BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85236_g1_i1 len=832 path=[810:0-831]

Length=832
                                                                      Score     E

ref|XP_009593962.1|  PREDICTED: beta-mannosyltransferase 3-like         102   3e-23   
ref|XP_009781683.1|  PREDICTED: actin-binding protein F-like            101   1e-22   
ref|XP_004244019.2|  PREDICTED: uncharacterized protein LOC101268886    105   5e-22   
ref|XP_009632025.1|  PREDICTED: uncharacterized protein LOC104121679  97.8    1e-21   
ref|XP_009786340.1|  PREDICTED: uncharacterized protein LOC104234474  97.1    2e-21   
ref|XP_006346244.1|  PREDICTED: uncharacterized protein LOC102592214  95.5    2e-20   
ref|XP_010313956.1|  PREDICTED: uncharacterized protein LOC104644861  92.4    2e-19   
ref|XP_006344908.1|  PREDICTED: uncharacterized protein LOC102601467  90.5    1e-18   
ref|XP_010644661.1|  PREDICTED: uncharacterized protein LOC100264...  74.3    2e-13   
ref|XP_010644663.1|  PREDICTED: uncharacterized protein LOC100853541  73.6    5e-13   
ref|XP_010644659.1|  PREDICTED: uncharacterized protein LOC100257...  71.6    2e-12   
ref|XP_007206533.1|  hypothetical protein PRUPE_ppa019605mg           70.1    9e-12   
ref|XP_010064973.1|  PREDICTED: uncharacterized protein LOC104452160  68.9    2e-11   
ref|XP_007206993.1|  hypothetical protein PRUPE_ppb021408mg           68.9    3e-11   
ref|XP_009339282.1|  PREDICTED: uncharacterized protein LOC103931496  67.4    7e-11   
ref|XP_007208514.1|  hypothetical protein PRUPE_ppa026247mg           67.4    8e-11   
ref|XP_011095605.1|  PREDICTED: uncharacterized protein LOC105175...  67.0    1e-10   
ref|XP_011095818.1|  PREDICTED: uncharacterized protein LOC105175168  67.0    1e-10   
ref|XP_011095815.1|  PREDICTED: uncharacterized protein LOC105175165  67.0    1e-10   
ref|XP_009339286.1|  PREDICTED: uncharacterized protein LOC103931499  66.6    2e-10   
ref|XP_007204171.1|  hypothetical protein PRUPE_ppa017127mg           66.2    2e-10   
ref|XP_010253026.1|  PREDICTED: glutelin type-A 1-like                69.7    3e-10   
ref|XP_007212494.1|  hypothetical protein PRUPE_ppa017532mg           65.1    3e-10   
ref|XP_008218443.1|  PREDICTED: uncharacterized protein LOC103318786  65.9    3e-10   
ref|XP_009415399.1|  PREDICTED: uncharacterized protein LOC103996246  65.9    4e-10   
ref|XP_008219472.1|  PREDICTED: uncharacterized protein LOC103319678  68.9    4e-10   
gb|KCW70441.1|  hypothetical protein EUGRSUZ_F03666                   65.1    4e-10   
ref|XP_010644662.1|  PREDICTED: uncharacterized protein LOC100264...  65.1    6e-10   
ref|XP_008342265.1|  PREDICTED: uncharacterized protein LOC103405072  65.1    6e-10   
ref|XP_008232364.1|  PREDICTED: uncharacterized protein LOC103331...  65.1    7e-10   
ref|XP_002268731.1|  PREDICTED: uncharacterized protein LOC100255094  65.1    7e-10   Vitis vinifera
gb|EYU27493.1|  hypothetical protein MIMGU_mgv1a016643mg              64.7    8e-10   
ref|XP_010928047.1|  PREDICTED: uncharacterized protein LOC105049937  64.7    8e-10   
emb|CBI39835.3|  unnamed protein product                              64.3    1e-09   
ref|XP_007207854.1|  hypothetical protein PRUPE_ppa022793mg           64.3    1e-09   
gb|EYU21092.1|  hypothetical protein MIMGU_mgv1a023329mg              63.5    2e-09   
ref|XP_008380030.1|  PREDICTED: uncharacterized protein LOC103443026  63.9    2e-09   
ref|XP_010928046.1|  PREDICTED: uncharacterized protein LOC105049936  63.2    3e-09   
ref|XP_004293421.1|  PREDICTED: uncharacterized protein LOC101306992  62.4    3e-09   
emb|CBI39830.3|  unnamed protein product                              63.2    3e-09   
ref|XP_011039897.1|  PREDICTED: uncharacterized protein LOC105136306  62.4    4e-09   
ref|XP_008232363.1|  PREDICTED: uncharacterized protein LOC103331...  62.8    6e-09   
ref|XP_011095606.1|  PREDICTED: uncharacterized protein LOC105175...  62.0    6e-09   
gb|ABK96536.1|  unknown                                               62.0    8e-09   Populus trichocarpa x Populus deltoides
ref|XP_002299059.1|  hypothetical protein POPTR_0001s47250g           62.0    8e-09   Populus trichocarpa [western balsam poplar]
ref|XP_011091871.1|  PREDICTED: uncharacterized protein LOC105172...  61.6    1e-08   
ref|XP_007020387.1|  Heavy metal transport/detoxification superfa...  61.6    1e-08   
gb|EMS57369.1|  hypothetical protein TRIUR3_01188                     61.2    1e-08   
gb|EMT17917.1|  hypothetical protein F775_02489                       61.6    1e-08   
ref|XP_008344728.1|  PREDICTED: uncharacterized protein LOC103407605  62.0    1e-08   
ref|XP_009361504.1|  PREDICTED: uncharacterized protein LOC103951779  61.2    1e-08   
ref|XP_007020384.1|  Copper transport protein family, putative is...  61.2    2e-08   
ref|XP_008218909.1|  PREDICTED: uncharacterized protein LOC103319169  60.8    2e-08   
ref|XP_010026243.1|  PREDICTED: uncharacterized protein LOC104416568  61.2    2e-08   
ref|XP_009391790.1|  PREDICTED: uncharacterized protein LOC103977867  60.8    2e-08   
ref|XP_010942541.1|  PREDICTED: uncharacterized protein LOC105060501  60.5    2e-08   
ref|XP_011091863.1|  PREDICTED: uncharacterized protein LOC105172...  60.5    3e-08   
ref|XP_003620393.1|  hypothetical protein MTR_6g082330                62.4    3e-08   
ref|XP_006375589.1|  hypothetical protein POPTR_0014s16960g           60.5    3e-08   
ref|XP_009145723.1|  PREDICTED: uncharacterized protein LOC103869399  61.2    3e-08   
ref|XP_010251978.1|  PREDICTED: uncharacterized protein LOC104593713  60.8    3e-08   
ref|XP_010260985.1|  PREDICTED: uncharacterized protein LOC104599930  61.6    4e-08   
gb|KDP22993.1|  hypothetical protein JCGZ_01715                       60.5    4e-08   
ref|XP_004294919.1|  PREDICTED: uncharacterized protein LOC101303978  60.1    4e-08   
ref|XP_009419204.1|  PREDICTED: uncharacterized protein LOC103999...  60.1    5e-08   
ref|XP_011032087.1|  PREDICTED: uncharacterized protein LOC105131...  60.1    5e-08   
ref|XP_007206826.1|  hypothetical protein PRUPE_ppa026184mg           59.7    5e-08   
ref|XP_007142458.1|  hypothetical protein PHAVU_008G282300g           59.7    6e-08   
ref|XP_006474799.1|  PREDICTED: uncharacterized protein LOC102607832  59.7    6e-08   
gb|KDP22996.1|  hypothetical protein JCGZ_01718                       59.7    6e-08   
gb|EMS57368.1|  hypothetical protein TRIUR3_01187                     59.7    6e-08   
ref|XP_008218899.1|  PREDICTED: uncharacterized protein LOC103319162  59.7    7e-08   
gb|EMS57367.1|  hypothetical protein TRIUR3_01185                     59.3    7e-08   
ref|XP_006379054.1|  hypothetical protein POPTR_0009s05300g           59.3    7e-08   
ref|XP_010644660.1|  PREDICTED: uncharacterized protein LOC100257...  59.3    7e-08   
ref|XP_006299613.1|  hypothetical protein CARUB_v10015791mg           59.3    8e-08   
ref|XP_008355038.1|  PREDICTED: keratin-associated protein 4-7-like   59.7    1e-07   
gb|EMT17916.1|  hypothetical protein F775_42527                       58.9    1e-07   
ref|XP_011032085.1|  PREDICTED: uncharacterized protein LOC105131026  58.9    1e-07   
ref|XP_008363364.1|  PREDICTED: uncharacterized protein LOC103427075  58.9    1e-07   
ref|XP_006452542.1|  hypothetical protein CICLE_v10010297mg           58.2    1e-07   
ref|XP_004512882.1|  PREDICTED: NF-X1-type zinc finger protein NF...  60.5    1e-07   
gb|KDO62244.1|  hypothetical protein CISIN_1g048525mg                 58.2    1e-07   
ref|XP_011012621.1|  PREDICTED: uncharacterized protein LOC105116833  58.9    1e-07   
ref|XP_002447999.1|  hypothetical protein SORBIDRAFT_06g019500        58.9    1e-07   Sorghum bicolor [broomcorn]
ref|XP_011012623.1|  PREDICTED: uncharacterized protein LOC105116834  58.5    1e-07   
ref|XP_010260987.1|  PREDICTED: uncharacterized protein LOC104599...  58.9    1e-07   
gb|KHN44584.1|  hypothetical protein glysoja_027195                   59.3    2e-07   
ref|XP_010096497.1|  hypothetical protein L484_017949                 57.8    2e-07   
gb|EMT17918.1|  hypothetical protein F775_02490                       59.3    2e-07   
ref|XP_011069516.1|  PREDICTED: uncharacterized protein LOC105155344  57.4    2e-07   
ref|XP_003589925.1|  ATFP4-like protein                               58.2    2e-07   
ref|XP_003594348.1|  hypothetical protein MTR_2g027600                57.4    2e-07   
ref|XP_010260986.1|  PREDICTED: uncharacterized protein LOC104599...  58.5    2e-07   
emb|CDY29800.1|  BnaC05g31900D                                        58.5    2e-07   
emb|CDY25395.1|  BnaA05g18890D                                        58.2    2e-07   
gb|KDP22994.1|  hypothetical protein JCGZ_01716                       58.2    2e-07   
ref|XP_008344748.1|  PREDICTED: uncharacterized protein LOC103407626  57.8    3e-07   
ref|XP_008353240.1|  PREDICTED: uncharacterized protein LOC103416792  57.8    3e-07   
ref|XP_006452704.1|  hypothetical protein CICLE_v10010525mg           58.9    3e-07   
gb|KDP22991.1|  hypothetical protein JCGZ_01713                       57.8    3e-07   
ref|XP_008348826.1|  PREDICTED: uncharacterized protein LOC103411...  57.8    3e-07   
ref|XP_007212970.1|  hypothetical protein PRUPE_ppa021120mg           57.0    3e-07   
ref|XP_004978065.1|  PREDICTED: uncharacterized protein LOC101770792  57.4    3e-07   
ref|XP_002447997.1|  hypothetical protein SORBIDRAFT_06g019480        57.8    3e-07   Sorghum bicolor [broomcorn]
ref|XP_008348827.1|  PREDICTED: uncharacterized protein LOC103411...  57.8    3e-07   
ref|XP_011009814.1|  PREDICTED: uncharacterized protein LOC105114819  57.8    3e-07   
gb|EMT11065.1|  hypothetical protein F775_02341                       57.0    4e-07   
ref|XP_007020579.1|  Heavy metal transport/detoxification superfa...  57.8    5e-07   
ref|XP_003601492.1|  ATFP4                                            58.9    5e-07   
ref|XP_008344729.1|  PREDICTED: uncharacterized protein LOC103407607  57.4    5e-07   
ref|XP_002524589.1|  conserved hypothetical protein                   56.2    5e-07   Ricinus communis
ref|XP_007208673.1|  hypothetical protein PRUPE_ppa023968mg           57.0    5e-07   
ref|XP_004296129.1|  PREDICTED: uncharacterized protein LOC101294055  57.0    5e-07   
ref|XP_002313367.2|  hypothetical protein POPTR_0009s05280g           57.0    5e-07   Populus trichocarpa [western balsam poplar]
gb|EMT17914.1|  hypothetical protein F775_22425                       57.8    6e-07   
dbj|BAD17465.1|  hypothetical protein                                 57.0    6e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006583442.1|  PREDICTED: uncharacterized protein LOC100812612  57.0    6e-07   
gb|KCW58915.1|  hypothetical protein EUGRSUZ_H01538                   57.0    6e-07   
ref|XP_006387353.1|  hypothetical protein POPTR_1183s00200g           57.0    6e-07   
ref|XP_008393331.1|  PREDICTED: uncharacterized protein LOC103455520  57.0    7e-07   
ref|XP_002320539.2|  heavy-metal-associated domain-containing fam...  56.6    8e-07   Populus trichocarpa [western balsam poplar]
ref|XP_008353688.1|  PREDICTED: uncharacterized protein LOC103417272  56.6    8e-07   
ref|NP_188653.1|  putative copper transport protein                   56.2    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008344749.1|  PREDICTED: uncharacterized protein LOC103407627  56.2    1e-06   
ref|XP_002266819.2|  PREDICTED: uncharacterized protein LOC100242530  56.6    1e-06   Vitis vinifera
ref|XP_010251773.1|  PREDICTED: uncharacterized protein LOC104593570  56.2    1e-06   
ref|XP_004952921.1|  PREDICTED: uncharacterized protein LOC101786...  56.2    1e-06   
ref|XP_010466200.1|  PREDICTED: uncharacterized protein LOC104746425  55.8    1e-06   
ref|XP_007049439.1|  Heavy metal transport/detoxification superfa...  55.8    1e-06   
gb|KHN44735.1|  hypothetical protein glysoja_032074                   55.8    2e-06   
ref|XP_004294695.1|  PREDICTED: uncharacterized protein LOC101309518  55.8    2e-06   
ref|XP_011032086.1|  PREDICTED: uncharacterized protein LOC105131...  55.8    2e-06   
emb|CBI28485.3|  unnamed protein product                              57.4    2e-06   
ref|XP_004975911.1|  PREDICTED: uncharacterized protein LOC101766713  56.6    2e-06   
ref|XP_010668394.1|  PREDICTED: serrate RNA effector molecule hom...  56.2    2e-06   
ref|XP_002448002.1|  hypothetical protein SORBIDRAFT_06g019520        55.5    2e-06   Sorghum bicolor [broomcorn]
ref|XP_004952918.1|  PREDICTED: uncharacterized protein LOC101784893  55.8    2e-06   
ref|XP_004978064.1|  PREDICTED: uncharacterized protein LOC101770379  55.5    2e-06   
gb|EMS57370.1|  hypothetical protein TRIUR3_01189                     55.5    2e-06   
ref|XP_006469401.1|  PREDICTED: uncharacterized protein LOC102626...  55.5    2e-06   
tpg|DAA37388.1|  TPA: ATFP4                                           55.8    2e-06   
emb|CAH67426.1|  OSIGBa0150F01.6                                      55.5    2e-06   Oryza sativa [red rice]
ref|XP_010241736.1|  PREDICTED: uncharacterized protein LOC104586261  54.7    2e-06   
ref|XP_004952919.1|  PREDICTED: uncharacterized protein LOC101785283  55.5    3e-06   
ref|XP_008809609.1|  PREDICTED: uncharacterized protein LOC103721...  55.1    3e-06   
emb|CAE06009.3|  OSJNBa0016O02.19                                     55.5    3e-06   Oryza sativa [red rice]
ref|XP_009339284.1|  PREDICTED: uncharacterized protein LOC103931498  55.1    3e-06   
ref|XP_002448006.1|  hypothetical protein SORBIDRAFT_06g019560        54.7    4e-06   Sorghum bicolor [broomcorn]
ref|XP_006447867.1|  hypothetical protein CICLE_v10017001mg           55.5    4e-06   
gb|ACJ84180.1|  unknown                                               56.6    4e-06   Medicago truncatula
ref|XP_006652383.1|  PREDICTED: uncharacterized protein LOC102714171  54.7    4e-06   
ref|XP_002454080.1|  hypothetical protein SORBIDRAFT_04g024270        54.7    4e-06   Sorghum bicolor [broomcorn]
ref|XP_009124284.1|  PREDICTED: early nodulin-75-like                 55.5    4e-06   
gb|EEE61156.1|  hypothetical protein OsJ_15122                        54.7    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008809611.1|  PREDICTED: uncharacterized protein LOC103721258  54.3    5e-06   
ref|XP_007217188.1|  hypothetical protein PRUPE_ppa013552mg           54.3    5e-06   
ref|NP_001151460.1|  ATFP4                                            54.7    5e-06   Zea mays [maize]
gb|KEH15709.1|  heavy metal transport/detoxification superfamily ...  53.5    5e-06   
gb|KDP22988.1|  hypothetical protein JCGZ_01710                       54.7    5e-06   
ref|XP_006469400.1|  PREDICTED: uncharacterized protein LOC102626...  54.7    5e-06   
ref|XP_002524590.1|  metal ion binding protein, putative              54.3    5e-06   Ricinus communis
ref|XP_009419205.1|  PREDICTED: uncharacterized protein LOC103999...  53.9    6e-06   
ref|XP_007208761.1|  hypothetical protein PRUPE_ppa027120mg           53.9    6e-06   
ref|XP_007213144.1|  hypothetical protein PRUPE_ppa024668mg           53.1    7e-06   
gb|EYU21091.1|  hypothetical protein MIMGU_mgv1a018053mg              53.9    7e-06   
ref|XP_003620388.1|  Mitochondrial protein, putative                  56.2    7e-06   
ref|XP_002533038.1|  metal ion binding protein, putative              53.9    8e-06   Ricinus communis
ref|XP_004952920.1|  PREDICTED: uncharacterized protein LOC101786...  54.3    9e-06   
ref|XP_004978062.1|  PREDICTED: uncharacterized protein LOC101769152  53.9    9e-06   
ref|XP_007141682.1|  hypothetical protein PHAVU_008G216200g           53.9    9e-06   
ref|XP_006469399.1|  PREDICTED: uncharacterized protein LOC102626447  53.5    9e-06   
dbj|BAD26132.1|  unknown protein                                      54.3    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009419465.1|  PREDICTED: uncharacterized protein LOC103999434  54.3    1e-05   
ref|XP_007020383.1|  Heavy metal transport/detoxification superfa...  53.1    1e-05   
ref|XP_003547302.1|  PREDICTED: uncharacterized protein LOC100776617  52.4    1e-05   
ref|XP_002885357.1|  metal ion binding protein                        53.1    1e-05   
gb|EEC84223.1|  hypothetical protein OsI_30639                        53.9    1e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001152411.1|  ATFP4                                            53.1    1e-05   Zea mays [maize]
gb|AFW72061.1|  ATFP4                                                 53.1    1e-05   
ref|XP_011095517.1|  PREDICTED: uncharacterized protein LOC105174948  52.4    1e-05   
tpg|DAA37389.1|  TPA: hypothetical protein ZEAMMB73_588334            53.1    1e-05   
ref|XP_008363893.1|  PREDICTED: uncharacterized protein LOC103427602  54.3    1e-05   
gb|EEC77445.1|  hypothetical protein OsI_16250                        55.5    1e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001053015.1|  Os04g0464100                                     53.1    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006587486.1|  PREDICTED: lysine-specific demethylase 5A-like   54.7    2e-05   
ref|XP_006652393.1|  PREDICTED: uncharacterized protein LOC102716957  52.8    2e-05   
gb|KHN44736.1|  hypothetical protein glysoja_032075                   52.8    2e-05   
ref|XP_008794762.1|  PREDICTED: uncharacterized protein LOC103710688  52.4    2e-05   
ref|XP_003579938.1|  PREDICTED: uncharacterized protein LOC100833023  52.8    2e-05   
gb|KDP22990.1|  hypothetical protein JCGZ_01712                       52.8    2e-05   
gb|ACU24434.1|  unknown                                               54.3    2e-05   Glycine max [soybeans]
ref|XP_004975908.1|  PREDICTED: uncharacterized protein LOC101765481  52.4    2e-05   
ref|NP_001053041.1|  Os04g0469000                                     52.4    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447998.1|  hypothetical protein SORBIDRAFT_06g019490        52.8    2e-05   Sorghum bicolor [broomcorn]
ref|XP_009134984.1|  PREDICTED: uncharacterized protein LOC103859...  52.8    2e-05   
ref|XP_011045596.1|  PREDICTED: uncharacterized protein LOC105140450  52.4    2e-05   
ref|XP_006447866.1|  hypothetical protein CICLE_v10017259mg           52.4    2e-05   
ref|XP_010246562.1|  PREDICTED: uncharacterized protein LOC104589819  52.4    3e-05   
gb|EMT10667.1|  hypothetical protein F775_27842                       52.4    3e-05   
ref|XP_004502101.1|  PREDICTED: uncharacterized protein LOC101495677  52.4    3e-05   
ref|XP_003575245.1|  PREDICTED: uncharacterized protein LOC100845716  52.4    3e-05   
ref|XP_003601491.1|  ATFP4-like protein                               52.0    3e-05   
gb|KDP39243.1|  hypothetical protein JCGZ_01000                       52.0    3e-05   
ref|XP_003533352.1|  PREDICTED: uncharacterized protein LOC100797364  52.0    3e-05   
ref|XP_008809610.1|  PREDICTED: uncharacterized protein LOC103721...  52.0    3e-05   
gb|KDP45151.1|  hypothetical protein JCGZ_15016                       52.0    3e-05   
gb|KDO74056.1|  hypothetical protein CISIN_1g033712mg                 52.0    3e-05   
gb|KDO40226.1|  hypothetical protein CISIN_1g048349mg                 51.6    4e-05   
emb|CAD41036.1|  OSJNBa0060P14.7                                      52.0    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007152714.1|  hypothetical protein PHAVU_004G153100g           53.5    4e-05   
ref|XP_010422376.1|  PREDICTED: uncharacterized protein LOC104707...  51.2    4e-05   
ref|XP_006575706.1|  PREDICTED: uncharacterized protein LOC102669549  50.8    4e-05   
gb|EMS57371.1|  hypothetical protein TRIUR3_01191                     51.6    4e-05   
gb|KHN14404.1|  hypothetical protein glysoja_012442                   50.8    5e-05   
ref|XP_010542497.1|  PREDICTED: uncharacterized protein LOC104815685  51.6    5e-05   
ref|XP_010455734.1|  PREDICTED: uncharacterized protein LOC104737...  52.0    5e-05   
ref|XP_009395840.1|  PREDICTED: uncharacterized protein LOC103980998  51.2    6e-05   
gb|AAD09508.1|  ATFP4                                                 52.4    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567284.1|  putative copper transport protein                   51.2    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187417.1|  heavy-metal-associated domain-containing protein    51.6    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007020385.1|  Copper transport protein family, putative is...  50.8    7e-05   
ref|XP_003616824.1|  hypothetical protein MTR_5g084660                51.2    7e-05   
gb|EMT24129.1|  hypothetical protein F775_26351                       51.6    7e-05   
ref|XP_008669292.1|  PREDICTED: uncharacterized protein LOC103646338  50.8    7e-05   
ref|XP_009398759.1|  PREDICTED: uncharacterized protein LOC103983262  51.2    7e-05   
ref|XP_007216846.1|  hypothetical protein PRUPE_ppa022086mg           50.8    8e-05   
ref|XP_004975909.1|  PREDICTED: uncharacterized protein LOC101765889  50.8    8e-05   
gb|EMT17915.1|  hypothetical protein F775_02488                       50.8    8e-05   
ref|XP_010107367.1|  hypothetical protein L484_006882                 50.8    9e-05   
ref|XP_006857655.1|  hypothetical protein AMTR_s00061p00147320        50.8    9e-05   
emb|CAE06008.3|  OSJNBa0016O02.18                                     50.8    9e-05   
ref|XP_002447995.1|  hypothetical protein SORBIDRAFT_06g019460        52.0    1e-04   Sorghum bicolor [broomcorn]
ref|XP_002865298.1|  hypothetical protein ARALYDRAFT_917047           50.1    1e-04   
dbj|BAA98186.1|  ATFP4-like                                           50.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464391.1|  PREDICTED: uncharacterized protein LOC104744...  50.8    1e-04   
gb|EMT17919.1|  hypothetical protein F775_02491                       50.1    1e-04   
ref|XP_010455810.1|  PREDICTED: uncharacterized protein LOC104737...  50.8    1e-04   
gb|EYU41174.1|  hypothetical protein MIMGU_mgv1a016413mg              50.4    1e-04   
tpg|DAA37385.1|  TPA: hypothetical protein ZEAMMB73_318699            51.2    1e-04   
ref|XP_006289318.1|  hypothetical protein CARUB_v10002803mg           49.7    1e-04   
gb|EYU33985.1|  hypothetical protein MIMGU_mgv1a016390mg              50.1    1e-04   
ref|NP_001150530.1|  heavy metal-associated domain containing pro...  50.8    1e-04   Zea mays [maize]
ref|XP_010661737.1|  PREDICTED: uncharacterized protein LOC100854219  50.1    1e-04   
ref|XP_004975907.1|  PREDICTED: uncharacterized protein LOC101765088  50.1    2e-04   
ref|XP_011005768.1|  PREDICTED: uncharacterized protein LOC105111948  49.3    2e-04   
ref|XP_010942540.1|  PREDICTED: uncharacterized protein LOC105060500  49.7    2e-04   
ref|XP_004956436.1|  PREDICTED: 5'-3' exoribonuclease 2-like isof...  50.4    2e-04   
ref|XP_008229766.1|  PREDICTED: uncharacterized protein LOC103329115  49.7    2e-04   
ref|NP_568695.1|  heavy metal transport/detoxification domain-con...  50.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101379.1|  PREDICTED: uncharacterized protein LOC103827613  49.7    2e-04   
ref|XP_004975910.1|  PREDICTED: uncharacterized protein LOC101766303  49.7    3e-04   
ref|XP_006407818.1|  hypothetical protein EUTSA_v10021695mg           49.7    3e-04   
gb|AES76597.2|  hypothetical protein MTR_6g082180                     50.4    3e-04   
ref|XP_004486553.1|  PREDICTED: uncharacterized protein LOC101501843  48.5    3e-04   
emb|CDY22124.1|  BnaC01g39770D                                        52.0    3e-04   
emb|CDX74037.1|  BnaA03g30100D                                        50.1    3e-04   
ref|NP_001062737.1|  Os09g0272000                                     50.1    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003581336.1|  PREDICTED: uncharacterized protein LOC100830180  50.4    3e-04   
ref|XP_004956437.1|  PREDICTED: 5'-3' exoribonuclease 2-like isof...  49.7    3e-04   
ref|XP_009134983.1|  PREDICTED: uncharacterized protein LOC103859...  49.7    3e-04   
emb|CDP06147.1|  unnamed protein product                              49.3    3e-04   
ref|XP_004243774.1|  PREDICTED: uncharacterized protein LOC101249661  49.3    3e-04   
ref|XP_008355039.1|  PREDICTED: uncharacterized protein LOC103418705  48.9    3e-04   
ref|XP_010464393.1|  PREDICTED: uncharacterized protein LOC104744...  49.7    3e-04   
gb|EMS57366.1|  hypothetical protein TRIUR3_01184                     48.9    4e-04   
gb|EMS67137.1|  hypothetical protein TRIUR3_26965                     48.9    4e-04   
ref|XP_009134328.1|  PREDICTED: uncharacterized protein LOC103858683  48.1    4e-04   
ref|XP_002863883.1|  hypothetical protein ARALYDRAFT_494881           49.3    5e-04   
dbj|BAG71909.1|  NBS-LRR class disease resistance protein             51.6    5e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004979908.1|  PREDICTED: uncharacterized protein LOC101770118  50.8    5e-04   
ref|XP_008809608.1|  PREDICTED: uncharacterized protein LOC103721256  48.5    6e-04   
gb|ADE80951.1|  NBS-LRR class disease resistance protein              51.2    6e-04   
gb|ADZ48537.1|  Pik-1 blast resistance protein                        51.2    6e-04   
gb|EAZ23585.1|  hypothetical protein OsJ_07286                        50.1    7e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003577912.1|  PREDICTED: uncharacterized protein LOC100824...  48.5    7e-04   
ref|XP_010422375.1|  PREDICTED: uncharacterized protein LOC104707...  47.8    7e-04   
gb|EAY86444.1|  hypothetical protein OsI_07826                        50.1    7e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_008224680.1|  PREDICTED: 6-phosphofructokinase 2               50.8    7e-04   
emb|CDY07985.1|  BnaC03g35380D                                        48.9    7e-04   
ref|NP_001173975.1|  Os04g0469300                                     48.1    7e-04   
ref|NP_001047254.1|  Os02g0582600                                     50.1    8e-04   
ref|XP_010057994.1|  PREDICTED: uncharacterized protein LOC104445765  47.4    8e-04   
ref|XP_002307842.2|  hypothetical protein POPTR_0006s00390g           47.4    8e-04   
gb|AES71743.2|  hypothetical protein MTR_3g082260                     47.8    8e-04   
ref|XP_006299450.1|  hypothetical protein CARUB_v10015615mg           48.5    8e-04   
ref|XP_008794753.1|  PREDICTED: uncharacterized protein LOC103710677  47.8    9e-04   
emb|CAN71095.1|  hypothetical protein VITISV_041493                   47.4    9e-04   
gb|AAF79341.1|AC002304_34  F14J16.2                                   48.5    9e-04   
dbj|BAK02048.1|  predicted protein                                    48.9    0.001   
ref|XP_002263769.1|  PREDICTED: uncharacterized protein LOC100252914  47.8    0.001   
emb|CBI40308.3|  unnamed protein product                              50.1    0.001   



>ref|XP_009593962.1| PREDICTED: beta-mannosyltransferase 3-like [Nicotiana tomentosiformis]
Length=134

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQK+ I LP++ DK R+KAM+IAV + GV SVNID+ KS LVVIG G+DSF L+KCLK+
Sbjct  1    MKQKVVIDLPLSTDKSRSKAMQIAVNIRGVTSVNIDKEKSHLVVIGEGIDSFELMKCLKR  60

Query  204  KFKCASIFSIEEV  242
            KF+CASI S+EEV
Sbjct  61   KFRCASIVSVEEV  73



>ref|XP_009781683.1| PREDICTED: actin-binding protein F-like [Nicotiana sylvestris]
Length=140

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MK+KI I LP++ DK R+KAM+IAV + GV SVNID+ K+ LVVIG GVDSF L+KCLK+
Sbjct  1    MKKKIVIDLPLSTDKSRSKAMQIAVNIRGVTSVNIDKEKNHLVVIGEGVDSFALMKCLKR  60

Query  204  KFKCASIFSIEEV  242
            KF+CASI S+EEV
Sbjct  61   KFRCASIVSVEEV  73



>ref|XP_004244019.2| PREDICTED: uncharacterized protein LOC101268886 [Solanum lycopersicum]
Length=603

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  21   SMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLK  200
            +MK+KI I LPIN DKCR+KAM+IAVG  GVISVNID+ K  LVVIG+GVD F L+ C++
Sbjct  479  NMKKKIVIDLPINTDKCRSKAMQIAVGSPGVISVNIDKEKGHLVVIGIGVDFFRLMHCIR  538

Query  201  KKFKCASIFSIEEV  242
            +KFKC+ I S+EEV
Sbjct  539  RKFKCSRIVSVEEV  552



>ref|XP_009632025.1| PREDICTED: uncharacterized protein LOC104121679 [Nicotiana tomentosiformis]
Length=120

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MK+KI I LP+N + CR+KAM+IAV  AGV+SVN+D+ K  LVVIGVGVD F L+ C++K
Sbjct  1    MKKKIVIDLPLNTENCRSKAMQIAVRCAGVMSVNVDKEKGHLVVIGVGVDYFRLMNCIRK  60

Query  204  KFKCASIFSIEEV  242
            KF+C+SI S+E+V
Sbjct  61   KFRCSSIVSLEDV  73



>ref|XP_009786340.1| PREDICTED: uncharacterized protein LOC104234474 [Nicotiana sylvestris]
Length=117

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            M +KI I LP+N + CR+KAM+IAV  AGVISVNID+ K  LVVIGVG+D F L+ C++K
Sbjct  1    MTKKIVIDLPLNTENCRSKAMQIAVRSAGVISVNIDKEKGHLVVIGVGIDFFRLMNCIRK  60

Query  204  KFKCASIFSIEEV  242
            KFKC+SI S+EEV
Sbjct  61   KFKCSSIVSLEEV  73



>ref|XP_006346244.1| PREDICTED: uncharacterized protein LOC102592214 [Solanum tuberosum]
Length=161

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  30   QKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKKF  209
            +KI I LP+N D+CR+KAM+IAV  +GVISVNID+ K  LVVIG+GVD F L+ C+++KF
Sbjct  44   KKIVIDLPVNTDQCRSKAMQIAVRSSGVISVNIDKEKGHLVVIGIGVDFFRLMHCIRRKF  103

Query  210  KCASIFSIEEV  242
            KC+ I SIEEV
Sbjct  104  KCSRIVSIEEV  114


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +3

Query  426  NPCLQYYPVCQPVYDPYPQTGCSIL  500
            NPC+QYYP+CQPVYD Y    CSI+
Sbjct  137  NPCVQYYPICQPVYDTYDNPSCSIM  161



>ref|XP_010313956.1| PREDICTED: uncharacterized protein LOC104644861 [Solanum lycopersicum]
Length=158

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MK+KI I +P++ D+C +KAM++AV + GV SVN+D+ K  L+VIG GVDSF L+KC+K+
Sbjct  1    MKKKIVIDIPVSSDRCISKAMQMAVTICGVTSVNVDKGKGHLIVIGEGVDSFALMKCIKR  60

Query  204  KFKCASIFSIEEV  242
            +F+CA+I S+EEV
Sbjct  61   RFRCANIVSVEEV  73



>ref|XP_006344908.1| PREDICTED: uncharacterized protein LOC102601467 [Solanum tuberosum]
Length=154

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MK+KI I +P++ D+C +KAM+IAV + GV SVN+D+ K  L+VIG GVDSF L++C+K+
Sbjct  1    MKKKIVIDIPVSSDRCISKAMQIAVTICGVTSVNVDKGKGHLIVIGEGVDSFDLMRCIKR  60

Query  204  KFKCASIFSIEEV  242
            +F+CA+I S+E+V
Sbjct  61   RFRCANIVSVEDV  73



>ref|XP_010644661.1| PREDICTED: uncharacterized protein LOC100264837 isoform X1 [Vitis 
vinifera]
 emb|CBI39832.3| unnamed protein product [Vitis vinifera]
Length=111

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + +N DKCRAKAMKIA    GVISV I+ A K ++VVIG GVDS  L  CL 
Sbjct  1    MKQKIIVKVQMNCDKCRAKAMKIAAVEEGVISVAIEGAEKDRVVVIGDGVDSASLTHCLG  60

Query  201  KKFKCASIFSIEEV  242
            KK   A+I S+EEV
Sbjct  61   KKLGYATIVSVEEV  74



>ref|XP_010644663.1| PREDICTED: uncharacterized protein LOC100853541 [Vitis vinifera]
Length=120

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + +N DKCR KAMKIA    GVISV I+ A K ++VVIG GVDS  L  CL+
Sbjct  1    MKQKIIVKVQMNCDKCRTKAMKIAAVEEGVISVAIEGAEKDRVVVIGDGVDSASLTHCLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A++ S+EEV
Sbjct  61   KKLGYATLVSVEEV  74



>ref|XP_010644659.1| PREDICTED: uncharacterized protein LOC100257941 isoform X1 [Vitis 
vinifera]
Length=113

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + +N DKCR KAMKIA    GVISV I+ A K ++VVIG GVDS  L  CL+
Sbjct  1    MKQKIVVKVQMNCDKCRTKAMKIAAVEEGVISVAIEGAEKDRVVVIGDGVDSASLTCCLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A++ S+EEV
Sbjct  61   KKLGYATLVSVEEV  74



>ref|XP_007206533.1| hypothetical protein PRUPE_ppa019605mg [Prunus persica]
 gb|EMJ07732.1| hypothetical protein PRUPE_ppa019605mg [Prunus persica]
Length=115

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI +S+P++ DKCR KA+KIA    GV  V+I+  K  + VIG GVDS  L   L+K
Sbjct  1    MKQKIVVSVPMHCDKCRTKALKIAAAAHGVNKVSIEVDKGHMEVIGDGVDSVCLTSLLRK  60

Query  204  KFKCASIFSIEEV  242
            K   A+I  +EEV
Sbjct  61   KLGFATIVKVEEV  73



>ref|XP_010064973.1| PREDICTED: uncharacterized protein LOC104452160 [Eucalyptus grandis]
Length=104

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI I L ++ +K R+KAMKIA    GVISV ++  KS LVVIGVGVD+  L   L+K
Sbjct  1    MKQKIVIKLCMDCEKARSKAMKIAADAHGVISVAVEIDKSHLVVIGVGVDAASLTGALRK  60

Query  204  KFKCASIFSI  233
            KF  A+I S+
Sbjct  61   KFSHATIVSV  70



>ref|XP_007206993.1| hypothetical protein PRUPE_ppb021408mg [Prunus persica]
 gb|EMJ08192.1| hypothetical protein PRUPE_ppb021408mg [Prunus persica]
Length=123

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            M+QKI + +P++ DKCR KA+KIA    GV  V+I+ A K  + VIG GVDS  L + L+
Sbjct  1    MQQKILVKVPMHCDKCRTKALKIAAAAHGVSKVSIEGADKDHIEVIGDGVDSVCLTRLLR  60

Query  201  KKFKCASIFSIEEV  242
            KK + A+I  +EEV
Sbjct  61   KKLRSATIVKVEEV  74



>ref|XP_009339282.1| PREDICTED: uncharacterized protein LOC103931496 [Pyrus x bretschneideri]
Length=112

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI + + ++ +KCR KA+KIA    GV +V+I+  K  +VVIG GVD+  L K LKK
Sbjct  1    MKQKIVMKVQLSSEKCRTKALKIAAVAKGVSTVSIEAEKEHVVVIGDGVDAVDLAKSLKK  60

Query  204  KFKCASIFSIEEV  242
            K    +I S+EEV
Sbjct  61   KLGSGTIVSVEEV  73



>ref|XP_007208514.1| hypothetical protein PRUPE_ppa026247mg [Prunus persica]
 gb|EMJ09713.1| hypothetical protein PRUPE_ppa026247mg [Prunus persica]
Length=116

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQKI +S+P++ DKCR KA+KIA    GV  V+I+ A K  + VIG GVDS  L   L+
Sbjct  1    MKQKILLSVPMHCDKCRTKALKIAAAAHGVSKVSIEGADKDHIEVIGDGVDSVCLASLLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A+I  +EEV
Sbjct  61   KKLGFAAIVKVEEV  74



>ref|XP_011095605.1| PREDICTED: uncharacterized protein LOC105175010 isoform X1 [Sesamum 
indicum]
Length=109

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQ+I I++P+  +K ++KAMKIAVG+ GV SV + + K +L VIG GVDS  L K L+K
Sbjct  1    MKQRIVINVPMQSEKGKSKAMKIAVGMQGVNSVIVVKDKDRLEVIGEGVDSVCLAKSLRK  60

Query  204  KFKCASIFSIEEV  242
            KF  A I SI EV
Sbjct  61   KFCFADIVSIGEV  73



>ref|XP_011095818.1| PREDICTED: uncharacterized protein LOC105175168 [Sesamum indicum]
Length=119

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI I + +  DK ++KAMKIAV + GV SV++ +   QL V+G GVDS  L K L+K
Sbjct  1    MKQKIVIKVAMGSDKAKSKAMKIAVAMEGVSSVSVGKDNDQLQVVGEGVDSVCLAKSLRK  60

Query  204  KFKCASIFSIEEV  242
            KF  A I S++EV
Sbjct  61   KFCFADIVSVQEV  73



>ref|XP_011095815.1| PREDICTED: uncharacterized protein LOC105175165 [Sesamum indicum]
Length=113

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI I + +  DK ++KAMKIAV + GV SV++ +   QL V+G GVDS  L K L+K
Sbjct  1    MKQKIVIKVAMGSDKAKSKAMKIAVAMEGVSSVSVGKDNDQLQVVGEGVDSVCLAKSLRK  60

Query  204  KFKCASIFSIEEV  242
            KF  A I S++EV
Sbjct  61   KFCFADIVSVQEV  73



>ref|XP_009339286.1| PREDICTED: uncharacterized protein LOC103931499 [Pyrus x bretschneideri]
Length=112

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI + + +N +KCR KA+KIA    G  +V+I+  K  +VVIG G+D+  L K LKK
Sbjct  1    MKQKIVMKVQLNSEKCRTKALKIAAVAKGASTVSIEVEKEHVVVIGDGIDAVDLAKSLKK  60

Query  204  KFKCASIFSIEEV  242
            K    +I S+EEV
Sbjct  61   KLGSGTIVSVEEV  73



>ref|XP_007204171.1| hypothetical protein PRUPE_ppa017127mg [Prunus persica]
 gb|EMJ05370.1| hypothetical protein PRUPE_ppa017127mg [Prunus persica]
Length=121

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQKITI   I  DKCR+KAMKIAV   GVISV      + ++V+ G G+D+  + K L+
Sbjct  1    MKQKITIEAQIRCDKCRSKAMKIAVAEDGVISVAFQGPNRDKMVITGDGIDAVDMAKSLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+EE+
Sbjct  61   KKLGYADLVSVEEI  74



>ref|XP_010253026.1| PREDICTED: glutelin type-A 1-like [Nelumbo nucifera]
Length=359

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            M+QKI + + +N DKCR+KAM IA    GVISV I+ + K +LVVIG GVDS  L   L+
Sbjct  1    MQQKIVVKVQMNCDKCRSKAMSIASVAEGVISVAIEGDDKDRLVVIGDGVDSAKLTTSLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A+I S+EEV
Sbjct  61   KKVGHATIISVEEV  74



>ref|XP_007212494.1| hypothetical protein PRUPE_ppa017532mg [Prunus persica]
 gb|EMJ13693.1| hypothetical protein PRUPE_ppa017532mg [Prunus persica]
Length=79

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQKITI   I  DKCR++AMKIAV   GVISV      + ++V+ G GVD+  + K L+
Sbjct  1    MKQKITIEAQIQCDKCRSQAMKIAVAEDGVISVAFQGPNRDKMVITGDGVDAADMAKSLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+EE+
Sbjct  61   KKLGYADLVSVEEI  74



>ref|XP_008218443.1| PREDICTED: uncharacterized protein LOC103318786 [Prunus mume]
Length=116

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ +S+P+  DKCR KA+KIA    GV  V+I+ A K  + VIG GVDS  L   L+
Sbjct  1    MKQKLVVSVPMRCDKCRNKALKIAAAAHGVSKVSIEGADKDHIEVIGDGVDSVCLTSLLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A+I  +EEV
Sbjct  61   KKLGFATIVKVEEV  74



>ref|XP_009415399.1| PREDICTED: uncharacterized protein LOC103996246 [Musa acuminata 
subsp. malaccensis]
Length=130

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +N D+CR+KAMK AVG  G+ +V+I+ E +  LV+IG  VDS  L   L+
Sbjct  1    MKQKIVIRVQMNCDRCRSKAMKTAVGNHGIETVSIEGEERDLLVIIGERVDSVALACSLR  60

Query  201  KKFKCASIFSI  233
            KK  CA I ++
Sbjct  61   KKLHCADILTV  71



>ref|XP_008219472.1| PREDICTED: uncharacterized protein LOC103319678 [Prunus mume]
Length=322

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            M+QKI + +P++ DKCR KA+KIA    GV  V+I+ A K  + VIG GVDS  L + L+
Sbjct  1    MQQKILVKVPMHFDKCRTKALKIAAAAHGVSKVSIEGADKDHIEVIGDGVDSVCLTRLLR  60

Query  201  KKFKCASIFSIEEV  242
            KK + A+I  +EEV
Sbjct  61   KKLRSATIVKVEEV  74


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +3

Query  30   QKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLKKK  206
            QKI + + ++ DKCR KA+KIA    GV  V+I+ A +  + VIG GVDS  L + L+KK
Sbjct  111  QKILVKVQMHCDKCRTKALKIAASAYGVSKVSIEGANRDHVEVIGDGVDSVCLTELLRKK  170

Query  207  FKCASIFSIEEV  242
               A+I  +E+V
Sbjct  171  LGFAAIVKVEQV  182



>gb|KCW70441.1| hypothetical protein EUGRSUZ_F03666, partial [Eucalyptus grandis]
Length=102

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  30   QKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKKF  209
            QKI I L ++ +K R+KAMKIA    GVISV ++  KS LVVIGVGVD+  L   L+KKF
Sbjct  1    QKIVIKLCMDCEKARSKAMKIAADAHGVISVAVEIDKSHLVVIGVGVDAASLTGALRKKF  60

Query  210  KCASIFSI  233
              A+I S+
Sbjct  61   SHATIVSV  68



>ref|XP_010644662.1| PREDICTED: uncharacterized protein LOC100264837 isoform X2 [Vitis 
vinifera]
Length=107

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 49/74 (66%), Gaps = 5/74 (7%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + +N DKCRAKAMKI    A V  V I+ A K ++VVIG GVDS  L  CL 
Sbjct  1    MKQKIIVKVQMNCDKCRAKAMKI----AAVEEVAIEGAEKDRVVVIGDGVDSASLTHCLG  56

Query  201  KKFKCASIFSIEEV  242
            KK   A+I S+EEV
Sbjct  57   KKLGYATIVSVEEV  70



>ref|XP_008342265.1| PREDICTED: uncharacterized protein LOC103405072 [Malus domestica]
Length=117

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQK+ I L +  ++ RAKAMK AVGVAGV S +    K Q+ V+G GVD  VL   L+K
Sbjct  1    MKQKVVIKLSVPDERTRAKAMKTAVGVAGVNSASYQHDKEQIEVMGEGVDVVVLTTSLRK  60

Query  204  KFKCASIFSI  233
              K A + S+
Sbjct  61   SLKYAEVVSV  70



>ref|XP_008232364.1| PREDICTED: uncharacterized protein LOC103331515 isoform X2 [Prunus 
mume]
Length=121

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQKITI   I  DKCR+KAMKIAV   GVISV      + ++V+ G GVD+  +   L+
Sbjct  1    MKQKITIEAQIRCDKCRSKAMKIAVAEDGVISVAFQGPNRDKMVITGDGVDAVDMANSLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+EE+
Sbjct  61   KKLGYADLVSVEEI  74



>ref|XP_002268731.1| PREDICTED: uncharacterized protein LOC100255094 [Vitis vinifera]
Length=124

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +3

Query  24   MKQKITISLPINVDK-CRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCL  197
            MKQK+ I +P+N +K CR+KAM+ AVGV GV S+ ++ E K+Q+VVIG  VDS  L   L
Sbjct  1    MKQKMVIRVPMNGEKKCRSKAMQTAVGVPGVESIALEGEDKNQIVVIGDSVDSVNLTCLL  60

Query  198  KKKFKCASIFSIEEV  242
            +KKF  A + S+  V
Sbjct  61   RKKFGSAELLSVSAV  75



>gb|EYU27493.1| hypothetical protein MIMGU_mgv1a016643mg [Erythranthe guttata]
Length=113

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI I +P+  DK ++KAM+IAV + GV SV+I +   ++ VIG GVDS  L K L+K
Sbjct  1    MKQKIVIKVPMQSDKDKSKAMQIAVTMQGVSSVSIGKEGDRIEVIGEGVDSVCLAKSLRK  60

Query  204  KFKCASIFSIEEV  242
            KF  A I S+ EV
Sbjct  61   KFCFADIVSVGEV  73



>ref|XP_010928047.1| PREDICTED: uncharacterized protein LOC105049937 [Elaeis guineensis]
Length=120

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MK++I I + +N  KCR+KAMK+A    GV S+ ID E K+QLVVIG GVD  +L   L+
Sbjct  1    MKKQIVIKVQMNCGKCRSKAMKLAASADGVDSIKIDGEDKNQLVVIGEGVDPVILTGILR  60

Query  201  KKFKCASIFSIEEV  242
            KK   + I  +EE+
Sbjct  61   KKMGHSEIVKVEEM  74



>emb|CBI39835.3| unnamed protein product [Vitis vinifera]
Length=110

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +3

Query  54   INVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLKKKFKCASIFS  230
            +N DKCR KAMKIA    GVISV I+ A K ++VVIG GVDS  L  CL+KK   A++ S
Sbjct  1    MNCDKCRTKAMKIAAVEEGVISVAIEGAEKDRVVVIGDGVDSASLTHCLRKKLGYATLVS  60

Query  231  IEEV  242
            +EEV
Sbjct  61   VEEV  64



>ref|XP_007207854.1| hypothetical protein PRUPE_ppa022793mg [Prunus persica]
 gb|EMJ09053.1| hypothetical protein PRUPE_ppa022793mg [Prunus persica]
Length=104

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI + + +  +KCR KA+KIA    GV  V+I+  K  + VIG GVD+  L K LKK
Sbjct  1    MKQKIVMKVQLKSEKCRTKALKIAAVAKGVSKVSIEMEKEHVEVIGDGVDAVDLAKSLKK  60

Query  204  KFKCASIFSIEEV  242
            K   A+I S+EEV
Sbjct  61   KLGYATIVSVEEV  73



>gb|EYU21092.1| hypothetical protein MIMGU_mgv1a023329mg, partial [Erythranthe 
guttata]
Length=101

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + ++ DKCR+KA+KIAVG++GV SV +  + + Q+ V+G G+DS  L + L+
Sbjct  1    MKQKIVIKMSVHCDKCRSKALKIAVGISGVESVALTGQERDQVEVVGDGIDSVELTRRLR  60

Query  201  KKFKCASIFSIEE  239
            K    A + S+ E
Sbjct  61   KNVAHAELVSVGE  73



>ref|XP_008380030.1| PREDICTED: uncharacterized protein LOC103443026 [Malus domestica]
Length=122

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQK+ I L ++ ++ RAKAMK AVGV GV S +  + K+Q+ V+G G+D  +L   L+K
Sbjct  1    MKQKVVIKLSVHDERARAKAMKTAVGVDGVNSASYQQDKNQMEVMGEGIDVVLLTTSLRK  60

Query  204  KFKCASIFSIEEV  242
              K A + S+  V
Sbjct  61   NLKYAEVVSVSPV  73



>ref|XP_010928046.1| PREDICTED: uncharacterized protein LOC105049936 [Elaeis guineensis]
Length=117

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MK++I I + +N DKCR+KAM++A  V GV S+ +D E K+QLVV+G GVD  +L + L+
Sbjct  1    MKKQIVIKVQMNCDKCRSKAMQLAASVDGVDSIKVDGEDKNQLVVVGEGVDPVILTRILR  60

Query  201  KKFKCASIFSIEEV  242
            K    + I  + E+
Sbjct  61   KNIGHSDIVKVGEM  74



>ref|XP_004293421.1| PREDICTED: uncharacterized protein LOC101306992 [Fragaria vesca 
subsp. vesca]
Length=73

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            M+ KI + +P+N  KC+ +A+KI     GV SV + + K  LVVIG GVD+  L K L+K
Sbjct  1    MQHKIVMKVPMNCRKCQTEALKIVAEENGVSSVALGKEKDSLVVIGEGVDAVKLAKRLRK  60

Query  204  KFKCASIFSIEEV  242
            KFK A I ++ EV
Sbjct  61   KFKTADIVTVAEV  73



>emb|CBI39830.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +3

Query  54   INVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLKKKFKCASIFS  230
            +N DKCR KAMKIA    GVISV I+ A K ++VVIG GVDS  L  CL+KK   A++ S
Sbjct  1    MNCDKCRTKAMKIAAVEEGVISVAIEGAEKDRVVVIGDGVDSASLTCCLRKKLGYATLVS  60

Query  231  IEEV  242
            +EEV
Sbjct  61   VEEV  64



>ref|XP_011039897.1| PREDICTED: uncharacterized protein LOC105136306, partial [Populus 
euphratica]
Length=87

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI I + ++ +KCR KA KIA    GV SV ++ AK Q+VVIG  VDS  L K L+K
Sbjct  1    MKQKIVIKVQMHCEKCRTKAKKIAATACGVTSVALEAAKDQIVVIGEEVDSVKLAKSLRK  60

Query  204  KFKCASIFSIE  236
            K   A + S++
Sbjct  61   KVGHAVLMSVQ  71



>ref|XP_008232363.1| PREDICTED: uncharacterized protein LOC103331515 isoform X1 [Prunus 
mume]
Length=140

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +3

Query  18   FSMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKC  194
              ++QKITI   I  DKCR+KAMKIAV   GVISV      + ++V+ G GVD+  +   
Sbjct  18   HDLQQKITIEAQIRCDKCRSKAMKIAVAEDGVISVAFQGPNRDKMVITGDGVDAVDMANS  77

Query  195  LKKKFKCASIFSIEEV  242
            L+KK   A + S+EE+
Sbjct  78   LRKKLGYADLVSVEEI  93



>ref|XP_011095606.1| PREDICTED: uncharacterized protein LOC105175010 isoform X2 [Sesamum 
indicum]
Length=106

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 3/73 (4%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQ+I I++P+  +K ++KAMKIAVGV  VI V   + K +L VIG GVDS  L K L+K
Sbjct  1    MKQRIVINVPMQSEKGKSKAMKIAVGVNSVIVV---KDKDRLEVIGEGVDSVCLAKSLRK  57

Query  204  KFKCASIFSIEEV  242
            KF  A I SI EV
Sbjct  58   KFCFADIVSIGEV  70



>gb|ABK96536.1| unknown [Populus trichocarpa x Populus deltoides]
Length=113

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI I + ++ +KCR KA KIA    GV SV ++ AK Q+VVIG  VDS  L K L+K
Sbjct  1    MKQKIVIKVHMHCEKCRTKAKKIAATACGVTSVALEAAKDQIVVIGEEVDSVKLAKSLRK  60

Query  204  KFKCASIFSIE  236
            K   A + S++
Sbjct  61   KVGHAVLMSVQ  71



>ref|XP_002299059.1| hypothetical protein POPTR_0001s47250g [Populus trichocarpa]
 gb|EEE83864.1| hypothetical protein POPTR_0001s47250g [Populus trichocarpa]
Length=115

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI I + ++ +KCR KA KIA    GV SV ++ AK Q+VVIG  VDS  L K L+K
Sbjct  1    MKQKIVIKVHMHCEKCRTKAKKIAATACGVTSVALEAAKDQIVVIGEEVDSVKLAKSLRK  60

Query  204  KFKCASIFSIE  236
            K   A + S++
Sbjct  61   KVGHAVLMSVQ  71



>ref|XP_011091871.1| PREDICTED: uncharacterized protein LOC105172196 isoform X2 [Sesamum 
indicum]
Length=101

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I L    ++  +KAMKIA GV+GV S+ +  E K Q++VIG G+D+  L KC++
Sbjct  1    MKQKIVIKLGNGNNQYSSKAMKIAAGVSGVESMTLLGENKDQIMVIGAGIDAVNLTKCMR  60

Query  201  KKFKCASIFSI  233
            KK   A + S+
Sbjct  61   KKLGSAELISL  71



>ref|XP_007020387.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
 gb|EOY11912.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
Length=121

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I +P++ DKCR KAMKIA    GV SV I    K Q+VV G G+DS  L   L+
Sbjct  1    MKQKIVIKVPMHCDKCRTKAMKIAAVANGVSSVAIAGNDKDQVVVTGEGIDSANLTCLLR  60

Query  201  KKFKCASIFSIEE  239
            KK   A+I S+ E
Sbjct  61   KKLGYAAIISVGE  73



>gb|EMS57369.1| hypothetical protein TRIUR3_01188 [Triticum urartu]
Length=110

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I L ++ DK R+KA+ +A   AGV S+ I  +A+ QL V+G GVDS  L+ CL+
Sbjct  1    MKQKIVIQLGMSCDKSRSKALTMAARAAGVTSMEITGDARDQLEVVGDGVDSVCLVSCLR  60

Query  201  KKFKCASIF  227
            KK   A I 
Sbjct  61   KKLGHAQII  69



>gb|EMT17917.1| hypothetical protein F775_02489 [Aegilops tauschii]
Length=112

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I L ++ DK R+KA+ +A   AGV S+ I  +A+ QL V+G GVDS  L+ CL+
Sbjct  1    MKQKIVIQLSMSCDKRRSKALTLAARAAGVTSMGITGDARDQLEVVGDGVDSVCLVSCLR  60

Query  201  KKFKCASI  224
            KK   A I
Sbjct  61   KKLGHAQI  68



>ref|XP_008344728.1| PREDICTED: uncharacterized protein LOC103407605 [Malus domestica]
Length=149

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLV-VIGVGVDSFVLIKCLKK  203
            + KI + +P + DKCR+KA+KIAV   GV  V+I+ A   LV VIG  VD F L+K L+K
Sbjct  4    QMKIVVKVPFHCDKCRSKALKIAVNARGVSKVSIEGANKDLVEVIGDDVDPFCLMKSLRK  63

Query  204  KFK-CASIFSIEEV  242
            +F  C ++  +EEV
Sbjct  64   RFGCCCALVKVEEV  77



>ref|XP_009361504.1| PREDICTED: uncharacterized protein LOC103951779 [Pyrus x bretschneideri]
Length=109

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQK+ I L ++ ++ +AKAMK AVGV GV S +    K Q+ V G GVD  VL   L+K
Sbjct  1    MKQKVVIKLSVHDERTKAKAMKTAVGVDGVNSASYQRDKEQIEVTGEGVDVVVLTTSLRK  60

Query  204  KFKCASIFSI  233
              K A + S+
Sbjct  61   SLKYADVLSV  70



>ref|XP_007020384.1| Copper transport protein family, putative isoform 1 [Theobroma 
cacao]
 gb|EOY11909.1| Copper transport protein family, putative isoform 1 [Theobroma 
cacao]
Length=113

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQKI IS+ +  +KCR KA+K+A    GV+SV ++ A K +LVV G GVDS  L + L+
Sbjct  1    MKQKIVISVNMGCNKCRVKALKVAATTNGVVSVAVEGADKDKLVVKGDGVDSAELTRSLR  60

Query  201  KKFKCASIFSI  233
            KK + A++ S+
Sbjct  61   KKVRAATLLSV  71



>ref|XP_008218909.1| PREDICTED: uncharacterized protein LOC103319169 [Prunus mume]
Length=104

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI + + +  +KCR KA+KIA    GV  V+I+  K  + VIG GVD+  L K LKK
Sbjct  1    MKQKIVMKVQLKSEKCRTKALKIAAVAKGVSKVSIEVEKEHVEVIGDGVDAVDLAKSLKK  60

Query  204  KFKCASIFSIEEV  242
            K   A+I S+ EV
Sbjct  61   KLGYATIVSVAEV  73



>ref|XP_010026243.1| PREDICTED: uncharacterized protein LOC104416568 [Eucalyptus grandis]
 ref|XP_010042963.1| PREDICTED: uncharacterized protein LOC104432199 [Eucalyptus grandis]
Length=135

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAG-VISVNIDE-AKSQLVVIGVGVDSFVLIKCLK  200
            +QK+ I +P+N DKCR++A++I     G +ISV+I    + +LVV G GVD   L++ L+
Sbjct  3    QQKMIIRMPMNSDKCRSRALRIVARAKGTIISVSIGGLNEDELVVTGEGVDPATLVQSLR  62

Query  201  KKFKCASIFSIEEV  242
            KKF+  +I S++++
Sbjct  63   KKFRQVTILSVQQI  76



>ref|XP_009391790.1| PREDICTED: uncharacterized protein LOC103977867 [Musa acuminata 
subsp. malaccensis]
Length=124

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + IN +KCR+KAM++     GV SV ++ E K QLV++G GVD   L   L+
Sbjct  1    MKQKIVIKVQINCNKCRSKAMRLVASAEGVDSVAVEGEDKDQLVLVGDGVDPADLTCTLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A I  +EEV
Sbjct  61   KKVGHAYIVKVEEV  74



>ref|XP_010942541.1| PREDICTED: uncharacterized protein LOC105060501 [Elaeis guineensis]
Length=113

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKK  203
            KQK+ I L +   K R+KA+KI VG+ GV S ++D   K Q+VV+G G+DSF L++ L+K
Sbjct  3    KQKVVIRLSMVDAKKRSKALKIVVGLDGVTSASVDGNEKDQIVVVGDGIDSFALVRKLRK  62

Query  204  KFKCASIFSI  233
            + K A + S+
Sbjct  63   RMKYAELVSV  72



>ref|XP_011091863.1| PREDICTED: uncharacterized protein LOC105172196 isoform X1 [Sesamum 
indicum]
Length=105

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +3

Query  21   SMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCL  197
            S++QKI I L    ++  +KAMKIA GV+GV S+ +  E K Q++VIG G+D+  L KC+
Sbjct  4    SLQQKIVIKLGNGNNQYSSKAMKIAAGVSGVESMTLLGENKDQIMVIGAGIDAVNLTKCM  63

Query  198  KKKFKCASIFSI  233
            +KK   A + S+
Sbjct  64   RKKLGSAELISL  75



>ref|XP_003620393.1| hypothetical protein MTR_6g082330 [Medicago truncatula]
 gb|AES76611.1| hypothetical protein MTR_6g082330 [Medicago truncatula]
Length=233

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I L ++ DKCR KA+K A  V GV SV+++   K  + VIG  VD+  L   LK
Sbjct  1    MKQKMVIKLQMDCDKCRNKALKTAAEVQGVTSVSLEGNDKDSICVIGDDVDTICLANQLK  60

Query  201  KKFKCASIFSIEEV  242
            KKF   +I S+EEV
Sbjct  61   KKFNSVTILSVEEV  74



>ref|XP_006375589.1| hypothetical protein POPTR_0014s16960g [Populus trichocarpa]
 gb|ERP53386.1| hypothetical protein POPTR_0014s16960g [Populus trichocarpa]
Length=121

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +N  K R+K+++IAVG +GV S  +  + KSQ+ V+G GVD+  L  CL+
Sbjct  1    MKQKIVIKVTVNGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGHGVDAVELTNCLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A I S+  V
Sbjct  61   KKVGYAEIVSVAAV  74



>ref|XP_009145723.1| PREDICTED: uncharacterized protein LOC103869399 [Brassica rapa]
Length=174

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 57/83 (69%), Gaps = 6/83 (7%)
 Frame = +3

Query  9    NIAFSMKQKITISLPINVDKCRAKAMKIAVG----VAGVISVNID-EAKSQLVVIGVGVD  173
            N+ FS K K+ I L +N D+CR KAM++AV     +AGVISV I+ E++ +LVV+G G+D
Sbjct  16   NLLFSTK-KMRIKLSVNCDRCRRKAMEVAVNAKALLAGVISVAIEGESEDELVVVGDGID  74

Query  174  SFVLIKCLKKKFKCASIFSIEEV  242
            +  L+  L+K+   A + ++EEV
Sbjct  75   AACLVDTLRKQACYAILETLEEV  97



>ref|XP_010251978.1| PREDICTED: uncharacterized protein LOC104593713 [Nelumbo nucifera]
Length=157

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I +P+N  K R KA+KIAVG+ GV S ++  E KSQ+VV G G+DS  L   L+
Sbjct  1    MKQKVVIKVPVNGSKSRIKALKIAVGIQGVESASLQGEDKSQIVVEGEGIDSITLAVSLR  60

Query  201  KKFKCASI  224
            K    A +
Sbjct  61   KSLGSAEL  68



>ref|XP_010260985.1| PREDICTED: uncharacterized protein LOC104599930 [Nelumbo nucifera]
Length=204

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKITI + ++ D CR KAM+IA    GV SV +D++K ++VV+G  VD+  L   L+K
Sbjct  1    MKQKITIKVDMHCDDCRHKAMRIAAAACGVTSVALDDSKDKMVVVGEDVDTTCLTNILRK  60

Query  204  K  206
            K
Sbjct  61   K  61



>gb|KDP22993.1| hypothetical protein JCGZ_01715 [Jatropha curcas]
Length=125

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I   ++  K R+KAMKIAVGVAGV S  +  + KSQ+ VIG GVD+  L   L+
Sbjct  1    MKQKIVIKFSLSSQKSRSKAMKIAVGVAGVESAALGGQDKSQIEVIGDGVDAVQLTTLLR  60

Query  201  KKFKCASIFSIEEV  242
            K    + I S+  V
Sbjct  61   KHVGYSEIMSVSAV  74



>ref|XP_004294919.1| PREDICTED: uncharacterized protein LOC101303978 [Fragaria vesca 
subsp. vesca]
Length=107

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI + +  +  K R  A+KIA G  GV +V+I+  K Q+VVIG GVDS  L+K L+K
Sbjct  1    MKQKIVMKVQFSCQKRRTDALKIAAGTTGVSNVSIEADKDQIVVIGDGVDSVCLVKSLRK  60

Query  204  KFKCASIFS  230
            K +   I S
Sbjct  61   KLRYVEIVS  69



>ref|XP_009419204.1| PREDICTED: uncharacterized protein LOC103999243 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=116

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + I  DKCR+KAM++     GV SV I+ E K QLV++G GVD   +   L+
Sbjct  1    MKQKIVIRVQIKCDKCRSKAMQLVAEADGVDSVAIEGENKDQLVIVGDGVDPANVTLVLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A+I  +EEV
Sbjct  61   KKVGRATIVKVEEV  74



>ref|XP_011032087.1| PREDICTED: uncharacterized protein LOC105131028 isoform X2 [Populus 
euphratica]
 ref|XP_011032089.1| PREDICTED: uncharacterized protein LOC105131029 isoform X2 [Populus 
euphratica]
Length=114

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I +  N  K R+KA++IAVG++GV S  +  E KSQ+ V+G GVD+  L   L+
Sbjct  1    MKQKIVIKVTGNGQKSRSKALQIAVGLSGVESAGLGGEDKSQVEVVGDGVDAVQLTNLLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+E V
Sbjct  61   KKVGYAELASVEAV  74



>ref|XP_007206826.1| hypothetical protein PRUPE_ppa026184mg [Prunus persica]
 gb|EMJ08025.1| hypothetical protein PRUPE_ppa026184mg [Prunus persica]
Length=114

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + ++ DKCR KA+KIA    GV  V+I+ A +  + VIG GVDS  L + L+
Sbjct  1    MKQKILVKVQMHCDKCRTKALKIAASAYGVSKVSIEGANRDHVEVIGDGVDSVCLTELLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A+I  +E+V
Sbjct  61   KKLGFAAIVKVEQV  74



>ref|XP_007142458.1| hypothetical protein PHAVU_008G282300g [Phaseolus vulgaris]
 gb|ESW14452.1| hypothetical protein PHAVU_008G282300g [Phaseolus vulgaris]
Length=112

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + ++ DKCR+KA+KIA    GV SV ++ E K ++ VIG  VDS  L + L+
Sbjct  1    MKQKIVIRVSLDCDKCRSKALKIAADANGVSSVALEGEHKDKVAVIGERVDSVCLCRALR  60

Query  201  KKFKCASIFS  230
            KKF+ A I S
Sbjct  61   KKFRHAIIES  70



>ref|XP_006474799.1| PREDICTED: uncharacterized protein LOC102607832 [Citrus sinensis]
Length=121

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +   KCR KAMKIAV   GVI V I  E K +LVVIG  VDS  L + L+
Sbjct  1    MKQKIVIKVQMTCKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVNLTRSLR  60

Query  201  KKFKCASIFSIE  236
            K    AS+ S++
Sbjct  61   KGLGFASLLSVQ  72



>gb|KDP22996.1| hypothetical protein JCGZ_01718 [Jatropha curcas]
Length=115

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + ++  K R+KAMKIAVGVAGV S  +  + KS++ V+G GVDS  L   L+
Sbjct  1    MKQKIVIKISMSSQKSRSKAMKIAVGVAGVESAALGGQDKSEIEVVGDGVDSVKLTTLLR  60

Query  201  KKFKCASIFSIEEV  242
            K+   + + S+  V
Sbjct  61   KQVGYSELLSVSSV  74



>gb|EMS57368.1| hypothetical protein TRIUR3_01187 [Triticum urartu]
Length=112

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I L ++ DK R+KA+ +A   AGV S+ I  +A+ QL V+G GVD   L+ CL+
Sbjct  1    MKQKIVIQLSLSCDKRRSKALTMAARAAGVTSMEITGDARDQLEVVGDGVDPVCLVSCLR  60

Query  201  KKFKCASI  224
            KK   A I
Sbjct  61   KKLGHAQI  68



>ref|XP_008218899.1| PREDICTED: uncharacterized protein LOC103319162 [Prunus mume]
Length=122

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKK  206
            +QKI + L +N +K R  A+KIA    GV  V+I+  K Q+ VIG GVD+  L   L+KK
Sbjct  3    QQKIVMKLQMNCEKHRTNALKIAAVAKGVSKVSIEAEKEQMEVIGAGVDTTRLTMSLRKK  62

Query  207  FKCASIFSIEEV  242
               A+I S+E V
Sbjct  63   LGSAAIISVEPV  74



>gb|EMS57367.1| hypothetical protein TRIUR3_01185 [Triticum urartu]
Length=113

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I L ++ DK R+KA+ +A   AGV S+ I  +A+ QL V+G GVD   L+ CL+
Sbjct  1    MKQKIVIQLSMSCDKRRSKALTLAARAAGVTSMGITGDARDQLEVVGDGVDPVCLVSCLR  60

Query  201  KKFKCASI  224
            KK   A I
Sbjct  61   KKLGHAQI  68



>ref|XP_006379054.1| hypothetical protein POPTR_0009s05300g [Populus trichocarpa]
 gb|ERP56851.1| hypothetical protein POPTR_0009s05300g [Populus trichocarpa]
Length=118

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I +  N  K R KA++IAVG++GV S  +  E KSQ+ V+G GVD+  L   L+
Sbjct  1    MKQKIVIKVTGNGPKSRTKALRIAVGLSGVESARLGGEDKSQIEVVGDGVDAVQLTNLLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+E V
Sbjct  61   KKVGYAELASVEAV  74



>ref|XP_010644660.1| PREDICTED: uncharacterized protein LOC100257941 isoform X2 [Vitis 
vinifera]
Length=106

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 8/74 (11%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + +N DKCR KAMKIA       +V  + A K ++VVIG GVDS  L  CL+
Sbjct  1    MKQKIVVKVQMNCDKCRTKAMKIA-------AVEEEGAEKDRVVVIGDGVDSASLTCCLR  53

Query  201  KKFKCASIFSIEEV  242
            KK   A++ S+EEV
Sbjct  54   KKLGYATLVSVEEV  67



>ref|XP_006299613.1| hypothetical protein CARUB_v10015791mg [Capsella rubella]
 gb|EOA32511.1| hypothetical protein CARUB_v10015791mg [Capsella rubella]
Length=121

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +3

Query  36   ITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKKKFK  212
            + I L +N DKCR KAM++AV  +GV SV ++ E   +LVVIG GVD+  L+  L+KK  
Sbjct  1    MRIKLSVNSDKCRKKAMQVAVLASGVTSVALEGEFGDELVVIGDGVDAACLVLALRKKGC  60

Query  213  CASIFSIEEV  242
            CA++ +++EV
Sbjct  61   CATLETLQEV  70



>ref|XP_008355038.1| PREDICTED: keratin-associated protein 4-7-like [Malus domestica]
Length=159

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = +3

Query  33   KITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKKFK  212
            KI + +P++ DKCR KA+KIA    GV  V+ID  K  + VIG  VD F L+K L+K+F 
Sbjct  2    KIVVKVPMHCDKCRTKALKIAAAAHGVSKVSID--KDLVEVIGDDVDPFCLMKSLRKRFG  59

Query  213  -CASIFSIEEV  242
             C ++  +EEV
Sbjct  60   CCCALVKVEEV  70



>gb|EMT17916.1| hypothetical protein F775_42527 [Aegilops tauschii]
Length=127

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I L ++ DK R+KA+ +A   AGV S+ I  + + QL V+G GVD   L+ CL+
Sbjct  1    MKQKIVIQLSMSCDKSRSKALTLAARAAGVTSMGITGDGRDQLEVVGDGVDPVCLVSCLR  60

Query  201  KKFKCASI  224
            KK   A I
Sbjct  61   KKLGHAQI  68



>ref|XP_011032085.1| PREDICTED: uncharacterized protein LOC105131026 [Populus euphratica]
Length=114

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I +  N  K R KA++IAVG++GV S  I  + KSQ+ V+G GVD+  L   L+
Sbjct  1    MKQKIVIKVTGNGPKSRTKALQIAVGLSGVESAGIGGQDKSQIEVVGDGVDAVQLTNLLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+E V
Sbjct  61   KKVGYAELASVEAV  74



>ref|XP_008363364.1| PREDICTED: uncharacterized protein LOC103427075 [Malus domestica]
Length=118

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKK  206
            + KI + +P++ DKCR KA+KIA    GV  V+ID  K  + VIG  VD F L+K L+K+
Sbjct  4    QMKIVVKVPMHCDKCRTKALKIAAAAHGVSKVSID--KDLVEVIGDDVDPFCLMKSLRKR  61

Query  207  FK-CASIFSIEEV  242
            F  C ++  +EEV
Sbjct  62   FGCCCALVKVEEV  74



>ref|XP_006452542.1| hypothetical protein CICLE_v10010297mg [Citrus clementina]
 gb|ESR65782.1| hypothetical protein CICLE_v10010297mg [Citrus clementina]
Length=91

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            ++QKI I + +  DKCR+KAM+ A    GVISV++  + K  +VV G GVDS  L K L 
Sbjct  2    VQQKIVIKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKDTVVVTGDGVDSASLAKRLG  61

Query  201  KKFKCASIFSIEEV  242
            KK   AS+ ++EE+
Sbjct  62   KKLGHASLETVEEM  75



>ref|XP_004512882.1| PREDICTED: NF-X1-type zinc finger protein NFXL1-like [Cicer arietinum]
Length=217

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I L ++ +KCR KA+K A  V GV+SV ++ + K ++ V G  +D+  L   LK
Sbjct  1    MKQKIVIKLHMDCEKCRNKALKTAAEVKGVVSVALEGDDKDRVCVTGDNIDTVCLANMLK  60

Query  201  KKFKCASIFSIEEV  242
            KKF   +I S+EEV
Sbjct  61   KKFNDVTILSVEEV  74



>gb|KDO62244.1| hypothetical protein CISIN_1g048525mg [Citrus sinensis]
Length=86

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +3

Query  30   QKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKKK  206
            QKI I + +  DKCR+KAM+ A    GVISV++  + K  +VV G GVDS  L K L KK
Sbjct  2    QKIVIKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKDTVVVTGDGVDSASLAKRLGKK  61

Query  207  FKCASIFSIEEV  242
               AS+ ++EE+
Sbjct  62   LGHASLETVEEM  73



>ref|XP_011012621.1| PREDICTED: uncharacterized protein LOC105116833 [Populus euphratica]
Length=121

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +N  K R+K+++IAVG +GV S  +  + KSQ+ V+G GVD+  L  CL+
Sbjct  1    MKQKIVIMVTVNGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNCLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+  V
Sbjct  61   KKVGYAELVSVAAV  74



>ref|XP_002447999.1| hypothetical protein SORBIDRAFT_06g019500 [Sorghum bicolor]
 gb|EES12327.1| hypothetical protein SORBIDRAFT_06g019500 [Sorghum bicolor]
Length=133

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQK  I + +  D+ R+KA+ +A    GVISV I    K +L V+G GVD+  L+ CL+
Sbjct  1    MKQKTVIKVSMPCDRSRSKALTLAARADGVISVEITGGDKDKLEVVGDGVDTVCLVSCLR  60

Query  201  KKFKCASIFSIEEV  242
            +K   A I  +EEV
Sbjct  61   RKLGHADILQVEEV  74



>ref|XP_011012623.1| PREDICTED: uncharacterized protein LOC105116834 [Populus euphratica]
Length=121

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +N  K R+K+++IAVG +GV S  +  + KSQ+ V+G GVD+  L  CL+
Sbjct  1    MKQKIVIMVTVNGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNCLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+  V
Sbjct  61   KKVGYAELVSVAAV  74



>ref|XP_010260987.1| PREDICTED: uncharacterized protein LOC104599931 isoform X2 [Nelumbo 
nucifera]
Length=144

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +3

Query  54   INVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKKFKCASIFSI  233
            ++ D CR KAM+IA    GVISV++D++K +LVV+G GVD+  L   L+KK     + +I
Sbjct  1    MHCDDCRHKAMRIAAEAYGVISVSLDDSKEKLVVVGDGVDTTCLTTMLRKKVGYTVLVTI  60

Query  234  EE  239
            EE
Sbjct  61   EE  62



>gb|KHN44584.1| hypothetical protein glysoja_027195 [Glycine soja]
Length=171

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I L ++ DKCR KA+KIA  V GV SV+++ +   ++ V GV VD   L   LK
Sbjct  1    MKQKIVIKLKMDCDKCRNKALKIAAEVPGVTSVSLEGDDNDRVAVTGVNVDMVCLANQLK  60

Query  201  KKFKCASIFSIEEV  242
            KKF   +I ++E++
Sbjct  61   KKFSSVTIPTVEDL  74



>ref|XP_010096497.1| hypothetical protein L484_017949 [Morus notabilis]
 gb|EXB64617.1| hypothetical protein L484_017949 [Morus notabilis]
Length=76

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + +  +KCR KA+K+     GVI V ++ EAK ++VVIG GVD+  L K L+
Sbjct  1    MKQKIVMKVAMKCNKCRTKALKVVAAKDGVIYVGLEGEAKDKVVVIGDGVDAIDLAKALR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A I +I  V
Sbjct  61   KKMGGADIITIAAV  74



>gb|EMT17918.1| hypothetical protein F775_02490 [Aegilops tauschii]
Length=183

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +3

Query  21   SMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCL  197
            +MKQKI I L ++ DK R+KA+ +A   AGV S+ I  +A+ +L V+G GVD   L+ CL
Sbjct  56   AMKQKIVIQLSMSCDKSRSKALTLAARAAGVTSMGITGDARDKLEVVGDGVDPVCLVSCL  115

Query  198  KKKFKCASI  224
            +KK   A I
Sbjct  116  RKKLGHAQI  124



>ref|XP_011069516.1| PREDICTED: uncharacterized protein LOC105155344, partial [Sesamum 
indicum]
Length=65

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  63   DKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKKFKCASIFSIEEV  242
            DK ++KAMKIAV + GV SV++ +   QL V+G GVDS  L K L+KKF  A I S++EV
Sbjct  4    DKAKSKAMKIAVAMEGVSSVSVGKDNDQLQVVGEGVDSVCLAKSLRKKFCFADIVSVQEV  63



>ref|XP_003589925.1| ATFP4-like protein [Medicago truncatula]
Length=117

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLKK  203
            KQKI I +P+N  K R KAM IAVGV+GV    I  + K Q+ V G  +DS  L   L+K
Sbjct  3    KQKIVIRVPMNNQKLRNKAMAIAVGVSGVEGATIKGDNKDQIEVTGEEIDSVKLASLLRK  62

Query  204  KFKCASIFSIEEV  242
            KF  A + SIE V
Sbjct  63   KFGYADLVSIEAV  75



>ref|XP_003594348.1| hypothetical protein MTR_2g027600 [Medicago truncatula]
 gb|ABN08867.1| Heavy metal transport/detoxification protein [Medicago truncatula]
 gb|AES64599.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=77

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + +   KCR KA+++  G  GV  V ++ + K ++VVIG GVD+  L KCL+
Sbjct  1    MKQKIVMRVHMRCQKCRTKALEVVAGANGVNFVGLEGDEKDKIVVIGDGVDAVTLTKCLR  60

Query  201  KKFKCASIFSIEEV  242
            KK     I S+ EV
Sbjct  61   KKVGQTEIVSLGEV  74



>ref|XP_010260986.1| PREDICTED: uncharacterized protein LOC104599931 isoform X1 [Nelumbo 
nucifera]
Length=147

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +3

Query  54   INVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKKFKCASIFSI  233
            ++ D CR KAM+IA    GVISV++D++K +LVV+G GVD+  L   L+KK     + +I
Sbjct  1    MHCDDCRHKAMRIAAEAYGVISVSLDDSKEKLVVVGDGVDTTCLTTMLRKKVGYTVLVTI  60

Query  234  EE  239
            EE
Sbjct  61   EE  62



>emb|CDY29800.1| BnaC05g31900D [Brassica napus]
Length=146

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +3

Query  42   ISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKKKFKCA  218
            I L +N D+CR KAM++AV   GVISV I+ E+   LVV+G G+D+  L+  L+KK   A
Sbjct  3    IKLSVNCDRCRRKAMEVAVNAKGVISVAIEGESGDDLVVVGDGIDAACLVDTLRKKACYA  62

Query  219  SIFSIEEV  242
             + ++EEV
Sbjct  63   MLETLEEV  70



>emb|CDY25395.1| BnaA05g18890D [Brassica napus]
Length=121

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  36   ITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKKKFK  212
            + I L +N D+CR KAM++AV   GVISV I+ E + +LVV+G G+D+  L+  L+KK  
Sbjct  1    MCIKLSVNCDRCRRKAMEVAVNAKGVISVAIEGELEDELVVVGDGIDAACLVDTLRKKAC  60

Query  213  CASIFSIEEV  242
             A + ++EE 
Sbjct  61   YAMLETLEET  70



>gb|KDP22994.1| hypothetical protein JCGZ_01716 [Jatropha curcas]
Length=119

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + ++  K R+KAMKIAVGVAGV S  +  + KSQ+ V+G GVD+  L   L+
Sbjct  1    MKQKIVIKVSMSSQKSRSKAMKIAVGVAGVESAALGGQDKSQIEVVGDGVDAVKLTTLLR  60

Query  201  KKFKCASIFSIEEV  242
            K+   + + S+  V
Sbjct  61   KQVGYSELVSVSAV  74



>ref|XP_008344748.1| PREDICTED: uncharacterized protein LOC103407626 [Malus domestica]
Length=115

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 2/74 (3%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLKK  203
            + KI + +P++ DKCR KA+KIA    GV  V+I+ A K  + VIG  VDS  L + L+K
Sbjct  4    QMKIVVKVPMHCDKCRTKALKIAAAAHGVSKVSIEGANKDHVEVIGDDVDSVCLTRSLRK  63

Query  204  KFKCA-SIFSIEEV  242
            K  C+ +I  +EEV
Sbjct  64   KLGCSCTIVKVEEV  77



>ref|XP_008353240.1| PREDICTED: uncharacterized protein LOC103416792 [Malus domestica]
Length=111

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 2/74 (3%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLKK  203
            + KI + +P++ DKCR KA+KIA    GV  V+I+ A K  + VIG  VDS  L + L+K
Sbjct  4    QMKIVVKVPMHCDKCRTKALKIAAAAHGVSKVSIEGANKDHVEVIGDDVDSVCLTRSLRK  63

Query  204  KFKCA-SIFSIEEV  242
            K  C+ +I  +EEV
Sbjct  64   KLGCSCTIVKVEEV  77



>ref|XP_006452704.1| hypothetical protein CICLE_v10010525mg, partial [Citrus clementina]
 gb|ESR65944.1| hypothetical protein CICLE_v10010525mg, partial [Citrus clementina]
Length=180

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +3

Query  18   FSMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKC  194
            +S  QKI I + I   KCR KAMKIAV   GVI V I  E K +LVVIG  VDS  L + 
Sbjct  57   YSHFQKIVIKVQITCKKCRRKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRK  116

Query  195  LKKKFKCASIFSIE  236
            L+KK   AS+ S++
Sbjct  117  LQKKLGFASLLSVQ  130



>gb|KDP22991.1| hypothetical protein JCGZ_01713 [Jatropha curcas]
Length=123

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + ++  K R+KAMKIAVGVAGV S  +  + KSQ+ V+G GVD+  L   L+
Sbjct  1    MKQKIVIKVSMSSQKSRSKAMKIAVGVAGVESAALRGQDKSQIEVVGDGVDAVKLTTLLR  60

Query  201  KKFKCASIFSIEEV  242
            K+   + + S+  V
Sbjct  61   KQIGYSELVSVSAV  74



>ref|XP_008348826.1| PREDICTED: uncharacterized protein LOC103411991 isoform X1 [Malus 
domestica]
Length=130

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLV-VIGVGVDSFVLIKCLKK  203
            + KI + +P++ DKCR KAMKIA    G   V+I+ A   LV VIG  VDS  L + L+K
Sbjct  4    QMKIVVKVPMHCDKCRRKAMKIAARAQGASKVSIEGANKDLVEVIGDDVDSVCLTRSLRK  63

Query  204  KFKCA-SIFSIEEV  242
            KF C+  +  +EEV
Sbjct  64   KFGCSCDLVKVEEV  77



>ref|XP_007212970.1| hypothetical protein PRUPE_ppa021120mg, partial [Prunus persica]
 gb|EMJ14169.1| hypothetical protein PRUPE_ppa021120mg, partial [Prunus persica]
Length=73

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            M QKI I + +   K RAKAMKIA    GV SV   +E K Q+V+IG GVD+  L  CL+
Sbjct  1    MMQKIVIEVQMRSRKHRAKAMKIAAVADGVNSVAFNEEKKDQMVIIGDGVDAASLALCLR  60

Query  201  KKFKCASIFSIEE  239
            KK   A++  +EE
Sbjct  61   KKVGHANLVKVEE  73



>ref|XP_004978065.1| PREDICTED: uncharacterized protein LOC101770792 [Setaria italica]
Length=110

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I L +  DK R+KAM +A    GV  + I  + K +L V G GVD+  L++CL+
Sbjct  1    MKQKIVIKLSVASDKSRSKAMVLAAKADGVSKMGITGDGKDRLEVEGDGVDAVCLVECLR  60

Query  201  KKFKCASIFSIEEV  242
            +K   A I  +EEV
Sbjct  61   RKVGHAEILQVEEV  74



>ref|XP_002447997.1| hypothetical protein SORBIDRAFT_06g019480 [Sorghum bicolor]
 gb|EES12325.1| hypothetical protein SORBIDRAFT_06g019480 [Sorghum bicolor]
Length=118

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  12   IAFSMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLI  188
            +A  +KQ+I I + +  DKCR  A+ +A    GV SV I+ E K QLVV+G GVD+  L 
Sbjct  1    MAIIIKQRIVIKVQMTCDKCRKSALALACSTYGVQSVGIEGEDKDQLVVVGDGVDATCLT  60

Query  189  KCLKKKFK  212
             CL+KK K
Sbjct  61   SCLRKKVK  68



>ref|XP_008348827.1| PREDICTED: uncharacterized protein LOC103411991 isoform X2 [Malus 
domestica]
Length=129

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +3

Query  33   KITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLV-VIGVGVDSFVLIKCLKKKF  209
            KI + +P++ DKCR KAMKIA    G   V+I+ A   LV VIG  VDS  L + L+KKF
Sbjct  5    KIVVKVPMHCDKCRRKAMKIAARAQGASKVSIEGANKDLVEVIGDDVDSVCLTRSLRKKF  64

Query  210  KCA-SIFSIEEV  242
             C+  +  +EEV
Sbjct  65   GCSCDLVKVEEV  76



>ref|XP_011009814.1| PREDICTED: uncharacterized protein LOC105114819 [Populus euphratica]
Length=121

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + ++  K R+K+++IAVG +GV S  +  + KSQ+ V+G GVD+  L  CL+
Sbjct  1    MKQKIVIKVTVSGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNCLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A I S+  V
Sbjct  61   KKVGYAEIVSVAAV  74



>gb|EMT11065.1| hypothetical protein F775_02341 [Aegilops tauschii]
Length=105

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I + +  DKCR+KAM +   V GV  V I  + + QL V+G GVD+  L  CL+
Sbjct  1    MKQKMVIRVQMTCDKCRSKAMGLVASVHGVERVEIQGDDRDQLAVVGDGVDAANLTACLR  60

Query  201  KKFKCASIFSI  233
            KK   A + ++
Sbjct  61   KKIGNADLLTL  71



>ref|XP_007020579.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
 gb|EOY12104.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
Length=155

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + ++ DKCR KA+KIA    GVISV +    K +L+++G G+D+  L   L+
Sbjct  1    MKQKIVIKVSMHCDKCRTKALKIAAAADGVISVELQGPEKDKLMIVGDGIDAACLTWYLR  60

Query  201  KKFKCASI  224
            KK   AS+
Sbjct  61   KKLSHASL  68



>ref|XP_003601492.1| ATFP4 [Medicago truncatula]
Length=220

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +3

Query  21   SMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCL  197
            S++QKI I +P+N  K R KAM IAVGV+GV    I  + K Q+ V G  +DS  L   L
Sbjct  104  SIQQKIVIRVPMNNQKLRNKAMAIAVGVSGVEGTTIKGDNKDQIEVTGEEIDSVKLASLL  163

Query  198  KKKFKCASIFSIEEV  242
            +KKF  A + SIE V
Sbjct  164  RKKFGYADLVSIEAV  178



>ref|XP_008344729.1| PREDICTED: uncharacterized protein LOC103407607 [Malus domestica]
Length=124

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +3

Query  33   KITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKKKF  209
            KI + +P++ DKCR KA KIA    GV  V+I+ E K  + VIG GVDS  L + L+KK 
Sbjct  6    KIVVKVPMHCDKCRRKAXKIAARAQGVSKVSIEGENKDLVEVIGDGVDSVCLTRSLRKKL  65

Query  210  KCA-SIFSIEEV  242
             C+ +I  +EEV
Sbjct  66   GCSCTIVKVEEV  77



>ref|XP_002524589.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37797.1| conserved hypothetical protein [Ricinus communis]
Length=64

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I + +N DK R+KA++I V   GV S ++ E  KSQLVV+G GVD+  L   L+
Sbjct  1    MKQKMVIKVEMNGDKSRSKALQIIVSSYGVTSASLGEKDKSQLVVVGEGVDAVKLTNSLR  60

Query  201  KKF  209
            KK 
Sbjct  61   KKL  63



>ref|XP_007208673.1| hypothetical protein PRUPE_ppa023968mg [Prunus persica]
 gb|EMJ09872.1| hypothetical protein PRUPE_ppa023968mg [Prunus persica]
Length=107

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            M QKI I + +    CR KA+KIA    GV +V+ID  K+ + VIG+GVD+  L + L+K
Sbjct  1    MGQKIVIKVQLTSQNCRTKALKIAAEAKGVSNVSIDVEKAVVEVIGIGVDAVSLAQSLEK  60

Query  204  KFKCASIFSIEEV  242
            +   ASI S+ EV
Sbjct  61   QLGFASIVSVGEV  73



>ref|XP_004296129.1| PREDICTED: uncharacterized protein LOC101294055 [Fragaria vesca 
subsp. vesca]
Length=126

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  15   AFSMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKC  194
            A S+KQKI I +  + +K + +A K+A G  GV +V+++  K Q+VVIGVG+DS  L K 
Sbjct  22   ASSVKQKIVIKVQFSSEKRKTEAFKVAAGFRGVSNVSVEADKDQVVVIGVGIDSVCLAKS  81

Query  195  LKKKFKCASIFS  230
            L+KK   A I S
Sbjct  82   LRKKLSYAVIVS  93



>ref|XP_002313367.2| hypothetical protein POPTR_0009s05280g [Populus trichocarpa]
 gb|EEE87322.2| hypothetical protein POPTR_0009s05280g [Populus trichocarpa]
Length=114

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I +     K R+KA++IAVG++GV S  +  E KSQ+ V+G GVD+  L   L+
Sbjct  1    MKQKIVIKVTGKGPKSRSKALQIAVGLSGVESAGLGGEDKSQIEVVGDGVDAVQLTNLLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+E V
Sbjct  61   KKVGYAELASVEAV  74



>gb|EMT17914.1| hypothetical protein F775_22425 [Aegilops tauschii]
Length=172

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKK  203
            KQKI I L ++ DK R+KA+ +A   AGV S+ I  +A+ QL V+G GVD   L+ CL+K
Sbjct  54   KQKIVIQLSMSCDKRRSKALTLASRAAGVTSMGITGDARDQLEVVGDGVDPVCLVSCLRK  113

Query  204  KFKCASI  224
            K   A I
Sbjct  114  KLGHAHI  120



>dbj|BAD17465.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD29339.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ23593.1| hypothetical protein OsJ_07292 [Oryza sativa Japonica Group]
Length=119

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLKK  203
            KQKI I + +  DKCR+KAM +     GV SV +  + K QLVV+G GVDS  L   L+K
Sbjct  3    KQKIVIKMNMASDKCRSKAMALVASTTGVDSVALAGDGKDQLVVVGDGVDSIELTTALRK  62

Query  204  KFKCASIFSI  233
            K   A++ ++
Sbjct  63   KVGHATLMTV  72



>ref|XP_006583442.1| PREDICTED: uncharacterized protein LOC100812612 [Glycine max]
 gb|KHN44586.1| hypothetical protein glysoja_027197 [Glycine soja]
Length=123

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + ++ DK R+KA+KIA    GV SV ++ + K +L V G  VD+  L + L+
Sbjct  1    MKQKIVLQMQLDSDKSRSKALKIAAQEIGVSSVALEGDNKDKLTVTG-DVDAVHLGRVLR  59

Query  201  KKFKCASIFSIEEV  242
            KKF+C ++ S+EEV
Sbjct  60   KKFQCVTLVSVEEV  73



>gb|KCW58915.1| hypothetical protein EUGRSUZ_H01538 [Eucalyptus grandis]
Length=130

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +3

Query  42   ISLPINVDKCRAKAMKIAVGVAG-VISVNIDE-AKSQLVVIGVGVDSFVLIKCLKKKFKC  215
            I +P+N DKCR++A++I     G +ISV+I    + +LVV G GVD   L++ L+KKF+ 
Sbjct  3    IRMPMNSDKCRSRALRIVARAKGTIISVSIGGLNEDELVVTGEGVDPATLVQSLRKKFRQ  62

Query  216  ASIFSIEEV  242
             +I S++++
Sbjct  63   VTILSVQQI  71



>ref|XP_006387353.1| hypothetical protein POPTR_1183s00200g [Populus trichocarpa]
 gb|ERP46267.1| hypothetical protein POPTR_1183s00200g [Populus trichocarpa]
Length=128

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +3

Query  9    NIAFSMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVL  185
            N A S++QKI I +     K R+KA++IAVG++GV S  +  + KSQ+ V+G GVD+  L
Sbjct  10   NYAKSLQQKIVIKVTGKGPKSRSKALQIAVGLSGVESAGLGGQDKSQIEVVGDGVDAVQL  69

Query  186  IKCLKKKFKCASIFSIEEV  242
               L+KK   A + S+E V
Sbjct  70   TNLLRKKVGYAELASVEAV  88



>ref|XP_008393331.1| PREDICTED: uncharacterized protein LOC103455520 [Malus domestica]
Length=139

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +3

Query  33   KITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKKFK  212
            KI + +P++ DKCR KAMKIA    GV  V+ID  K  + VIG  VD F L+K L+K+F 
Sbjct  2    KIVVKVPMHCDKCRRKAMKIAARAQGVSKVSID--KDLVEVIGDDVDPFCLMKSLRKRFG  59

Query  213  CA  218
            C 
Sbjct  60   CC  61



>ref|XP_002320539.2| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
 gb|EEE98854.2| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
Length=123

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +3

Query  18   FSMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKC  194
             +MKQKI I + +N  K R+K+++IAVG +GV S  +  + KSQ+ V+G GVD+  L   
Sbjct  1    MTMKQKIVIKVTVNGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNR  60

Query  195  LKKKFKCASIFSIEEV  242
            L+KK   A I S+  V
Sbjct  61   LRKKVGYAEIVSVAAV  76



>ref|XP_008353688.1| PREDICTED: uncharacterized protein LOC103417272 [Malus domestica]
Length=122

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            M+QKI + + ++ DKCR KA+KIA    GV  V+I+   K  L V G GVDS  L   L+
Sbjct  1    MEQKIIVKVEMHCDKCRTKALKIAAAAYGVSKVSIEGTDKDHLEVRGDGVDSVRLTGLLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A+I  IE+V
Sbjct  61   KKVGFATIVQIEQV  74



>ref|NP_188653.1| putative copper transport protein [Arabidopsis thaliana]
 gb|AEE76344.1| putative copper transport protein [Arabidopsis thaliana]
Length=118

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  36   ITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKKKFK  212
            + I L +N +KCR KAM++AV   GV SV ++ E + +LVV+G GVDS  LI  L+KK  
Sbjct  1    MRIKLSVNSEKCRKKAMQVAVAADGVTSVAMEGEFQDELVVVGDGVDSASLIMALRKKAC  60

Query  213  CASIFSIEEV  242
              ++ ++EEV
Sbjct  61   HVTLETLEEV  70



>ref|XP_008344749.1| PREDICTED: uncharacterized protein LOC103407627 [Malus domestica]
Length=111

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKK  206
            + KI + +P++ DKCR KA+KIA    GV  V+ID  K  + VIG  VD F L+K L+K+
Sbjct  4    QMKIVVKVPMHCDKCRTKALKIAAAAHGVSKVSID--KDLVEVIGDDVDPFCLMKSLRKR  61

Query  207  FKC  215
            F C
Sbjct  62   FGC  64



>ref|XP_002266819.2| PREDICTED: uncharacterized protein LOC100242530 [Vitis vinifera]
Length=152

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  21   SMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCL  197
            +MK+K+ I + +N +K R+K++K+AVGVAGV S  +  + K+Q+ VIG G+D+  L   L
Sbjct  34   TMKKKMVIKVTMNGEKSRSKSLKVAVGVAGVESAALQGQEKNQIEVIGEGIDAVALTTLL  93

Query  198  KKKFKCASIFSI  233
            +KK   A + S+
Sbjct  94   RKKVGFAELVSV  105



>ref|XP_010251773.1| PREDICTED: uncharacterized protein LOC104593570 [Nelumbo nucifera]
Length=134

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I +P+N  K R K  KIAVG+ GV S ++  E KSQ+VV G  +DS  L   L+
Sbjct  1    MKQKVVIKVPVNGSKSRTKNHKIAVGIQGVESASLQGEDKSQIVVEGEWIDSITLTVSLR  60

Query  201  KKFKCASI  224
            K    A +
Sbjct  61   KSLGSAEL  68



>ref|XP_004952921.1| PREDICTED: uncharacterized protein LOC101786087 isoform X2 [Setaria 
italica]
Length=125

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLKK  203
            KQKI I + ++ DKCR+KAM +     GV SV +  + K Q+VV+G GVDS  L + L+K
Sbjct  3    KQKIVIKVQMSSDKCRSKAMALVASTGGVDSVALAGDGKDQVVVVGEGVDSIKLTEALRK  62

Query  204  KFKCASIFSIEE  239
            K   A +  + E
Sbjct  63   KVGDAQLVQVGE  74



>ref|XP_010466200.1| PREDICTED: uncharacterized protein LOC104746425 [Camelina sativa]
Length=126

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I L  N DKCR KAMK AV   GV SV ++ E   +LVV+G  VD+  L+  L+
Sbjct  1    MKQKMRIKLSENSDKCRKKAMKAAVVAKGVTSVAVEGEFDDKLVVVGNDVDAARLVIELR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A++ ++EEV
Sbjct  61   KKACFATLETLEEV  74



>ref|XP_007049439.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
 gb|EOX93596.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
Length=121

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ + + +N  K R+KA+KIAVG+AGV S ++  + KSQ+ + G GVD   L   L+
Sbjct  1    MKQKMVVKVTLNGHKSRSKALKIAVGLAGVESASLKGDDKSQIEITGEGVDPVQLTSLLR  60

Query  201  KKFKCASIFSIEEV  242
            K    A + S+  V
Sbjct  61   KSVGHAELVSVSAV  74



>gb|KHN44735.1| hypothetical protein glysoja_032074 [Glycine soja]
Length=128

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +   KCR+KA+KIA    GV S+  + E   QLVV G G+D+  L   ++
Sbjct  1    MKQKIVIRMHVEDGKCRSKALKIAAVCQGVQSLAFEGETSDQLVVTGEGIDAVFLTNRMR  60

Query  201  KKFKCASIFS  230
            KKF  A++ S
Sbjct  61   KKFSYATLLS  70



>ref|XP_004294695.1| PREDICTED: uncharacterized protein LOC101309518 [Fragaria vesca 
subsp. vesca]
Length=127

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQK+ I L ++ +K R+KAMK AVGV GV S ++   K Q+ V G  VD  +L   L+K
Sbjct  1    MKQKVVIKLSVHDEKSRSKAMKTAVGVDGVDSASLPMDKDQIEVTGNDVDVVLLTTLLRK  60

Query  204  KFKCASIFSI  233
              K A + S+
Sbjct  61   TVKHAEVVSV  70



>ref|XP_011032086.1| PREDICTED: uncharacterized protein LOC105131028 isoform X1 [Populus 
euphratica]
 ref|XP_011032088.1| PREDICTED: uncharacterized protein LOC105131029 isoform X1 [Populus 
euphratica]
Length=128

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
             +QKI I +  N  K R+KA++IAVG++GV S  +  E KSQ+ V+G GVD+  L   L+
Sbjct  15   WQQKIVIKVTGNGQKSRSKALQIAVGLSGVESAGLGGEDKSQVEVVGDGVDAVQLTNLLR  74

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+E V
Sbjct  75   KKVGYAELASVEAV  88



>emb|CBI28485.3| unnamed protein product [Vitis vinifera]
Length=213

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  21   SMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCL  197
            +MK+K+ I + +N +K R+K++K+AVGVAGV S  +  + K+Q+ VIG G+D+  L   L
Sbjct  34   TMKKKMVIKVTMNGEKSRSKSLKVAVGVAGVESAALQGQEKNQIEVIGEGIDAVALTTLL  93

Query  198  KKKFKCASIFSI  233
            +KK   A + S+
Sbjct  94   RKKVGFAELVSV  105



>ref|XP_004975911.1| PREDICTED: uncharacterized protein LOC101766713 [Setaria italica]
Length=188

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = +3

Query  3    KNNIAFSMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSF  179
            ++N   +MKQKI I + ++ +K R+KAM++     GV S+ +    K QL V+G GVD+ 
Sbjct  70   RSNQKQAMKQKIVIKVSMSSEKSRSKAMELVARADGVSSMGVTGNGKDQLEVVGDGVDTV  129

Query  180  VLIKCLKKKFKCASIFSI  233
             L+KCL+KK   A I  +
Sbjct  130  CLVKCLRKKLGHADILKV  147



>ref|XP_010668394.1| PREDICTED: serrate RNA effector molecule homolog [Beta vulgaris 
subsp. vulgaris]
Length=167

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +   KCR +AMKIA    GV+SV +  + K ++VV+G  VDS  L   L+
Sbjct  1    MKQKIVIKVQMRCGKCRKEAMKIAASAEGVLSVTMQGKDKDEIVVVGNEVDSAGLCAALR  60

Query  201  KKFKCASIFSIEEV  242
            KK   + + S+EEV
Sbjct  61   KKVGVSDLLSVEEV  74



>ref|XP_002448002.1| hypothetical protein SORBIDRAFT_06g019520 [Sorghum bicolor]
 gb|EES12330.1| hypothetical protein SORBIDRAFT_06g019520 [Sorghum bicolor]
Length=107

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I L +  DKCR+KAM +A    GV  + I  + K QL V G G+D+  L+ CL+
Sbjct  1    MKQKIVIRLSVASDKCRSKAMVLAAKADGVSKMGITGDGKDQLEVEGDGIDTVCLVNCLR  60

Query  201  KKFKCASI  224
            KK   A I
Sbjct  61   KKIGRADI  68



>ref|XP_004952918.1| PREDICTED: uncharacterized protein LOC101784893 [Setaria italica]
Length=139

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +  D+CR+KA+ +     GV SV +  +A+ QLVV+G GVDS  L   L+
Sbjct  1    MKQKIVIRVEMTCDRCRSKALSLVAATRGVDSVALAGDARDQLVVVGDGVDSICLASALR  60

Query  201  KKFKCASIFSI  233
            KK   A I  +
Sbjct  61   KKVGPAEIVQV  71



>ref|XP_004978064.1| PREDICTED: uncharacterized protein LOC101770379 [Setaria italica]
Length=128

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID--EAKSQLVVIGVGVDSFVLIKCL  197
            MKQK+ I + +  ++ R++AM +     GV+S+ I   +A+ +L V+G GVD+  L+ CL
Sbjct  1    MKQKVVIKVSMPCERSRSRAMALVARAHGVLSMEITGGDARDKLEVVGDGVDAARLVSCL  60

Query  198  KKKFKCASIFSIEEV  242
            ++K   A I  +EEV
Sbjct  61   RRKLGHAEILLVEEV  75



>gb|EMS57370.1| hypothetical protein TRIUR3_01189 [Triticum urartu]
Length=118

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + ++ DK R+KAM +  G  GV SV I  ++K  L V+G GVD   L+ CL+
Sbjct  1    MKQKIVIKVSMSCDKSRSKAMTMVAGANGVSSVGITGDSKDMLEVVGNGVDPVCLVGCLR  60

Query  201  KKFK  212
            KK+ 
Sbjct  61   KKYH  64



>ref|XP_006469401.1| PREDICTED: uncharacterized protein LOC102626749 isoform X2 [Citrus 
sinensis]
Length=124

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            M QK+ I L +   K R+KA+KIAVGV+GV S ++  + KSQ+ V G G+D  +L   L+
Sbjct  1    MTQKVVIKLTLEGHKSRSKALKIAVGVSGVESASLKGDDKSQIEVTGDGMDPVLLTSLLR  60

Query  201  KKFKCASIFSI  233
            KK   A + S+
Sbjct  61   KKVGYAELVSV  71



>tpg|DAA37388.1| TPA: ATFP4 [Zea mays]
Length=136

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI I + +  ++ R KAM +A G  GVISV I  A  +L V+G  VD   L  CL++
Sbjct  1    MKQKIVIKVSMPCERSRTKAMTLAAGANGVISVAI--AGEKLEVVGDDVDPVRLASCLRR  58

Query  204  KFKCASIFSIEEV  242
            K   A I  +EEV
Sbjct  59   KVGHADILQVEEV  71



>emb|CAH67426.1| OSIGBa0150F01.6 [Oryza sativa Indica Group]
Length=132

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I + +   KCR+KAM +  G  GV SV +  + K +L V+G GVD   ++  L+
Sbjct  1    MKQKMVIKVSMPCGKCRSKAMALVAGATGVSSVEVTGDGKDRLQVVGDGVDPVCVVNRLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A I  +EEV
Sbjct  61   KKIGHAEIVQVEEV  74



>ref|XP_010241736.1| PREDICTED: uncharacterized protein LOC104586261, partial [Nelumbo 
nucifera]
Length=85

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + ++ + CR+KAMKIA    GV SV ++ + K +LVV+G  VDS  L + L+
Sbjct  1    MKQKIVIKVDMHCNDCRSKAMKIAASTQGVTSVALEGDFKDKLVVMGEEVDSTCLTRLLR  60

Query  201  KKFKCASIFSI  233
            KK   A I +I
Sbjct  61   KKVGHAVIVTI  71



>ref|XP_004952919.1| PREDICTED: uncharacterized protein LOC101785283 [Setaria italica]
Length=127

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLKK  203
            KQKI I + ++ DKCR+KAM +     GV+SV I  A + Q+VV+G GVDS  L   L+K
Sbjct  3    KQKIVIKVQMSCDKCRSKAMALVAAKGGVVSVAIAGADRDQVVVVGEGVDSIELTSTLRK  62

Query  204  KFKCASIFSIEE  239
            K   A +  + E
Sbjct  63   KVGPAQLVQVGE  74



>ref|XP_008809609.1| PREDICTED: uncharacterized protein LOC103721257 isoform X1 [Phoenix 
dactylifera]
Length=117

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MK+++ I++ +N +KCR+KAM++A    GV SV +D  K+QLVV+G   D  +L   L+K
Sbjct  1    MKKEMVINVQMNCEKCRSKAMQLAASAGGVDSVKVDGEKNQLVVVG-EADPVILTGILRK  59

Query  204  KFKCASIFSIEEV  242
            K   + I  + EV
Sbjct  60   KIGHSVIVKVAEV  72



>emb|CAE06009.3| OSJNBa0016O02.19 [Oryza sativa Japonica Group]
Length=150

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I + +   KCR+KAM +  G  GV SV +  + K +L V+G GVD   ++  L+
Sbjct  1    MKQKMVIKVSMPCGKCRSKAMALVAGATGVSSVEVTGDGKDRLQVVGDGVDPVCVVNRLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A I  +EEV
Sbjct  61   KKIGHAEIVQVEEV  74



>ref|XP_009339284.1| PREDICTED: uncharacterized protein LOC103931498 [Pyrus x bretschneideri]
Length=123

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            M+QKI + + ++ DKCR KA+KIA    GV  V+++ E K  L VIG  VD   L + L+
Sbjct  1    MQQKILVKVQMHCDKCRTKALKIAAAAYGVSKVSLEGENKDHLEVIGDDVDFVCLTRSLR  60

Query  201  KKFKCA-SIFSIEEV  242
            KK  C+ +I  +E+V
Sbjct  61   KKLGCSCTIVEVEKV  75



>ref|XP_002448006.1| hypothetical protein SORBIDRAFT_06g019560 [Sorghum bicolor]
 gb|EES12334.1| hypothetical protein SORBIDRAFT_06g019560 [Sorghum bicolor]
Length=111

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + ++ +K R+KAM +     GV S+ I  + K +L V+GV VD+  L+ CL+
Sbjct  1    MKQKIVIKVSMSSEKSRSKAMALVARADGVSSMGIVGDGKDRLEVVGVDVDTVCLVTCLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A I  ++EV
Sbjct  61   KKLGHADILLVDEV  74



>ref|XP_006447867.1| hypothetical protein CICLE_v10017001mg [Citrus clementina]
 gb|ESR61107.1| hypothetical protein CICLE_v10017001mg [Citrus clementina]
Length=164

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            M QK+ I L +   K R+KA+KIAVGV+GV S ++  + KSQ+ V G G+D  +L   L+
Sbjct  41   MTQKVVIKLTLEGHKSRSKALKIAVGVSGVESASLKGDDKSQIEVTGDGMDPVLLTSLLR  100

Query  201  KKFKCASIFSI  233
            KK   A + S+
Sbjct  101  KKVGYAELVSV  111



>gb|ACJ84180.1| unknown [Medicago truncatula]
 gb|AES76606.2| hypothetical protein MTR_6g082280 [Medicago truncatula]
Length=233

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I L ++ DKCR KA+K A  V GV SV+++   K  + VIG  VD+  L   LK
Sbjct  1    MKQKMVIKLQMDCDKCRNKALKTAAEVQGVTSVSLEGNDKDSICVIGDDVDTICLANQLK  60

Query  201  KKFKCASIFSI  233
            KKF   +I S+
Sbjct  61   KKFNSVTILSV  71



>ref|XP_006652383.1| PREDICTED: uncharacterized protein LOC102714171 [Oryza brachyantha]
Length=115

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            M+QKI I + +  +K R+K M +   V+GV SV +  + + +L V+G GVD   L+ CL+
Sbjct  1    MQQKIVIKVSMPCEKSRSKGMALVARVSGVSSVEVTGDCRDRLQVVGDGVDPVCLVHCLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A I  +EEV
Sbjct  61   KKVGHAEIVQVEEV  74



>ref|XP_002454080.1| hypothetical protein SORBIDRAFT_04g024270 [Sorghum bicolor]
 gb|EES07056.1| hypothetical protein SORBIDRAFT_04g024270 [Sorghum bicolor]
Length=127

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLKK  203
            KQKI I +P++ DK R+KAM +     GV SV I  + K Q+VV+G GVDS  L   L+K
Sbjct  3    KQKIVIKVPMSSDKSRSKAMALVAAAGGVHSVAIAGDGKDQVVVVGEGVDSIKLTTDLRK  62

Query  204  KFKCASIFSI  233
            K   A +  +
Sbjct  63   KMGDAQLVEV  72



>ref|XP_009124284.1| PREDICTED: early nodulin-75-like [Brassica rapa]
Length=172

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +  DK RAKAMK AV   GV +V I  + ++Q+ V GV VD   L   L+
Sbjct  1    MKQKILIRVTMTDDKARAKAMKTAVKFKGVSAVEIKGDHRNQIEVTGVEVDMIGLTNTLR  60

Query  201  KKFKCASIFSIEEV  242
            +K  CA + S+ +V
Sbjct  61   RKVACAELVSVNKV  74



>gb|EEE61156.1| hypothetical protein OsJ_15122 [Oryza sativa Japonica Group]
Length=126

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I + +   KCR+KAM +  G  GV SV +  + K +L V+G GVD   ++  L+
Sbjct  1    MKQKMVIKVSMPCGKCRSKAMALVAGATGVSSVEVTGDGKDRLQVVGDGVDPVCVVNRLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A I  +EEV
Sbjct  61   KKIGHAEIVQVEEV  74



>ref|XP_008809611.1| PREDICTED: uncharacterized protein LOC103721258 [Phoenix dactylifera]
Length=117

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MK+++ I++ +N +KCR+KAM++A   AGV SV +D  KSQLVV+G  VD  +L   L+K
Sbjct  1    MKKEMVINVQMNCEKCRSKAMQLAAS-AGVDSVKVDGEKSQLVVVG-EVDPVILTGNLRK  58

Query  204  KFKCASIFSIEEV  242
            K   + I  + +V
Sbjct  59   KIGHSEIVKVADV  71



>ref|XP_007217188.1| hypothetical protein PRUPE_ppa013552mg [Prunus persica]
 gb|EMJ18387.1| hypothetical protein PRUPE_ppa013552mg [Prunus persica]
Length=117

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLP-INVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I L  ++ +K RAKAMK AVGV GV S ++ + K  + V G GVD  +L   L+
Sbjct  1    MKQKVVIKLSALHDEKSRAKAMKTAVGVDGVNSASLQQDKGLIEVTGDGVDVVLLTTLLR  60

Query  201  KKFKCASIFSIEEV  242
            K  K A + S+  V
Sbjct  61   KSLKHADVVSVNSV  74



>ref|NP_001151460.1| ATFP4 [Zea mays]
 gb|ACG42942.1| ATFP4 [Zea mays]
Length=133

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI I + +   + R KAM +A G  GVISV I  A  +L V+G  VD   L  CL++
Sbjct  1    MKQKIVIKVSMPCQRSRTKAMTLAAGANGVISVAI--AGEKLEVVGDDVDPVRLASCLRR  58

Query  204  KFKCASIFSIEEV  242
            K   A I  +EEV
Sbjct  59   KVGHADILHVEEV  71



>gb|KEH15709.1| heavy metal transport/detoxification superfamily protein, partial 
[Medicago truncatula]
Length=75

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +3

Query  30   QKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKKK  206
            QKI + + +   KCR KA+++  G  GV  V ++ + K ++VVIG GVD+  L KCL+KK
Sbjct  1    QKIVMRVHMRCQKCRTKALEVVAGANGVNFVGLEGDEKDKIVVIGDGVDAVTLTKCLRKK  60

Query  207  FKCASIFSIEEV  242
                 I S+ EV
Sbjct  61   VGQTEIVSLGEV  72



>gb|KDP22988.1| hypothetical protein JCGZ_01710 [Jatropha curcas]
Length=134

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I + +N DK R+KA++IAVG+ GV S  + E  K+QL VIG GVD   L   L+
Sbjct  1    MKQKMVIRVCMNGDKSRSKALQIAVGIYGVESAALGEKDKNQLEVIGEGVDPVKLTASLR  60

Query  201  KKFKCASIFS  230
            KK    ++ S
Sbjct  61   KKMAKPNLLS  70



>ref|XP_006469400.1| PREDICTED: uncharacterized protein LOC102626749 isoform X1 [Citrus 
sinensis]
Length=145

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            ++QK+ I L +   K R+KA+KIAVGV+GV S ++  + KSQ+ V G G+D  +L   L+
Sbjct  22   LQQKVVIKLTLEGHKSRSKALKIAVGVSGVESASLKGDDKSQIEVTGDGMDPVLLTSLLR  81

Query  201  KKFKCASIFSI  233
            KK   A + S+
Sbjct  82   KKVGYAELVSV  92



>ref|XP_002524590.1| metal ion binding protein, putative [Ricinus communis]
 gb|EEF37798.1| metal ion binding protein, putative [Ricinus communis]
Length=125

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I + +N  K R+KA+KIAV V+GV S ++  + KSQ+ V+G GVD+  L   L+
Sbjct  1    MKQKVVIRVSMNGQKSRSKALKIAVSVSGVESASLGGQDKSQIEVVGDGVDAVELATMLR  60

Query  201  KKFKCASIFSIEEV  242
            K    A + S+  V
Sbjct  61   KNVGHAELVSVSAV  74



>ref|XP_009419205.1| PREDICTED: uncharacterized protein LOC103999243 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=115

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +3

Query  30   QKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKKK  206
            +KI I + I  DKCR+KAM++     GV SV I+ E K QLV++G GVD   +   L+KK
Sbjct  2    KKIVIRVQIKCDKCRSKAMQLVAEADGVDSVAIEGENKDQLVIVGDGVDPANVTLVLRKK  61

Query  207  FKCASIFSIEEV  242
               A+I  +EEV
Sbjct  62   VGRATIVKVEEV  73



>ref|XP_007208761.1| hypothetical protein PRUPE_ppa027120mg [Prunus persica]
 gb|EMJ09960.1| hypothetical protein PRUPE_ppa027120mg [Prunus persica]
Length=119

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAV---GVAGVISVNIDEAKSQLVVIGVGVDSFVLIKC  194
            M+QKI   + IN +K + KA+K A    GV  V +V+++  K  + V GVGVDS  L K 
Sbjct  1    MQQKIVFKVQINSEKYKTKALKTAAKARGVYRVSNVSVEVEKELMEVTGVGVDSVCLAKS  60

Query  195  LKKKFKCASIFSIEE  239
            L+KK   A+I S+EE
Sbjct  61   LQKKLGYATIVSVEE  75



>ref|XP_007213144.1| hypothetical protein PRUPE_ppa024668mg [Prunus persica]
 gb|EMJ14343.1| hypothetical protein PRUPE_ppa024668mg [Prunus persica]
Length=76

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  30   QKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKKF  209
            +KI + +P+N  KC+ KA KI     GV  + + E +  +VVIG GVD+  L K L+KKF
Sbjct  6    KKIEMKVPMNCQKCQQKAFKIIAEADGVTFLGLREERDIVVVIGQGVDACNLAKSLRKKF  65

Query  210  KCASIFSIEEV  242
            K   I ++ +V
Sbjct  66   KTTDIITVADV  76



>gb|EYU21091.1| hypothetical protein MIMGU_mgv1a018053mg [Erythranthe guttata]
Length=123

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +3

Query  48   LPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLKKKFKCASI  224
            + I+ DKCR+KA+K AVG++GV SV +  + K Q+ ++G G+DS  L + L+K    A +
Sbjct  1    MSIHSDKCRSKALKNAVGISGVESVTVTGQDKDQVELVGDGIDSVELTRQLRKNVAHAEL  60

Query  225  FSIEEV  242
             S+ EV
Sbjct  61   LSVGEV  66



>ref|XP_003620388.1| Mitochondrial protein, putative [Medicago truncatula]
Length=313

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I L ++ DKCR KA+K A  V GV SV+++   K  + VIG  VD+  L   LK
Sbjct  81   MKQKMVIKLQMDCDKCRNKALKTAAEVQGVTSVSLEGNDKDSICVIGDDVDTICLANQLK  140

Query  201  KKFKCASIFSI  233
            KKF   +I S+
Sbjct  141  KKFNSVTILSV  151



>ref|XP_002533038.1| metal ion binding protein, putative [Ricinus communis]
 gb|EEF29346.1| metal ion binding protein, putative [Ricinus communis]
Length=119

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MK+KI I +    +KCR KAM+ A    GV SV ++ + K +LVVIG  VD+  L K L+
Sbjct  1    MKKKIVIKVSTCCEKCRTKAMQTAAVADGVNSVALEGDDKDKLVVIGEMVDAACLTKALR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A I ++EEV
Sbjct  61   KKINYAEIVTVEEV  74



>ref|XP_004952920.1| PREDICTED: uncharacterized protein LOC101786087 isoform X1 [Setaria 
italica]
Length=167

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLKK  203
            +QKI I + ++ DKCR+KAM +     GV SV +  + K Q+VV+G GVDS  L + L+K
Sbjct  45   QQKIVIKVQMSSDKCRSKAMALVASTGGVDSVALAGDGKDQVVVVGEGVDSIKLTEALRK  104

Query  204  KFKCASIFSIEE  239
            K   A +  + E
Sbjct  105  KVGDAQLVQVGE  116



>ref|XP_004978062.1| PREDICTED: uncharacterized protein LOC101769152 [Setaria italica]
Length=143

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKK  203
            KQKI I + +  DKCR  A+ +A    GV SV I+ E + QLVV+G GVD+  L  CL+K
Sbjct  3    KQKIVIKVQMTCDKCRRSALTLAGSTYGVQSVAIEGEERDQLVVVGDGVDATSLASCLRK  62

Query  204  KFKC--ASIFSIEEV  242
              K   A I  +E V
Sbjct  63   AVKVGRADIIKVEAV  77



>ref|XP_007141682.1| hypothetical protein PHAVU_008G216200g [Phaseolus vulgaris]
 gb|ESW13676.1| hypothetical protein PHAVU_008G216200g [Phaseolus vulgaris]
Length=129

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +  DKCR +A++IA   +GV S+  D E   Q+VV G  VD+  L   ++
Sbjct  1    MKQKIVIKVNVASDKCRREALQIAAKCSGVQSIAFDGECNDQVVVTGDEVDAVSLTNQIR  60

Query  201  KKFKCASIFSIEEV  242
            KKF+ A + S++ V
Sbjct  61   KKFRYAKLISLKNV  74



>ref|XP_006469399.1| PREDICTED: uncharacterized protein LOC102626447 [Citrus sinensis]
Length=127

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I + +N  K R+KA+K+AVG +GV SV +  +  SQ+ V G GVD+  L   L+
Sbjct  1    MKQKMVIKVYMNKHKSRSKALKVAVGFSGVESVALKGDDMSQIEVTGDGVDAVALTTSLR  60

Query  201  KKFKCASIFSI  233
            KK   A + S+
Sbjct  61   KKVGYAEVVSV  71



>dbj|BAD26132.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD26204.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ43997.1| hypothetical protein OsJ_28619 [Oryza sativa Japonica Group]
Length=176

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKK  206
            KQKI + +P++ ++ + KA K AVG+ GV S ++D  K  L+VIG GVD   L   L++ 
Sbjct  3    KQKIVVKMPMDTERKKRKAFKAAVGMTGVTSASLDGDK--LIVIGDGVDPIALTTILRRS  60

Query  207  FKCASIFSI  233
               A + S+
Sbjct  61   LGHAELLSV  69



>ref|XP_009419465.1| PREDICTED: uncharacterized protein LOC103999434 [Musa acuminata 
subsp. malaccensis]
Length=160

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = +3

Query  12   IAFSMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLI  188
            I  S++QKI I + I  DKCR+KAMK+ V   GV SV I+ E K  LV++G  +D   L 
Sbjct  45   IHLSLQQKIVIKVQIKCDKCRSKAMKL-VAATGVDSVAIEGEDKDHLVIVGDDIDPANLT  103

Query  189  KCLKKKFKCASIFSIE  236
              L+KK   A+I  +E
Sbjct  104  CILRKKVGHANILKVE  119



>ref|XP_007020383.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
 gb|EOY11908.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
Length=114

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            M QKI I + I+ +KCR KA+KIA    GV  V I  +A+ +L VIG  VDS  L   L+
Sbjct  1    MTQKIVIKVNIHCEKCRTKALKIAATTHGVNEVAIKGKARDELTVIGNEVDSVKLACSLR  60

Query  201  KKFKCASIFSI  233
            KK + A+I S+
Sbjct  61   KKLRNATIVSV  71



>ref|XP_003547302.1| PREDICTED: uncharacterized protein LOC100776617 [Glycine max]
Length=77

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + +N  KCR KA+K+    +GV  V ++ E K +LVVIG  VD   L   L+
Sbjct  1    MKQKIVMKVHMNCQKCRTKALKVVAAASGVNFVGLEGEEKDKLVVIGDEVDPVKLTNSLR  60

Query  201  KKFKCASIFSIEEV  242
            KK     I S+ EV
Sbjct  61   KKVGHTDIISLAEV  74



>ref|XP_002885357.1| metal ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61616.1| metal ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=118

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  36   ITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKKKFK  212
            + I L +N +KCR KAM++AV   GV SV ++ E + +LVV+G GVD+  LI  L+KK  
Sbjct  1    MRIKLSVNSEKCRKKAMQVAVVANGVTSVAMEGEFQDELVVVGDGVDAASLIMALRKKAC  60

Query  213  CASIFSIEEV  242
              ++ ++EEV
Sbjct  61   HVTLETLEEV  70



>gb|EEC84223.1| hypothetical protein OsI_30639 [Oryza sativa Indica Group]
Length=173

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKK  206
            KQKI + +P++ ++ + KA K AVG+ GV S ++D  K  L+VIG GVD   L   L++ 
Sbjct  3    KQKIVVKMPMDTERKKRKAFKAAVGMTGVTSASLDGDK--LLVIGDGVDPIALTTMLRRS  60

Query  207  FKCASIFSI  233
               A + S+
Sbjct  61   LGHAELLSV  69



>ref|NP_001152411.1| ATFP4 [Zea mays]
 gb|ACG47476.1| ATFP4 [Zea mays]
Length=122

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLKK  203
            KQKI I +P+  DK R+KAM +     GV SV I  + K Q+VV+G GVDS  L   L+K
Sbjct  3    KQKIVIKVPMASDKSRSKAMALVAAAGGVNSVAIAGDGKDQVVVVGEGVDSIKLTTILRK  62

Query  204  KFKCASIFSI  233
            K   A +  +
Sbjct  63   KMGDAQLVEV  72



>gb|AFW72061.1| ATFP4 [Zea mays]
Length=122

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLKK  203
            KQKI I +P+  DK R+KAM +     GV SV I  + K Q+VV+G GVDS  L   L+K
Sbjct  3    KQKIVIKVPMASDKSRSKAMALVAAAGGVNSVAIAGDGKDQVVVVGEGVDSIKLTTILRK  62

Query  204  KFKCASIFSI  233
            K   A +  +
Sbjct  63   KMGDAQLVEV  72



>ref|XP_011095517.1| PREDICTED: uncharacterized protein LOC105174948 [Sesamum indicum]
Length=75

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +3

Query  30   QKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKKK  206
            QKI I + +  +KCR+KAM IA   +GV+SV ++ + + Q+VVIG GVD+  +   L+KK
Sbjct  2    QKIVIKVQLKCNKCRSKAMSIAAMASGVLSVQLEGDKRDQVVVIGDGVDAAGMTTLLRKK  61

Query  207  FKCASIFSIEEV  242
               AS+  ++++
Sbjct  62   VGHASLEFVDDL  73



>tpg|DAA37389.1| TPA: hypothetical protein ZEAMMB73_588334 [Zea mays]
Length=115

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 39/65 (60%), Gaps = 2/65 (3%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI--DEAKSQLVVIGVGVDSFVLIKCL  197
            MKQ+I I + +  DKCR  A+ +A    GV SV I  +E   QLVVIG GVD+  L   L
Sbjct  1    MKQRIVIKVQMTCDKCRKNALALACSTYGVQSVGIEGEERDHQLVVIGDGVDATCLASGL  60

Query  198  KKKFK  212
            +KK K
Sbjct  61   RKKVK  65



>ref|XP_008363893.1| PREDICTED: uncharacterized protein LOC103427602 [Malus domestica]
Length=208

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 47/74 (64%), Gaps = 2/74 (3%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLV-VIGVGVDSFVLIKCLKK  203
            + KI + +P++ DKC+ KA+ IA    GV  V+I+ A   L+ VIG  VDSF L + L+K
Sbjct  4    QMKIVVKVPMDCDKCKTKALTIAAAAHGVSKVSIEGANKDLMEVIGDDVDSFCLTRSLRK  63

Query  204  KFKCA-SIFSIEEV  242
            K  C+ ++  +E+V
Sbjct  64   KLGCSCALVKVEKV  77



>gb|EEC77445.1| hypothetical protein OsI_16250 [Oryza sativa Indica Group]
Length=270

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I + +   KCR+KAM +  G  GV SV +  + K +L V+G GVD   ++  L+
Sbjct  1    MKQKMVIKVSMPCGKCRSKAMALVAGATGVSSVEVTGDGKDRLQVVGDGVDPVCVVNRLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A I  +EEV
Sbjct  61   KKIGHAEIVQVEEV  74



>ref|NP_001053015.1| Os04g0464100 [Oryza sativa Japonica Group]
 dbj|BAF14929.1| Os04g0464100 [Oryza sativa Japonica Group]
 dbj|BAH00062.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            M+QKI I + +  +K R+KAM +    +GV S+ +  + K +L V+G GVD   L+ CL+
Sbjct  1    MQQKIVIKVSMPCEKSRSKAMALVARASGVNSMEVTGDGKDRLQVVGDGVDPVCLVACLR  60

Query  201  KKFKCASIFSIEEV  242
            +K   A I  +EEV
Sbjct  61   RKIGYAEIVQVEEV  74



>ref|XP_006587486.1| PREDICTED: lysine-specific demethylase 5A-like [Glycine max]
Length=224

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I L ++ DKCR KA+KIA  V GV +V+++ +   ++ V GV VD   L   LK
Sbjct  1    MKQKIVIKLQMDCDKCRNKALKIAAEVRGVTTVSLEGDDNDRVAVSGVNVDMVCLANQLK  60

Query  201  KKFKCASIFSI  233
            KKF   +I ++
Sbjct  61   KKFSSVTILTV  71



>ref|XP_006652393.1| PREDICTED: uncharacterized protein LOC102716957 [Oryza brachyantha]
Length=123

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            M+QKI I L +  + CR KA+++A    GVIS+ I    K +L V+GVGVD   L+ CL+
Sbjct  1    MQQKIEIKLCVPCEGCRTKALEVAARADGVISLAIAGGDKDRLEVVGVGVDVTCLVVCLR  60

Query  201  KKFKCASIFSI  233
            KK + A +  +
Sbjct  61   KKVRFADVLQV  71



>gb|KHN44736.1| hypothetical protein glysoja_032075 [Glycine soja]
Length=127

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +3

Query  30   QKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKKK  206
            +KI I + +  DKCR+KA+KIA    GV SV ++ E++ Q+VV G  +DS  L    +KK
Sbjct  2    KKIVIQVHMENDKCRSKALKIAAASQGVHSVALEGESRDQVVVTGDTIDSVCLTNKFRKK  61

Query  207  FKCASIFSIEE  239
            F  A++ S+ +
Sbjct  62   FSNATLISVAD  72



>ref|XP_008794762.1| PREDICTED: uncharacterized protein LOC103710688 [Phoenix dactylifera]
Length=111

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKK  203
            KQK+ I L +   K R+KA+K  VG  G+ S ++D + K Q+VV+G G+D   L+K L+K
Sbjct  3    KQKVVIRLGMVDAKQRSKALKTVVGFNGITSASLDGKEKDQIVVVGDGIDPVTLVKKLRK  62

Query  204  KFKCASIFSI  233
            +   A + S+
Sbjct  63   RMNYAELLSV  72



>ref|XP_003579938.1| PREDICTED: uncharacterized protein LOC100833023 [Brachypodium 
distachyon]
Length=115

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK  ISL +  +K R+KAM IA  + GVISV I  + K  L V+GV VD   L+ CL+
Sbjct  1    MKQKTVISLSMPNEKSRSKAMAIAARIPGVISVGITGDGKDMLEVVGVSVDPVSLVCCLR  60

Query  201  KK  206
             K
Sbjct  61   NK  62



>gb|KDP22990.1| hypothetical protein JCGZ_01712 [Jatropha curcas]
Length=134

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MK+K+ + + +  DK R+KAMKIAVGV GV SV +  + K+Q+ VIG GVD   L   L+
Sbjct  1    MKKKMVVQMSLQCDKHRSKAMKIAVGVCGVHSVALGAKDKNQIEVIGEGVDPVELTSSLR  60

Query  201  KK  206
            KK
Sbjct  61   KK  62



>gb|ACU24434.1| unknown [Glycine max]
Length=224

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I L ++ DKCR KA+KIA  V GV +V+++ +   ++ V GV VD   L   LK
Sbjct  1    MKQKIVIKLQMDCDKCRNKALKIAAEVRGVTTVSLEGDDNDRVAVSGVNVDMVCLANQLK  60

Query  201  KKFKCASIFSI  233
            KKF   +I ++
Sbjct  61   KKFSSVTILTV  71



>ref|XP_004975908.1| PREDICTED: uncharacterized protein LOC101765481 [Setaria italica]
Length=113

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 2/75 (3%)
 Frame = +3

Query  24   MKQKITISLP-INVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCL  197
            MKQKI I +  +  +K R+KAM +     GV S+ +  + K QL V+G GVD+  L+ CL
Sbjct  1    MKQKIVIRVSQLASEKTRSKAMALVAKADGVSSMGVTGDGKDQLEVVGDGVDTVCLVLCL  60

Query  198  KKKFKCASIFSIEEV  242
            +KK   A I  +EEV
Sbjct  61   RKKIGHAEILKVEEV  75



>ref|NP_001053041.1| Os04g0469000 [Oryza sativa Japonica Group]
 emb|CAE06007.3| OSJNBa0016O02.17 [Oryza sativa Japonica Group]
 dbj|BAF14955.1| Os04g0469000 [Oryza sativa Japonica Group]
 emb|CAH67375.1| OSIGBa0128P10.9 [Oryza sativa Indica Group]
 emb|CAH67424.1| OSIGBa0150F01.4 [Oryza sativa Indica Group]
 gb|EAY94479.1| hypothetical protein OsI_16249 [Oryza sativa Indica Group]
 gb|EAZ31037.1| hypothetical protein OsJ_15120 [Oryza sativa Japonica Group]
 dbj|BAG88453.1| unnamed protein product [Oryza sativa Japonica Group]
Length=122

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +  +K R+KAMK+ V  +GV SV +  + K +L V+G GVD+  L+ CL+
Sbjct  1    MKQKIVIKVSMPCEKSRSKAMKLVVMASGVSSVEVTGDGKDRLQVVGDGVDAACLVTCLR  60

Query  201  KKFKCASI  224
            KK   A +
Sbjct  61   KKIGHAEL  68



>ref|XP_002447998.1| hypothetical protein SORBIDRAFT_06g019490 [Sorghum bicolor]
 gb|EES12326.1| hypothetical protein SORBIDRAFT_06g019490 [Sorghum bicolor]
Length=128

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I + +  ++ R+KAM +A    GVIS+ I  +A+ +L V+G GVD   L+ CL+
Sbjct  1    MKQKMVIKVSMPCERSRSKAMTLAARADGVISMAITGDAREKLEVVGDGVDPVRLVSCLR  60

Query  201  KKFKCASIFSI  233
            +K   A I  +
Sbjct  61   RKVGHAEILQV  71



>ref|XP_009134984.1| PREDICTED: uncharacterized protein LOC103859232 isoform X2 [Brassica 
rapa]
Length=131

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +  DK RAKAMK AV   GV+   I  + ++Q+ V GV VD   L   L+
Sbjct  1    MKQKILIRISMTDDKTRAKAMKTAVQFQGVLGAEIKGDHRNQIEVTGVEVDMICLTNTLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+ +V
Sbjct  61   KKVAFAELVSVNKV  74



>ref|XP_011045596.1| PREDICTED: uncharacterized protein LOC105140450 [Populus euphratica]
Length=118

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MKQKI + + +N  K R KAMKIA    GV SV I E   ++VV G  VDS  L + LKK
Sbjct  1    MKQKIVMEVSMNSSKHRTKAMKIAAVANGVNSVEI-EGSDKVVVTGDEVDSVKLARALKK  59

Query  204  KFKCASIFSI  233
            KF    I S+
Sbjct  60   KFGHVMIVSV  69



>ref|XP_006447866.1| hypothetical protein CICLE_v10017259mg [Citrus clementina]
 gb|ESR61106.1| hypothetical protein CICLE_v10017259mg [Citrus clementina]
Length=108

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I L +   K R+KA+KIAV V+GV SV +  + +SQ+ V G G+D  +L   L+
Sbjct  25   MKQKVVIKLSLEGHKSRSKALKIAVRVSGVESVALKGDDRSQIEVTGDGMDPVLLTSLLR  84

Query  201  KKFKCASIFSI  233
            K  + A + ++
Sbjct  85   KTMRFAELLTV  95



>ref|XP_010246562.1| PREDICTED: uncharacterized protein LOC104589819 [Nelumbo nucifera]
Length=116

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKK  203
            KQKI + + +   K R+KAM+  VGV+GV +  +  + K+Q+ VIG G+DS  L   L+K
Sbjct  3    KQKIVVKVSLQSAKDRSKAMRTVVGVSGVETAALQGDDKNQIAVIGEGIDSIELTTSLRK  62

Query  204  KFKCASIFSI  233
            KF  A + ++
Sbjct  63   KFGYADLLTV  72



>gb|EMT10667.1| hypothetical protein F775_27842 [Aegilops tauschii]
Length=115

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + ++ DK R+KAM +     GV SV I  ++K  L V+G GVD   L+ CL+
Sbjct  1    MKQKIVIKVSMSCDKSRSKAMTMVAKANGVSSVGITGDSKDMLEVVGNGVDPVCLVGCLR  60

Query  201  KKFK  212
            KK+ 
Sbjct  61   KKYH  64



>ref|XP_004502101.1| PREDICTED: uncharacterized protein LOC101495677 [Cicer arietinum]
Length=127

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVN-IDEAKSQLVVIGVGVDSFVLIKCLKK  203
            KQKI I + +N  K ++KAM I VGV+GV   + I E+K Q+ V G GVDS  +   L+K
Sbjct  3    KQKIVIKVSMNNKKSKSKAMTIVVGVSGVEGASIIGESKDQIEVTGEGVDSVKVACLLRK  62

Query  204  KFKCASIFSIEEV  242
            KF  A + S+ +V
Sbjct  63   KFGHAELVSVGDV  75



>ref|XP_003575245.1| PREDICTED: uncharacterized protein LOC100845716 [Brachypodium 
distachyon]
Length=139

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +3

Query  18   FSMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKC  194
             ++KQKI I + +   +CR+KAM +     GV SV +  + K Q+VV+G GVDS  L   
Sbjct  1    MAVKQKIVIKVEMASGRCRSKAMALVAATPGVDSVALAGDGKDQVVVVGEGVDSINLTSA  60

Query  195  LKKKFKCASIFSIEE  239
            L+KK   A I  + E
Sbjct  61   LRKKVGPAEIVQVGE  75



>ref|XP_003601491.1| ATFP4-like protein [Medicago truncatula]
 gb|AES71742.1| metal ion-binding protein, putative [Medicago truncatula]
Length=115

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKK  203
            KQKI I + +N  K R+KAM IA GV+GV    I  E K Q+ V G  +DS  L   L+K
Sbjct  3    KQKIVIKVSMNNQKLRSKAMTIAAGVSGVEGTAIQGENKDQIEVTGEQIDSVRLTSLLRK  62

Query  204  KFKCASIFSI  233
            KF  A + S+
Sbjct  63   KFCHAELVSV  72



>gb|KDP39243.1| hypothetical protein JCGZ_01000 [Jatropha curcas]
Length=120

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MK+KI I +    +KCR KAMK A    GVISV  + + + +L+VIG  VD+  L + L+
Sbjct  1    MKKKIVIEISTCCEKCRVKAMKTAAVADGVISVAFEGSDREKLIVIGERVDAACLTRALR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A++  +EEV
Sbjct  61   KKVSYANLVLVEEV  74



>ref|XP_003533352.1| PREDICTED: uncharacterized protein LOC100797364 [Glycine max]
 gb|KHN23744.1| hypothetical protein glysoja_033627 [Glycine soja]
Length=122

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + ++ DK R+KA+KIA    GV SV ++ + K +LVV G  VD+  L + L+
Sbjct  1    MKQKIVLQMQLHSDKSRSKALKIAAQEIGVSSVALEGDNKDKLVVTG-DVDAVCLGRVLR  59

Query  201  KKFKCASIFS  230
            KKF+C ++ S
Sbjct  60   KKFRCVTLVS  69



>ref|XP_008809610.1| PREDICTED: uncharacterized protein LOC103721257 isoform X2 [Phoenix 
dactylifera]
Length=116

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MK+++ I++ +N +KCR+KAM++A   AGV SV +D  K+QLVV+G   D  +L   L+K
Sbjct  1    MKKEMVINVQMNCEKCRSKAMQLAAS-AGVDSVKVDGEKNQLVVVG-EADPVILTGILRK  58

Query  204  KFKCASIFSIEEV  242
            K   + I  + EV
Sbjct  59   KIGHSVIVKVAEV  71



>gb|KDP45151.1| hypothetical protein JCGZ_15016 [Jatropha curcas]
Length=130

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            M +K+ I + +N DK R +A++IAVGV GV SV + E  K+QL VIG GVD   L   L+
Sbjct  1    MPKKMVIKVSMNSDKSRKRALEIAVGVYGVQSVALGEKDKNQLEVIGEGVDPVKLTSSLR  60

Query  201  KK  206
            KK
Sbjct  61   KK  62



>gb|KDO74056.1| hypothetical protein CISIN_1g033712mg [Citrus sinensis]
Length=113

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  66   KCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLKKKFKCASIFSIE  236
            KCR KAMKIAV   GVI V I  E K +LVVIG  VDS  L + L+KK   AS+ S++
Sbjct  5    KCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLGFASLLSVQ  62



>gb|KDO40226.1| hypothetical protein CISIN_1g048349mg [Citrus sinensis]
Length=94

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MK+ + I  P+  DK R+KA+KI  G+ GV SV    + +SQ+ V G G+D+ VL   L+
Sbjct  1    MKRMVGIEQPLENDKSRSKALKIVGGMPGVESVAFKGDDRSQIEVTGDGMDAIVLFMSLR  60

Query  201  KKFKCASI  224
            KK + A+ 
Sbjct  61   KKLRYATF  68



>emb|CAD41036.1| OSJNBa0060P14.7 [Oryza sativa Japonica Group]
 gb|EAY94438.1| hypothetical protein OsI_16209 [Oryza sativa Indica Group]
 gb|EAY94440.1| hypothetical protein OsI_16211 [Oryza sativa Indica Group]
 gb|EAZ31005.1| hypothetical protein OsJ_15087 [Oryza sativa Japonica Group]
Length=119

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKK  203
            KQKI I + +  +K R+KAM +    +GV S+ +  + K +L V+G GVD   L+ CL++
Sbjct  3    KQKIVIKVSMPCEKSRSKAMALVARASGVNSMEVTGDGKDRLQVVGDGVDPVCLVACLRR  62

Query  204  KFKCASIFSIEEV  242
            K   A I  +EEV
Sbjct  63   KIGYAEIVQVEEV  75



>ref|XP_007152714.1| hypothetical protein PHAVU_004G153100g [Phaseolus vulgaris]
 gb|ESW24708.1| hypothetical protein PHAVU_004G153100g [Phaseolus vulgaris]
Length=226

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVI-GVGVDSFVLIKCLK  200
            MKQK+ I L ++ DKCR KA+KIA  V GV SV ++   S  V + G  VD   L   LK
Sbjct  1    MKQKVVIKLQMDCDKCRNKALKIAAEVPGVTSVALEGDDSDRVAVSGENVDMVCLANQLK  60

Query  201  KKFKCASIFSIEEV  242
            KKF    I ++E++
Sbjct  61   KKFSSVVIVTVEDL  74



>ref|XP_010422376.1| PREDICTED: uncharacterized protein LOC104707675 isoform X2 [Camelina 
sativa]
Length=76

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            M +KI +S+ +  +KCR++A+KI     GV  V I+ E K ++VVIG GVD+  L+  L+
Sbjct  1    MPKKILMSVSMRCEKCRSEALKIGAKTTGVTFVGIEGEEKDKVVVIGEGVDAACLVVRLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A I S+ +V
Sbjct  61   KKVGFADIISVADV  74



>ref|XP_006575706.1| PREDICTED: uncharacterized protein LOC102669549 [Glycine max]
Length=78

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = +3

Query  18   FSMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKC  194
             +MKQKI I +P++ ++C+ K M I     GV SV    E K ++V+IG G+D+  +  C
Sbjct  1    MTMKQKIVIEVPLHCERCKKKIMTICTMADGVTSVTFQREEKEKVVIIGEGIDAAGVAAC  60

Query  195  LKKKF-KCASIFSI  233
            L+KK  K A + S+
Sbjct  61   LRKKVNKYARLVSV  74



>gb|EMS57371.1| hypothetical protein TRIUR3_01191 [Triticum urartu]
Length=113

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +3

Query  36   ITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKKKFK  212
            + I + +  DKCR+KAM +   V GV  V I  + + QL V+G GVD+  L  CL+KK  
Sbjct  1    MVIRVHMTCDKCRSKAMGLVASVYGVERVEIQGDDRDQLAVVGDGVDAANLTACLRKKVG  60

Query  213  CASIFSIEEV  242
             A + ++E V
Sbjct  61   NADLLTVEAV  70



>gb|KHN14404.1| hypothetical protein glysoja_012442, partial [Glycine soja]
Length=77

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            ++QKI + + +N  KCR KA+K+    +GV  V ++ E K +LVVIG  VD   L   L+
Sbjct  1    LQQKIVMKVHMNCQKCRTKALKVVAAASGVNYVGLEGEEKDKLVVIGDEVDPVKLTNSLR  60

Query  201  KKFKCASIFSIEEV  242
            KK     I S+ EV
Sbjct  61   KKVGHTDIISLAEV  74



>ref|XP_010542497.1| PREDICTED: uncharacterized protein LOC104815685 [Tarenaya hassleriana]
Length=136

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +3

Query  24   MKQKITISLPI-NVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLK  200
            M+Q+I + + + +  K R+KAMKIA G +GV SV+I     QLVV+G  +D+  L + L+
Sbjct  1    MRQRIVLKVAMTDSPKSRSKAMKIASGTSGVRSVSIQGENDQLVVLGEEIDTVELTRELR  60

Query  201  KKFKCASIFSIE  236
            KK   A I +++
Sbjct  61   KKVGHAKIVTVQ  72



>ref|XP_010455734.1| PREDICTED: uncharacterized protein LOC104737261 isoform X1 [Camelina 
sativa]
Length=151

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + +  DK RAKA+K AV   GV +V I  + ++Q+ V GV VD   LI  L+
Sbjct  1    MKQKILLRVAMTEDKTRAKALKTAVQFKGVSAVEIKGDHRNQIEVTGVEVDMIALINTLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+ +V
Sbjct  61   KKVAFAELVSVAKV  74



>ref|XP_009395840.1| PREDICTED: uncharacterized protein LOC103980998 [Musa acuminata 
subsp. malaccensis]
Length=118

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKK  206
            KQ++ + L +   K R+KA+KIAVG+ GVIS  +D  K  +VV+G GVDS VL   L+KK
Sbjct  3    KQEMVMKLTMEDAKKRSKALKIAVGLPGVISAKLDGDK--IVVVGDGVDSIVLTTMLRKK  60

Query  207  F  209
             
Sbjct  61   M  61



>gb|AAD09508.1| ATFP4, partial [Arabidopsis thaliana]
Length=179

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +3

Query  21   SMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCL  197
            +MKQKI I + +  D  RAKAMK AV   GV +V I  + ++Q+ V GV VD   LI  L
Sbjct  22   NMKQKILIRIAMTDDTTRAKAMKTAVQFKGVNAVEIKGDHRNQIEVTGVEVDMIALINTL  81

Query  198  KKKFKCASIFSIEEV  242
            +KK   A + S+ +V
Sbjct  82   RKKVAFAELVSVAKV  96



>ref|NP_567284.1| putative copper transport protein [Arabidopsis thaliana]
 gb|AAD48978.1|AF162444_10 T32N4.11 gene product [Arabidopsis thaliana]
 emb|CAB81045.1| AT4g05030 [Arabidopsis thaliana]
 gb|AEE82462.1| putative copper transport protein [Arabidopsis thaliana]
Length=110

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +3

Query  33   KITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLKKKF  209
            KI +S+ +  DKCR++A+KI     GV  V I+ E K ++VVIG GVD+  L+  L+KK 
Sbjct  37   KILMSVSMRCDKCRSEALKIGAKTTGVTFVGIEGEEKDKVVVIGEGVDAACLVVRLRKKV  96

Query  210  KCASIFSIEEV  242
              A I S+ +V
Sbjct  97   GFADIISVTDV  107



>ref|NP_187417.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
 gb|AAF13078.1|AC009176_5 unknown protein [Arabidopsis thaliana]
 gb|AEE74572.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
Length=157

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +  D  RAKAMK AV   GV +V I  + ++Q+ V GV VD   LI  L+
Sbjct  1    MKQKILIRIAMTDDTTRAKAMKTAVQFKGVNAVEIKGDHRNQIEVTGVEVDMIALINTLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+ +V
Sbjct  61   KKVAFAELVSVAKV  74



>ref|XP_007020385.1| Copper transport protein family, putative isoform 2 [Theobroma 
cacao]
 gb|EOY11910.1| Copper transport protein family, putative isoform 2 [Theobroma 
cacao]
Length=109

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 5/71 (7%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEA-KSQLVVIGVGVDSFVLIKCLK  200
            MKQKI IS+ +  +KCR KA+K    VA   +V ++ A K +LVV G GVDS  L + L+
Sbjct  1    MKQKIVISVNMGCNKCRVKALK----VAATTNVAVEGADKDKLVVKGDGVDSAELTRSLR  56

Query  201  KKFKCASIFSI  233
            KK + A++ S+
Sbjct  57   KKVRAATLLSV  67



>ref|XP_003616824.1| hypothetical protein MTR_5g084660 [Medicago truncatula]
 gb|AES99782.1| metal ion-binding protein, putative [Medicago truncatula]
Length=134

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = +3

Query  30   QKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIG-VGVDSFVLIKCLKK  203
            +KI I + +  DK R+KA+KIA    GVISV+++ E++ Q+VVIG   +D   L K L+K
Sbjct  2    KKIVIQMHMESDKFRSKALKIAAAFQGVISVSLEGESRDQVVVIGDYQIDCVCLTKKLRK  61

Query  204  KFKCASIFSIEE  239
            KF   ++ S+E+
Sbjct  62   KFCYVNLLSVED  73



>gb|EMT24129.1| hypothetical protein F775_26351 [Aegilops tauschii]
Length=171

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKK  206
            KQKI + LP++ ++ R KA K AVG+AGV S  ++  K  ++++G GVD   L   L++ 
Sbjct  3    KQKIVLKLPLDGERNRRKAFKAAVGMAGVTSATLEGDK--IIIVGDGVDPIALTTMLRRS  60

Query  207  FKCASIFSI  233
               A + SI
Sbjct  61   LGKAELVSI  69



>ref|XP_008669292.1| PREDICTED: uncharacterized protein LOC103646338 [Zea mays]
 tpg|DAA37386.1| TPA: hypothetical protein ZEAMMB73_657435 [Zea mays]
Length=113

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +  DKCR+KAM +A   AG   + I  + + QL V G  +D+  L+ CL+
Sbjct  1    MKQKIVIKVCMPCDKCRSKAMGLAAK-AGANKMGITGDGRDQLEVEGDDIDTVCLVNCLR  59

Query  201  KKFKCASIFSIEEV  242
            KK   A I  +EEV
Sbjct  60   KKVGRADIVKVEEV  73



>ref|XP_009398759.1| PREDICTED: uncharacterized protein LOC103983262 [Musa acuminata 
subsp. malaccensis]
Length=142

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            M+QKI I + +  D+CR KA+K+A  V GV SV I    ++++VV G GVDS  L   L+
Sbjct  1    MEQKIVIKINVICDRCRNKALKLASSVRGVESVAIQGRNRNRVVVTGEGVDSVCLTSILR  60

Query  201  KKFKCASIFSI  233
            +K   A I  I
Sbjct  61   QKMGYAEIIGI  71



>ref|XP_007216846.1| hypothetical protein PRUPE_ppa022086mg [Prunus persica]
 gb|EMJ18045.1| hypothetical protein PRUPE_ppa022086mg [Prunus persica]
Length=119

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +3

Query  33   KITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKKFK  212
            ++ I L ++ +K RAKAMK AVGV GV S ++ + K  + V G G+D  +L   L+K  K
Sbjct  2    QVVIKLSVHDEKSRAKAMKAAVGVDGVNSASLQQDKDLIEVTGEGIDVVLLTNQLRKSLK  61

Query  213  CASIFSIEEV  242
             A + S+  V
Sbjct  62   YAEVVSVNPV  71



>ref|XP_004975909.1| PREDICTED: uncharacterized protein LOC101765889 [Setaria italica]
Length=109

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = +3

Query  27   KQKITISLP-INVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            KQKI I +  +  +K R+KAM +     GV S+ +  + K QL V+G GVD+  L++CL+
Sbjct  3    KQKIVIRVSQLASEKTRSKAMALVAKADGVSSMGVTGDGKDQLEVVGDGVDTVCLVQCLR  62

Query  201  KKFKCASIFSIEEV  242
            +K   A I  +EEV
Sbjct  63   RKIGPAEILKVEEV  76



>gb|EMT17915.1| hypothetical protein F775_02488 [Aegilops tauschii]
Length=114

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +3

Query  54   INVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLKKKFKCASIF  227
            ++ DK RAKA+ +A   AGV S+ I  +A+ QL V+G GVD   L+ CL+KK   A I 
Sbjct  1    MSCDKSRAKALTMAARAAGVTSMGIIGDARDQLEVVGDGVDPVCLVSCLRKKLGHAHII  59



>ref|XP_010107367.1| hypothetical protein L484_006882 [Morus notabilis]
 gb|EXC15618.1| hypothetical protein L484_006882 [Morus notabilis]
Length=132

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKK  206
            KQK+ I + +N  K R KA+K AVGV GV    +   K Q+ V G G+D   L   L+K 
Sbjct  3    KQKVVIKVSLNDRKSRTKAIKTAVGVDGVTQAALQADKDQIEVTGEGIDVVCLATLLRKS  62

Query  207  FKCASIFSIEEV  242
             K A + S+  V
Sbjct  63   LKYAEVVSVTAV  74



>ref|XP_006857655.1| hypothetical protein AMTR_s00061p00147320 [Amborella trichopoda]
 gb|ERN19122.1| hypothetical protein AMTR_s00061p00147320 [Amborella trichopoda]
Length=117

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MK+++ I + +N +KCR +A K      GVI + ++ E KSQ++VIG GVD+  L   L+
Sbjct  1    MKREVVIEVTVNCEKCRIQAFKDVSKARGVIQLGLEGEDKSQVMVIGDGVDAAKLTMILR  60

Query  201  KKFKCASIFSIEE  239
            KK     + S+EE
Sbjct  61   KKVGHTELVSVEE  73



>emb|CAE06008.3| OSJNBa0016O02.18 [Oryza sativa Japonica Group]
 emb|CAH67376.1| OSIGBa0128P10.10 [Oryza sativa Indica Group]
 emb|CAH67425.1| OSIGBa0150F01.5 [Oryza sativa Indica Group]
 gb|EAZ31038.1| hypothetical protein OsJ_15121 [Oryza sativa Japonica Group]
Length=131

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I   +  D CR KA+ +A    GVIS+ I  + + +L V+G GVD   L+ CL+
Sbjct  1    MKQKIVIKACMPCDGCRVKALGVAAKADGVISMAITGDDRDRLEVVGDGVDVTCLVTCLR  60

Query  201  KKFKCASIFSI  233
            KK + A +  +
Sbjct  61   KKVRFADVLQV  71



>ref|XP_002447995.1| hypothetical protein SORBIDRAFT_06g019460 [Sorghum bicolor]
 gb|EES12323.1| hypothetical protein SORBIDRAFT_06g019460 [Sorghum bicolor]
Length=215

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            M+++I I +  + DK RAKA+K+A  V+GV SV +  E++  L++IG GVD+  L + LK
Sbjct  1    MRKEIIIRMQPDSDKGRAKALKVAASVSGVESVTVAGESRDMLLLIGDGVDAGKLTRKLK  60

Query  201  KKFKCASIFSIE  236
            K+   A I  + 
Sbjct  61   KEVGEADILELR  72



>ref|XP_002865298.1| hypothetical protein ARALYDRAFT_917047 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41557.1| hypothetical protein ARALYDRAFT_917047 [Arabidopsis lyrata subsp. 
lyrata]
Length=86

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + +  DK RAKAMK AV   GV +V I  + ++Q+ V GV VD   LI  L+
Sbjct  1    MKQKILLRVAMTDDKTRAKAMKTAVQFKGVNAVEIKGDHRNQIEVTGVEVDMIALINTLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+ +V
Sbjct  61   KKVAFAELVSVTKV  74



>dbj|BAA98186.1| ATFP4-like [Arabidopsis thaliana]
Length=157

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +  DK RAKAM  AV   GV +V I  + ++Q+ V GV VD   LI+ L+
Sbjct  1    MKQKILIRVTMTDDKTRAKAMTKAVQFKGVSAVEIKGDHRNQIEVTGVEVDMIPLIQILR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+ +V
Sbjct  61   KKVAFAELVSVTKV  74



>ref|XP_010464391.1| PREDICTED: uncharacterized protein LOC104744951 isoform X1 [Camelina 
sativa]
Length=152

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + +  DK RAKA+K AV   GV +V I  + ++Q+ V GV VD   LI  L+
Sbjct  1    MKQKILLRVAMTDDKTRAKALKTAVQFKGVNAVEIKGDHRNQIEVTGVEVDMIALINTLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+ +V
Sbjct  61   KKVAFAELVSVAKV  74



>gb|EMT17919.1| hypothetical protein F775_02491 [Aegilops tauschii]
Length=113

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I L ++ DK R+KA+ +A   AGV S+ I  +A+ QL V+G GVD   L+ CL+
Sbjct  1    MKQKIVIQLSMSCDKSRSKALTLAAKAAGVTSMGITGDARDQLEVVGDGVDPVCLVSCLR  60

Query  201  KKFKCASI  224
            KK   A I
Sbjct  61   KKLGHAQI  68



>ref|XP_010455810.1| PREDICTED: uncharacterized protein LOC104737261 isoform X2 [Camelina 
sativa]
Length=151

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            M+QKI + + +  DK RAKA+K AV   GV +V I  + ++Q+ V GV VD   LI  L+
Sbjct  1    MQQKILLRVAMTEDKTRAKALKTAVQFKGVSAVEIKGDHRNQIEVTGVEVDMIALINTLR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+ +V
Sbjct  61   KKVAFAELVSVAKV  74



>gb|EYU41174.1| hypothetical protein MIMGU_mgv1a016413mg [Erythranthe guttata]
Length=123

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MK KI + + +N DK R KAM+I+VG++GV S  +  + + ++ V+G  VD+  L + L+
Sbjct  1    MKTKIVVKVSMNDDKSRTKAMQISVGISGVESAALTGQERDRVEVVGDDVDAVELTRQLR  60

Query  201  KKFKCASIFSIEE  239
            K    A + S+ E
Sbjct  61   KNVAYAELVSVGE  73



>tpg|DAA37385.1| TPA: hypothetical protein ZEAMMB73_318699 [Zea mays]
Length=191

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = +3

Query  21   SMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCL  197
            +MKQKI I + +  DKCR+KAM +A  + GV  + I  + + QL V G  +D+  L+ CL
Sbjct  96   AMKQKIVIKVCMPCDKCRSKAMGLAA-IEGVSKIGITGDGRDQLEVEGDDIDTVCLVNCL  154

Query  198  KKKFKCASIFSIEEV  242
            +KK   A I  ++E+
Sbjct  155  RKKVGRADIVKVKEL  169



>ref|XP_006289318.1| hypothetical protein CARUB_v10002803mg, partial [Capsella rubella]
 gb|EOA22216.1| hypothetical protein CARUB_v10002803mg, partial [Capsella rubella]
Length=87

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            +  KI IS+ +  +KCR++A+KI     GV  V I+ E K ++VVIG GVD+  L+  L+
Sbjct  12   LTLKILISVSMRCEKCRSEALKIGAKTTGVTFVGIEGEEKDKVVVIGEGVDAACLVVRLR  71

Query  201  KKFKCASIFSIEEV  242
            KK   A I S+ +V
Sbjct  72   KKVGFADIISVADV  85



>gb|EYU33985.1| hypothetical protein MIMGU_mgv1a016390mg [Erythranthe guttata]
 gb|EYU33987.1| hypothetical protein MIMGU_mgv1a016402mg [Erythranthe guttata]
Length=123

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MK KI + + +N DK R KAM+I+VG++GV S  +  + + ++ V+G  VD+  L + L+
Sbjct  1    MKTKIVVKVSMNDDKSRTKAMQISVGISGVESAALTGQERDRVEVVGDDVDAVELTRQLR  60

Query  201  KKFKCASIFSIEE  239
            K    A + S+ E
Sbjct  61   KNVAYAELVSVGE  73



>ref|NP_001150530.1| heavy metal-associated domain containing protein [Zea mays]
 gb|ACF85248.1| unknown [Zea mays]
 gb|ACG39424.1| heavy metal-associated domain containing protein [Zea mays]
 tpg|DAA60837.1| TPA: heavy metal-associated domain containing protein [Zea mays]
Length=167

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKK  206
            KQKI + LP++ ++ R KA K AVG+ GV S  ++  K  + V+G GVD   L   L++ 
Sbjct  3    KQKIVLKLPLDDERKRRKAFKAAVGMNGVTSATMEGDK--ITVVGDGVDPITLTTILRRS  60

Query  207  FKCASIFSI  233
               A + S+
Sbjct  61   LGYAELLSV  69



>ref|XP_010661737.1| PREDICTED: uncharacterized protein LOC100854219 [Vitis vinifera]
Length=120

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +3

Query  24   MKQKITISLPINVDK-CRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCL  197
            MKQK+ I +  N +K  R K M+ AVG  GV S+    E   Q+VVIG  +DS  L + L
Sbjct  1    MKQKVVIKVSFNGEKKSRTKVMQAAVGAPGVESIAFGGEDNDQIVVIGDSLDSVNLTRLL  60

Query  198  KKKFKCASIFSIEEV  242
            +KK K A + S+  V
Sbjct  61   RKKVKFAELLSVSSV  75



>ref|XP_004975907.1| PREDICTED: uncharacterized protein LOC101765088 [Setaria italica]
Length=129

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKK  203
            MK+KI I + +  ++CR KA+K+     G+ISV I     +L V+G GVD   L++CL+K
Sbjct  1    MKKKIVIKVCMPCERCRTKALKVVARADGLISVAI-TGDEKLEVVGDGVDPVCLVRCLRK  59

Query  204  KFKCASIFS  230
            K   A I  
Sbjct  60   KICYAEILQ  68



>ref|XP_011005768.1| PREDICTED: uncharacterized protein LOC105111948 [Populus euphratica]
Length=76

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNID-EAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI + + +N  KCR KA+++     GV  + ++ E K ++VVIG GVD+  L+  LK
Sbjct  1    MKQKIVLGVQMNCQKCRRKALQVVAETDGVSFLGLEGENKERVVVIGDGVDAAKLVGRLK  60

Query  201  KKFKCASIFSI  233
            KK    +I S+
Sbjct  61   KKVGYTAIISV  71



>ref|XP_010942540.1| PREDICTED: uncharacterized protein LOC105060500 [Elaeis guineensis]
Length=112

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = +3

Query  27   KQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLKKK  206
            KQKI + + ++  K R+KA+K AVG  GVIS  ID  K +  V G GVDS  L   L+K+
Sbjct  3    KQKIVMKVSMDDSKKRSKALKSAVGSTGVISAKIDGDKME--VEGDGVDSIALTTTLRKR  60

Query  207  FKCASIFSI  233
               A + S+
Sbjct  61   MGYAELVSV  69



>ref|XP_004956436.1| PREDICTED: 5'-3' exoribonuclease 2-like isoform X1 [Setaria italica]
Length=173

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = +3

Query  15   AFSMKQKITISLPINVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKC  194
            + S++QKI + LP++ ++ + KA K AVG+ GV S  ++  K  ++V+G GVD   L   
Sbjct  14   SLSLQQKIVLKLPLDDERKKRKAFKAAVGMNGVTSATMEGDK--IIVVGDGVDPITLTTM  71

Query  195  LKKKFKCASIFSI  233
            L++    A + S+
Sbjct  72   LRRSLGYAELLSV  84



>ref|XP_008229766.1| PREDICTED: uncharacterized protein LOC103329115 [Prunus mume]
Length=119

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +3

Query  24   MKQKITISLP-INVDKCRAKAMKIAVGVAGVISVNIDEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQK+ I L  ++ +K RAKAMK AVGV GV S ++ + K  + V G GVD  +L   L+
Sbjct  1    MKQKMVIKLSAVHDEKSRAKAMKTAVGVDGVNSASLQQDKGLIEVTGDGVDVALLTYLLR  60

Query  201  KKFKCA  218
            K  K A
Sbjct  61   KSLKHA  66



>ref|NP_568695.1| heavy metal transport/detoxification domain-containing protein 
[Arabidopsis thaliana]
 gb|AAV84521.1| At5g48290 [Arabidopsis thaliana]
 gb|AAW38970.1| At5g48290 [Arabidopsis thaliana]
 gb|AED95646.1| heavy metal transport/detoxification domain-containing protein 
[Arabidopsis thaliana]
Length=181

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  24   MKQKITISLPINVDKCRAKAMKIAVGVAGVISVNI-DEAKSQLVVIGVGVDSFVLIKCLK  200
            MKQKI I + +  DK RAKAM  AV   GV +V I  + ++Q+ V GV VD   LI+ L+
Sbjct  1    MKQKILIRVTMTDDKTRAKAMTKAVQFKGVSAVEIKGDHRNQIEVTGVEVDMIPLIQILR  60

Query  201  KKFKCASIFSIEEV  242
            KK   A + S+ +V
Sbjct  61   KKVAFAELVSVTKV  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1590667407420