLHQTVTNVVIPTFDMKKLQPTIFSSYQALVDPSLDVKISDICLGTSAAPTFFPP  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF N D +G T EFNL+DG V ANNPTLVA++ VT+++  K++PD     P+   +F V
Sbjct  197   HYFSNEDSQGKTTEFNLVDGAVTANNPTLVAMTAVTKQIL-KNNPDMGKLKPLGYDKFLV  255

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGSSK  +KY+AK AA WGII WL +    P++D+ SD+  DM+ FH + +F +L 
Sbjct  256   ISIGTGSSKNEEKYSAKKAAKWGIISWLYNDGSTPILDMVSDSGRDMIHFHSSVLFKALQ  315

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + D YLRI  D+LEGDV+S+D+ T+ NL+ L ++G+ +LK  V  +++ TG Y+P     
Sbjct  316   SEDKYLRIDDDTLEGDVSSMDLATKSNLENLVKIGEKVLKNRVMHMNIDTGVYEPITENI  375

Query  1151  TNEEALKR  1174
             TNEE LKR
Sbjct  376   TNEEELKR  383



>ref|XP_010432097.1| PREDICTED: patatin-like protein 1 [Camelina sativa]
Length=414

 Score =   418 bits (1074),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 201/388 (52%), Positives = 279/388 (72%), Gaps = 1/388 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RG+I   ILA+LE QLQELDG+  R+ DYFDVIAGTSTGGLVTAMLT 
Sbjct  18    LVTILSLDGGGVRGVIAGVILAYLEKQLQELDGEDARLADYFDVIAGTSTGGLVTAMLTV  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+  RP FAAKDI+PFY EH PKIFPQ  G+   +     LL GPKY GKYL  ++ + 
Sbjct  78    PDETGRPHFAAKDIVPFYLEHCPKIFPQPAGVLALLPKLPKLLSGPKYSGKYLRNLLSKL  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+T+LHQTLT VVIPT+DIK  QP +F++ +A   P L+VK+SDIC+G+S+APT+FP H
Sbjct  138   LGETKLHQTLTNVVIPTYDIKKLQPTIFSSYQALADPSLNVKVSDICVGTSSAPTFFPPH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF N D +G T EFNL+DG + ANNPTLVA++ V++++  K++PD     P+   +F V+
Sbjct  198   YFSNEDSQGKTTEFNLVDGAITANNPTLVAMTAVSKQIV-KNNPDMGDIKPLGYDQFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +KY+AK AA WGII WL  +   P++D+  ++S DM+ +H + +F +L +
Sbjct  257   SIGTGSTKREEKYSAKKAAKWGIISWLYDNGSTPILDITMESSRDMIHYHSSVVFKALQS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+L+GDV+ +D+ T+ NL+ L ++G+ +L   V  +++ TG Y+P      
Sbjct  317   EDKYLRIDDDTLDGDVSLMDLATKSNLENLVKIGEKILSNRVVHMNIDTGVYEPVPENIN  376

Query  1154  NEEALKRFAKVLSENRKNRLKNEAKLSK  1237
             N+E LKR+AK+LS+ RK R      ++K
Sbjct  377   NDEQLKRYAKILSDERKLRRMRSDTMTK  404



>gb|KFK30335.1| hypothetical protein AALP_AA7G248500 [Arabis alpina]
Length=410

 Score =   417 bits (1073),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 207/388 (53%), Positives = 278/388 (72%), Gaps = 1/388 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RGII   IL +LE QLQELDGK VR+ DYFDV+AGTSTGGL+TAMLT 
Sbjct  20    LVTILSLDGGGVRGIIAGVILDYLEKQLQELDGKDVRLADYFDVVAGTSTGGLMTAMLTV  79

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PDK  RP FAAKDI+PFY EH PKIFPQ  GL   +     LL GPKY GKYL K++ + 
Sbjct  80    PDKTGRPHFAAKDIVPFYLEHSPKIFPQPTGLSALLPKLPKLLSGPKYSGKYLRKLLSDL  139

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+T+L+QTLT +VIPTFDIK  QP +F++ ++   P LDVK+SDIC+G+SAAPT+FP H
Sbjct  140   LGETKLNQTLTNIVIPTFDIKKLQPTIFSSYQSLVDPSLDVKVSDICVGTSAAPTFFPPH  199

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             +F N D +G   EFNL+DG V ANNPTLVAI+ V++++  K++PD     P+   +F V+
Sbjct  200   FFTNEDSQGKKTEFNLVDGAVTANNPTLVAITAVSKQIL-KNNPDMGKLKPLGFDKFLVI  258

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+G GS+K  +KY+AK AA WGII WL      P++D+  ++S DM+ FH + +F +L +
Sbjct  259   SVGMGSAKKEEKYSAKKAAKWGIISWLYDDGSTPILDITMESSRDMIHFHSSVVFAALQS  318

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+LEGD  S+D+ T+ NL+ L ++G+ +L   VSK+++ TG Y+      T
Sbjct  319   EDKYLRIDNDTLEGDATSMDLATKPNLENLVKIGEKMLTNKVSKMNIDTGVYEHIPENVT  378

Query  1154  NEEALKRFAKVLSENRKNRLKNEAKLSK  1237
             N++ L+RFAK+LSE RK R      ++K
Sbjct  379   NDQELQRFAKILSEERKVRRMRSDTMTK  406



>ref|NP_568015.1| patatin-related phospholipase A [Arabidopsis thaliana]
 ref|NP_849512.3| patatin-related phospholipase A [Arabidopsis thaliana]
 gb|AEE86745.1| patatin-related phospholipase A [Arabidopsis thaliana]
 gb|AEE86746.1| patatin-related phospholipase A [Arabidopsis thaliana]
Length=383

 Score =   416 bits (1069),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 202/367 (55%), Positives = 269/367 (73%), Gaps = 1/367 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RGII   ILAFLE QLQELDG++ R+ DYFDVIAGTSTGGLVTAMLT 
Sbjct  18    LVTILSLDGGGVRGIIAGVILAFLEKQLQELDGEEARLADYFDVIAGTSTGGLVTAMLTV  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+  RP FAAKDI+PFY EH PKIFPQ  G+   +     LL GPKY GKYL  ++ + 
Sbjct  78    PDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPKLLSGPKYSGKYLRNLLSKL  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+TRLHQTLT +VIPTFDIK  QP +F++ +    P LDVK+SDICIG+SAAPT+FP H
Sbjct  138   LGETRLHQTLTNIVIPTFDIKKLQPTIFSSYQLLVDPSLDVKVSDICIGTSAAPTFFPPH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF N D +GN  EFNL+DG V ANNPTLVA++ V++++  K++PD     P+   RF V+
Sbjct  198   YFSNEDSQGNKTEFNLVDGAVTANNPTLVAMTAVSKQIV-KNNPDMGKLKPLGFDRFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +KY+AK AA WGII WL      P++D+  ++S DM+ +H + +F +L +
Sbjct  257   SIGTGSTKREEKYSAKKAAKWGIISWLYDDGSTPILDITMESSRDMIHYHSSVVFKALQS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+LEGDV+++D+ T+ NL+ L+++G+ +L   V ++++ TG Y+P     T
Sbjct  317   EDKYLRIDDDTLEGDVSTMDLATKSNLENLQKIGEKMLTNRVMQMNIDTGVYEPVAENIT  376

Query  1154  NEEALKR  1174
             N+E LKR
Sbjct  377   NDEQLKR  383



>ref|XP_007017310.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOY14535.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=404

 Score =   417 bits (1071),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 223/382 (58%), Positives = 285/382 (75%), Gaps = 4/382 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             + IT+LSIDGGGIRGIIP  IL+FLE++LQ+LDG++ RI DYFDV+AGTSTGGL+T MLT
Sbjct  15    ELITVLSIDGGGIRGIIPGVILSFLESELQKLDGEQARIADYFDVVAGTSTGGLLTTMLT  74

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             AP++  RPLFAA++I  FY EHGP+IFPQ    F  +   +  + GPKYDGKYLH V++E
Sbjct  75    APNEKNRPLFAAQEIKAFYFEHGPRIFPQNRFPFSGVTNMIKRVLGPKYDGKYLHGVLKE  134

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             RLG TRLHQTLT VVIPTFDIK  QP++F++ E + SP L+  LSDICIG+SAAPTY PA
Sbjct  135   RLGYTRLHQTLTNVVIPTFDIKKLQPVIFSSYEVKKSPSLNALLSDICIGTSAAPTYLPA  194

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARK--DDPDFAGTNPMDCQRF  784
             HYFE +D +G   +FNLIDGG+ ANNP LVAIS VT+++ R   D     G N     RF
Sbjct  195   HYFETKDSEGEVKKFNLIDGGMAANNPALVAISEVTKQINRGHCDFSSIKGAN--HYSRF  252

Query  785   RVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHS  964
              VLS+GTGS K ++KY A  AA WG+IGWLT     PL++ F++ S+DMVDFHI+ IF +
Sbjct  253   LVLSIGTGSEKLAEKYNASQAARWGLIGWLTSGHSTPLVNAFTEGSADMVDFHISVIFKA  312

Query  965   LDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDA  1144
             L +  NYLRIQ D L G+V+S+DV+TE+NLK L +V +NLL K VS+++  TG Y+P   
Sbjct  313   LGSEKNYLRIQNDKLVGEVSSIDVSTEDNLKNLVQVAENLLNKPVSRVNFETGNYEPSGE  372

Query  1145  RGTNEEALKRFAKVLSENRKNR  1210
               TN +ALKR+AK+LS+ +  R
Sbjct  373   LETNAQALKRYAKLLSQEKACR  394



>gb|AAM64566.1| patatin-like protein [Arabidopsis thaliana]
Length=383

 Score =   416 bits (1068),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 202/367 (55%), Positives = 269/367 (73%), Gaps = 1/367 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RGII   ILAFLE QLQELDG++ R+ DYFDVIAGTSTGGLVTAMLT 
Sbjct  18    LVTILSLDGGGVRGIIAGVILAFLEKQLQELDGEEARLADYFDVIAGTSTGGLVTAMLTV  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+  RP FAAKDI+PFY EH PKIFPQ  G+   +     LL GPKY GKYL  ++ + 
Sbjct  78    PDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPKLLSGPKYSGKYLRNLLSKL  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+TRLHQTLT +VIPTFDIK  QP +F++ +    P LDVK+SDICIG+SAAPT+FP H
Sbjct  138   LGETRLHQTLTNIVIPTFDIKKLQPTIFSSYQLLVDPSLDVKVSDICIGTSAAPTFFPPH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF N D +GN  EFNL+DG V ANNPTLVA++ V++++  K++PD     P+   RF V+
Sbjct  198   YFSNEDSQGNKTEFNLVDGAVTANNPTLVAMTAVSKQIV-KNNPDMGKLKPLGFDRFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +KY+AK AA WGII WL      P++D+  ++S DM+ +H + +F +L +
Sbjct  257   SIGTGSTKREEKYSAKKAAKWGIISWLYDDGSTPILDITMESSRDMIHYHSSVVFKALQS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+LEGDV+++D+ T+ NL+ L+++G+ +L   V ++++ TG Y+P     T
Sbjct  317   EDKYLRIDDDTLEGDVSTMDLATKSNLENLQKIGEKMLTNRVVQMNIDTGVYEPVAENIT  376

Query  1154  NEEALKR  1174
             N+E LKR
Sbjct  377   NDEQLKR  383



>ref|XP_009393655.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=414

 Score =   417 bits (1071),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 205/380 (54%), Positives = 283/380 (74%), Gaps = 1/380 (0%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K IT+LSIDGGG+RG+IP T+LAFLE +LQELDG   RI DYFDVI GTSTGGL++AM+T
Sbjct  29    KLITVLSIDGGGVRGLIPGTVLAFLELKLQELDGPDARIADYFDVITGTSTGGLLSAMIT  88

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             +PD+NKRPLF+A  ++ FY E+ PKIFPQG G+F S+   ++ + GPKYDGK+LH  V++
Sbjct  89    SPDENKRPLFSANQVIDFYLENSPKIFPQGSGMFSSLTKLVSAIRGPKYDGKFLHSKVKQ  148

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              L +T+L +TLT V+IPTFDIK  QP++F++ EA  SP  +  L+DICI +SAAPTY PA
Sbjct  149   LLTETKLSETLTNVIIPTFDIKLLQPVIFSSFEARHSPLKNAHLADICISTSAAPTYLPA  208

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE  D  G +  +NLIDGG+ ANNPTLVA+S + + +A  +  +FA    +D  +F +
Sbjct  209   HYFETTDSDGKSHSYNLIDGGIAANNPTLVAMSQIKKEIALTNK-NFANFKSIDYHKFII  267

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGS+K  QK++A +A+ WG++ WL H   NPLID F   S+D+VD H++++F SL+
Sbjct  268   ISIGTGSAKVEQKFSAHLASKWGVLQWLYHGGSNPLIDSFFQGSADVVDIHMSSLFQSLN  327

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
                NYLRIQ D+L G+ +SVDV+T+ENL +L ++G+NLL K VS+++L TG ++  D  G
Sbjct  328   CEKNYLRIQDDTLMGERSSVDVSTKENLLELVQIGKNLLNKKVSRVNLETGIFQEIDEEG  387

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TN +AL + AK LS  R+ R
Sbjct  388   TNADALTQLAKRLSRERQLR  407



>ref|XP_010320347.1| PREDICTED: patatin-like protein 2 isoform X2 [Solanum lycopersicum]
Length=388

 Score =   416 bits (1069),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 229/369 (62%), Positives = 286/369 (78%), Gaps = 2/369 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K ITILSIDGGGIRGIIPA IL +LE+QLQELDG+  R+ DYFD+IAGTSTGGLVTAMLT
Sbjct  21    KLITILSIDGGGIRGIIPAIILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAMLT  80

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfg-sikggLALLEGPKYDGKYLHKVVE  427
             AP+K+KRP+FAAKDI PFY EHGPKIFPQ G LF  SI   L  L GPKY+GKYLH+V++
Sbjct  81    APNKDKRPIFAAKDIKPFYLEHGPKIFPQKGMLFFGSIIKTLKSLIGPKYNGKYLHQVIK  140

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+T LH+TLT VVIPTFDIKN QP +F+  EA++ P +D KLSDICI +S APTY P
Sbjct  141   EKLGETHLHETLTNVVIPTFDIKNLQPTIFSTFEAKEKPLMDAKLSDICISTSGAPTYLP  200

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYF+ +D   N  EFNL+DGGV ANNP LVA S VT+++    +PDF    P+D  RF 
Sbjct  201   AHYFKTQDRDDNFHEFNLVDGGVAANNPALVATSQVTKQIM-AGNPDFFPIKPIDYGRFL  259

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+S+GTGS+K  QKY AK+A+ WGI+GWL +    P++DVF+ AS DMVDFHI+ +F +L
Sbjct  260   VISVGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDFHISVVFQAL  319

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + +NYLR+Q D+L G  +SVD++T+EN+ KL E+G NLLKK VS+++L TG ++     
Sbjct  320   HSEENYLRVQDDTLSGTDSSVDISTKENMNKLVEIGTNLLKKPVSRVNLQTGLFEECKKD  379

Query  1148  GTNEEALKR  1174
              TNEE LKR
Sbjct  380   DTNEETLKR  388



>ref|XP_010446709.1| PREDICTED: patatin-like protein 1 isoform X2 [Camelina sativa]
Length=414

 Score =   417 bits (1071),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 201/388 (52%), Positives = 280/388 (72%), Gaps = 1/388 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RG+I   +LA+LE QLQE+DG+  R+ DYFDVIAGTSTGGLVTAMLT 
Sbjct  18    LVTILSLDGGGVRGVIAGVVLAYLEKQLQEIDGEGARLADYFDVIAGTSTGGLVTAMLTV  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD   RP FAAKDI+PFY EH PKIFPQ  G+F  +     LL GPKY GKYL  ++ + 
Sbjct  78    PDGTGRPHFAAKDIVPFYLEHCPKIFPQPAGVFALLPKLPKLLSGPKYSGKYLRNLLSKL  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+T+LHQTLT VVIPT+DIK  QP +F++ +A   P L+VK+SDIC+G+S+APT+FP H
Sbjct  138   LGETKLHQTLTNVVIPTYDIKKLQPTIFSSYQALTDPSLNVKVSDICVGTSSAPTFFPPH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF N D +G T EFNL+DG + ANNPTLVA++ V++++  K++PD     P+   +F V+
Sbjct  198   YFSNEDSQGKTTEFNLVDGAITANNPTLVAMTAVSKQIV-KNNPDMGDIKPLGYDQFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +KY+AK AA WGII WL  +   P++D+  ++S DM+ +H + +F +L +
Sbjct  257   SIGTGSTKREEKYSAKKAAKWGIISWLYDNGSTPILDITMESSRDMIHYHSSVVFKALQS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+L+GDV+ +D+ T+ NL+ L +VG+ +L   V ++++ TG Y+P      
Sbjct  317   EDKYLRIDDDTLDGDVSVMDLATKSNLENLVKVGEKILSSRVVQMNIDTGAYEPVPENIN  376

Query  1154  NEEALKRFAKVLSENRKNRLKNEAKLSK  1237
             N+E LKR+AK+LS+ RK R      ++K
Sbjct  377   NDEQLKRYAKILSDERKLRRMRSDTMTK  404



>ref|XP_006473887.1| PREDICTED: patatin-05-like [Citrus sinensis]
Length=408

 Score =   416 bits (1070),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 227/379 (60%), Positives = 282/379 (74%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRGIIPATILAFLE++LQ+LDG++ RI DYFDVI+GTSTGGLVTAMLTA
Sbjct  18    LITILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPLFAAKDI  FY  H PKIFPQ  G FG     +  L GPKYDGKYLH++V+E+
Sbjct  78    PNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDGKYLHRLVKEK  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+ +LH+TLT VVIPTFDIK  QP +F++CE + +P LD  LSDICI +SAAPTY PAH
Sbjct  138   LGNKKLHETLTNVVIPTFDIKKLQPTIFSSCEMKQNPSLDASLSDICIATSAAPTYLPAH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              FE +D  G    F+LIDGGV ANNPTLVA++ VT+ + R    D+   N MD  RF V+
Sbjct  198   TFETKDSTGKVRRFDLIDGGVAANNPTLVALNEVTKEINRGSS-DYYAINAMDYTRFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+ K   KY A  AA WG++GWL+     PL+DVF  +SSDM DFHI+T F +L +
Sbjct  257   SLGTGAPKTEVKYDALKAAKWGVLGWLSSESSTPLVDVFMQSSSDMTDFHISTAFKALHS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              + YLRIQ D+L GD ASVDV T++NL+ L  +G+ LLKK V+K++  TG  +P   +GT
Sbjct  317   ENGYLRIQDDTLTGDEASVDVATKKNLESLVGIGERLLKKPVTKVNFETGLCEP-YGQGT  375

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL R A+VLS+ ++ R
Sbjct  376   NEEALIRLAEVLSKEKRIR  394



>ref|XP_006408594.1| hypothetical protein EUTSA_v10002000mg [Eutrema salsugineum]
 gb|ESQ50047.1| hypothetical protein EUTSA_v10002000mg [Eutrema salsugineum]
Length=407

 Score =   416 bits (1070),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 212/379 (56%), Positives = 278/379 (73%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGG+RGIIPATILAFLE++LQ+LDG++ R+ DYFDV+AGTSTGGLVTAMLTA
Sbjct  18    LVTILSIDGGGVRGIIPATILAFLESELQKLDGEEARLADYFDVMAGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+K  RPLFAA +I  FY EH PKIFPQ    F + K  +  L GPKYDG+YLH+++  +
Sbjct  78    PNKEGRPLFAASEIKDFYLEHCPKIFPQDHFPFSAAKNLVKSLTGPKYDGEYLHQLIHAK  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+TRLHQTLT VVIPTFDIK+ QP +F++ E +++   +  L+DI I +SAAPTY PAH
Sbjct  138   LGETRLHQTLTNVVIPTFDIKHLQPTIFSSYEVKNNSLKNATLADIAISTSAAPTYLPAH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             +F+ ++  GN  E+NLIDGGV ANNP LVAI  VT+ + R    +F    P D  RF VL
Sbjct  198   FFKTQNSAGNVKEYNLIDGGVAANNPALVAIGEVTKEITRGSS-EFFPIRPNDYGRFLVL  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+ K  +K+ AK  A WG++ WLTH +  PLID F  ASSDMVDFH++++F +L +
Sbjct  257   SLGTGNRKAEEKFNAKEVAGWGMLSWLTHDNSTPLIDAFMQASSDMVDFHLSSVFRALHS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NY+RIQ D+L GD ASVD+ T ENL  L ++G  +LKK VS+++L +G  + +    T
Sbjct  317   EANYIRIQDDTLNGDAASVDIATVENLNILAKIGDEILKKVVSRVNLESGSNE-NAYEVT  375

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NE+AL + A +LS+ +K R
Sbjct  376   NEKALIKLAGILSKEKKIR  394



>ref|XP_006339914.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=405

 Score =   416 bits (1069),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 231/401 (58%), Positives = 292/401 (73%), Gaps = 1/401 (0%)
 Frame = +2

Query  17    KQTLSQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDY  196
             K+   +SS       N+ K ITIL+IDGGGIRGIIP  ILA+LE+QLQELDG+  RI DY
Sbjct  3     KEVEGESSRVAMPPPNTGKLITILAIDGGGIRGIIPGVILAYLESQLQELDGENARIADY  62

Query  197   FDVIAGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA  376
             FDVIAGTSTGGLVTAML AP+K+KRPL+AAKDI PFY EH PKIFPQ  GLF  +     
Sbjct  63    FDVIAGTSTGGLVTAMLAAPNKDKRPLYAAKDITPFYIEHSPKIFPQISGLFAGVINLTK  122

Query  377   LLEGPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDV  556
             ++ GPKYDGKYLH + +  LG TRLH TLT VVIPTFDIK  QP++F++ EA   P LD 
Sbjct  123   MMNGPKYDGKYLHALTKRLLGGTRLHDTLTAVVIPTFDIKTLQPVIFSSYEANSKPDLDA  182

Query  557   KLSDICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARK  736
             +L+DICI +SAAPT+ PA+ F+ +D +    EFNLIDGGV ANNPTL+AI  VT++   K
Sbjct  183   ELADICISTSAAPTFLPAYCFKTQDAQNKDREFNLIDGGVAANNPTLIAIGEVTKQTLMK  242

Query  737   DDPDFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSD  916
                D     PMD  RF V+SLGTG++K  +KY AKMAA WG++ WLTH +  P+I+ F+ 
Sbjct  243   HG-DLFPIKPMDYGRFLVISLGTGNAKNEEKYNAKMAAKWGLLSWLTHDNSTPIIEAFNQ  301

Query  917   ASSDMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkks  1096
             AS+DMVD+H   +F +L + D YLRIQ D+L G++ASVD++T+ENL+ L +VG+ LL K 
Sbjct  302   ASADMVDYHNFVVFKALHSDDKYLRIQDDTLTGNLASVDISTKENLEGLIKVGEELLDKP  361

Query  1097  vskldllTGQYKPDDARGTNEEALKRFAKVLSENRKNRLKN  1219
              SK++L  G Y+  +  GTN+EAL+RFAK LS+ RK R  N
Sbjct  362   TSKINLDKGVYEAVENGGTNKEALRRFAKKLSDERKFRQAN  402



>ref|XP_003611771.1| Patatin-like protein [Medicago truncatula]
 gb|AES94729.1| patatin-like phospholipase [Medicago truncatula]
Length=399

 Score =   416 bits (1069),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 214/387 (55%), Positives = 283/387 (73%), Gaps = 9/387 (2%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
             FIT+LSIDGGG+RGIIP  ILA+LE+QLQE+DG+  RI DYFDVIAGTSTGGL+T ML A
Sbjct  15    FITVLSIDGGGVRGIIPGVILAYLESQLQEIDGEDARIADYFDVIAGTSTGGLITTMLAA  74

Query  254   PD-KNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             P+ K+ RPLFAAK+I+PFY ++ P IFPQ  G+F  +      L G KY+G+YLHK++  
Sbjct  75    PNPKDNRPLFAAKEIVPFYLQNLPSIFPQKSGIFAPLINITKALTGAKYNGEYLHKLIRN  134

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
                DT L QTLT +VIP+FD++N QP +F++ + +  P LDV L+DICI +SAAPTY PA
Sbjct  135   MTKDTLLSQTLTNIVIPSFDVQNLQPTIFSSYQIDAEPTLDVPLADICIATSAAPTYLPA  194

Query  611   HYFENRDGKGNTF-EFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             HYF  +D  G    E+NLIDGGVCANNPT+VAI  VT+ M R         N +   RF 
Sbjct  195   HYFAKKDENGKVIKEYNLIDGGVCANNPTMVAIREVTKNMIRLG----RSGNGIGYDRFI  250

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+S+GTGS+K  QKY AKM A WG + WL +S   P+ID F++AS+DMVD+H + +F +L
Sbjct  251   VISIGTGSNKSEQKYNAKMVAKWGALTWLFNSGSTPIIDCFNEASTDMVDYHNSVLFTAL  310

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + DNYLRIQ D+L+G++ASVDV+T+ NL  L +VG+NLLKK  ++++L TG Y+    +
Sbjct  311   QSQDNYLRIQDDTLQGELASVDVSTKNNLNNLVKVGENLLKKKFTRVNLDTGIYETVPDK  370

Query  1148  GTNEEALKRFAKVLSE---NRKNRLKN  1219
             GT EE LKRFA++LSE    +K++L+N
Sbjct  371   GTIEEELKRFARLLSEIAKEKKSKLQN  397



>ref|XP_007017305.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOY14530.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=420

 Score =   416 bits (1070),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 229/381 (60%), Positives = 286/381 (75%), Gaps = 3/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRGIIP TILAFLEA+LQ+LDG++VR+ DYFDVI+GTSTGG+VTAMLT 
Sbjct  27    LITVLSIDGGGIRGIIPGTILAFLEAELQKLDGEEVRLADYFDVISGTSTGGIVTAMLTT  86

Query  254   PDKNK--RPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVE  427
             P++N+  RPLFAAKDI  FY EH PKIFPQ    F      +    GPKYDG+YL  +V 
Sbjct  87    PNQNEGNRPLFAAKDINKFYLEHCPKIFPQDCSPFAPAANLVKSFTGPKYDGRYLQNIVR  146

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG TRLHQTLT VVIPTFDIK  QP VF++ E +++P ++  LSD+CIG+SAAPTY P
Sbjct  147   EKLGGTRLHQTLTNVVIPTFDIKQLQPKVFSSLEVKNNPSINALLSDVCIGTSAAPTYLP  206

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AH FE +D  GN  EF+LIDGGV ANNPTLVA++ VT+ + RK+  DF      D   F 
Sbjct  207   AHQFETKDSTGNVKEFHLIDGGVAANNPTLVAMNEVTKEITRKNS-DFFPIEANDFSHFL  265

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             VLSLGTGS K  +KY A MAA WG++GWLT     PL+DVF  ASSDMVDFHIAT+F +L
Sbjct  266   VLSLGTGSQKCEEKYPAHMAAKWGLLGWLTSEHSTPLMDVFMQASSDMVDFHIATVFQAL  325

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              + D YLRIQ D+L G ++SVD+ T+ENL+ L +VG+ LLKK VS+++L  G+++P   +
Sbjct  326   QSEDRYLRIQDDTLCGTISSVDIATKENLENLVQVGEELLKKPVSRVNLDNGKFEPIKNQ  385

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TNE+AL R AKVLS+ ++ R
Sbjct  386   DTNEDALIRLAKVLSQEKRLR  406



>ref|XP_008241846.1| PREDICTED: patatin-like protein 1 [Prunus mume]
Length=398

 Score =   416 bits (1068),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 211/378 (56%), Positives = 269/378 (71%), Gaps = 5/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             IT+LSIDGGGIR IIPATIL FLE++LQELDG++ RI DYFDVIAGTSTGGL+TAMLTAP
Sbjct  16    ITVLSIDGGGIRSIIPATILTFLESKLQELDGEEARIADYFDVIAGTSTGGLITAMLTAP  75

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             D+N+RPL+ AKDI+PFY  H PKIFPQ           +  L GPKYDGKYL K+V + L
Sbjct  76    DQNRRPLYEAKDIVPFYLNHCPKIFPQ----SSGTLMRMRALRGPKYDGKYLRKLVRKIL  131

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             G  RLH+T+TR+V+PTFDIK  QP VF+  EAE     D  LSD+CIG+S+APTY PAH+
Sbjct  132   GTRRLHETVTRIVVPTFDIKLLQPHVFSTFEAEMDVSEDALLSDVCIGTSSAPTYLPAHH  191

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             F+ +D  GN  EF L+DGGV ANNP L+A+    +      D D A    +  +++ +LS
Sbjct  192   FKTKDSGGNEREFQLVDGGVAANNPALLAMKPTGKVFPGSPD-DLASPQSLQYEKYLMLS  250

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG+SK  +KY AKMAA WGI+GWL      PL+D F+ AS DMVD H++ IF S+   
Sbjct  251   LGTGTSKMEKKYNAKMAAKWGILGWLYKDGHCPLVDAFTFASGDMVDLHMSLIFRSVKCE  310

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
              NYLRIQ D+L G+ +S D  T EN+++L + G++LL+K  S+++L TG ++P     TN
Sbjct  311   HNYLRIQDDTLSGNTSSTDKATMENMRELIKTGESLLQKPASRMNLDTGIFEPAHNGATN  370

Query  1157  EEALKRFAKVLSENRKNR  1210
             +EAL RFAK LS+ RK R
Sbjct  371   QEALTRFAKKLSDERKLR  388



>gb|KCW54973.1| hypothetical protein EUGRSUZ_I00941 [Eucalyptus grandis]
Length=403

 Score =   416 bits (1068),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 220/380 (58%), Positives = 280/380 (74%), Gaps = 4/380 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K ITILSIDGGG+RGIIP  IL +LEAQLQELDG+  R+ DYFDVIAGTSTGGL+TAML+
Sbjct  17    KLITILSIDGGGVRGIIPGVILDYLEAQLQELDGEGARLADYFDVIAGTSTGGLITAMLS  76

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             APD + RPLFAAKDI+PFY E+ PKIFPQG G  GS+   L  L GPKY+G YLHK++ +
Sbjct  77    APDADNRPLFAAKDIVPFYLENCPKIFPQGCGCLGSVVSTLRSLAGPKYNGVYLHKLIRK  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LG TRLH +LT +VIPTFDIK  +P++F++ E      LD +LSDICIG+SAAPTYFPA
Sbjct  137   LLGTTRLHASLTGLVIPTFDIKKLEPVLFSSYEVSKHSFLDAQLSDICIGTSAAPTYFPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF   +    T EFNLIDGG+ ANNPTLVA+S VT+++ R++        P+D  R  V
Sbjct  197   HYFTTEE----THEFNLIDGGMVANNPTLVAVSEVTKQILREEAHFIDIKPPVDYTRLLV  252

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGS      + AK A+ WG+  WL     +PLID++S  SSD+VD+H + +F +  
Sbjct  253   ISLGTGSDTSELMFNAKKASKWGLFCWLYQDGTSPLIDIYSQGSSDLVDYHNSVVFKAYQ  312

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             +  NYLRI  DSL+G ++SVD +T+ENL+ L +VG++LLKK VS+ DL TG+Y+     G
Sbjct  313   SEKNYLRINDDSLKGTLSSVDTSTKENLEGLVKVGEHLLKKPVSRFDLDTGRYESIPNAG  372

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEEALKRFAK+LS+ +K R
Sbjct  373   TNEEALKRFAKLLSDEKKLR  392



>ref|XP_009403085.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=413

 Score =   416 bits (1069),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 208/380 (55%), Positives = 277/380 (73%), Gaps = 1/380 (0%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K IT+LSIDGGG+RGIIP TI+ FLE +LQELDG   R+ DYFDV+ GTSTGGL+TAM+T
Sbjct  28    KLITVLSIDGGGVRGIIPGTIINFLETKLQELDGPDARVADYFDVVTGTSTGGLLTAMIT  87

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             APD+ +RPLF+AKDI+ FY ++ PKIFPQG G   S++     + GPKYDGKYLH  V++
Sbjct  88    APDEKQRPLFSAKDIIDFYLQNCPKIFPQGSGFLSSVRKLAGAIMGPKYDGKYLHSKVKD  147

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              L D +L QTLT V+IP FDIK  QP++F++ EA   P  D  ++DICI +SAAPT+ PA
Sbjct  148   LLKDIKLSQTLTNVIIPAFDIKLLQPIIFSSFEARLEPLKDAHVADICISTSAAPTFLPA  207

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE +D  GNT  +NLIDGGV ANNPTLVA+S + + M   +  DF    P+D   F +
Sbjct  208   HYFETQDSNGNTRSYNLIDGGVAANNPTLVAMSQIKKEMFLMNQ-DFHSYKPIDYHNFII  266

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTG++K  +K++A +A+ WGI+ WL H    PLID FS AS+D+VD H++++F SL 
Sbjct  267   ISIGTGAAKVEKKFSAHLASKWGILQWLYHGGSTPLIDSFSHASADIVDVHMSSVFQSLH  326

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
                NYLRIQ ++L G  +SVDV+T+ENL +L ++G++LLKK VS+++L TG ++     G
Sbjct  327   CEQNYLRIQDETLMGQASSVDVSTKENLLELVKIGESLLKKPVSRVNLETGDFEEVKGEG  386

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TN EAL R AK+LSE R  R
Sbjct  387   TNAEALTRLAKILSEERHRR  406



>ref|XP_004979715.1| PREDICTED: patatin-2-Kuras 1-like [Setaria italica]
Length=410

 Score =   416 bits (1069),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 208/389 (53%), Positives = 277/389 (71%), Gaps = 5/389 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K IT+LSIDGGGIRG+IPATI+AFLEA+LQELDG   RI DYFDVIAGTSTG L+T+ML 
Sbjct  24    KLITVLSIDGGGIRGLIPATIIAFLEAKLQELDGLDARIADYFDVIAGTSTGALLTSMLA  83

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQgggl-fgsikggLALLEGPKYDGKYLHKVVE  427
             APDKN RPLF AKD+  FY ++GP IFP+            L  + GPKYDG +LH  ++
Sbjct  84    APDKNNRPLFTAKDLNTFYLKNGPNIFPEKKAGFLTPAAKLLGAVRGPKYDGVFLHDKIK  143

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
                 D R+  T+T V++P FD+K  QP++F+  EA+  P  +  L+DICI +SAAPTYFP
Sbjct  144   SLTHDVRVADTVTNVIVPAFDVKYLQPVIFSTYEAKHDPLKNAHLADICISTSAAPTYFP  203

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AH+F   DGKG + E++L++GGV ANNPT+ A+S +T+ + R + PDF    P D + + 
Sbjct  204   AHFFTTSDGKGGSREYHLVNGGVAANNPTMAAMSMLTKEVLRHN-PDFNPGKPSDYRHYL  262

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             ++S+GTGS+K  +KYTA   A WG++ WL +    P+ID+FS ASSDMVD H A +F +L
Sbjct  263   IISIGTGSAKQEEKYTAPQCAKWGLLQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFEAL  322

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
                 NYLRIQ DSL GD +SVD+TT+EN++ L  +G  LLKK VS++++ TG Y+P +  
Sbjct  323   HCEKNYLRIQDDSLTGDTSSVDITTKENMEALIRIGHELLKKPVSRVNIDTGMYEPVNGE  382

Query  1148  GTNEEALKRFAKVLSENRKNRLKNEAKLS  1234
             GTNEEAL RFAK+LS+ R+ R   ++KLS
Sbjct  383   GTNEEALARFAKILSDERRLR---QSKLS  408



>ref|XP_011038245.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   416 bits (1068),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 228/379 (60%), Positives = 289/379 (76%), Gaps = 3/379 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             IT+LSIDGGGIRGIIP TILAFLE++LQ+LDG   R+ DYFDVI+GTSTGGLVTAML AP
Sbjct  20    ITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVISGTSTGGLVTAMLAAP  79

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA-LLEGPKYDGKYLHKVVEER  433
             +K  RPLFAAKDI  FY E+ PKIFPQ      +    L   L GPKYDGK+LH +V+E+
Sbjct  80    NKQNRPLFAAKDINDFYLENCPKIFPQDSSSKFASAANLVKTLRGPKYDGKFLHSIVKEK  139

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGDT L QTLT +VIPTFDIK+ QP +F++ + +++P  DV LSDICIG+SAAPTY PAH
Sbjct  140   LGDTWLQQTLTNIVIPTFDIKHLQPTIFSSYKVKNNPSTDVLLSDICIGTSAAPTYLPAH  199

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D  G   +FNLIDGGV ANNPTLVAIS V++ + R + PD    NPM+  RF VL
Sbjct  200   YFETKDPSGKVRDFNLIDGGVAANNPTLVAISEVSKAINR-EGPDSYHMNPMEYGRFLVL  258

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG++K  +KY A+ AA WG++GWLT     PL+DVF+ AS DMVDFHI+T+F +L +
Sbjct  259   SLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQALSS  318

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              +NYLRIQ D+L G ++SVDV T+ENL+ L +VG+ LLKK VS+++L TG ++P + + T
Sbjct  319   EENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEELLKKPVSRVNLATGVFEPIN-KMT  377

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL++ AK+LS  +  R
Sbjct  378   NEEALRKLAKLLSREKHLR  396



>ref|XP_008779158.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=404

 Score =   416 bits (1068),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 224/379 (59%), Positives = 277/379 (73%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRGIIPATILAFLE+QLQE DG   R+ DYFDVIAGTSTGGLVTAMLTA
Sbjct  15    LITVLSIDGGGIRGIIPATILAFLESQLQEHDGVDARLADYFDVIAGTSTGGLVTAMLTA  74

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RP+F AKDI  FY EH PKIFPQ  G          L  GPKYDGKYLH+ ++ER
Sbjct  75    PNEKNRPIFEAKDIKAFYLEHSPKIFPQPRGPIDGAFNAFRLFSGPKYDGKYLHQTIKER  134

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG  RLHQTLT VVIP FDIK  QP +F++ E + +  LD +LSDI I +SAAPTY P H
Sbjct  135   LGSLRLHQTLTNVVIPAFDIKKLQPTIFSSYEVKHNALLDAELSDISISTSAAPTYLPGH  194

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+ ++  G   EFNLIDGGV ANNP LVA+S VT+ + R  + DF    P D  RF V+
Sbjct  195   YFKIKNSDGKVREFNLIDGGVAANNPALVAMSEVTKEIFR-GNTDFFPIKPTDYGRFLVI  253

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG++K  +K+ AK ++ WG++GWL     NPL+D F+ ASSDMVD HI+ +F +L +
Sbjct  254   SLGTGTAKNEEKFDAKESSKWGVLGWLLSGGSNPLVDAFTQASSDMVDIHISVVFQALHS  313

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
                YLRIQ D+L+G V+SVDV T+ENL  L ++G+ LLKK  S+++L TG Y+P D + T
Sbjct  314   DSKYLRIQDDTLKGTVSSVDVATKENLDSLVKIGEELLKKPTSRINLETGVYEPVD-KET  372

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NE+ALKRFAK+LSE R+ R
Sbjct  373   NEQALKRFAKILSEERRLR  391



>ref|XP_010680418.1| PREDICTED: patatin-like protein 1 [Beta vulgaris subsp. vulgaris]
Length=407

 Score =   416 bits (1068),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 231/383 (60%), Positives = 284/383 (74%), Gaps = 1/383 (0%)
 Frame = +2

Query  62    NSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTA  241
             N    ITILSIDGGGIRGIIPA +L FLE+QLQ+LDG++ R+ DYFDVIAGTSTGGL+TA
Sbjct  17    NHGNLITILSIDGGGIRGIIPAVMLEFLESQLQKLDGEEARLADYFDVIAGTSTGGLITA  76

Query  242   MLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKV  421
             MLTAP+   RPL+AAK+I PFY EH PKIF Q  G+FGSI   + LL GPKYDGKYLH +
Sbjct  77    MLTAPNDKTRPLYAAKEITPFYLEHCPKIFRQPSGIFGSIGTLMKLLSGPKYDGKYLHNL  136

Query  422   VEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTY  601
             V+E LG  RLHQ LT VVIPTFDIKN QP++F+      + +LDV LSDICIG+SAAPT+
Sbjct  137   VKELLGQRRLHQALTNVVIPTFDIKNLQPVLFSTYMVPIAKELDVLLSDICIGTSAAPTF  196

Query  602   FPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQR  781
              PAH+FEN+D +GN  EFNLIDGG+ ANNP+LVAIS VT+++  K +P+F      D +R
Sbjct  197   LPAHHFENKDDQGNVKEFNLIDGGIAANNPSLVAISEVTKQIV-KSNPNFFPIKATDRER  255

Query  782   FRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFH  961
               V+SLGTGS K  Q Y AK AA WGII WL  +   PL+D F+ + +DMVDFH +  F 
Sbjct  256   LLVISLGTGSDKVEQLYNAKSAAKWGIISWLFDNGNTPLLDAFNQSKADMVDFHNSVAFQ  315

Query  962   SLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDD  1141
             +  + DNYLRIQ D+L+G  ASVDV T ENL  L  +G+ LLKK VS+++  TG+Y+P  
Sbjct  316   AYGSLDNYLRIQDDTLKGVSASVDVATTENLANLVTIGKALLKKPVSRINFDTGRYQPIP  375

Query  1142  ARGTNEEALKRFAKVLSENRKNR  1210
               GTNEEAL RFAK+L+E +  R
Sbjct  376   NGGTNEEALIRFAKLLTEEKSRR  398



>ref|XP_008444643.1| PREDICTED: patatin-like protein 2 [Cucumis melo]
Length=416

 Score =   416 bits (1068),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 232/382 (61%), Positives = 293/382 (77%), Gaps = 7/382 (2%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRGIIP TIL FLE++LQ+LDGK+VR+ DYFDVIAGTSTGGLVTAM+ A
Sbjct  16    LITILSIDGGGIRGIIPGTILNFLESELQKLDGKEVRLADYFDVIAGTSTGGLVTAMIAA  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+N RPLF+AKDI  FY +H PKIFPQ       +   + LL GPKYDGKYLHK+V+E+
Sbjct  76    PDQNNRPLFSAKDINQFYLDHCPKIFPQ--NRTWPLGRIVKLLSGPKYDGKYLHKLVKEK  133

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGDT+LHQTLT VVIPTFDIK  QP +F++ E +++P L+  LSDICI +SAAPTY P+H
Sbjct  134   LGDTKLHQTLTNVVIPTFDIKLLQPTIFSSYEMKNTPSLNAYLSDICISTSAAPTYLPSH  193

Query  614   YFENRDGKGN-TFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
              F+  D     T EFNLIDGGV ANNPTLVAI  VT+ +  K  PDF    PMD +RF V
Sbjct  194   RFKTEDTAAKETREFNLIDGGVAANNPTLVAIGEVTKEVI-KQTPDFFAIKPMDYRRFLV  252

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTG+ K  ++YTA++AA WG++ WLT+    P+IDVFS ASSDMVD H++ IF +L 
Sbjct  253   ISLGTGAPKAEKRYTAELAAEWGMLDWLTNGGSTPIIDVFSQASSDMVDLHLSVIFQALH  312

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYK--PDDA  1144
               +NYLRIQ D+L GD++SVDV TE+NL  L +VG++LLKK VS+++L TG ++  P ++
Sbjct  313   CEENYLRIQDDTLSGDLSSVDVATEKNLNDLVKVGESLLKKQVSRVNLQTGIFEDCPSNS  372

Query  1145  RGTNEEALKRFAKVLSENRKNR  1210
               TN++AL RFAK+LS+ R+ R
Sbjct  373   E-TNDQALTRFAKLLSDERRLR  393



>ref|XP_009410116.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=413

 Score =   416 bits (1068),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 206/383 (54%), Positives = 282/383 (74%), Gaps = 1/383 (0%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K IT+LSIDGGG+RG+IP TI++FLE++LQELDG   RI DYFDVI GTSTGGL+TAM+T
Sbjct  28    KLITVLSIDGGGVRGLIPGTIISFLESKLQELDGPDARIADYFDVITGTSTGGLLTAMIT  87

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             AP++N RP+F+AK+++ FY E+ PKIFPQ  G   S+      + GPKYDGK+LH  V++
Sbjct  88    APNENNRPMFSAKEVIDFYLENSPKIFPQAKGFLSSVTKLAGAIMGPKYDGKFLHTKVKD  147

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              L +T+L QTLT V+IPTFDIK  QP++F++ EA  +   D  L+DICI +SAAPTY PA
Sbjct  148   LLTETKLSQTLTNVIIPTFDIKLLQPVIFSSFEARLAAVKDAHLADICISTSAAPTYLPA  207

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYFE +D  GNT  +NLIDGG+ ANNPTLVA+S + + +A  +  DFA    +D   F V
Sbjct  208   HYFETKDSDGNTRSYNLIDGGIAANNPTLVAMSQIKKEIALMNK-DFANFKSIDYHNFIV  266

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTGS+K  QK++A +A+ WG++ WL H    PLID F   S+D+VD H++++F SL+
Sbjct  267   ISIGTGSAKIEQKFSADLASKWGVLQWLYHGGSTPLIDSFFQGSADVVDIHMSSLFQSLN  326

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
                NYLRIQ D+L G+ +SVDV+T+ENL++L ++G+NLLKK VS+++L TG ++  D  G
Sbjct  327   CEKNYLRIQDDTLVGERSSVDVSTKENLQELVQIGKNLLKKPVSRVNLETGIFEELDGEG  386

Query  1151  TNEEALKRFAKVLSENRKNRLKN  1219
             TN +AL   A+ LS+ R+ R  N
Sbjct  387   TNADALTHLAQRLSQERRLRKAN  409



>ref|XP_006374974.1| hypothetical protein POPTR_0014s03260g [Populus trichocarpa]
 gb|ERP52771.1| hypothetical protein POPTR_0014s03260g [Populus trichocarpa]
Length=392

 Score =   414 bits (1065),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 219/379 (58%), Positives = 275/379 (73%), Gaps = 13/379 (3%)
 Frame = +2

Query  107   IRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAPDKNKRPLFAA  286
             +RGIIP TILAFLE++LQ+LDG   R+ DYFDVI+GTSTGGLVTAML AP++  RPLFAA
Sbjct  1     MRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGGLVTAMLAAPNEQNRPLFAA  60

Query  287   KDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERLGDTRLHQTLT  466
             KDI  FY E+ PKIF Q G    S    +  L+GPKYDGK LH +V+E+LGD RLHQT+T
Sbjct  61    KDINDFYLENCPKIFHQDGSPLASAGKLIKSLKGPKYDGKILHSIVKEKLGDKRLHQTMT  120

Query  467   RVVIPTFDIKNFQPLVFTNCEAEDSPQ-----------LDVKLSDICIGSSAAPTYFPAH  613
              +VIPTFDIK  QP +F++ +   + Q            D  LSDICIG+SAAPTY PAH
Sbjct  121   NIVIPTFDIKRLQPTIFSSYQNRFTLQNICPNNTYRLSTDALLSDICIGTSAAPTYLPAH  180

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D  G   EFNLIDGGV ANNPTLVA+S V++ + RK +PDF  T PMD  RF VL
Sbjct  181   YFETKDPSGKVREFNLIDGGVAANNPTLVAVSEVSKEITRK-NPDFFPTAPMDYGRFLVL  239

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG++K  +KY A  AA WG++GWLT  +  PL+DVF++AS DM+D HI+T+F +L  
Sbjct  240   SLGTGTAKCEEKYDADEAAKWGVLGWLTSENSTPLVDVFTEASGDMIDLHISTVFQALHC  299

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              +NYLRIQ D+L G ++SVDV T+ENL+ L +VG+ LLKK VS++DL TG + P D + T
Sbjct  300   EENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGIFTPVD-KMT  358

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL + AK+LS  +  R
Sbjct  359   NEEALIKMAKLLSREKHLR  377



>emb|CDP02483.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   415 bits (1066),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 225/391 (58%), Positives = 292/391 (75%), Gaps = 1/391 (0%)
 Frame = +2

Query  62    NSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTA  241
             N    +TILSIDGGGIRGIIP  ILA+LE+QLQELDG++ RI DYFDVIAGTSTGGL+TA
Sbjct  17    NCGNLVTILSIDGGGIRGIIPGVILAYLESQLQELDGEEARIADYFDVIAGTSTGGLITA  76

Query  242   MLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKV  421
             ML AP++N RPL+AAKDI+PFY E+ PKIFPQ GG FG +      L GP YDGKY+ ++
Sbjct  77    MLAAPNENHRPLYAAKDIVPFYLENSPKIFPQIGGPFGGVVNAFKTLIGPGYDGKYVQQL  136

Query  422   VEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTY  601
             ++  LG TRLHQTLT +V+PTFDIK  QP++F++ +  D+P +D  LSDICIG+SAAPT+
Sbjct  137   IKSNLGSTRLHQTLTSIVVPTFDIKILQPVIFSSYQVTDNPVVDALLSDICIGTSAAPTF  196

Query  602   FPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQR  781
              PA+YF+N D +GN  EFNLIDGG+ ANNPTLVA+S VT+++ +K +PDF    PMD  R
Sbjct  197   LPAYYFKNSDAQGNEREFNLIDGGIAANNPTLVAVSEVTKQVMKK-NPDFFPIKPMDYGR  255

Query  782   FRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFH  961
             F V+SLGTGS K    Y AKMA+ WG+ GWL +    PLI   + AS+DMVDFH + +F 
Sbjct  256   FLVISLGTGSDKNEHTYNAKMASKWGVFGWLYYKGSTPLIKAVNQASADMVDFHNSVVFQ  315

Query  962   SLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDD  1141
             +L + DNYLRIQ D+L G ++SV   T++NL  L +VG+ LLKK V +++L +G ++P +
Sbjct  316   ALHSDDNYLRIQDDALTGTLSSVATATKQNLDNLVKVGEELLKKPVLRVNLTSGDHEPVE  375

Query  1142  ARGTNEEALKRFAKVLSENRKNRLKNEAKLS  1234
               GTN +AL RFAK+LS+ RK R  N  ++S
Sbjct  376   NGGTNMDALTRFAKLLSDERKLRDANFGRMS  406



>ref|XP_002301194.1| patatin-like family protein [Populus trichocarpa]
 gb|EEE80467.1| patatin-like family protein [Populus trichocarpa]
Length=405

 Score =   414 bits (1065),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 227/380 (60%), Positives = 287/380 (76%), Gaps = 2/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRGIIP TILAFLE++LQ+LDG+  R+ DYFDVI+GTSTGGLVTAMLTA
Sbjct  16    LITVLSIDGGGIRGIIPGTILAFLESELQKLDGEDARLADYFDVISGTSTGGLVTAMLTA  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPLFAAKDI  FY +H P+IFPQ G  F +    +    GPKYDGKYLH +V+E+
Sbjct  76    PNEQNRPLFAAKDINDFYLKHSPRIFPQDGSPFAAAGNLIKAFSGPKYDGKYLHSIVKEK  135

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+ RLHQTLT VVIPTFDIK  QP +F++ + ++ P  D  LSDICIG+SAAPTY PAH
Sbjct  136   LGEKRLHQTLTNVVIPTFDIKYLQPTIFSSYQVKNDPSTDALLSDICIGTSAAPTYLPAH  195

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D +G    FNL+DGGV ANNPTLVAI  V++ + R D PDF    P D  RF VL
Sbjct  196   YFETKDSEGKVRGFNLVDGGVAANNPTLVAIGEVSKEINR-DSPDFFPVKPTDYGRFLVL  254

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG++K  +KY A  AA WG++GWLT  +  PL+DVF+ ASSDMVD H+ T+F +L +
Sbjct  255   SLGTGTAKTEEKYDANKAAKWGVLGWLTSDNSTPLVDVFTQASSDMVDLHLGTVFQALLS  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L G +ASVD+ T+ENL+ L +VG+ LLKK VS+++L TG ++P + + T
Sbjct  315   EKNYLRIQDDTLTGTLASVDIATKENLENLVKVGEGLLKKPVSRVNLDTGVFEPAN-KLT  373

Query  1154  NEEALKRFAKVLSENRKNRL  1213
             NEEAL +FA+ LS  ++ RL
Sbjct  374   NEEALIKFAERLSHQKQLRL  393



>ref|XP_006411935.1| hypothetical protein EUTSA_v10025343mg [Eutrema salsugineum]
 gb|ESQ53388.1| hypothetical protein EUTSA_v10025343mg [Eutrema salsugineum]
Length=408

 Score =   414 bits (1064),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 207/379 (55%), Positives = 273/379 (72%), Gaps = 1/379 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RGII   ILA+LE QLQELDG+ VR+ DYFDV+AGTSTGGLVTAMLT 
Sbjct  18    LVTILSLDGGGVRGIIAGVILAYLEKQLQELDGEDVRLADYFDVVAGTSTGGLVTAMLTV  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+  RP FAAKDI+PFY EH PKIFPQ  GLF  +     LL GPKYDGKYL  ++ + 
Sbjct  78    PDETGRPHFAAKDIVPFYLEHTPKIFPQPEGLFALLPKLPKLLSGPKYDGKYLKNLLSKL  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+ RLHQTLT VVI TFDIK  QP +F++ +    P LDVKLSDIC+G+SAAPTYFP H
Sbjct  138   LGEKRLHQTLTNVVITTFDIKKLQPTIFSSYQTLTDPSLDVKLSDICLGTSAAPTYFPPH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             +F N D +G T EF+L+DG V ANNPTLVA++ V++++  K +PD     P+   +F V+
Sbjct  198   FFSNEDSQGKTTEFHLVDGAVSANNPTLVAMTAVSKQIL-KHNPDMGKLKPLGYDKFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTG++K  + Y+AK AA WGII WL      P++D+  ++S DM+ FH + +F +L +
Sbjct  257   SIGTGTAKKEENYSAKKAAKWGIISWLYDDGSTPILDITMESSRDMIHFHSSVLFKALQS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+LEGD + +D+ T+ NL  L ++G+ +LK  V  +++ TG Y+P     T
Sbjct  317   EDKYLRIDDDTLEGDESYMDLATKPNLDNLVKIGEKVLKNRVMHMNIDTGVYEPILENIT  376

Query  1154  NEEALKRFAKVLSENRKNR  1210
             N++ LKRFAK+LS+ RK R
Sbjct  377   NDQELKRFAKILSDERKLR  395



>ref|XP_002301195.2| hypothetical protein POPTR_0002s12980g [Populus trichocarpa]
 gb|EEE80468.2| hypothetical protein POPTR_0002s12980g [Populus trichocarpa]
Length=411

 Score =   414 bits (1064),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 220/384 (57%), Positives = 276/384 (72%), Gaps = 7/384 (2%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRG+IP TI+ FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT 
Sbjct  17    LITVLSIDGGGIRGLIPGTIINFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTC  76

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglf-gsikggLALLEGPKYDGKYLHKVVEE  430
             PD+N R +FAAKDI  FY    PKIFPQ        +K  +  L GPKYDGKYLH +V+E
Sbjct  77    PDENSRAMFAAKDIKDFYLNQCPKIFPQPRCSLFTQVKKVIKALTGPKYDGKYLHGLVKE  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSP---QLDVKLSDICIGSSAAPTY  601
              LG+ RLH TLT+VVIPTFDIK FQP +F++ E   +    +L+  LSDICI +SAAPTY
Sbjct  137   LLGNRRLHHTLTKVVIPTFDIKTFQPTIFSSFEVRFASLLLKLEKPLSDICIATSAAPTY  196

Query  602   FPAHYFENRDGK-GNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQ  778
              PAHYFE +D + G   EFNLIDGGV ANNP L+AIS VT+ +  K  PDF    PMD  
Sbjct  197   LPAHYFETKDEQTGEVREFNLIDGGVAANNPALIAISEVTKEIV-KGSPDFFPIKPMDYG  255

Query  779   RFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIF  958
             RF ++SLGTGS K  +KY A  AA WG++GWLT     P+ID FS AS+DMVD HI+ + 
Sbjct  256   RFLLISLGTGSPKAQEKYKATEAAKWGLLGWLTSGGSTPVIDAFSHASADMVDLHISVVL  315

Query  959   HSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPD  1138
              +L + +NYLRIQ D+L  +  SVD+ T+ NL+ L +VG+ LLKK VS+++L +G  +P 
Sbjct  316   QALHSENNYLRIQDDTLSREECSVDIATKTNLEDLVKVGERLLKKPVSRVNLESGLSEP-  374

Query  1139  DARGTNEEALKRFAKVLSENRKNR  1210
               + TNEEAL RFAK+LS+ ++ R
Sbjct  375   SVKETNEEALARFAKILSQEKQLR  398



>ref|XP_004499077.1| PREDICTED: patatin-2-Kuras 3-like isoform X3 [Cicer arietinum]
Length=372

 Score =   412 bits (1060),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 209/353 (59%), Positives = 270/353 (76%), Gaps = 2/353 (1%)
 Frame = +2

Query  155   LQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFP  334
             +QELDG+  R+ DYFDVI+GTSTGGLVTAM+ APDKN RPLFAAKDI PFY EH PKIFP
Sbjct  1     MQELDGEDARLADYFDVISGTSTGGLVTAMIAAPDKNNRPLFAAKDIKPFYLEHCPKIFP  60

Query  335   QggglfgsikggLAL-LEGPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPL  511
             Q  GL G +   +   L GPKYDGKYLH V+ E+LGD RLH+T+T +VIPTFDIK+ QP+
Sbjct  61    QHRGLGGIMLAKVVRSLGGPKYDGKYLHDVIREKLGDIRLHETITNIVIPTFDIKSLQPI  120

Query  512   VFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNP  691
             +F++ + E SP LD KLSDICI +SAAPTY PA+ F N+D   +  EFNLIDGGVCANNP
Sbjct  121   IFSSYQLEKSPCLDAKLSDICISTSAAPTYLPAYNFTNKDPNNHEEEFNLIDGGVCANNP  180

Query  692   TLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGW  871
              LVA++ VT+++  +  PDF    P++  RF ++SLGTG++K  +K++A +AA WG++GW
Sbjct  181   ALVAMNEVTKQIINQ-SPDFFPIKPLEYGRFLIISLGTGTAKNEEKFSADIAAKWGLLGW  239

Query  872   LTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEEN  1051
             LT+S  NPLIDVF+ +S DMVDFH++ +  +L + DNYLRIQ D+L GDV+SVD+ TEEN
Sbjct  240   LTNSGSNPLIDVFTQSSGDMVDFHLSCVTQALHSQDNYLRIQDDTLTGDVSSVDIATEEN  299

Query  1052  LKKLEEVGQNllkksvskldllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             L+KL E+G  LLKK VS+++L  G ++P     TNE+ALKR AK LS+ R+ R
Sbjct  300   LEKLCEIGDKLLKKPVSRVNLENGHFEPVIDGETNEQALKRLAKTLSQERRLR  352



>ref|XP_002262942.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=397

 Score =   413 bits (1062),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 211/394 (54%), Positives = 278/394 (71%), Gaps = 7/394 (2%)
 Frame = +2

Query  47    MASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTG  226
             MA++    + +T+LSIDGGG+RGIIP T+LAFLE++ QELDG   RI DYFDVIAGTSTG
Sbjct  1     MATSFGKGRMVTVLSIDGGGVRGIIPGTLLAFLESKFQELDGDDARIADYFDVIAGTSTG  60

Query  227   GLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQg------gglfgsikggLALLEG  388
             GLVTAMLTAP+K+ RP+FAAKDI  FY +H P+IFPQ                 +  + G
Sbjct  61    GLVTAMLTAPNKDNRPVFAAKDINSFYLDHCPEIFPQNRRISFGKSTISRFGSLIDAVRG  120

Query  389   PKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSD  568
             PKY+GKYL  +  + L    L QTLT VVIPTFDIK  QP++F+  EA+ +   + +LSD
Sbjct  121   PKYNGKYLQSLAVDLLDKVYLKQTLTNVVIPTFDIKLLQPVIFSTDEAKVNVAKNARLSD  180

Query  569   ICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPD  748
             ICI +SAAPTY PAHYFE ++  G T  FNLIDGGV ANNPTLVA+S +++ +   D+  
Sbjct  181   ICISTSAAPTYLPAHYFETKEANGKTRSFNLIDGGVAANNPTLVAMSHISKEILM-DNTQ  239

Query  749   FAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSD  928
             F    PMD +   VLSLGTG+ K+ +KY+A  A+ WG+  W  ++   PL+D+FS ASSD
Sbjct  240   FIEMKPMDSKSMLVLSLGTGAPKHEEKYSAAEASRWGLHRWAYNNGATPLLDIFSHASSD  299

Query  929   MVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskl  1108
             MVD H++T+F SL    NYLRIQ D+L G+ +SVDV T ENL++L E+G+ LL K +S++
Sbjct  300   MVDIHVSTVFQSLGCEKNYLRIQDDTLTGEESSVDVATTENLQRLGEIGKELLAKPLSRV  359

Query  1109  dllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             +L TG+++  +  GTN+EAL +FAK+LSE RK R
Sbjct  360   NLETGRHEQLEGEGTNQEALTQFAKLLSEERKFR  393



>ref|XP_010238242.1| PREDICTED: patatin-like protein 2 isoform X2 [Brachypodium distachyon]
Length=399

 Score =   413 bits (1062),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 232/382 (61%), Positives = 284/382 (74%), Gaps = 9/382 (2%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRGII A  LAFLE +LQ+LDG++ R+ DYFDVIAGTSTGGLVTAMLTA
Sbjct  18    LITVLSIDGGGIRGIIAAVALAFLETELQKLDGEEARLADYFDVIAGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+K++RPLFAAKDI  FY +H PKIFPQ  G FG I   L  L GP YDGKYLH+VV ++
Sbjct  78    PNKDRRPLFAAKDIQAFYMDHAPKIFPQLRGAFGRIMKVLRSLSGPSYDGKYLHEVVRKK  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQ-LDVKLSDICIGSSAAPTYFPA  610
             LG  RLHQTLT VVIPTFDIK  QP +F++ E +     +D  LSDICI +SAAPTY PA
Sbjct  138   LGSIRLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKKRNTMDALLSDICISTSAAPTYLPA  197

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF+  D  GN  EFNLIDGGV ANNP LVAI  VT+++  K++PDF    PMD  RF V
Sbjct  198   HYFKTEDLHGNIKEFNLIDGGVAANNPALVAIGEVTKQIF-KENPDFFPIKPMDYGRFLV  256

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTGSSK+ +KY A+ A +WG++ WL  S   PL+D+F+ AS+DMVD HIA +F +L 
Sbjct  257   ISLGTGSSKFEEKYNAQKAKSWGVLDWLLSSGSTPLVDIFTRASADMVDIHIAAVFKALH  316

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPD--DA  1144
             +  NYLRIQ     G ++SVDV T++NL+KL  VG+ LLKKSVS+ +L TGQ  P   D+
Sbjct  317   SEQNYLRIQ-----GTLSSVDVATKDNLEKLVNVGEMLLKKSVSRANLETGQMVPTCGDS  371

Query  1145  RGTNEEALKRFAKVLSENRKNR  1210
               TNE+AL+RFA +LSE R+ R
Sbjct  372   EMTNEKALERFANLLSEERRIR  393



>ref|XP_010061771.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
Length=380

 Score =   412 bits (1060),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 213/367 (58%), Positives = 268/367 (73%), Gaps = 2/367 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG++P  ILAFLE++LQ+LDG+  RI DYFDVIAGTSTG L+TAMLTA
Sbjct  16    LITILSIDGGGIRGVVPGVILAFLESELQKLDGEDARIADYFDVIAGTSTGALLTAMLTA  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPLFAAK I  FY ++GPKIFPQ   LF SI     L+ GPKYDGKYLH ++  +
Sbjct  76    PNEENRPLFAAKGIKSFYFDNGPKIFPQKSCLFSSITQSAKLVFGPKYDGKYLHSLLRAK  135

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+ RLHQTLT VVIPTFDIK  QP++F++ E +   +LD  LSDICIGSSAAPTY PAH
Sbjct  136   LGNLRLHQTLTNVVIPTFDIKQLQPIIFSSFEEKRKTRLDALLSDICIGSSAAPTYLPAH  195

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             +F+  D  G   ++NLIDGG+ ANNPTL+AIS VT+ + RK  P F   N  +  RF V+
Sbjct  196   FFQTSDSTGALRDYNLIDGGMAANNPTLIAISEVTREITRK-SPAFNSINASEFGRFLVI  254

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +KY AK  A WG+ GWL  ++  PLID F   S+DMVD H++ +F +L++
Sbjct  255   SVGTGSAKIEEKYEAKSVAKWGVFGWLMGANSVPLIDAFMQGSADMVDIHLSVVFKALNS  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L G V++VD +T+ENL  L  VG+ LLKK VSK++L TG  +      T
Sbjct  315   ESNYLRIQDDTLSGTVSTVDTSTKENLNNLVGVGEKLLKKPVSKVNLETGNLEASKME-T  373

Query  1154  NEEALKR  1174
             NE+ALKR
Sbjct  374   NEQALKR  380



>ref|XP_006488152.1| PREDICTED: patatin-05-like [Citrus sinensis]
Length=408

 Score =   413 bits (1062),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 225/379 (59%), Positives = 280/379 (74%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIPATILAFLE++LQ+LDG++ RI DYFDVI+GTSTGGLVTAMLTA
Sbjct  18    LVTILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPLFAAKDI  FY  H PKIFPQ  G FG     +  L GPKYDGKYLH +V+E+
Sbjct  78    PNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDGKYLHHLVKEK  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD +LH+TLT VVIPTFDIK  QP +F++CE + +P LD  LSDIC+ +SAAPTY PAH
Sbjct  138   LGDKKLHETLTNVVIPTFDIKKLQPTIFSSCEMKQNPSLDASLSDICVATSAAPTYLPAH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              FE +D  G    F+LIDGGV ANNPTLVA++ VT+ + R    D+   N MD  RF V+
Sbjct  198   SFETKDSTGTVRRFDLIDGGVAANNPTLVALNEVTKEINRGSS-DYYAINAMDYTRFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+ K   KY A  AA WG++GWL+     PL+DVF  +SSDM DFHI+T F +L +
Sbjct  257   SLGTGAPKTEVKYDALKAAKWGVLGWLSSESSTPLVDVFMQSSSDMTDFHISTAFKALHS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              + YLRIQ D+L GD ASVDV T++NL+ L  +G+ LLKK V+K++  TG  +P   +GT
Sbjct  317   ENGYLRIQDDTLTGDEASVDVATKKNLESLVGIGERLLKKPVTKVNFETGLCEP-CGQGT  375

Query  1154  NEEALKRFAKVLSENRKNR  1210
             N+EAL R A+VLS  ++ R
Sbjct  376   NDEALIRLAEVLSREKRIR  394



>emb|CBI25858.3| unnamed protein product [Vitis vinifera]
Length=378

 Score =   412 bits (1059),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/379 (55%), Positives = 273/379 (72%), Gaps = 5/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +T+LSIDGGG+RGIIP T+LAFLE++ QELDG   RI DYFDVIAGTSTGGLVTAMLTA
Sbjct  1     MVTVLSIDGGGVRGIIPGTLLAFLESKFQELDGDDARIADYFDVIAGTSTGGLVTAMLTA  60

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+K+ RP+FAAKDI  FY +H P+IFPQ           +  + GPKY+GKYL  +  + 
Sbjct  61    PNKDNRPVFAAKDINSFYLDHCPEIFPQNSRFGSL----IDAVRGPKYNGKYLQSLAVDL  116

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             L    L QTLT VVIPTFDIK  QP++F+  EA+ +   + +LSDICI +SAAPTY PAH
Sbjct  117   LDKVYLKQTLTNVVIPTFDIKLLQPVIFSTDEAKVNVAKNARLSDICISTSAAPTYLPAH  176

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE ++  G T  FNLIDGGV ANNPTLVA+S +++ +   D+  F    PMD +   VL
Sbjct  177   YFETKEANGKTRSFNLIDGGVAANNPTLVAMSHISKEILM-DNTQFIEMKPMDSKSMLVL  235

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+ K+ +KY+A  A+ WG+  W  ++   PL+D+FS ASSDMVD H++T+F SL  
Sbjct  236   SLGTGAPKHEEKYSAAEASRWGLHRWAYNNGATPLLDIFSHASSDMVDIHVSTVFQSLGC  295

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L G+ +SVDV T ENL++L E+G+ LL K +S+++L TG+++  +  GT
Sbjct  296   EKNYLRIQDDTLTGEESSVDVATTENLQRLGEIGKELLAKPLSRVNLETGRHEQLEGEGT  355

Query  1154  NEEALKRFAKVLSENRKNR  1210
             N+EAL +FAK+LSE RK R
Sbjct  356   NQEALTQFAKLLSEERKFR  374



>emb|CDX69270.1| BnaC01g01830D [Brassica napus]
Length=405

 Score =   413 bits (1061),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/384 (53%), Positives = 284/384 (74%), Gaps = 1/384 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RGI+   ILA+LE QLQ LDG+ +R+ DYFDV+AGTSTGGL+TAMLT 
Sbjct  16    LVTILSLDGGGVRGIMVGVILAYLEEQLQALDGEDMRLADYFDVVAGTSTGGLMTAMLTV  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+  RP F+AKDI+PFY +H PKIFPQ GGL   +     LL GPKYDG YL  ++   
Sbjct  76    PDETGRPRFSAKDIVPFYLQHSPKIFPQPGGLAALLPKLPKLLSGPKYDGVYLRNLLNNL  135

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+TRLHQT+T VVIPTFD+K  QP +F++ +A   P LDVK+SDICIG+SAAPTYFP H
Sbjct  136   LGETRLHQTVTNVVIPTFDMKKLQPTIFSSYQALVDPSLDVKISDICIGTSAAPTYFPPH  195

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+N D +G T EF+L+DGGV ANNPTL+A++ VT+++   D+PD     P+   +F V+
Sbjct  196   YFQNEDIQGKTSEFHLVDGGVTANNPTLLAMTAVTKQIVN-DNPDMGELKPLGYNKFLVV  254

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS++  +KY+A+ AA WGII WL  +   P++D+  ++S D+VDFH + +F +  +
Sbjct  255   SIGTGSAQKEKKYSARKAAKWGIISWLYDNGSTPILDITMESSRDIVDFHSSVVFKARQS  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+L+GD +S+D+ T+ NL+ L  +G+ +LK  V ++++ TG Y+P     T
Sbjct  315   EDKYLRIDDDTLKGDASSMDLATKSNLENLVTIGEKMLKNRVVQMNIDTGVYEPVPGDVT  374

Query  1154  NEEALKRFAKVLSENRKNRLKNEA  1225
             N++ LKRFAK+LS+ RK R+++EA
Sbjct  375   NDQELKRFAKILSDERKLRMQSEA  398



>ref|XP_009139287.1| PREDICTED: patatin-like protein 1 [Brassica rapa]
 emb|CDX75620.1| BnaA01g00820D [Brassica napus]
Length=405

 Score =   413 bits (1061),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/384 (53%), Positives = 285/384 (74%), Gaps = 1/384 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RGI+   ILA+LE QLQ LDG+ +R+ DYFDV+AGTSTGGL+TAMLT 
Sbjct  16    LVTILSLDGGGVRGIMVGVILAYLEEQLQALDGEDMRLADYFDVVAGTSTGGLMTAMLTV  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+  RP FAAKDI+PFY +H PKIFPQ GGL   +     LL GPKYDG YL  ++   
Sbjct  76    PDETGRPRFAAKDIVPFYLQHSPKIFPQPGGLAALLPKLPKLLSGPKYDGVYLRNLLNNL  135

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+TRLHQT+T VVIPTFD+K  QP +F++ +A   P LDVK+SDICIG+SAAPTYFP H
Sbjct  136   LGETRLHQTITNVVIPTFDMKKLQPTIFSSYQALVDPSLDVKISDICIGTSAAPTYFPPH  195

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF+N D +G T EF+L+DGGV ANNPTL+A++ VT+++   D+PD     P+   +F V+
Sbjct  196   YFQNEDIQGKTSEFHLVDGGVTANNPTLLAMTAVTKQIVN-DNPDMGELKPLGYNKFLVV  254

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS++ ++KY+A+ AA WGII WL  +   P++D+  ++S D+VDFH + +F +  +
Sbjct  255   SIGTGSAQKAKKYSAREAAKWGIISWLYDNGSTPILDITMESSRDIVDFHSSVVFKARQS  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+L+GD +S+D+ T+ NL+ L  +G+ +LK  V ++++ TG Y+P     T
Sbjct  315   EDKYLRIDDDTLKGDASSMDLATKSNLENLVIIGEKMLKNRVVQMNIDTGVYEPVPGNVT  374

Query  1154  NEEALKRFAKVLSENRKNRLKNEA  1225
             N++ LKRFAK+LS+ RK R++++A
Sbjct  375   NDQELKRFAKILSDERKLRMQSDA  398



>ref|XP_006338216.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=412

 Score =   413 bits (1061),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 201/389 (52%), Positives = 279/389 (72%), Gaps = 2/389 (1%)
 Frame = +2

Query  47    MASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTG  226
             M S     K +TILSIDGGGIRG+IP T+LAFLE++LQELDG   R+ DYFDV+AGTSTG
Sbjct  25    MVSAATKGKTVTILSIDGGGIRGVIPGTLLAFLESKLQELDGPNARLADYFDVVAGTSTG  84

Query  227   GLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGK  406
             GLVT MLTAP+K+ RPL+ AKDI  FY EHGP+IFPQ        +    L  GPKYDG 
Sbjct  85    GLVTTMLTAPNKDNRPLYQAKDISNFYMEHGPQIFPQSRRNSFVRRVT-NLFGGPKYDGI  143

Query  407   YLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSS  586
             YL  ++   LG+  + QTLT  VIPTFDIK  QP++F+  +A+ +   + +LSD+C+ +S
Sbjct  144   YLRTIINSILGNITMKQTLTNTVIPTFDIKRLQPIIFSTADAKANISKNAQLSDVCLSTS  203

Query  587   AAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNP  766
             AAPTYFP H FE +D +G    F+L+DGGV ANNPTL+AI+ V++++    +  + G   
Sbjct  204   AAPTYFPVHSFETKDAQGKPRTFDLVDGGVAANNPTLMAITYVSKQIM-TGNFQYEGMKN  262

Query  767   MDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHI  946
             MDC++  VLSLGTG  K  +KY A +A+ WG++GW+ ++   PLID++ DAS+DMVD H+
Sbjct  263   MDCKKMLVLSLGTGIGKQEEKYNATVASRWGMLGWVYNNGATPLIDIYGDASADMVDIHV  322

Query  947   ATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQ  1126
             +T+F +L +  NY+RIQ D+L G+ AS+D+ T +N++ L ++G +LLKK +S+++L TG+
Sbjct  323   STMFQTLGSEKNYIRIQDDNLTGEAASMDIATTKNMETLVQIGNDLLKKPISRVNLETGR  382

Query  1127  YKPDDARGTNEEALKRFAKVLSENRKNRL  1213
             Y+P    GTNE A+ RFA++LSE RK R+
Sbjct  383   YEPVVGEGTNEAAIVRFAQLLSEERKLRI  411



>ref|NP_001062043.1| Os08g0477100 [Oryza sativa Japonica Group]
 dbj|BAD09208.1| putative latex protein allergen [Oryza sativa Japonica Group]
 dbj|BAF23957.1| Os08g0477100 [Oryza sativa Japonica Group]
 gb|EAZ43080.1| hypothetical protein OsJ_27670 [Oryza sativa Japonica Group]
 dbj|BAG98488.1| unnamed protein product [Oryza sativa Japonica Group]
Length=431

 Score =   413 bits (1062),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 213/386 (55%), Positives = 272/386 (70%), Gaps = 3/386 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +T+LSIDGGG+RGIIP TILA LE +LQ+LDG   RI DYFDVIAGTSTGGLVTAMLTA
Sbjct  48    IVTVLSIDGGGVRGIIPGTILASLEEKLQKLDGADARIADYFDVIAGTSTGGLVTAMLTA  107

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+   RPLFAAKDI  FY +H PKIFP        +   +A   GPKYDGKYLH VV+  
Sbjct  108   PNDQGRPLFAAKDINDFYLKHCPKIFPPRSIPIVGLFQSMA---GPKYDGKYLHSVVQSL  164

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD R+++T+T VVIPTFDIK  QP+ F+  +A+     +  LSD+CI +SAAPTY P H
Sbjct  165   LGDKRVNETITNVVIPTFDIKLLQPITFSRFDAQIDVSKNALLSDVCISTSAAPTYLPGH  224

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              F+ +D  G   EFNL+DGGV ANNPTL+A++ V++++      DF    P D  +F +L
Sbjct  225   RFQTKDKDGKPREFNLVDGGVAANNPTLLAMTHVSKQILLGKQDDFFPIKPADYGKFMIL  284

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG++K  +KY A  +  WG+I W+ H   +PLID FS AS+D+VD H + +F +L  
Sbjct  285   SLGTGTAKIEEKYDAVQSGKWGMINWVYHDGSSPLIDSFSQASADLVDIHASVLFQALHC  344

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               +YLRIQ D L GD ASVDV+T ENL +L +VG+ LLKK   K++L TG+ +PD +RGT
Sbjct  345   EKSYLRIQDDELTGDTASVDVSTPENLNRLVDVGKALLKKRACKVNLETGKNEPDMSRGT  404

Query  1154  NEEALKRFAKVLSENRKNRLKNEAKL  1231
             NEE L+ FAK+LSE RK RL+ +A L
Sbjct  405   NEEELENFAKMLSEERKARLQKKAFL  430



>ref|XP_006374977.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
 gb|ERP52774.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
Length=415

 Score =   413 bits (1061),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 228/378 (60%), Positives = 286/378 (76%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             ITILSIDGGGIRGIIP TILAFLE++LQ+LDG   R+ DYFDVI+GTSTGGLVTAML AP
Sbjct  27    ITILSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGGLVTAMLAAP  86

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             ++  RPLFAAKDI  FY E+ PKIF Q G    S    +  L+GP+YDGK+LH +V+E+L
Sbjct  87    NEQNRPLFAAKDINDFYLENCPKIFHQDGSPLASAGKLIKSLKGPQYDGKFLHSIVKEKL  146

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             GD RLHQT+T +VIPTFDIK  QP +F++ + ++ P  D  LSDICIG+SAAPTY PAHY
Sbjct  147   GDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSTDALLSDICIGTSAAPTYLPAHY  206

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE +D  G   EFNLIDGGV ANNPTLVA+S V++ + RK +PDF    PMD  RF VLS
Sbjct  207   FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRK-NPDFFPAAPMDYGRFLVLS  265

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG++K  +KY A  AA WG++GWLT  +  PL+DVF++AS DMVD HI+T+F +L   
Sbjct  266   LGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQALHCE  325

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             +NY+RIQ D+L G ++SVDV T+ENL+ L +VG+ LLKK VS++DL TG + P D + TN
Sbjct  326   ENYIRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVD-KMTN  384

Query  1157  EEALKRFAKVLSENRKNR  1210
             EEAL + AK+LS  +  R
Sbjct  385   EEALIKMAKLLSREKHLR  402



>ref|XP_006434817.1| hypothetical protein CICLE_v10003658mg [Citrus clementina]
 gb|ESR48057.1| hypothetical protein CICLE_v10003658mg [Citrus clementina]
Length=408

 Score =   412 bits (1060),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 224/379 (59%), Positives = 281/379 (74%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRGIIPATILAFLE++LQ+LDG++ RI DYFD+I+GTSTGGLVTAMLTA
Sbjct  18    LVTILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFDMISGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPLFAAKDI  FY  H PKIFPQ  G FG     +  L GPKYDGKYLH++V+E+
Sbjct  78    PNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDGKYLHRLVKEK  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+ +LH+TLT VVIPTFDIK  QP +F++CE + +P LD  LSDICI +SAAPTY PAH
Sbjct  138   LGNKKLHETLTNVVIPTFDIKKLQPTIFSSCEMKQNPSLDASLSDICIATSAAPTYLPAH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              FE +D  G    F+LIDGGV ANNPTLVA++ VT+ + R    D+   N MD  RF V+
Sbjct  198   TFETKDSTGKVRRFDLIDGGVAANNPTLVALNEVTKEINRGSS-DYYAINAMDYTRFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG+ K   KY A  AA WG++GWL+     PL+DVF  +SSDM DFHI+T F +L +
Sbjct  257   SLGTGAPKTEVKYDALKAAKWGVLGWLSSESSTPLVDVFMQSSSDMTDFHISTAFKALHS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              + YLRIQ D+L GD ASVDV T++NL+ L  +G+ LLKK V+K++  TG  +P   +GT
Sbjct  317   ENGYLRIQDDTLTGDQASVDVATKKNLESLVGIGERLLKKPVTKVNFETGLCEP-CGQGT  375

Query  1154  NEEALKRFAKVLSENRKNR  1210
             N+EAL R A+VLS  ++ R
Sbjct  376   NDEALIRLAEVLSREKRIR  394



>gb|KDP38381.1| hypothetical protein JCGZ_04306 [Jatropha curcas]
Length=377

 Score =   411 bits (1057),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 265/380 (70%), Gaps = 25/380 (7%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K ITILSIDGGGIRG+IPATIL+FLE++LQ+LDG++ R+ DYFDVI GTSTGGLVTAMLT
Sbjct  17    KLITILSIDGGGIRGLIPATILSFLESELQKLDGEEARLADYFDVITGTSTGGLVTAMLT  76

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             AP++  +PLFAAKDI  FY EH PKIF Q    F      +  L GPKYDGKYLH +V+E
Sbjct  77    APNEQNKPLFAAKDIKDFYTEHCPKIFHQDTSPFAPAANLVKSLTGPKYDGKYLHNIVKE  136

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LGD R+ QTLT VVIPTFDIK+ QP +F++ EA+ +P ++  LSDICI +SAAPTY PA
Sbjct  137   KLGDIRIDQTLTHVVIPTFDIKHLQPTIFSSYEAKKNPSMNALLSDICIATSAAPTYLPA  196

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             H FE +D  G   EF+LIDGGV ANNP                        P D  RF V
Sbjct  197   HRFETKDSTGKVREFDLIDGGVAANNP------------------------PTDYSRFLV  232

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             LSLGTGS K  +KY A  AA WG+ GWLT     PL DVF  ASSDMVDFHI T+F +L 
Sbjct  233   LSLGTGSPKCEEKYKATEAAKWGLFGWLTSEHSTPLTDVFMQASSDMVDFHICTVFKALH  292

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + +NY+RIQ D+L G+++SVD+ TEENL  L +VG+ LLKK V +++L +G ++P     
Sbjct  293   SEENYIRIQDDTLTGNLSSVDIATEENLNNLVKVGEELLKKRVGRVNLDSGAFEP-AYEA  351

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNE +L + AK+LS  ++ R
Sbjct  352   TNEHSLIKLAKMLSREKQVR  371



>ref|XP_004288052.1| PREDICTED: patatin group A-3-like [Fragaria vesca subsp. vesca]
Length=407

 Score =   412 bits (1059),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 223/380 (59%), Positives = 291/380 (77%), Gaps = 3/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRGIIP  +L +LE+QLQ LDG+  RI DYFDVI+GTSTGGL+TAML A
Sbjct  20    LITVLSIDGGGIRGIIPGVLLTYLESQLQHLDGEDARIADYFDVISGTSTGGLITAMLAA  79

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD+N RPLFAAKDI+PFY ++ PKIFPQ  GL  ++   + +L GPKYDGKYLHK++   
Sbjct  80    PDENNRPLFAAKDIVPFYLDNCPKIFPQSRGLCATVTDLVKVLIGPKYDGKYLHKLIRSI  139

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             +GD RL QTLT V+IPTFDIK   P++F+  +    P  + KLSDICIG+SAAPTYFPAH
Sbjct  140   VGDKRLSQTLTNVIIPTFDIKTLLPVIFSTYQVASYPVKNAKLSDICIGTSAAPTYFPAH  199

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDC-QRFRV  790
             YFEN   +G T +FNLIDGGV ANNP LVAI+ VT+++ RK +PDF+   P++  +RF +
Sbjct  200   YFENHQ-QGETNKFNLIDGGVAANNPALVAITEVTKQIMRK-NPDFSEVQPLELYERFLL  257

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             ++LGTGS+K   +Y+AKMA+ WGI+ WL     +PL++ +++ASSDMV +H   IF +L 
Sbjct  258   ITLGTGSNKSELRYSAKMASKWGILSWLYDDGSSPLVNSYNEASSDMVAYHNCAIFEALQ  317

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + +NYLRI  D+L GD++SVD  T+ENL+ L EVG+ LLKK VS+++L TG Y+P +  G
Sbjct  318   SENNYLRIDDDTLTGDLSSVDKATKENLENLVEVGEQLLKKQVSRMNLDTGLYEPVENGG  377

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEEAL+RFAKVLS+ +K R
Sbjct  378   TNEEALQRFAKVLSDEKKYR  397



>ref|XP_010269013.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=404

 Score =   412 bits (1059),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 228/380 (60%), Positives = 284/380 (75%), Gaps = 4/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRGIIP  IL FLE+QLQELDG+ VR+ DYFDVIAGTSTGGLVTAMLT 
Sbjct  16    LITILSIDGGGIRGIIPGIILGFLESQLQELDGEDVRLADYFDVIAGTSTGGLVTAMLTT  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++ KRPLF+AKDI  FY E+ P+IFPQ    F      +  L GP+Y G YLH +V ++
Sbjct  76    PNEKKRPLFSAKDIKNFYLENAPRIFPQQSCPFAHAAKVIKSLSGPRYKGYYLHNLVRKK  135

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG TRLHQTLT VVIPTFD+K  QP +F++ + +  P LD  LSD+CIG+SAAPTY PAH
Sbjct  136   LGSTRLHQTLTNVVIPTFDVKELQPTIFSSYQLKCKPSLDALLSDVCIGTSAAPTYLPAH  195

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D +G   EFNLIDGGV ANNP LVAI  V++ + +  +PD     PM+  RF VL
Sbjct  196   YFETKDEEGKVREFNLIDGGVAANNPALVAIGEVSKDIIK--NPDSFSIKPMEFGRFLVL  253

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDG-NPLIDVFSDASSDMVDFHIATIFHSLD  970
             SLGTG+ K   KY AK A+ WG++GWL HSDG +PL+DVF+ AS DMVD+H++ +F +L 
Sbjct  254   SLGTGAPKSEHKYGAKQASKWGVLGWL-HSDGSSPLVDVFTQASGDMVDYHVSAVFQALS  312

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + DNYLRIQ D+L G V+SVD  ++ENL  L +VG+ LLKK VS+++L TG Y+P   + 
Sbjct  313   SKDNYLRIQDDTLGGTVSSVDFASKENLDNLVKVGEALLKKPVSRVNLDTGIYEPCKEQI  372

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEEAL+RFAK+LSE +K R
Sbjct  373   TNEEALRRFAKLLSEEKKLR  392



>emb|CDY42719.1| BnaA03g53720D [Brassica napus]
Length=712

 Score =   422 bits (1086),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 210/388 (54%), Positives = 278/388 (72%), Gaps = 1/388 (0%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGGIRG I   ILA LE QLQE+DG+ VR+ DYFDV+AGTSTGGL+TAMLT 
Sbjct  322   LVTILSLDGGGIRGTISGVILACLEKQLQEIDGEDVRLADYFDVVAGTSTGGLITAMLTV  381

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             PD   RP FAAKDI+PFY EH PKIFPQ  G+   +     LL GPKYDGKYL  ++   
Sbjct  382   PDATGRPHFAAKDIVPFYLEHCPKIFPQPEGVAALLPKLPKLLSGPKYDGKYLRNLLSNL  441

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+T+LHQT+T VVIPTFD+K  QP +F++ +A   P LDVKLSDICIG+SAAPT+FP H
Sbjct  442   LGETKLHQTITNVVIPTFDMKKLQPTIFSSYQALFDPSLDVKLSDICIGTSAAPTFFPPH  501

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YF N+D +G T EF+L+DGGV A+NPTLVA++ VT+++  K++PD     P+   +F V+
Sbjct  502   YFSNKDSQGKTSEFHLVDGGVTASNPTLVAMTAVTKQIV-KNNPDMGKLKPLGYDKFLVI  560

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             S+GTGS+K  +KY+AK AA WGII WL      P++D+  ++S DM+ FH + +F +L +
Sbjct  561   SIGTGSTKKVEKYSAKKAAKWGIISWLYDDGSTPILDITMESSRDMIHFHSSVLFKALQS  620

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
              D YLRI  D+L+ D  S DV T+ NL+ L ++G+ +LK  V  +++ TG Y+P     T
Sbjct  621   EDKYLRIDDDTLDNDAGSTDVATKSNLENLVKIGEKVLKNRVVHMNIDTGAYEPIPENVT  680

Query  1154  NEEALKRFAKVLSENRKNRLKNEAKLSK  1237
             NEE LKRFAK+LSE +K R  +   ++K
Sbjct  681   NEEELKRFAKILSEEQKLRRMSSDTMTK  708


 Score =   274 bits (700),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 159/208 (76%), Gaps = 0/208 (0%)
 Frame = +2

Query  74   FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
             +TILS+DGGGIRG I   ILA LE QLQE+DG+ VR+ DYFDV++GTSTGGL+TAMLT 
Sbjct  19   LVTILSLDGGGIRGTISGVILACLEKQLQEIDGEDVRLADYFDVVSGTSTGGLMTAMLTV  78

Query  254  PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
            P KN RP  AAKDI+PFY EH PKIFPQ  GL   +     LL GPKY GKYL K++ + 
Sbjct  79   PGKNGRPQLAAKDIVPFYLEHCPKIFPQPEGLGALLPKLPKLLSGPKYSGKYLRKLLSKL  138

Query  434  LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
            LG+T+LHQT+T VVIPTFD+K  QP +F++ +A   P LDVK+SDIC+G+SAAPT+FP H
Sbjct  139  LGETKLHQTVTNVVIPTFDMKKLQPTIFSSYQALIDPSLDVKISDICLGTSAAPTFFPPH  198

Query  614  YFENRDGKGNTFEFNLIDGGVCANNPTL  697
            YF N D +G T EFNL+DG V ANNP +
Sbjct  199  YFSNEDSQGKTTEFNLVDGAVTANNPVM  226



>gb|EAZ07350.1| hypothetical protein OsI_29600 [Oryza sativa Indica Group]
Length=429

 Score =   413 bits (1061),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 215/386 (56%), Positives = 269/386 (70%), Gaps = 5/386 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +T+LSIDGGG+RGIIP TILA LE +LQ +DG   RI DYFDVIAGTSTGGLVTAMLTA
Sbjct  48    IVTVLSIDGGGVRGIIPGTILASLEEKLQRIDGADARIADYFDVIAGTSTGGLVTAMLTA  107

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+   RPLFAAKDI  FY EH PKIFP    +          + GPKYDGKYLH VV+  
Sbjct  108   PNDQGRPLFAAKDINDFYLEHCPKIFPPRSIMGLFQS-----MAGPKYDGKYLHSVVQSL  162

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGD R+++TLT VVIPTFDIK  QP+ F+  +A+     +  LSD+CI +SAAPTY P H
Sbjct  163   LGDKRVNETLTNVVIPTFDIKLLQPITFSRYDAQIDVSKNALLSDVCISTSAAPTYLPGH  222

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              F+  D  G   EFNL+DGGV ANNPTL+A++ V++++      DF    P D  +F +L
Sbjct  223   RFQTTDKDGKHREFNLVDGGVAANNPTLLAMTHVSKQIMLGKQDDFFPIKPADYGKFMIL  282

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS+K  +KY A  +  WG+I W+ H   +PLID FS AS+D+VD H + +F +L  
Sbjct  283   SLGTGSAKIEEKYDAVQSGKWGMINWVYHDGSSPLIDSFSQASADLVDIHASVLFQALRC  342

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               +YLRIQ D L GD ASVDV+T ENL +L EVG+ LLKK V K++L TG+ +PD +RGT
Sbjct  343   EKSYLRIQDDELTGDTASVDVSTPENLNRLVEVGKALLKKRVCKVNLETGKNEPDMSRGT  402

Query  1154  NEEALKRFAKVLSENRKNRLKNEAKL  1231
             NEE L  FAK+LS+ RK RL+ +A L
Sbjct  403   NEEELDHFAKMLSDERKARLQKKACL  428



>ref|XP_006354912.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=404

 Score =   412 bits (1058),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 224/373 (60%), Positives = 278/373 (75%), Gaps = 2/373 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              IT+LSIDGGGIRGIIPATIL+FLE+QLQELDG   R+ DYFDV+AGTSTG LVTAMLTA
Sbjct  16    LITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVMAGTSTGSLVTAMLTA  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA-LLEGPKYDGKYLHKVVEE  430
             PD+N RPL+AAKDI PFY EH PKIFPQ      +  G +   L G KYDGKYLH+VV+E
Sbjct  76    PDENNRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNIVQTLIGSKYDGKYLHEVVKE  135

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +L DTRL  T+T VVIPTFDIK  QP +F+  E + +   D KLSDICI +SAAPTY PA
Sbjct  136   KLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLSDICISTSAAPTYLPA  195

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF+  D KGN  E +LIDGGV ANNP L+AIS V++ +  K++PDF    PM+  RF V
Sbjct  196   HYFKVEDSKGNVREHHLIDGGVAANNPGLIAISEVSKEIF-KNNPDFYPIKPMEYGRFLV  254

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTG++K  QKY + M A WGI+ WL H    PL++VF+ +S+DMVD+H + +F +L 
Sbjct  255   ISLGTGAAKCEQKYNSLMGAKWGIVDWLFHKGSTPLVEVFTQSSADMVDYHNSVVFQALR  314

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + D+YLRIQ D L G  ASVDV T+ENL++L E+G+ LLKK +S+++L TG  +P    G
Sbjct  315   SEDSYLRIQEDELSGTEASVDVATKENLERLVEIGEKLLKKPLSRVNLETGLTEPIPKGG  374

Query  1151  TNEEALKRFAKVL  1189
             TNEEALKRFA +L
Sbjct  375   TNEEALKRFATLL  387



>emb|CAN62059.1| hypothetical protein VITISV_024099 [Vitis vinifera]
Length=397

 Score =   411 bits (1057),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 211/394 (54%), Positives = 276/394 (70%), Gaps = 7/394 (2%)
 Frame = +2

Query  47    MASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTG  226
             MA++    + +T+LSIDGGG+RGIIP T+LAFLE++ QELDG   RI DYFDVIAGTSTG
Sbjct  1     MATSFGKGRMVTVLSIDGGGVRGIIPGTLLAFLESKFQELDGDDARIADYFDVIAGTSTG  60

Query  227   GLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQg------gglfgsikggLALLEG  388
             GLVTAMLTAP+K+ RP FAAKDI  FY +H P+IFPQ                 +  + G
Sbjct  61    GLVTAMLTAPNKDNRPXFAAKDINSFYLDHCPEIFPQNRRISFGKSTISRFGSLIDAVRG  120

Query  389   PKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSD  568
             PKY+GKYL  +  + L    L QTLT VVIPTFDIK  QP++F   EA+ +   + +LSD
Sbjct  121   PKYNGKYLQSLAVDLLDKVYLKQTLTNVVIPTFDIKLLQPVIFXTDEAKVNVAKNARLSD  180

Query  569   ICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPD  748
             ICI +SAAPTY PAHYFE ++  G T  FNLIDGGV ANNPTLVA+S +++ +   D+  
Sbjct  181   ICISTSAAPTYLPAHYFETKEANGKTRSFNLIDGGVAANNPTLVAMSHISKEILM-DNTQ  239

Query  749   FAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSD  928
             F    PMD +   VLSLGTG+ K+ +KY+A  A+ WG+  W  ++   PL+D+FS ASSD
Sbjct  240   FIEMKPMDSKSMLVLSLGTGAPKHEEKYSAAEASRWGLHRWAYNNGATPLLDIFSHASSD  299

Query  929   MVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskl  1108
             MVD H++T+F SL    NYLRIQ D+L G+ +SVDV T ENL++L E+G+ LL K +S++
Sbjct  300   MVDIHVSTVFQSLGCEKNYLRIQDDTLTGEESSVDVATTENLQRLGEIGKELLXKPLSRV  359

Query  1109  dllTGQYKPDDARGTNEEALKRFAKVLSENRKNR  1210
             +L TG+++  +  GTN+EAL +FAK+LSE RK R
Sbjct  360   NLETGRHEQLEGEGTNQEALTQFAKLLSEERKFR  393



>ref|XP_009603683.1| PREDICTED: patatin-like protein 1 [Nicotiana tomentosiformis]
Length=407

 Score =   412 bits (1058),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 227/383 (59%), Positives = 288/383 (75%), Gaps = 1/383 (0%)
 Frame = +2

Query  62    NSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTA  241
             N+   ITIL+IDGGGIRGIIP  IL++LE+QLQELDGK  RI DYFD+IAGTSTGGLVTA
Sbjct  17    NTGTLITILAIDGGGIRGIIPGVILSYLESQLQELDGKDARIADYFDLIAGTSTGGLVTA  76

Query  242   MLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKV  421
             ML AP+K+KRPL+AAKDI PFY EH PKIFPQ  G    I      + GPKYDGKYLHK+
Sbjct  77    MLAAPNKDKRPLYAAKDITPFYLEHSPKIFPQISGPLAGIINLTKAMGGPKYDGKYLHKL  136

Query  422   VEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTY  601
             +++ LG TRLH TLT VVIPTFDIK  QP++F + EA   P LD +L+DICI +SAAPT+
Sbjct  137   IKDILGGTRLHDTLTAVVIPTFDIKKLQPVIFNSYEAILKPDLDAELADICISTSAAPTF  196

Query  602   FPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQR  781
              PA+ F+N+D + N  EFNLIDGGV ANNPTLVAI  VT+++  +   D     PMD  R
Sbjct  197   LPAYGFKNKDAQDNEREFNLIDGGVAANNPTLVAIGEVTKQVLMQ-HADLFPIKPMDYGR  255

Query  782   FRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFH  961
             F V+SLGTG++K   KY A+MAA WG++ WL + +  P+ID F+ AS+DMVDFH   +F 
Sbjct  256   FLVISLGTGNAKNEHKYNAQMAAKWGLLSWLFNDNSTPIIDAFNQASADMVDFHNFVVFK  315

Query  962   SLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDD  1141
             +L + D YLRIQ D+L G++ASVD+ T+ENL+ L +VG++LL+K VSK++L  G Y+  +
Sbjct  316   ALHSDDKYLRIQDDTLTGNLASVDIATKENLQGLVKVGEHLLEKPVSKINLDKGVYEAVE  375

Query  1142  ARGTNEEALKRFAKVLSENRKNR  1210
               GTN+EAL+RFAK+LS+ RK R
Sbjct  376   NGGTNKEALQRFAKILSDERKLR  398



>ref|XP_006374976.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
 gb|ERP52773.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
Length=415

 Score =   412 bits (1058),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 228/378 (60%), Positives = 285/378 (75%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             IT+LSIDGGGIRGIIP TILAFLE++LQ+LDG   R+ DYFDVI+GTSTGGLVTAML AP
Sbjct  27    ITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGGLVTAMLAAP  86

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             ++  RPLFAAKDI  FY E+ PKIF Q G    S    +  L+GPKYDGK LH +V+E+L
Sbjct  87    NEQNRPLFAAKDINDFYLENCPKIFHQDGSPLASAGKLIKSLKGPKYDGKILHSIVKEKL  146

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             GD RLHQT+T +VIPTFDIK  QP +F++ + ++ P  D  LSDICIG+SAAPTY PAHY
Sbjct  147   GDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSTDALLSDICIGTSAAPTYLPAHY  206

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE +D  G   EFNLIDGGV ANNPTLVA+S V++ + RK +PDF    PMD  RF VLS
Sbjct  207   FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRK-NPDFFPAAPMDYGRFLVLS  265

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTG++K  +KY A  AA WG++GWLT  +  PL+DVF++AS DMVD HI+T+F +L   
Sbjct  266   LGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQALHCE  325

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             +NY+RIQ D+L G ++SVDV T+ENL+ L +VG+ LLKK VS++DL TG + P D + TN
Sbjct  326   ENYIRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVD-KMTN  384

Query  1157  EEALKRFAKVLSENRKNR  1210
             EEAL + AK+LS  +  R
Sbjct  385   EEALIKMAKLLSREKHLR  402



>ref|NP_001190942.1| PATATIN-like protein 5 [Arabidopsis thaliana]
 gb|AEE86743.1| PATATIN-like protein 5 [Arabidopsis thaliana]
Length=435

 Score =   412 bits (1060),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 211/419 (50%), Positives = 282/419 (67%), Gaps = 32/419 (8%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQ-------------------------------  160
              +TILS+DGGG+RGII   ILA+LE QLQ                               
Sbjct  8     LVTILSLDGGGVRGIIAGVILAYLEKQLQVYIYINFSRMQVTKIVDTYDRIITRHANFVV  67

Query  161   ELDGKKVRICDYFDVIAGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQg  340
             ELDG+ VR+ DYFDVIAGTSTGGLVTAMLTAPD+N RP FAAK+I+PFY EH PKIFPQ 
Sbjct  68    ELDGEHVRVADYFDVIAGTSTGGLVTAMLTAPDENGRPRFAAKEIVPFYLEHCPKIFPQP  127

Query  341   gglfgsikggLALLEGPKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFT  520
              G+   +     LL GPKY G YL   + + LG+T+L QTLT VVIPTFDIK  QP +F+
Sbjct  128   TGVLALLPKLPKLLSGPKYSGNYLRTTLGKLLGETKLRQTLTNVVIPTFDIKTLQPTIFS  187

Query  521   NCEAEDSPQLDVKLSDICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLV  700
             + +A   P LDVK+SDICIG+SAAPTYFP +YF N D +G T  FNL+DGGV ANNPTLV
Sbjct  188   SYQALTDPSLDVKVSDICIGTSAAPTYFPPYYFSNEDSQGKTRHFNLVDGGVTANNPTLV  247

Query  701   AISTVTQRMARKDDPDFAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTH  880
             A++ VT+++   ++PD    NP+   +F V+S+GTGS+K  ++Y+AK AA WGII WL  
Sbjct  248   AMTAVTKQIV-NNNPDMGTLNPLGYDQFLVISIGTGSAKKEERYSAKKAAKWGIISWLYE  306

Query  881   SDGNPLIDVFSDASSDMVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKK  1060
                 P++D+  ++S D+V +H + +F +L + D YLRI  D+LEGD +++D++T+ NL+ 
Sbjct  307   DGTTPILDITFESSRDIVHYHSSVVFKALQSEDKYLRIDDDTLEGDASTLDLSTKSNLEN  366

Query  1061  LEEVGQNllkksvskldllTGQYKPDDARGTNEEALKRFAKVLSENRKNRLKNEAKLSK  1237
             L ++G+ +L   V ++++ TG Y+P      N+E LKRFAK+LSE RK R K   K++K
Sbjct  367   LIKLGEKMLTNRVMQMNIDTGTYEPAAENINNDEQLKRFAKILSEERKLRRKRSDKMTK  425



>ref|XP_010269043.1| PREDICTED: patatin-like protein 2 isoform X2 [Nelumbo nucifera]
Length=381

 Score =   410 bits (1054),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 225/382 (59%), Positives = 276/382 (72%), Gaps = 4/382 (1%)
 Frame = +2

Query  29    SQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVI  208
             ++SS +  +  N    ITILSIDGGGIRGIIP  IL +LE+QLQELDGK  R+ DYFDVI
Sbjct  4     TKSSLQPPTYGN---LITILSIDGGGIRGIIPGIILGYLESQLQELDGKDARLADYFDVI  60

Query  209   AGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEG  388
             AGTSTGGLVTAMLTAP++  RPLF+A+DI  FY E  P+IFPQ           +  L G
Sbjct  61    AGTSTGGLVTAMLTAPNEKNRPLFSAEDIKAFYLEQCPRIFPQLSCPLAPAAKVMKALIG  120

Query  389   PKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSD  568
             PKYDGKYLH+VV+E+L  TRLHQTLT VV+PTFDIKN QP +F++ E +  P LD  LSD
Sbjct  121   PKYDGKYLHRVVKEKLETTRLHQTLTNVVVPTFDIKNLQPTIFSSYEVKSKPSLDAFLSD  180

Query  569   ICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPD  748
             ICI +SAAPTY PAHYF+ +D  G   EFNLIDGGV ANNPTLVA+  VT+ +  K  PD
Sbjct  181   ICISTSAAPTYLPAHYFQTQDPDGKVREFNLIDGGVAANNPTLVAMREVTKEIT-KGSPD  239

Query  749   FAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSD  928
             F    PMD  RF V+SLGTG+ K ++KY+A  AA WG++GWL      PL+DVF+ AS D
Sbjct  240   FFPIKPMDYGRFLVISLGTGAPKAAEKYSAHQAAKWGVMGWLLEGGSTPLVDVFTHASGD  299

Query  929   MVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskl  1108
             MVD HI+ +F +L + DNYLRIQ D+L   V+SVDV T+ENL  L +VG+ LLK  VS++
Sbjct  300   MVDLHISVVFQALRSEDNYLRIQDDTLGSTVSSVDVATKENLDNLVKVGEALLKNPVSRV  359

Query  1109  dllTGQYKPDDARGTNEEALKR  1174
             +L TG Y+P   +GTNEE L+R
Sbjct  360   NLDTGIYEPSKTKGTNEEELRR  381



>ref|XP_009383171.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009383172.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=409

 Score =   411 bits (1057),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 219/380 (58%), Positives = 283/380 (74%), Gaps = 3/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGI+GIIPATILAFLE++LQ+LDG+  R+ DYFD +AGTSTGGLVTAMLTA
Sbjct  18    LITILSIDGGGIKGIIPATILAFLESELQKLDGEDARLADYFDAMAGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+   RPL+AAKDI  FY  H PKIFPQ    F +    +  + GP+YDGKYLH+++   
Sbjct  78    PNMQNRPLYAAKDIKEFYLNHSPKIFPQSSWPFNTAAKVIRAIIGPRYDGKYLHELIRRN  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LG+TRLHQTLT VVIPTFDIK  QP +F++ + +++P LD +LSDICIG+SAAPTY PA+
Sbjct  138   LGETRLHQTLTNVVIPTFDIKRLQPTIFSSYKVKNNPLLDARLSDICIGTSAAPTYLPAY  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
              F+  D +GN  EFNLIDGG+ ANNP LVA+  +T+    +++PDF    PMD  RF V+
Sbjct  198   DFQTEDSQGNIREFNLIDGGLAANNPALVAMGEITKE-TFEENPDFFPIKPMDYHRFLVI  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGSSK  ++Y+A  A  WG++GWL  +   PL+D F  AS+DMVD HI+  F +L +
Sbjct  257   SLGTGSSK-EERYSANHAKRWGVLGWLLSNGSTPLVDAFMQASADMVDIHISEAFQALHS  315

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKP-DDARG  1150
             G NYLRI+ D+L G +ASVD +T+ENL+ L +VG+ LLKK VS+++L TG  +P  +  G
Sbjct  316   GKNYLRIEDDALSGILASVDTSTKENLENLVKVGEMLLKKPVSRVNLETGHVEPVSEGEG  375

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEEAL R AK+LS+ R+ R
Sbjct  376   TNEEALIRLAKLLSDERRLR  395



>ref|XP_010446708.1| PREDICTED: patatin-like protein 1 isoform X1 [Camelina sativa]
Length=418

 Score =   411 bits (1057),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 199/392 (51%), Positives = 277/392 (71%), Gaps = 5/392 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILS+DGGG+RG+I   +LA+LE QLQE+DG+  R+ DYFDVIAGTSTGGLVTAMLT 
Sbjct  18    LVTILSLDGGGVRGVIAGVVLAYLEKQLQEIDGEGARLADYFDVIAGTSTGGLVTAMLTV  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglf----gsikggLALLEGPKYDGKYLHKV  421
             PD   RP FAAKDI+PFY EH PKIFPQ           +     LL GPKY GKYL  +
Sbjct  78    PDGTGRPHFAAKDIVPFYLEHCPKIFPQPAEKCRGVFALLPKLPKLLSGPKYSGKYLRNL  137

Query  422   VEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTY  601
             + + LG+T+LHQTLT VVIPT+DIK  QP +F++ +A   P L+VK+SDIC+G+S+APT+
Sbjct  138   LSKLLGETKLHQTLTNVVIPTYDIKKLQPTIFSSYQALTDPSLNVKVSDICVGTSSAPTF  197

Query  602   FPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQR  781
             FP HYF N D +G T EFNL+DG + ANNPTLVA++ V++++  K++PD     P+   +
Sbjct  198   FPPHYFSNEDSQGKTTEFNLVDGAITANNPTLVAMTAVSKQIV-KNNPDMGDIKPLGYDQ  256

Query  782   FRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFH  961
             F V+S+GTGS+K  +KY+AK AA WGII WL  +   P++D+  ++S DM+ +H + +F 
Sbjct  257   FLVISIGTGSTKREEKYSAKKAAKWGIISWLYDNGSTPILDITMESSRDMIHYHSSVVFK  316

Query  962   SLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDD  1141
             +L + D YLRI  D+L+GDV+ +D+ T+ NL+ L +VG+ +L   V ++++ TG Y+P  
Sbjct  317   ALQSEDKYLRIDDDTLDGDVSVMDLATKSNLENLVKVGEKILSSRVVQMNIDTGAYEPVP  376

Query  1142  ARGTNEEALKRFAKVLSENRKNRLKNEAKLSK  1237
                 N+E LKR+AK+LS+ RK R      ++K
Sbjct  377   ENINNDEQLKRYAKILSDERKLRRMRSDTMTK  408



>ref|XP_011071103.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
 ref|XP_011071104.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
Length=408

 Score =   410 bits (1055),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 225/382 (59%), Positives = 284/382 (74%), Gaps = 2/382 (1%)
 Frame = +2

Query  65    SQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAM  244
             S K I ILSIDGGGIRGIIP  ILAFLE++LQ LD ++ R+ DYFDVIAGTSTGGLVTAM
Sbjct  15    SGKLIRILSIDGGGIRGIIPGVILAFLESRLQMLDSEEARLADYFDVIAGTSTGGLVTAM  74

Query  245   LTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVV  424
             LTAP+++ RP+FAAKDI  FY +  PKIFPQ     G     +    GPKYDG YLH ++
Sbjct  75    LTAPNEDNRPMFAAKDIKAFYLDECPKIFPQQSHALGHAAKVIKSFSGPKYDGIYLHSLI  134

Query  425   EERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYF  604
             +E+LGD +LH+TLT VVIPTFDIK+ QP++F++ E ++ P LD  LSDICIG+SAAPTY 
Sbjct  135   KEKLGDVKLHETLTDVVIPTFDIKSLQPVIFSSYEVKNEPSLDASLSDICIGTSAAPTYL  194

Query  605   PAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRF  784
             PAHYFEN+D +G   EFNLIDGGV ANNPTLVAI+ VT+ + R     F    P +  RF
Sbjct  195   PAHYFENKDSEGRIREFNLIDGGVAANNPTLVAINQVTKEITRGSSEIFP-LKPKEDGRF  253

Query  785   RVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHS  964
              VLSLGTGS+K  +KY A+ AA WG++GWL +    PL DVF+ ASSDMVDFH  T F +
Sbjct  254   LVLSLGTGSAKAEEKYDAEGAAKWGVLGWLLNGGSTPLFDVFNRASSDMVDFHTTTFFQA  313

Query  965   LDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDA  1144
             L + +NYLRIQ D+L G ++SVDV T+ENL+ L + G+ LLKK VS+++  TG Y+P + 
Sbjct  314   LHSQNNYLRIQDDTLTGAMSSVDVATKENLEDLVKAGEKLLKKPVSRVNWETGIYEPSN-  372

Query  1145  RGTNEEALKRFAKVLSENRKNR  1210
             +GTNEEAL R A++LS+ ++ R
Sbjct  373   QGTNEEALIRLAELLSKEKRLR  394



>ref|XP_006339912.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=399

 Score =   410 bits (1054),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 226/380 (59%), Positives = 284/380 (75%), Gaps = 1/380 (0%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K ITILSIDGGGIRGIIP  ILA+LE+QLQELDG+  RI DYFD+IAGTSTGGLVTAML 
Sbjct  18    KLITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARIADYFDLIAGTSTGGLVTAMLA  77

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             AP+K KRPL+AAKDI PFY EH PKIF Q GG FG +     +L GPKYDGKYLH +++ 
Sbjct  78    APNKAKRPLYAAKDITPFYLEHSPKIFHQTGGPFGGVINLTKMLNGPKYDGKYLHTLIKG  137

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
              LG TRLH TLT VVIPTFDIK  QP++F++ E +  P  D +L+DICI +SAAPT+ PA
Sbjct  138   LLGGTRLHDTLTAVVIPTFDIKELQPVIFSSYETKSKPVSDAELADICISTSAAPTFLPA  197

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             H F+ +D + N  EFNLIDGGV ANNPTL+AI  VT+++  K + D     PM+  RF V
Sbjct  198   HSFKTKDAQNNEHEFNLIDGGVAANNPTLIAIGEVTKQVLMKHE-DLFPIKPMEYGRFLV  256

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +SLGTG++K   KY AKMAA WG++ WLTH +  P+I+ F+ AS+DMVD+H   +F +L 
Sbjct  257   ISLGTGNAKNEGKYNAKMAAKWGLLSWLTHDNSTPIIEAFNQASADMVDYHNFVVFKALQ  316

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + D YLRIQ D+L G++ASVD+ T+ENL+ L +VG+ LL K  SK++L  G Y+  +  G
Sbjct  317   SDDQYLRIQDDTLTGNLASVDIATKENLEGLVKVGERLLDKPASKINLDKGVYEAVENGG  376

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TN+EAL+RFAK LS+ RK R
Sbjct  377   TNKEALRRFAKTLSDERKFR  396



>gb|KFK32501.1| hypothetical protein AALP_AA6G250900, partial [Arabis alpina]
Length=384

 Score =   409 bits (1052),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 213/372 (57%), Positives = 268/372 (72%), Gaps = 2/372 (1%)
 Frame = +2

Query  95    DGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAPDKNKRP  274
             DGGGIRGIIPA ILAFLE++LQ+LDG++ R+ DYFDV+AGTSTGGLVTAMLTAP+K  RP
Sbjct  1     DGGGIRGIIPAAILAFLESELQKLDGEEARLADYFDVMAGTSTGGLVTAMLTAPNKEGRP  60

Query  275   LFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERLGDTRLH  454
             LFAA DI  FY EH PKIFPQ    F + K  +  L GPKYDG+YLH+++ + LGDTRLH
Sbjct  61    LFAASDIKDFYLEHCPKIFPQDHFPFSAAKTLVKSLTGPKYDGEYLHQLIHDLLGDTRLH  120

Query  455   QTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHYFENRDG  634
             QTLT VVIPTFDIK+ QP +F++ E + +P  +  L+DI I +SAAPTY PAH+F+  D 
Sbjct  121   QTLTNVVIPTFDIKHLQPTIFSSYEVKKNPLKNATLADIAISTSAAPTYLPAHFFKTEDS  180

Query  635   KGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLSLGTGSS  814
              GN  EFNLIDGGV ANNP LVAI  VT+ + R    DF    P D  RF VLSLGTG+ 
Sbjct  181   AGNVKEFNLIDGGVAANNPALVAIGEVTREITRGSS-DFFPIKPNDYGRFLVLSLGTGTP  239

Query  815   KYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAGDNYLRI  994
             K  +K+ AK  A WG++ WLTH +  PLID F  ASSDMVDFH++ +F +L +  NY+RI
Sbjct  240   KAEEKFDAKEVAGWGMLSWLTHDNSTPLIDAFMQASSDMVDFHLSAVFQALHSEANYIRI  299

Query  995   QVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTNEEALKR  1174
             Q D+L GD ASVD++T ENL  L + G  LL K VS+++L +G  + +    TNE+AL +
Sbjct  300   QDDTLSGDAASVDISTVENLDVLAKTGDELLNKPVSRVNLESGCNE-NAYEVTNEKALIK  358

Query  1175  FAKVLSENRKNR  1210
              A +LS+ +K R
Sbjct  359   LAGILSKEKKIR  370



>gb|EAZ07347.1| hypothetical protein OsI_29596 [Oryza sativa Indica Group]
Length=426

 Score =   411 bits (1056),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 214/395 (54%), Positives = 273/395 (69%), Gaps = 4/395 (1%)
 Frame = +2

Query  47    MASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTG  226
             M+S  +    +T+LSIDGGG+RGIIP TILA LE +LQELDG   RI DYFDVIAGTSTG
Sbjct  35    MSSPPSYGSIVTVLSIDGGGVRGIIPGTILASLEEKLQELDGADARIADYFDVIAGTSTG  94

Query  227   GLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGK  406
             GLVTAMLTAP+   RPLFAAKDI  FY EH PKIFP        +   +A   GPKYDGK
Sbjct  95    GLVTAMLTAPNDQGRPLFAAKDINNFYLEHCPKIFPPRSIPMVGLFQSMA---GPKYDGK  151

Query  407   YLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSS  586
             YLH VV+  LGD R+++T+T VVIPTFDIK  QP+ F+  +A++    +  LSD+CI +S
Sbjct  152   YLHSVVQSLLGDKRVNETITNVVIPTFDIKLLQPITFSRYDAQNDVSKNALLSDVCISTS  211

Query  587   AAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNP  766
             AAPTY P H FE  D  G   EFNL+DGGV ANNPTL+A++ V++++   +  DF    P
Sbjct  212   AAPTYLPGHRFETTDKDGKPREFNLVDGGVAANNPTLLAMTHVSKQILLGNQ-DFFPIKP  270

Query  767   MDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHI  946
              D  +F +LSLGTG++K  +KY A  +  WG+I W+ H   +PL+D FS AS+D+VD H 
Sbjct  271   ADYGKFMILSLGTGTAKIEEKYDAVQSGKWGMINWVYHDGSSPLMDSFSQASADLVDIHA  330

Query  947   ATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQ  1126
             + +F +L    +YLRIQ D L GD ASVDV+T ENL +L EVG+ LL K   K++L TG+
Sbjct  331   SVLFQALRCEKSYLRIQDDELTGDTASVDVSTPENLNRLVEVGKALLNKRACKVNLETGK  390

Query  1127  YKPDDARGTNEEALKRFAKVLSENRKNRLKNEAKL  1231
              +PD  R TNEE L+ FAK+LS+ RK RL+ +A  
Sbjct  391   NEPDMDRKTNEEELENFAKMLSDERKARLQKKASF  425



>ref|XP_002282597.1| PREDICTED: patatin-like protein 2 isoform X1 [Vitis vinifera]
 emb|CBI19546.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   410 bits (1055),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 227/381 (60%), Positives = 279/381 (73%), Gaps = 4/381 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRGIIP T+L FLE++LQ+LDG+  RI DYFDVIAGTSTGGLVTAMLT 
Sbjct  17    LITILSIDGGGIRGIIPGTVLGFLESELQKLDGEDARISDYFDVIAGTSTGGLVTAMLTT  76

Query  254   PDKNK-RPLFAAKDILPFYKEHGPKIFPQggg-lfgsikggLALLEGPKYDGKYLHKVVE  427
             P++N  RPLF+AKDI  FY EHGPKIFPQ        +   +  L GPKYDGKYLH +V+
Sbjct  77    PNENTGRPLFSAKDIKDFYLEHGPKIFPQHSHDPIPRVTKVVTALSGPKYDGKYLHNLVK  136

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+TRLHQTLT VVIPTFDIK  QP +F+  + +  P LD  LSDICIG+SAAPTY P
Sbjct  137   EKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPCLDALLSDICIGTSAAPTYLP  196

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYFE +D  G   EFNLIDGGV ANNPTLVAI  VT+ + R   PDF    PMD  RF 
Sbjct  197   AHYFETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEIIR-GSPDFFPIKPMDYGRFL  255

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGSSK  +KY A  AA WG++GWLT     PL+ VF+ AS+DMVD H++  F +L
Sbjct  256   VISLGTGSSKAEEKYNADEAAKWGLLGWLTSGGSTPLVQVFTQASADMVDLHLSEAFQAL  315

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              +  +YLRIQ D+L G  +SVD+ T+ENL  L ++G+ LLKK VS+++L TG ++P +  
Sbjct  316   HSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEPSNHE  375

Query  1148  GTNEEALKRFAKVLSENRKNR  1210
              TNEEAL  F ++LS+ ++ R
Sbjct  376   -TNEEALTSFTRLLSQEKQRR  395



>ref|XP_006374973.1| hypothetical protein POPTR_0014s03250g [Populus trichocarpa]
 gb|ERP52770.1| hypothetical protein POPTR_0014s03250g [Populus trichocarpa]
Length=414

 Score =   410 bits (1055),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 226/378 (60%), Positives = 285/378 (75%), Gaps = 2/378 (1%)
 Frame = +2

Query  77    ITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTAP  256
             IT+LSIDGGGIRGIIP TILAFLE++LQ+LDG   R+ DYFDVI+GTSTGGLVTAML AP
Sbjct  26    ITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGGLVTAMLAAP  85

Query  257   DKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEERL  436
             ++  RPLF+AKDI  FY E+ PKIF Q G    S    +  L GP YDGK+LH +V+E+L
Sbjct  86    NEQNRPLFSAKDINDFYLENCPKIFHQDGCPLASAGKLIKSLRGPTYDGKFLHSIVKEKL  145

Query  437   GDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAHY  616
             GD RLHQT+T +VIPTFDIK  QP +F++ + ++ P  D  LSDICIG+SAAPTY PAHY
Sbjct  146   GDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSTDALLSDICIGTSAAPTYLPAHY  205

Query  617   FENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVLS  796
             FE +D  G   EFNLIDGGV ANNPTLVA+S V++ + RK +PDF  T PMD  RF VLS
Sbjct  206   FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRK-NPDFFPTAPMDYGRFLVLS  264

Query  797   LGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDAG  976
             LGTGS+K  +KY A  AA WG++GWLT  +  PL+DVF++AS DM+D HI+T+F +L   
Sbjct  265   LGTGSAKCEEKYDADEAAKWGVLGWLTSENSTPLVDVFTEASGDMIDLHISTVFQALHCE  324

Query  977   DNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGTN  1156
             +NY+RIQ D+L G ++SVD+ T+ENL+ L +VG+ LLKK VS++DL TG + P D + TN
Sbjct  325   ENYIRIQDDTLTGTLSSVDIATKENLENLVKVGEKLLKKPVSRVDLGTGIFTPVD-KMTN  383

Query  1157  EEALKRFAKVLSENRKNR  1210
             EEAL + AK+LS  +  R
Sbjct  384   EEALIKMAKLLSREKHLR  401



>ref|XP_007047189.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOX91346.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=393

 Score =   409 bits (1052),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 213/392 (54%), Positives = 271/392 (69%), Gaps = 4/392 (1%)
 Frame = +2

Query  47    MASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTG  226
             MAS     K +T+LSIDGGG+RGIIP T+L+FLE++L ELDG   RI DYFD+IAGTSTG
Sbjct  1     MASRFAKGKMVTVLSIDGGGVRGIIPGTLLSFLESKLHELDGANARIADYFDIIAGTSTG  60

Query  227   GLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQgggl---fgsikggLALLEGPKY  397
             GL+  MLTAP+K  RP++AAKDI  FY EH PKIFPQ   L           A   GPKY
Sbjct  61    GLIATMLTAPNKQNRPMYAAKDINNFYLEHCPKIFPQNSRLNFLASMASFFRATSMGPKY  120

Query  398   DGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICI  577
             DGKYL  +  + L D  L QTLT VVIP FDIK  QP++F+  +A+     + +L+D+C+
Sbjct  121   DGKYLRSLTNQLLEDITLKQTLTNVVIPAFDIKLLQPVIFSTDDAKADALKNARLADVCV  180

Query  578   GSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAG  757
             G+SAAPT+ PAHYFE ++  G T  F+LIDGGV ANNPT++AI+  ++ +  K   +F  
Sbjct  181   GTSAAPTFLPAHYFETKNADGKTRTFDLIDGGVAANNPTMLAINHFSKEIL-KHGTEFVE  239

Query  758   TNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVD  937
               PMD +R  VLSLGTG +K+ +KY+A  A+ WG+I WL      PL+DVF DASSD+VD
Sbjct  240   IEPMDSRRMLVLSLGTGEAKHEEKYSAAAASKWGMIDWLYEKGKTPLLDVFWDASSDIVD  299

Query  938   FHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldll  1117
             FH +T F  L++ DNYLRIQ D+  GD ASVD+ TEENLKKL  +G  LLKK VS+++L 
Sbjct  300   FHTSTQFQCLNSKDNYLRIQDDTFTGDAASVDIATEENLKKLIGIGTELLKKRVSRVNLE  359

Query  1118  TGQYKPDDARGTNEEALKRFAKVLSENRKNRL  1213
             TG+++  +   TNE AL  FAK LSE RK RL
Sbjct  360   TGKFEEVEGEPTNEVALANFAKKLSEERKLRL  391



>ref|XP_008813724.1| PREDICTED: patatin-like protein 2 isoform X1 [Phoenix dactylifera]
Length=410

 Score =   410 bits (1053),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 223/395 (56%), Positives = 289/395 (73%), Gaps = 2/395 (1%)
 Frame = +2

Query  29    SQSSFEMASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVI  208
             S+S+  +         ITILSIDGGGIRGIIPA IL+FLE +LQ+LDG+  RI DYFDVI
Sbjct  4     SKSNINLIQAPTYGNLITILSIDGGGIRGIIPAVILSFLELELQKLDGEDARIADYFDVI  63

Query  209   AGTSTGGLVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEG  388
             AGTSTGGLVTAMLTAPD++ RPLFAAKDI  FY    PKIFPQ GG+   I   +  L G
Sbjct  64    AGTSTGGLVTAMLTAPDEDNRPLFAAKDIESFYLAESPKIFPQYGGILAPITRMVRALWG  123

Query  389   PKYDGKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSD  568
             P+Y+GKYLHK++ E LG  RLHQTLT VVIPTFDIK   P +F++ E +    L+ +LSD
Sbjct  124   PRYNGKYLHKLIRENLGSMRLHQTLTNVVIPTFDIKRLHPTIFSSYEVKRKSILNAQLSD  183

Query  569   ICIGSSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPD  748
             ICIG++AAPTY PAHYFE +D KGN  EF+LIDGGV ANNP L+AI  VT+ +  K +PD
Sbjct  184   ICIGTTAAPTYLPAHYFETKDAKGNVREFHLIDGGVAANNPALIAIREVTKEV-HKGNPD  242

Query  749   FAGTNPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSD  928
             +    PMD ++  ++SLGTGS+K  ++YTAK A+ WG++GWL      PL+DVF  +S+D
Sbjct  243   YFPYRPMDYRKLLLISLGTGSAKVEERYTAKRASKWGVLGWLLSGGSTPLVDVFMQSSAD  302

Query  929   MVDFHIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskl  1108
             MVD HI+ +F +L +  NYLRI+ D+L G V+SVDV+T++NL+ L + G+ LLKK VS++
Sbjct  303   MVDIHISVVFQALRSESNYLRIEDDTLNGTVSSVDVSTKDNLQDLVKRGEQLLKKPVSRV  362

Query  1109  dllTGQYKP-DDARGTNEEALKRFAKVLSENRKNR  1210
             +L TG ++   +  GTN++AL+RFAK+LS  R  R
Sbjct  363   NLETGVFETVGNGEGTNKDALRRFAKLLSHERGLR  397



>emb|CAN80453.1| hypothetical protein VITISV_028107 [Vitis vinifera]
Length=390

 Score =   409 bits (1051),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 214/379 (56%), Positives = 265/379 (70%), Gaps = 27/379 (7%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              ITILSIDGGGIRG+IP T+L FLE++LQ+LDG+ VRI DYFDVIAGTSTGGLVTAMLT 
Sbjct  17    LITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDVRISDYFDVIAGTSTGGLVTAMLTT  76

Query  254   PDKNK-RPLFAAKDILPFYKEHGPKIFPQggg-lfgsikggLALLEGPKYDGKYLHKVVE  427
             P++N  RPLF+AKDI  FY +H PKIFPQ        +   +  L GPKYDGKYLH +V+
Sbjct  77    PNENTGRPLFSAKDIKDFYLDHCPKIFPQHSHDPIPHVTKVVTALSGPKYDGKYLHNLVK  136

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
             E+LG+TRLHQTLT VVIPTFDIK  QP +F+  + +  P LD  LSDICIG+SAAPTY P
Sbjct  137   EKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDICIGTSAAPTYLP  196

Query  608   AHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFR  787
             AHYFE +D  G   EFNLIDGGV ANNP                        PMD  RF 
Sbjct  197   AHYFETKDPAGRVREFNLIDGGVAANNP------------------------PMDYGRFL  232

Query  788   VLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSL  967
             V+SLGTGSSK  +KY A  AA WG++GWLT     PL+ VF+ AS DM+D H++ IF +L
Sbjct  233   VISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQASGDMIDLHLSEIFQAL  292

Query  968   DAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDAR  1147
              +  +YLRIQ D+L G  +SVD+ T+ENL  L  +G+ LLKK VS+++L TG ++P +  
Sbjct  293   HSEKSYLRIQDDTLSGITSSVDIATKENLDDLVRIGEELLKKRVSRVNLDTGIFEPSNHE  352

Query  1148  GTNEEALKRFAKVLSENRK  1204
              TNEEAL  FA++LS+ ++
Sbjct  353   -TNEEALTSFARLLSQEKQ  370



>ref|XP_011017228.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
 ref|XP_011017229.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
Length=405

 Score =   409 bits (1051),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 225/379 (59%), Positives = 284/379 (75%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +T+LSIDGGGIRGIIP TILAFLE++LQ+LDG+  R+ DYFDVI+GTSTGGLVTAMLTA
Sbjct  16    LVTVLSIDGGGIRGIIPGTILAFLESELQKLDGEDARLADYFDVISGTSTGGLVTAMLTA  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P++  RPLFAAKDI  FY ++ PKIF Q G  F +    +    GPKYDGKYLH +V+E+
Sbjct  76    PNEQNRPLFAAKDINDFYLKNSPKIFHQDGSPFAAAGKLIKAFSGPKYDGKYLHSIVKEK  135

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             L D RLHQTLT VVIPTFDIK  QP +F++ + ++ P  D  LSDICIG+SAAPTY PAH
Sbjct  136   LRDKRLHQTLTNVVIPTFDIKYLQPTIFSSYQVKNDPSTDALLSDICIGTSAAPTYLPAH  195

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             YFE +D +G    FNL+DGGV ANNPTLVAI  V++ + R D PDF    P D  R+ VL
Sbjct  196   YFETKDSEGKVRAFNLVDGGVAANNPTLVAIGEVSKEINR-DSPDFFPMKPTDYGRYLVL  254

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTG++K  +KY A  AA WG++GWLT  +  PL+DVF+ ASSDMVD H+AT+F +L +
Sbjct  255   SLGTGTAKTEEKYDANKAAKWGVLGWLTSDNSTPLVDVFTQASSDMVDLHLATVFQALRS  314

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NYLRIQ D+L G +ASVD+ T+ENL+ L +VG+ LLKK VS ++L TG ++P + R T
Sbjct  315   EKNYLRIQDDTLTGTLASVDIATKENLENLVKVGEGLLKKPVSSVNLDTGVFEPAN-RLT  373

Query  1154  NEEALKRFAKVLSENRKNR  1210
             NEEAL +FA+ LS  ++ R
Sbjct  374   NEEALIKFAERLSHQKQLR  392



>ref|XP_010320535.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=380

 Score =   408 bits (1049),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 214/383 (56%), Positives = 271/383 (71%), Gaps = 31/383 (8%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             KFITILSIDGGGIRG+IPATIL +LE+QLQELDGK  R+ DYFD+I GTSTGGLVTAMLT
Sbjct  16    KFITILSIDGGGIRGLIPATILEYLESQLQELDGKDARLADYFDIITGTSTGGLVTAMLT  75

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             AP+K  RPLFAAKDI PFY EHGP IFPQ                    DG+        
Sbjct  76    APNKENRPLFAAKDIKPFYLEHGPNIFPQN-----------------NMDGR--------  110

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
                +T+LH+TLT VVIPTFDIKN QP +F+  EA+    ++ KLSDICIG+SAAPTY PA
Sbjct  111   ---ETKLHETLTNVVIPTFDIKNMQPTIFSTFEAKKHSIMNAKLSDICIGTSAAPTYLPA  167

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDD--PDFAGTNPMDCQRF  784
             H F+ ++  G   EFNLIDG + ANNPTL+AI+  T+++  +     +F    P +  +F
Sbjct  168   HNFQTQNEDGKFHEFNLIDGAIAANNPTLIAINEATKQIFEQTPYFKNFKEMKPTNYGKF  227

Query  785   RVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHS  964
              VLS+GTGS+K   KY AK+A+NWGI GWLT    NP+ID F+DAS DMVD+HI+ +F S
Sbjct  228   LVLSIGTGSAKLEHKYDAKIASNWGIFGWLTGGGSNPIIDAFADASDDMVDYHISVVFQS  287

Query  965   LDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKP-DD  1141
             + +  +YLRIQ D+L G  ++VD++T+EN+ KL E+G NLLKK VS+++L TG ++  + 
Sbjct  288   VHSQKHYLRIQDDTLSGADSTVDISTKENMNKLVEIGTNLLKKPVSRVNLQTGLFEQLNK  347

Query  1142  ARGTNEEALKRFAKVLSENRKNR  1210
               GTNEEALK FAK+LSE +K R
Sbjct  348   DGGTNEEALKEFAKLLSEEKKIR  370



>ref|XP_006354910.1| PREDICTED: LOW QUALITY PROTEIN: patatin group M-3-like [Solanum 
tuberosum]
Length=405

 Score =   409 bits (1051),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 220/380 (58%), Positives = 277/380 (73%), Gaps = 3/380 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
             FIT+LSIDGGGIRGIIPATIL+FLE+QLQE DGK  R+ +YFDVIAGTSTGGLVTAMLTA
Sbjct  16    FITVLSIDGGGIRGIIPATILSFLESQLQEFDGKDARLAEYFDVIAGTSTGGLVTAMLTA  75

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLA-LLEGPKYDGKYLHKVVEE  430
             PD+N RP +AAKDI PFY EH PKIFPQ      +    +   L GPKYDGKYLH+V++E
Sbjct  76    PDENNRPFYAAKDITPFYLEHCPKIFPQNKCGLFASMRKMVQALIGPKYDGKYLHEVIKE  135

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +L D+ L  T+T VVIPTFDIK  QP +F+  E + S + D KLSDICI +SAAPTY PA
Sbjct  136   KLKDSLLSNTITNVVIPTFDIKKLQPTIFSTYETKRSARYDAKLSDICISTSAAPTYLPA  195

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRV  790
             HYF+  D KGN  E NLIDGGV ANNP L+AIS V++ +  K++PDF    PMD  RF V
Sbjct  196   HYFKVEDDKGNIIEHNLIDGGVAANNPCLIAISEVSKEIL-KENPDFFPIKPMDYGRFLV  254

Query  791   LSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLD  970
             +S+GTG+ K  Q+Y + MAA WGI+ WL H    PL +VF+ +S+DM+D+H + +F +L 
Sbjct  255   ISIGTGAPKLEQEYNSSMAAKWGIVDWLFHKGCTPLFEVFTQSSADMIDYHNSVVFQALH  314

Query  971   AGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARG  1150
             + D+YLRIQ D L G  A      +ENL++L E+G+ LL K +S+++L TG  +P    G
Sbjct  315   SEDSYLRIQEDGLSGTEAQXGCGYKENLERLVEIGEKLLXKPLSRVNLETG-LEPIPKGG  373

Query  1151  TNEEALKRFAKVLSENRKNR  1210
             TNEEALKRFAK+L + R+ R
Sbjct  374   TNEEALKRFAKLLVDERRLR  393



>gb|AFJ92643.2| phospholipase A2 [Eschscholzia californica]
Length=411

 Score =   409 bits (1051),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 204/391 (52%), Positives = 274/391 (70%), Gaps = 4/391 (1%)
 Frame = +2

Query  50    ASNNNSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGG  229
             +S N   + +T+LSIDGGG+RG+IP  +L+FLE++LQELDG+++R+ DYFDV+AGTSTGG
Sbjct  9     SSGNGKGELVTVLSIDGGGVRGLIPGVVLSFLESKLQELDGEEMRLADYFDVVAGTSTGG  68

Query  230   LVTAMLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALL---EGPKYD  400
             L++ M+TAP  N RP +AAKD++ FY +H P IFP+     G     L  +    GPKY+
Sbjct  69    LLSTMITAPGANGRPYYAAKDLVQFYLDHCPNIFPKRSSCLGLFDSCLNFVGTATGPKYN  128

Query  401   GKYLHKVVEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIG  580
             GKYLH +++  L DTR+ +TLT +VIPTFDI++ QP++F+  EA+     D  LSDICIG
Sbjct  129   GKYLHSLLQRSLKDTRISETLTTLVIPTFDIRHLQPIIFSTHEAKRDESKDALLSDICIG  188

Query  581   SSAAPTYFPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGT  760
             +SAAPT+ PAHYFE  D KGN   FNLIDGGV ANNPTLVA+S V + +   D+  F   
Sbjct  189   TSAAPTFLPAHYFETEDSKGNVRHFNLIDGGVAANNPTLVAVSQVAKEVL-VDNETFGHG  247

Query  761   NPMDCQRFRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDF  940
                   ++ ++SLGTG++K   KY A  A  WGI GWL H    PL+DVF+ AS DMVD 
Sbjct  248   KVTGKTKYLIISLGTGTAKTENKYCAMKARKWGIFGWLYHETNMPLVDVFTQASGDMVDI  307

Query  941   HIATIFHSLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllT  1120
             H + +F +     NYLRI+ D LEG+ ASVDVTT E+++ L E+G+ LL+K +S+++L T
Sbjct  308   HASVLFQTHRTEQNYLRIEADDLEGNTASVDVTTIEDMRDLIEIGEGLLEKPMSRVNLET  367

Query  1121  GQYKPDDARGTNEEALKRFAKVLSENRKNRL  1213
             G Y+  D  GTN+EAL RFAK+LS+ RK RL
Sbjct  368   GTYEKVDGEGTNKEALTRFAKLLSDERKLRL  398



>gb|EMT13605.1| Patatin group A-3 [Aegilops tauschii]
Length=397

 Score =   408 bits (1049),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 210/386 (54%), Positives = 273/386 (71%), Gaps = 4/386 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             + IT+LSIDGGGIRG+IP+TILA LE++LQELDG   RI DYFDVIAGTSTG LVT+ML 
Sbjct  10    RLITVLSIDGGGIRGLIPSTILACLESKLQELDGPDARIADYFDVIAGTSTGALVTSMLA  69

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQgggl-fgsikggLALLEGPKYDGKYLHKVVE  427
             AP +NKRPLFAAKDI  FY ++GPKIFPQ        +   L  + GPKYDGK+LH  ++
Sbjct  70    APGENKRPLFAAKDINQFYLDNGPKIFPQRRWGFLTPVANLLGAVMGPKYDGKFLHDKIK  129

Query  428   ERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFP  607
                 D  +  T+T +V+PTFDIK  QP++F   EA+  P  +  LSDICI +SAAPTYFP
Sbjct  130   NLTNDVTVADTVTNIVVPTFDIKYLQPVIFNTYEAKVDPLKNAHLSDICISTSAAPTYFP  189

Query  608   AHYFENRD--GKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQR  781
             AH+F   D  GK    E++L+DGGV ANNPT+VA+S +TQ + R++ PDF    P +   
Sbjct  190   AHHFTTHDPLGKLPDREYHLVDGGVAANNPTMVAMSMITQEVMRRN-PDFTHGKPAEYSN  248

Query  782   FRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFH  961
             + ++S+GTG++K ++KYTA   A WG++ WL      PL+D+FS AS+DMVD H A +F 
Sbjct  249   YLIISIGTGTAKQAEKYTAPDCAKWGVLRWLKDGRFTPLLDIFSHASADMVDIHAAVLFQ  308

Query  962   SLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDD  1141
             SL    NYLRIQ DSL G  +SVD++T+EN++ L E+G  LLK SV+++++ TG Y+P D
Sbjct  309   SLRVEKNYLRIQDDSLTGHTSSVDISTKENMQALIEIGNKLLKMSVARVNIDTGMYEPVD  368

Query  1142  ARGTNEEALKRFAKVLSENRKNRLKN  1219
               GTNEEAL RFAK LS+ RK R  N
Sbjct  369   GEGTNEEALARFAKKLSDERKLRQTN  394



>ref|XP_009792908.1| PREDICTED: patatin-like protein 1 [Nicotiana sylvestris]
Length=406

 Score =   409 bits (1050),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 226/388 (58%), Positives = 292/388 (75%), Gaps = 1/388 (0%)
 Frame = +2

Query  62    NSQKFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTA  241
             N+   ITIL+IDGGGIRGIIP  IL++LE+QLQELDGK  RI DYFD+IAGTSTGGLVTA
Sbjct  16    NTGTLITILTIDGGGIRGIIPGVILSYLESQLQELDGKDARIADYFDLIAGTSTGGLVTA  75

Query  242   MLTAPDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKV  421
             ML AP+K+KRPL+AAKDI PFY EH PKIFPQ GG    I      + GPKYDGKYLHK+
Sbjct  76    MLAAPNKDKRPLYAAKDITPFYLEHSPKIFPQMGGPLAGIINLTKAMGGPKYDGKYLHKL  135

Query  422   VEERLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTY  601
             ++  LG TRLH TLT VVIPTFDIK  QP++F++ EA   P LD +L+DICI +SAAPT+
Sbjct  136   IKGILGGTRLHDTLTAVVIPTFDIKKLQPVIFSSYEAILKPDLDAELADICISTSAAPTF  195

Query  602   FPAHYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQR  781
              PA+ F+N+D + +  EFNLIDGGV ANNPTLVAI  VT+++  +   D     PMD  R
Sbjct  196   LPAYGFKNKDAQDSEREFNLIDGGVAANNPTLVAIGEVTKQVLMQHG-DLFPIKPMDYGR  254

Query  782   FRVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFH  961
             F V+SLGTG++K   K+ A+MAA WG++ WL +++  P+ID F+ AS+DMVD+H   +F 
Sbjct  255   FLVISLGTGNAKNEHKFNAQMAAKWGLLSWLLNNNSTPIIDAFNQASADMVDYHNFVVFK  314

Query  962   SLDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDD  1141
             +L + D YLRIQ D+L G++ASVD+ T+ENL+ L +VG++LL+K VSK++L  G Y+  +
Sbjct  315   ALHSDDKYLRIQDDTLTGNLASVDIATKENLQSLVKVGEHLLEKPVSKINLDKGVYEAVE  374

Query  1142  ARGTNEEALKRFAKVLSENRKNRLKNEA  1225
               GTN+EAL+RFAK+LS+ RK R  N +
Sbjct  375   NGGTNKEALQRFAKILSDERKFRESNAS  402



>ref|XP_010417357.1| PREDICTED: patatin-like protein 2 [Camelina sativa]
Length=407

 Score =   408 bits (1049),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 212/379 (56%), Positives = 271/379 (72%), Gaps = 2/379 (1%)
 Frame = +2

Query  74    FITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLTA  253
              +TILSIDGGGIRG+IPA IL FLE++LQ+LDG+  R+ DYFDV+AGTSTGGLVTAMLTA
Sbjct  18    LVTILSIDGGGIRGLIPAVILGFLESELQKLDGEDARLADYFDVVAGTSTGGLVTAMLTA  77

Query  254   PDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEER  433
             P+K  RPLFAA +I  FY E  PKIFPQ    F + K  +  L GPKYDG+YLH+++  +
Sbjct  78    PNKEGRPLFAASEIKEFYLEQCPKIFPQDHFPFSAAKNLVKSLTGPKYDGEYLHQLIHAK  137

Query  434   LGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPAH  613
             LGDT+L+QTLT VVIPTFDIK+ QP +F++ E +++P  +  L+DI I +SAAPTY PAH
Sbjct  138   LGDTKLNQTLTNVVIPTFDIKHLQPTIFSSYEVKNNPLKNATLADIAISTSAAPTYLPAH  197

Query  614   YFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQRMARKDDPDFAGTNPMDCQRFRVL  793
             +F   D  GN  E+NLIDGGV ANNP LVAI  VT  + R    DF    P D  RF VL
Sbjct  198   FFRTEDSTGNVKEYNLIDGGVAANNPALVAIGEVTNEITRGSS-DFFPIRPNDYGRFLVL  256

Query  794   SLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHSLDA  973
             SLGTGS K  +K+ AK  A WG++ WLTH +  PLID F+ ASSDMVDFH++ +F +L +
Sbjct  257   SLGTGSHKCEEKFNAKEVAGWGLLSWLTHDNSTPLIDAFTQASSDMVDFHLSAVFRALHS  316

Query  974   GDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDARGT  1153
               NY+RIQ D+L GD ASVD+ T ENL  L + G+ LLKK VS+++L +G  + +  + T
Sbjct  317   EPNYIRIQDDTLNGDAASVDIATVENLDILAKTGEELLKKPVSRVNLDSGSNE-NAYQTT  375

Query  1154  NEEALKRFAKVLSENRKNR  1210
             N  AL + A +LS+ +K R
Sbjct  376   NGMALIKLAGILSKEKKIR  394



>sp|Q6ZJD3.1|PLP2_ORYSJ RecName: Full=Patatin-like protein 2; Short=OsPLP2 [Oryza sativa 
Japonica Group]
 sp|A2YW91.1|PLP2_ORYSI RecName: Full=Patatin-like protein 2 [Oryza sativa Indica Group]
 dbj|BAD08998.1| putative patatin [Oryza sativa Japonica Group]
 gb|EAZ07352.1| hypothetical protein OsI_29602 [Oryza sativa Indica Group]
 gb|EAZ43081.1| hypothetical protein OsJ_27671 [Oryza sativa Japonica Group]
Length=405

 Score =   408 bits (1048),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 212/386 (55%), Positives = 271/386 (70%), Gaps = 4/386 (1%)
 Frame = +2

Query  71    KFITILSIDGGGIRGIIPATILAFLEAQLQELDGKKVRICDYFDVIAGTSTGGLVTAMLT  250
             K +T+LSIDGGG+RGIIPATILAFLE +LQ+LDG   RI DYFDV+AGTSTGGL+TAMLT
Sbjct  19    KMVTVLSIDGGGVRGIIPATILAFLEKELQKLDGPDARIADYFDVVAGTSTGGLLTAMLT  78

Query  251   APDKNKRPLFAAKDILPFYKEHGPKIFPQggglfgsikggLALLEGPKYDGKYLHKVVEE  430
             AP++N RPLFAA ++  FY EH P IFPQ   +   I G L ++ GPKYDGKYLH ++ E
Sbjct  79    APNENNRPLFAADELAKFYIEHSPSIFPQKNWVLSKIAGTLRMVSGPKYDGKYLHSLLRE  138

Query  431   RLGDTRLHQTLTRVVIPTFDIKNFQPLVFTNCEAEDSPQLDVKLSDICIGSSAAPTYFPA  610
             +LGDTRL + LT VVIPTFDI N QP +F+  E +  P  +  LSDI I +SAAPT+FPA
Sbjct  139   KLGDTRLDKALTNVVIPTFDIANLQPTIFSKFELKYKPLKNALLSDISISTSAAPTFFPA  198

Query  611   HYFENRDGKGNTFEFNLIDGGVCANNPTLVAISTVTQR--MARKDDPDFAGTNPMDCQRF  784
             HYFE +D  G T EFNL+DGGV ANNPTL A+S V++   +  K+D DF    P +  +F
Sbjct  199   HYFETKDDNGQTREFNLVDGGVAANNPTLCAMSQVSKYIILEDKEDCDFFPVKPTEYGKF  258

Query  785   RVLSLGTGSSKYSQKYTAKMAANWGIIGWLTHSDGNPLIDVFSDASSDMVDFHIATIFHS  964
              V+S+G GS+ + QKY AK AA WGI  WL      P+ID+F+ AS+DMVD H+  +F +
Sbjct  259   MVISIGCGSN-HDQKYKAKDAAKWGIFNWLIKGSSAPIIDMFTSASADMVDIHLGVLFSA  317

Query  965   LDAGDNYLRIQVDSLEGDVASVDVTTEENLKKLEEVGQNllkksvskldllTGQYKPDDA  1144
             L    NYLRIQ D L G   S+D  ++EN+  L ++G+ LL K+VS++DL TG Y     
Sbjct  318   LQCEKNYLRIQYDQLTGSAGSIDDCSKENMDNLVKIGEMLLDKNVSRVDLETGHYVDVAG  377

Query  1145  RGTNEEALKRFAKVLSENRKNRLKNE  1222
              GTN + L +FAK LS+ R+ R +NE
Sbjct  378   EGTNRDQLAKFAKQLSDERRRR-QNE  402



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5289568806203