BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85150_g1_i1 len=1438 path=[1416:0-1437]

Length=1438
                                                                      Score     E

ref|XP_009799363.1|  PREDICTED: chalcone synthase                       650   0.0      
ref|XP_009621338.1|  PREDICTED: chalcone synthase                       640   0.0      
ref|XP_004230925.1|  PREDICTED: chalcone synthase                       638   0.0      
ref|XP_006359643.1|  PREDICTED: chalcone synthase 2-like                636   0.0      
ref|XP_011092869.1|  PREDICTED: chalcone synthase                       634   0.0      
ref|XP_007041944.1|  Chalcone and stilbene synthase family protein      633   0.0      
ref|XP_006487398.1|  PREDICTED: chalcone synthase 6-like                629   0.0      
ref|XP_006423581.1|  hypothetical protein CICLE_v10028633mg             629   0.0      
ref|XP_002305482.1|  hypothetical protein POPTR_0004s17460g             629   0.0      Populus trichocarpa [western balsam poplar]
emb|CDO96957.1|  unnamed protein product                                629   0.0      
ref|XP_002276653.1|  PREDICTED: chalcone synthase                       625   0.0      Vitis vinifera
ref|XP_002529257.1|  Chalcone synthase, putative                        623   0.0      Ricinus communis
gb|KDP27594.1|  hypothetical protein JCGZ_19599                         622   0.0      
ref|XP_009350954.1|  PREDICTED: chalcone synthase                       620   0.0      
ref|XP_006379273.1|  chalcone and stilbene synthase family protein      619   0.0      
gb|EYU40405.1|  hypothetical protein MIMGU_mgv1a008045mg                616   0.0      
ref|XP_010690460.1|  PREDICTED: chalcone synthase                       616   0.0      
ref|XP_011046865.1|  PREDICTED: chalcone synthase-like                  613   0.0      
ref|XP_002869122.1|  chalcone synthase family protein                   613   0.0      
gb|AAZ23686.1|  chalcone synthase family protein                        612   0.0      Arabidopsis halleri subsp. gemmifera
ref|XP_003537759.1|  PREDICTED: chalcone synthase-like                  612   0.0      
ref|XP_010088676.1|  Chalcone synthase 9                                612   0.0      
ref|XP_010437562.1|  PREDICTED: chalcone synthase-like                  611   0.0      
gb|AAZ23705.1|  chalcone synthase family protein                        611   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285956.1|  hypothetical protein CARUB_v10007475mg             611   0.0      
ref|XP_010447028.1|  PREDICTED: chalcone synthase                       610   0.0      
gb|AAZ23684.1|  chalcone synthase family protein                        609   0.0      Arabidopsis halleri subsp. gemmifera
ref|XP_010432375.1|  PREDICTED: chalcone synthase-like                  609   0.0      
gb|AAZ23683.1|  chalcone synthase family protein                        609   0.0      Arabidopsis halleri subsp. gemmifera
ref|XP_010530789.1|  PREDICTED: chalcone synthase                       609   0.0      
gb|AAZ23702.1|  chalcone synthase family protein                        608   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_567971.1|  protein LESS ADHESIVE POLLEN 5                        608   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAZ23693.1|  chalcone synthase family protein                        608   0.0      Arabidopsis halleri subsp. gemmifera
ref|XP_004505681.1|  PREDICTED: chalcone synthase-like                  608   0.0      
gb|ABK28665.1|  unknown                                                 608   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAZ23704.1|  chalcone synthase family protein                        607   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAZ23685.1|  chalcone synthase family protein                        607   0.0      Arabidopsis halleri subsp. gemmifera
gb|AAZ23692.1|  chalcone synthase family protein                        607   0.0      Arabidopsis halleri subsp. gemmifera
gb|AAZ23682.1|  chalcone synthase family protein                        607   0.0      Arabidopsis halleri subsp. gemmifera
ref|XP_007131762.1|  hypothetical protein PHAVU_011G039700g             607   0.0      
ref|XP_006412179.1|  hypothetical protein EUTSA_v10025417mg             606   0.0      
gb|AAZ23688.1|  chalcone synthase family protein                        606   0.0      Arabidopsis halleri subsp. gemmifera
gb|AAZ23717.1|  chalcone synthase family protein                        605   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAZ23721.1|  chalcone synthase family protein                        605   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX75466.1|  BnaA01g02360D                                          605   0.0      
ref|XP_009108194.1|  PREDICTED: chalcone synthase-like                  605   0.0      
gb|EPS66734.1|  hypothetical protein M569_08037                         604   0.0      
gb|AAZ23699.1|  chalcone synthase family protein                        604   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010028685.1|  PREDICTED: chalcone synthase                       604   0.0      
gb|KFK30118.1|  hypothetical protein AALP_AA7G219100                    602   0.0      
ref|XP_009108697.1|  PREDICTED: chalcone synthase-like                  602   0.0      
emb|CDY40656.1|  BnaA03g53070D                                          602   0.0      
ref|XP_009138330.1|  PREDICTED: chalcone synthase-like                  602   0.0      
ref|XP_007199914.1|  hypothetical protein PRUPE_ppa006852mg             602   0.0      
emb|CDX69091.1|  BnaC01g03620D                                          602   0.0      
emb|CDX72506.1|  BnaC07g45280D                                          600   0.0      
ref|XP_008236187.1|  PREDICTED: chalcone synthase                       600   0.0      
gb|ADF43047.1|  chalcone synthase 6 protein                             600   0.0      
emb|CDY34811.1|  BnaA09g41780D                                          599   0.0      
emb|CDY17490.1|  BnaC03g65730D                                          598   0.0      
ref|XP_008372871.1|  PREDICTED: chalcone synthase                       596   0.0      
emb|CDY58814.1|  BnaAnng15370D                                          595   0.0      
ref|XP_010268693.1|  PREDICTED: chalcone synthase                       594   0.0      
dbj|BAE80096.1|  Chalcone synthase                                      587   0.0      Silene latifolia
gb|KEH30597.1|  chalcone synthase family protein                        585   0.0      
ref|XP_004289833.1|  PREDICTED: chalcone synthase-like                  583   0.0      
gb|KHN32314.1|  Chalcone synthase                                       576   0.0      
emb|CAB45446.1|  chalcone synthase-like protein                         575   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004138289.1|  PREDICTED: chalcone synthase A-like                574   0.0      
ref|XP_008453147.1|  PREDICTED: chalcone synthase                       571   0.0      
ref|XP_007131590.1|  hypothetical protein PHAVU_011G026000g             558   0.0      
ref|XP_006664811.1|  PREDICTED: chalcone synthase LF2-like              534   0.0      
ref|XP_002461886.1|  hypothetical protein SORBIDRAFT_02g009850          529   0.0      Sorghum bicolor [broomcorn]
ref|NP_001059449.2|  Os07g0411300                                       528   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC81903.1|  hypothetical protein OsI_25733                          528   0.0      Oryza sativa Indica Group [Indian rice]
emb|CAJ13548.1|  unnamed protein product                                526   0.0      Triticum turgidum [cone wheat]
tpg|DAA60355.1|  TPA: chalcone synthase                                 525   1e-180   
tpg|DAA60357.1|  TPA: hypothetical protein ZEAMMB73_750242              524   2e-180   
ref|NP_001149508.1|  chalcone synthase                                  524   2e-180   Zea mays [maize]
ref|XP_010933363.1|  PREDICTED: chalcone synthase                       521   3e-180   
ref|XP_008780014.1|  PREDICTED: chalcone synthase                       520   8e-180   
gb|ACJ22498.1|  chalcone synthase                                       521   3e-179   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ95097.1|  predicted protein                                      521   7e-179   
emb|CAJ13966.1|  unnamed protein product                                518   8e-178   Aegilops tauschii
gb|AAV49989.1|  putative chalcone synthase                              518   8e-178   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004956033.1|  PREDICTED: chalcone synthase 1-like                516   1e-177   
gb|AAB80804.1|  chalcone synthase homolog PrChS1                        515   3e-177   Pinus radiata
emb|CAJ15412.1|  unnamed protein product                                513   5e-176   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006375238.1|  chalcone and stilbene synthase family protein      506   7e-174   
ref|XP_002889339.1|  chalcone synthase family protein                   506   1e-173   
ref|XP_010107936.1|  Chalcone synthase A                                504   3e-173   
ref|XP_010474836.1|  PREDICTED: chalcone synthase isoform X2            504   3e-173   
ref|XP_010474834.1|  PREDICTED: chalcone synthase isoform X1            504   4e-173   
gb|AAZ81860.1|  chalcone synthase family protein                        504   7e-173   Arabidopsis halleri subsp. gemmifera
ref|XP_002302511.1|  chalcone and stilbene synthase family protein      503   8e-173   Populus trichocarpa [western balsam poplar]
gb|AAZ81859.1|  chalcone synthase family protein                        503   1e-172   Arabidopsis halleri subsp. gemmifera
ref|XP_010692112.1|  PREDICTED: chalcone synthase                       503   1e-172   
gb|AAZ81863.1|  chalcone synthase family protein                        503   2e-172   Arabidopsis halleri subsp. gemmifera
gb|AAZ81872.1|  chalcone synthase family protein                        503   2e-172   Arabidopsis halleri subsp. gemmifera
gb|AAZ81867.1|  chalcone synthase family protein                        502   5e-172   Arabidopsis halleri subsp. gemmifera
ref|XP_011017423.1|  PREDICTED: chalcone synthase-like                  503   8e-172   
gb|AAZ81870.1|  chalcone synthase family protein                        501   8e-172   Arabidopsis halleri subsp. gemmifera
gb|ADF43044.1|  chalcone synthase 3 protein                             501   1e-171   
emb|CDY18415.1|  BnaA04g21720D                                          501   1e-171   
ref|XP_009141701.1|  PREDICTED: chalcone synthase                       500   2e-171   
ref|XP_006418482.1|  hypothetical protein EUTSA_v10007831mg             500   2e-171   
gb|AAZ81871.1|  chalcone synthase family protein                        500   2e-171   Arabidopsis halleri subsp. gemmifera
ref|XP_008375736.1|  PREDICTED: chalcone synthase                       499   5e-171   
gb|AAZ81868.1|  chalcone synthase family protein                        499   7e-171   Arabidopsis halleri subsp. gemmifera
gb|AAZ81873.1|  chalcone synthase family protein                        498   1e-170   Arabidopsis halleri subsp. gemmifera
emb|CDX93339.1|  BnaC04g45570D                                          498   1e-170   
ref|NP_171707.1|  polyketide synthase A                                 498   1e-170   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007052226.1|  Chalcone and stilbene synthase family protein      498   1e-170   
ref|XP_002276642.1|  PREDICTED: chalcone synthase isoform X2            498   1e-170   Vitis vinifera
ref|XP_003557301.2|  PREDICTED: probable inorganic phosphate tran...    516   2e-170   
gb|AFN26935.1|  polyketide synthase                                     497   3e-170   
ref|XP_009618741.1|  PREDICTED: chalcone synthase                       497   3e-170   
gb|KDP28845.1|  hypothetical protein JCGZ_14616                         497   4e-170   
emb|CDP09465.1|  unnamed protein product                                496   4e-170   
gb|KHF97528.1|  Chalcone synthase 9                                     496   4e-170   
ref|XP_010540240.1|  PREDICTED: chalcone synthase                       497   4e-170   
emb|CBI16627.3|  unnamed protein product                                498   4e-170   
gb|AAY96720.1|  chalcone synthase family protein                        496   5e-170   Arabidopsis thaliana [mouse-ear cress]
gb|AEE69028.1|  polyketide synthase                                     496   5e-170   
gb|AAY96723.1|  chalcone synthase family protein                        496   6e-170   Arabidopsis thaliana [mouse-ear cress]
gb|ABP98922.1|  polyketide synthase                                     496   7e-170   Hypericum perforatum
ref|XP_006445367.1|  hypothetical protein CICLE_v10020530mg             496   9e-170   
ref|XP_009785374.1|  PREDICTED: chalcone synthase                       496   1e-169   
gb|AAY96741.1|  chalcone synthase family protein                        496   1e-169   Arabidopsis thaliana [mouse-ear cress]
gb|AAY96721.1|  chalcone synthase family protein                        495   1e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003516799.1|  PREDICTED: chalcone synthase-like                  495   1e-169   
gb|AAZ81861.1|  chalcone synthase family protein                        495   2e-169   Arabidopsis halleri subsp. gemmifera
gb|AGO05924.1|  anther-specific protein                                 495   2e-169   
gb|AAZ81862.1|  chalcone synthase family protein                        495   2e-169   Arabidopsis halleri subsp. gemmifera
gb|AAY96729.1|  chalcone synthase family protein                        495   2e-169   Arabidopsis thaliana [mouse-ear cress]
gb|AAY96717.1|  chalcone synthase family protein                        495   2e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003607498.1|  Chalcone synthase                                  494   3e-169   
gb|AAY96719.1|  chalcone synthase family protein                        494   3e-169   Arabidopsis thaliana [mouse-ear cress]
gb|AAY96725.1|  chalcone synthase family protein                        494   4e-169   Arabidopsis thaliana [mouse-ear cress]
gb|AAY96728.1|  chalcone synthase family protein                        493   1e-168   Arabidopsis thaliana [mouse-ear cress]
gb|AAY96746.1|  chalcone synthase family protein                        493   2e-168   Arabidopsis thaliana [mouse-ear cress]
gb|AAY96745.1|  chalcone synthase family protein                        493   2e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004492184.1|  PREDICTED: chalcone synthase-like                  493   2e-168   
gb|AAY96748.1|  chalcone synthase family protein                        490   2e-167   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009401221.1|  PREDICTED: chalcone synthase                       489   2e-167   
ref|XP_007140778.1|  hypothetical protein PHAVU_008G141200g             489   5e-167   
ref|XP_010258840.1|  PREDICTED: chalcone synthase-like                  489   7e-167   
ref|XP_006837297.1|  hypothetical protein AMTR_s00111p00033190          488   1e-166   
emb|CAN83038.1|  hypothetical protein VITISV_034337                     484   9e-166   Vitis vinifera
ref|XP_010501268.1|  PREDICTED: pentatricopeptide repeat-containi...    508   3e-165   
ref|XP_011094451.1|  PREDICTED: LOW QUALITY PROTEIN: chalcone syn...    484   3e-165   
gb|EYU31920.1|  hypothetical protein MIMGU_mgv1a007619mg                484   4e-165   
emb|CAA74847.1|  anther-specific protein                                483   7e-165   Nicotiana sylvestris
gb|AAZ81869.1|  chalcone synthase family protein                        483   1e-164   Arabidopsis halleri subsp. gemmifera
ref|XP_004229766.1|  PREDICTED: chalcone synthase 6-4                   483   2e-164   
ref|XP_011042452.1|  PREDICTED: pentatricopeptide repeat-containi...    507   7e-164   
ref|XP_006347928.1|  PREDICTED: octaketide synthase 3-like              479   4e-163   
gb|ADF43043.1|  chalcone synthase 2 protein                             478   7e-163   
emb|CDX83215.1|  BnaA03g22910D                                          478   7e-163   
emb|CDY21499.1|  BnaC03g26980D                                          478   1e-162   
ref|XP_009133969.1|  PREDICTED: chalcone synthase                       477   2e-162   
gb|ACY74337.1|  putative chalcone synthase                              474   1e-161   Artemisia annua [sweet Annie]
ref|XP_006854881.1|  hypothetical protein AMTR_s00182p00053650          472   2e-161   
ref|XP_002875049.1|  hypothetical protein ARALYDRAFT_490563             474   2e-161   
ref|XP_006290098.1|  hypothetical protein CARUB_v10003743mg             474   5e-161   
ref|XP_010456329.1|  PREDICTED: chalcone synthase-like isoform X1       471   8e-160   
ref|XP_004142644.1|  PREDICTED: chalcone synthase J-like                469   2e-159   
gb|AAM63363.1|  putative chalcone synthase                              469   3e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456330.1|  PREDICTED: chalcone synthase-like isoform X2       469   3e-159   
ref|XP_004308525.1|  PREDICTED: pentatricopeptide repeat-containi...    493   4e-159   
ref|XP_008444217.1|  PREDICTED: chalcone synthase                       468   5e-159   
ref|XP_008232397.1|  PREDICTED: pentatricopeptide repeat-containi...    491   1e-158   
ref|NP_191915.1|  Chalcone and stilbene synthase family protein         466   4e-158   Arabidopsis thaliana [mouse-ear cress]
gb|EMT21347.1|  hypothetical protein F775_52323                         466   9e-158   
ref|XP_007219350.1|  hypothetical protein PRUPE_ppa019432mg             464   1e-157   
ref|XP_006396202.1|  hypothetical protein EUTSA_v10028565mg             464   2e-157   
ref|XP_002511627.1|  pentatricopeptide repeat-containing protein,...    484   1e-155   Ricinus communis
ref|XP_006396200.1|  hypothetical protein EUTSA_v10028565mg             465   2e-155   
ref|XP_010053966.1|  PREDICTED: chalcone synthase-like                  456   3e-154   
gb|EPS63204.1|  hypothetical protein M569_11580                         448   2e-151   
ref|XP_010934708.1|  PREDICTED: chalcone synthase-like                  442   2e-149   
ref|XP_001781520.1|  predicted protein                                  438   1e-146   
ref|XP_003574084.1|  PREDICTED: chalcone synthase-like                  436   2e-146   
ref|XP_008775196.1|  PREDICTED: chalcone synthase-like                  434   2e-146   
ref|XP_010661353.1|  PREDICTED: chalcone synthase isoform X1            434   2e-145   
ref|NP_001064891.1|  Os10g0484800                                       428   4e-143   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001150611.1|  chalcone synthase G                                428   4e-143   Zea mays [maize]
gb|EAY78973.1|  hypothetical protein OsI_34081                          427   7e-143   Oryza sativa Indica Group [Indian rice]
ref|XP_008678397.1|  PREDICTED: chalcone synthase G isoform X1          425   4e-142   
gb|ACN35784.1|  unknown                                                 422   9e-142   Zea mays [maize]
gb|EAZ39507.1|  hypothetical protein OsJ_23944                          424   2e-141   Oryza sativa Japonica Group [Japonica rice]
emb|CAA62921.1|  chalcone synthase-like                                 422   1e-140   Oryza sativa [red rice]
ref|XP_004982809.1|  PREDICTED: stilbene synthase 4-like                421   1e-140   
ref|XP_002467058.1|  hypothetical protein SORBIDRAFT_01g018950          421   2e-140   Sorghum bicolor [broomcorn]
ref|XP_006661875.1|  PREDICTED: stilbene synthase 4-like                421   3e-140   
ref|NP_001131211.1|  uncharacterized protein LOC100192519               420   6e-140   Zea mays [maize]
ref|XP_002985571.1|  hypothetical protein SELMODRAFT_122361             420   7e-140   
gb|EMS57002.1|  Stilbene synthase 4                                     419   1e-139   
gb|AFW68541.1|  hypothetical protein ZEAMMB73_283153                    420   2e-139   
gb|ACB38748.1|  chalcone synthase-like protein                          418   4e-139   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006396201.1|  hypothetical protein EUTSA_v10028565mg             413   9e-138   
dbj|BAG32254.1|  chalcone synthase                                      400   1e-132   Raphanus sativus
ref|XP_008344150.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    414   1e-128   
ref|XP_010466554.1|  PREDICTED: chalcone synthase-like                  306   4e-97    
gb|ABI94386.1|  chalcone synthase-like polyketide synthase              308   3e-96    Huperzia serrata [toothed club-moss]
gb|AHY39238.1|  stilbenecarboxylate synthase 2                          307   1e-95    
gb|AIV42295.1|  chalcone synthase                                       306   1e-95    
pdb|3AWJ|A  Chain A, Crystal Structure Of The Huperzia Serrata Po...    304   1e-94    
gb|AAK49457.1|  chalcone synthase                                       303   2e-94    Nicotiana tabacum [American tobacco]
ref|XP_009619773.1|  PREDICTED: chalcone synthase 1B                    302   3e-94    
gb|AAW30010.1|  stilbenecarboxylate synthase 2                          302   5e-94    Marchantia polymorpha
ref|XP_009616637.1|  PREDICTED: chalcone synthase 2                     301   6e-94    
gb|AIM54369.1|  chalcone synthase                                       301   7e-94    
gb|AFU52909.1|  chalcone synthase                                       301   1e-93    
gb|ABB89213.1|  chalcone synthase                                       301   1e-93    Sorbus aucuparia [European mountain ash]
ref|NP_001275296.1|  chalcone synthase 2                                300   2e-93    
gb|AFL47798.1|  chalcone synthase                                       301   2e-93    
gb|AFM36768.1|  chalcone synthase                                       300   2e-93    
gb|AGM46641.1|  chalcone synthase protein                               300   2e-93    
gb|AGI02994.1|  chalcone synthase                                       300   2e-93    
ref|XP_009376347.1|  PREDICTED: polyketide synthase 5                   300   2e-93    
gb|ABM63466.1|  aromatic polyketide synthase                            300   2e-93    Hypericum hookerianum
gb|ACS12837.1|  chalcone synthase                                       300   2e-93    Nicotiana alata [flowering tobacco]
ref|XP_008380609.1|  PREDICTED: polyketide synthase 5                   300   3e-93    
dbj|BAB92996.1|  chalcone synthase                                      300   3e-93    Malus domestica [apple tree]
gb|AFH68066.1|  chalcone synthase                                       300   3e-93    
gb|AFM36767.1|  chalcone synthase                                       300   3e-93    
sp|Q9FUB7.1|CHSY_HYPAN  RecName: Full=Chalcone synthase; AltName:...    300   3e-93    Hypericum androsaemum
ref|XP_008358057.1|  PREDICTED: polyketide synthase 5                   299   6e-93    
gb|AFC37242.1|  chalcone synthase 1                                     299   6e-93    
gb|AIY22756.1|  chalcone synthase                                       299   6e-93    
gb|AFM36766.1|  chalcone synthase                                       299   6e-93    
gb|AEO96985.1|  chalcone synthase                                       299   6e-93    
sp|P08894.1|CHSA_PETHY  RecName: Full=Chalcone synthase A; AltNam...    299   7e-93    Petunia x hybrida [garden petunia]
gb|AGL50915.1|  chalcone synthase                                       299   8e-93    
sp|P48386.1|CHS1_CAMSI  RecName: Full=Chalcone synthase 1; AltNam...    299   8e-93    Camellia sinensis [black tea]
dbj|BAM17286.1|  chalcone synthase                                      299   8e-93    
gb|AGZ15299.1|  chalcone synthase                                       299   8e-93    
ref|NP_001234036.1|  chalcone synthase 2                                299   8e-93    
dbj|BAI66465.1|  chalcone synthase                                      298   8e-93    Camellia japonica [common camellia]
gb|AFQ92052.1|  chalcone synthase                                       298   9e-93    
gb|AAN04188.1|  Putative chalcone synthase                              299   9e-93    Oryza sativa Japonica Group [Japonica rice]
gb|AFL72079.1|  chalcone synthase                                       298   9e-93    
sp|Q01286.1|CHS1_PEA  RecName: Full=Chalcone synthase 1; AltName:...    298   1e-92    Pisum sativum [garden pea]
gb|AFE56210.1|  chalcone synthase                                       298   1e-92    
sp|Q43163.1|CHSB_SOLTU  RecName: Full=Chalcone synthase 1B; AltNa...    298   1e-92    Solanum tuberosum [potatoes]
gb|AGW24283.1|  chalcone synthase                                       298   1e-92    
gb|AEN04070.1|  chalcone synthase                                       298   1e-92    
gb|ABN80439.1|  chalcone synthase                                       298   1e-92    Nicotiana benthamiana
gb|AFM36769.1|  chalcone synthase                                       298   2e-92    
ref|XP_010099135.1|  Chalcone synthase                                  298   2e-92    
gb|ABI79305.1|  chalcone synthase                                       298   2e-92    Pyrus communis
ref|XP_009376346.1|  PREDICTED: chalcone synthase-like                  298   2e-92    
gb|ADV29810.1|  chalcone synthase                                       298   2e-92    
ref|XP_002299281.2|  naregenin-chalcone synthase family protein         298   2e-92    Populus trichocarpa [western balsam poplar]
gb|AIV99854.1|  chalcone synthase                                       297   2e-92    
pdb|4WUM|A  Chain A, X-ray Crystal Structure Of Chalcone Synthase...    297   2e-92    
gb|ABE01413.1|  chalcone synthase                                       298   2e-92    Anthurium andraeanum [flamingo-lily]
dbj|BAM17288.1|  chalcone synthase                                      297   2e-92    
gb|AAP20864.1|  putative chalcone synthase                              297   3e-92    Anthurium andraeanum [flamingo-lily]
gb|AIY22757.1|  chalcone synthase                                       297   3e-92    
gb|AAL67805.1|AF461105_1  chalcone synthase                             297   3e-92    Hypericum perforatum
gb|AFU90825.1|  chalcone synthase                                       297   3e-92    
dbj|BAM17287.1|  chalcone synthase                                      297   3e-92    
gb|AAX16494.1|  chalcone synthase                                       297   3e-92    Pyrus communis
pdb|2P0U|A  Chain A, Crystal Structure Of Marchantia Polymorpha S...    298   4e-92    
gb|KEH27375.1|  chalcone and stilbene synthase family protein           297   4e-92    
ref|XP_011034455.1|  PREDICTED: chalcone synthase 1-like                297   4e-92    
ref|XP_009764938.1|  PREDICTED: chalcone synthase A                     297   4e-92    
gb|KDP20327.1|  hypothetical protein JCGZ_06413                         297   4e-92    
emb|CAA32731.1|  chalcone synthase                                      297   4e-92    Petunia x hybrida [garden petunia]
gb|KHG25969.1|  Chalcone synthase 1                                     297   4e-92    
ref|XP_007034442.1|  Chalcone and stilbene synthase family protein      297   4e-92    
gb|ABS52573.1|  chalcone synthase                                       296   4e-92    Gossypium hirsutum [American cotton]
gb|AHA61354.1|  chalcone synthase                                       296   5e-92    
sp|Q9ZRR8.1|CHS1_CASGL  RecName: Full=Chalcone synthase; AltName:...    296   6e-92    Casuarina glauca
sp|P51085.1|CHS3_TRISU  RecName: Full=Chalcone synthase 3; AltNam...    296   6e-92    Trifolium subterraneum
gb|AEO96989.1|  chalcone synthase                                       296   6e-92    
ref|XP_009370115.1|  PREDICTED: chalcone synthase-like                  296   6e-92    
ref|XP_011034457.1|  PREDICTED: chalcone synthase 1-like                296   6e-92    
gb|ACN60400.1|  chalcone synthase                                       296   6e-92    
gb|ABM66532.1|  chalcone synthase                                       296   6e-92    
ref|XP_002977158.1|  hypothetical protein SELMODRAFT_271225             296   6e-92    
emb|CAC88858.1|  chalcone synthase                                      296   6e-92    
ref|XP_009353802.1|  PREDICTED: chalcone synthase-like                  296   6e-92    
ref|XP_010099134.1|  Chalcone synthase                                  296   7e-92    
gb|AAF60297.1|AF233638_1  chalcone synthase                             296   8e-92    
ref|XP_009774927.1|  PREDICTED: chalcone synthase 2                     296   9e-92    
gb|AAB36038.1|  chalcone synthase                                       296   9e-92    
sp|P51077.1|CHS3_MEDSA  RecName: Full=Chalcone synthase 4-1; AltN...    296   9e-92    
sp|Q9SB26.1|CHS9_DAUCA  RecName: Full=Chalcone synthase 9; AltNam...    296   1e-91    
gb|AHY35309.1|  chalcone synthase 2                                     296   1e-91    
gb|EPS72180.1|  chalcone synthase                                       296   1e-91    
gb|ADO85332.1|  chalcone synthase                                       296   1e-91    
ref|NP_001275352.1|  chalcone synthase 1A                               296   1e-91    
gb|AGW22222.1|  chalcone synthase                                       296   1e-91    
sp|P30077.1|CHS9_MEDSA  RecName: Full=Chalcone synthase 9; AltNam...    296   1e-91    
dbj|BAE53636.1|  chalcone synthase                                      296   1e-91    
gb|AGV53049.1|  chalcone synthase                                       296   1e-91    
gb|AGU70032.1|  chalcone synthase                                       296   1e-91    
gb|AFM36770.1|  chalcone synthase                                       295   1e-91    
gb|EAZ24017.1|  hypothetical protein OsJ_07741                          296   1e-91    
gb|ACE60221.1|  chalcone synthase                                       295   2e-91    
gb|AEN83501.1|  chalcone synthase                                       295   2e-91    
gb|AEF14414.1|  chalcone synthase                                       295   2e-91    
dbj|BAO58433.1|  chalcone synthase                                      295   2e-91    
gb|AHK22740.1|  chalcone synthase                                       295   2e-91    
gb|EAY77763.1|  hypothetical protein OsI_32800                          295   2e-91    
gb|AIB06736.1|  chalcone synthases-1                                    295   2e-91    
gb|KEH27376.1|  chalcone and stilbene synthase family protein           295   2e-91    
gb|ADW11243.1|  chalcone synthase 2                                     295   2e-91    
sp|P51087.1|CHS5_TRISU  RecName: Full=Chalcone synthase 5; AltNam...    295   2e-91    
ref|XP_006420608.1|  hypothetical protein CICLE_v10005133mg             295   3e-91    
gb|ACJ54531.1|  chalcone synthase                                       295   3e-91    
sp|P48387.1|CHS2_CAMSI  RecName: Full=Chalcone synthase 2; AltNam...    295   3e-91    
gb|AAS21057.1|  chalcone synthase                                       295   3e-91    
dbj|BAA03784.1|  chalcone synthase                                      295   3e-91    
gb|ACV72638.1|  chalcone synthase 1                                     295   3e-91    
gb|AFK33946.1|  unknown                                                 295   3e-91    
sp|Q8RVK9.1|CHS_CANSA  RecName: Full=Naringenin-chalcone synthase       295   3e-91    
sp|Q01288.1|CHS6_PEA  RecName: Full=Chalcone synthase 6; AltName:...    295   3e-91    
sp|Q9ZS41.1|CHS1_DAUCA  RecName: Full=Chalcone synthase 1; AltNam...    295   3e-91    
ref|XP_003595645.1|  Chalcone synthase                                  295   3e-91    
ref|XP_004504355.1|  PREDICTED: chalcone synthase 1-like                295   3e-91    
sp|Q01287.1|CHS2_PEA  RecName: Full=Chalcone synthase 2; AltName:...    295   3e-91    
ref|NP_001064227.2|  Os10g0167900                                       295   3e-91    
gb|AAM00232.1|AF358432_1  root-specific chalcone synthase               295   3e-91    
dbj|BAO58434.1|  chalcone synthase                                      295   3e-91    
sp|P30075.2|CHS4_MEDSA  RecName: Full=Chalcone synthase 4; AltNam...    295   3e-91    
dbj|BAA31259.1|  chalcone synthase                                      295   3e-91    
sp|P51088.1|CHS6_TRISU  RecName: Full=Chalcone synthase 6; AltNam...    294   4e-91    
gb|AFC37244.1|  chalcone synthase 3                                     294   4e-91    
gb|AAU43217.1|  chalcone synthase                                       294   4e-91    
gb|AAX63402.1|  chalcone synthase                                       294   4e-91    
ref|XP_008380608.1|  PREDICTED: polyketide synthase 5-like              294   4e-91    
ref|XP_011091402.1|  PREDICTED: chalcone synthase                       294   4e-91    
gb|AEW12813.1|  chalcone synthase                                       294   4e-91    
sp|O04111.1|CHSY_PERFR  RecName: Full=Chalcone synthase; AltName:...    294   5e-91    
gb|ADO85327.1|  chalcone synthase                                       294   5e-91    
sp|Q9SML4.1|CHS1_CICAR  RecName: Full=Chalcone synthase 1; AltNam...    294   5e-91    
ref|XP_009353801.1|  PREDICTED: chalcone synthase                       294   5e-91    
ref|NP_001267879.1|  chalcone synthase                                  294   5e-91    
sp|P51084.1|CHS2_TRISU  RecName: Full=Chalcone synthase 2; AltNam...    294   6e-91    
gb|AHY35308.1|  chalcone synthase 1                                     294   6e-91    
gb|AGE84303.1|  chalcone synthase                                       294   6e-91    
gb|AID51449.1|  chalcone synthase 2                                     294   6e-91    
ref|XP_011020677.1|  PREDICTED: chalcone synthase 1-like isoform X1     294   7e-91    
ref|XP_002299282.1|  naregenin-chalcone synthase family protein         294   7e-91    
gb|AAO13091.1|  chalcone synthase                                       293   7e-91    
gb|AIA22214.1|  chalcone synthase                                       293   8e-91    
dbj|BAC10998.1|  chalcone synthase                                      293   8e-91    
gb|AAN05791.1|  chalcone synthase                                       293   8e-91    
ref|XP_002268842.2|  PREDICTED: stilbene synthase 2                     293   8e-91    
gb|AIB06737.1|  chalcone synthases-1                                    294   9e-91    
ref|XP_003621530.1|  Chalcone synthase                                  293   9e-91    
ref|XP_003610852.1|  Chalcone synthase                                  293   1e-90    
ref|XP_003621538.1|  Chalcone synthase                                  293   1e-90    
gb|ADZ45299.1|  chalcone synthase 1                                     293   1e-90    
ref|XP_010249317.1|  PREDICTED: chalcone synthase                       293   1e-90    
gb|ACN30003.1|  chalcone synthase                                       293   1e-90    
ref|XP_011020680.1|  PREDICTED: chalcone synthase 1-like isoform X2     293   1e-90    
sp|P51083.1|CHS1_TRISU  RecName: Full=Chalcone synthase 1; AltNam...    293   1e-90    
gb|AAF00586.1|  stilbene synthase                                       293   1e-90    
ref|XP_003610855.1|  Chalcone synthase                                  293   1e-90    
gb|ABC84859.1|  resveratrol synthase                                    293   1e-90    
gb|ACH56521.1|  chalcone synthase                                       293   1e-90    
ref|XP_003621536.1|  Chalcone synthase                                  293   1e-90    
sp|P51082.1|CHSB_PEA  RecName: Full=Chalcone synthase 1B; AltName...    293   1e-90    
gb|ACS36661.1|  CHS4                                                    293   1e-90    
gb|AAO32821.1|  chalcone synthase                                       293   2e-90    
emb|CAK19319.1|  naringenin-chalcone synthase                           293   2e-90    
sp|O22046.1|CHSE_IPONI  RecName: Full=Chalcone synthase E; AltNam...    293   2e-90    
gb|ACM17224.1|  naringenin-chalcone synthase                            293   2e-90    
gb|ABE68894.1|  resveratrol synthase                                    293   2e-90    
gb|AFX71920.1|  CHS2 chalcone synthase                                  293   2e-90    
sp|P48388.1|CHS3_CAMSI  RecName: Full=Chalcone synthase 3; AltNam...    293   2e-90    
gb|KDP41871.1|  hypothetical protein JCGZ_26889                         293   2e-90    
gb|AGI02993.1|  chalcone synthase                                       293   2e-90    
ref|XP_003601647.1|  Chalcone synthase                                  293   2e-90    
gb|AID69535.1|  chalcone synthase                                       293   2e-90    
emb|CAR64527.1|  chalcone synthase                                      293   2e-90    
ref|XP_006489796.1|  PREDICTED: chalcone synthase 1-like                293   2e-90    
emb|CAA54221.1|  Stilbene synthase                                      293   2e-90    
ref|XP_003634068.1|  PREDICTED: stilbene synthase 2                     293   2e-90    
gb|AAU93767.1|  chalcone synthase                                       293   2e-90    
sp|P22928.2|CHSJ_PETHY  RecName: Full=Chalcone synthase J; AltNam...    293   2e-90    
gb|AFD36435.1|  chalcone synthase 1                                     293   2e-90    
ref|XP_002303819.2|  naregenin-chalcone synthase family protein         293   2e-90    
gb|ADZ45297.1|  chalcone synthase 2                                     292   2e-90    
ref|XP_003592044.1|  Chalcone synthase                                  292   2e-90    
gb|ADZ45295.1|  chalcone synthase 3                                     292   2e-90    
dbj|BAB84112.1|  chalcone synthase                                      293   2e-90    
gb|ABF59865.1|  chalcone synthase                                       292   2e-90    
emb|CAN74316.1|  hypothetical protein VITISV_005184                     292   2e-90    
emb|CAA64452.1|  naringenin-chalcone synthase                           292   2e-90    
emb|CAA10131.1|  chalcone synthase                                      292   2e-90    
ref|NP_001064197.1|  Os10g0158400                                       293   2e-90    
gb|ADO85325.1|  chalcone synthase                                       292   2e-90    
gb|ADO85328.1|  chalcone synthase                                       292   2e-90    
gb|ACO59456.1|  stilbene synthase 1                                     292   3e-90    
ref|XP_003634069.1|  PREDICTED: stilbene synthase 4-like                292   3e-90    
gb|EAY94420.1|  hypothetical protein OsI_16189                          292   3e-90    
gb|AGI02996.1|  chalcone synthase                                       292   3e-90    
sp|P51081.1|CHSA_PEA  RecName: Full=Chalcone synthase 1A; AltName...    292   3e-90    
sp|Q9ZRS4.1|CHSY_CATRO  RecName: Full=Chalcone synthase; AltName:...    292   3e-90    
ref|XP_007161599.1|  hypothetical protein PHAVU_001G083000g             292   3e-90    
gb|AFM56646.1|  stilbene synthase                                       292   3e-90    
gb|AHK07000.1|  chalcone synthase                                       292   3e-90    
sp|O23882.1|CHS4_PEA  RecName: Full=Chalcone synthase 4; AltName:...    292   3e-90    
gb|EAZ24018.1|  hypothetical protein OsJ_07742                          292   3e-90    
ref|XP_010662547.1|  PREDICTED: stilbene synthase 4                     292   3e-90    
gb|AAO63021.1|  chalcone synthase B                                     292   3e-90    
gb|AAM00230.1|AF358430_1  root-specific chalcone synthase               292   3e-90    
gb|ABC86919.1|  chalcone synthase                                       292   4e-90    
gb|AAY83389.1|  chalcone synthase                                       292   4e-90    
gb|AGJ50587.1|  CHS1                                                    292   4e-90    
sp|O23884.1|CHS5_PEA  RecName: Full=Chalcone synthase 5; AltName:...    291   4e-90    
gb|AFM29141.1|  chalcone synthase                                       291   4e-90    
gb|ABD24222.1|  chalcone synthase                                       292   4e-90    
emb|CAK19318.1|  naringenin-chalcone synthase                           291   4e-90    
ref|XP_002264989.1|  PREDICTED: stilbene synthase 4                     291   4e-90    
emb|CAK19317.1|  naringenin-chalcone synthase                           291   4e-90    
gb|ADD74168.1|  chalcone synthase                                       291   4e-90    
ref|XP_011020681.1|  PREDICTED: chalcone synthase 1                     291   5e-90    
gb|AHB50476.1|  putative stilbene synthase                              291   5e-90    
gb|AIC75908.1|  chalcone synthase                                       291   5e-90    
gb|AIS35912.1|  chalcone synthase                                       291   5e-90    
emb|CAC19808.1|  chalcone synthase                                      291   5e-90    
gb|AFN21537.1|  stilbene synthase                                       291   5e-90    
gb|AFJ44312.1|  chalcone synthase                                       291   5e-90    
gb|ACM62742.1|  chalcone synthase                                       291   5e-90    
ref|XP_003553986.1|  PREDICTED: chalcone synthase-like                  291   5e-90    
ref|XP_009393403.1|  PREDICTED: chalcone synthase 6-4-like              293   5e-90    
sp|P30073.1|CHS1_MEDSA  RecName: Full=Chalcone synthase 1; AltNam...    291   5e-90    
gb|ACH67480.1|  chalcone synthase                                       291   5e-90    
gb|AFM22751.1|  stilbene synthase                                       291   5e-90    
sp|O82144.1|CHSY_HYDMC  RecName: Full=Chalcone synthase; AltName:...    291   6e-90    
gb|KEH35361.1|  chalcone and stilbene synthase family protein           291   6e-90    
sp|P30074.1|CHS2_MEDSA  RecName: Full=Chalcone synthase 2; AltNam...    291   6e-90    
gb|ADO85331.1|  chalcone synthase                                       291   6e-90    
sp|P51090.1|CHSY_VITVI  RecName: Full=Chalcone synthase; AltName:...    291   6e-90    
ref|XP_010662501.1|  PREDICTED: stilbene synthase 4-like isoform X2     291   7e-90    
ref|XP_003634070.1|  PREDICTED: stilbene synthase 4-like isoform X1     291   7e-90    
sp|P06515.1|CHSY_ANTMA  RecName: Full=Chalcone synthase; AltName:...    291   7e-90    
gb|ABP57071.1|  chalcone synthase                                       291   7e-90    
ref|XP_003601648.1|  Chalcone synthase                                  291   7e-90    
gb|AFN21524.1|  stilbene synthase                                       291   7e-90    
gb|AFM56657.1|  stilbene synthase                                       291   8e-90    
emb|CBI31800.3|  unnamed protein product                                292   8e-90    
gb|ADO85326.1|  chalcone synthase                                       291   8e-90    
gb|ADO85333.1|  chalcone synthase                                       291   8e-90    
gb|ABM73434.1|  chalcone synthase                                       291   8e-90    
ref|XP_003634067.1|  PREDICTED: stilbene synthase 4-like                291   8e-90    
ref|XP_002303820.1|  naregenin-chalcone synthase family protein         291   9e-90    
gb|AIY34670.1|  chalcone synthase                                       291   9e-90    
gb|AAN76182.1|AF456445_1  stilbenecarboxylate synthase                  291   9e-90    
emb|CAM32716.1|  chalcone synthase enzyme                               291   9e-90    
ref|XP_004502226.1|  PREDICTED: chalcone synthase 1B-like               291   9e-90    
emb|CAC20725.1|  putative chalcone synthase                             291   9e-90    
gb|AEB00550.1|  stilbene synthase 1                                     291   1e-89    
gb|AAT75302.1|  chalcone synthase                                       291   1e-89    
gb|AEB00549.1|  stilbene synthase                                       291   1e-89    
gb|ACJ85339.1|  unknown                                                 291   1e-89    
dbj|BAE17123.1|  chalcone synthase                                      290   1e-89    
ref|XP_010662504.1|  PREDICTED: stilbene synthase 2                     291   1e-89    
dbj|BAA19548.1|  chalcone synthase                                      290   1e-89    
ref|XP_003634073.1|  PREDICTED: stilbene synthase 4                     290   1e-89    
emb|CAN72348.1|  hypothetical protein VITISV_020801                     290   1e-89    
gb|AEO36981.1|  chalcone synthase                                       290   1e-89    
gb|AHB18370.1|  chalcone synthase 1                                     290   1e-89    
ref|XP_003517529.1|  PREDICTED: chalcone synthase 7                     290   1e-89    
ref|NP_001234033.1|  chalcone synthase 1                                290   1e-89    
gb|AFN21506.1|  stilbene synthase                                       290   1e-89    
gb|ABF59866.1|  chalcone synthase                                       290   1e-89    
gb|AFM56662.1|  stilbene synthase                                       290   1e-89    
ref|XP_004306543.1|  PREDICTED: chalcone synthase 2-like                290   1e-89    
ref|XP_008808809.1|  PREDICTED: chalcone synthase 3                     290   1e-89    
sp|O22047.1|CHSE_IPOPU  RecName: Full=Chalcone synthase E; AltNam...    290   1e-89    
gb|AFN21543.1|  stilbene synthase                                       290   1e-89    
dbj|BAE17124.1|  chalcone synthase                                      290   1e-89    
emb|CAJ44127.1|  chalcone synthase                                      290   1e-89    
gb|ACT32034.1|  chalcone synthase                                       290   1e-89    
sp|P23569.1|CHSY_PUEML  RecName: Full=Chalcone synthase; AltName:...    290   2e-89    
gb|AFN21545.1|  stilbene synthase                                       290   2e-89    
gb|AHJ80976.1|  chalcone synthase                                       290   2e-89    
gb|AFN21500.1|  stilbene synthase                                       290   2e-89    
gb|ABF06882.1|  stilbene synthase                                       290   2e-89    
sp|O23883.1|CHS3_PEA  RecName: Full=Chalcone synthase 3; AltName:...    290   2e-89    
gb|ABF59867.1|  chalcone synthase                                       290   2e-89    
ref|XP_010910945.1|  PREDICTED: chalcone synthase-like                  290   2e-89    
ref|WP_039310897.1|  hypothetical protein                               289   2e-89    
ref|XP_007223025.1|  hypothetical protein PRUPE_ppa006888mg             290   2e-89    
ref|XP_003577513.1|  PREDICTED: chalcone synthase 2                     290   2e-89    
ref|NP_001149022.1|  chalcone synthase                                  290   2e-89    
gb|AFN21530.1|  stilbene synthase                                       290   2e-89    
gb|EAY94419.1|  hypothetical protein OsI_16188                          290   2e-89    
gb|AFN21532.1|  stilbene synthase                                       290   2e-89    
ref|XP_002271371.1|  PREDICTED: stilbene synthase 2                     290   2e-89    
ref|XP_010908134.1|  PREDICTED: chalcone synthase 3-like                290   2e-89    
sp|P16107.1|CHSY_PETCR  RecName: Full=Chalcone synthase; AltName:...    290   2e-89    



>ref|XP_009799363.1| PREDICTED: chalcone synthase [Nicotiana sylvestris]
Length=390

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/384 (84%), Positives = 360/384 (94%), Gaps = 3/384 (1%)
 Frame = +3

Query  72    LQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVK  251
             ++GGKK + G A+I+ALGKAFPHQLVMQEFLVDGYFKNTNCDDP LKQ+LTRLCKTTTVK
Sbjct  7     MEGGKKTNTGNATILALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQRLTRLCKTTTVK  66

Query  252   TRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITH  431
             TRYVVMSEEILKKYPEL +EGLPTVKQRLDICN+AVT+MAIEAS +CI KWGR  ++ITH
Sbjct  67    TRYVVMSEEILKKYPELTVEGLPTVKQRLDICNAAVTEMAIEASQSCINKWGRPISDITH  126

Query  432   LVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRV  611
             +VYVSSSEARLPGGDLYLAKGLGL P+T+RVMLYF+GCSGGVAGLRVAKDIAENNPGSRV
Sbjct  127   VVYVSSSEARLPGGDLYLAKGLGLSPETKRVMLYFAGCSGGVAGLRVAKDIAENNPGSRV  186

Query  612   LVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHF  791
             L+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGSNPVQ++ERPLFELHTAIQHF
Sbjct  187   LLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSNPVQDIERPLFELHTAIQHF  246

Query  792   VPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVH  971
             +PDTEKIIDG+LTEEGISFKLERELPQIIEDNI++FC KL+ +  Y+++ ++NKLFWAVH
Sbjct  247   LPDTEKIIDGRLTEEGISFKLERELPQIIEDNIEDFCDKLISITRYNNR-EYNKLFWAVH  305

Query  972   PGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEK--KRESEAED  1145
             PGGPAILNRLEK+LELSP+KLSASRRALADYGNASSNTIVYVLEYMLEE   K++   E 
Sbjct  306   PGGPAILNRLEKRLELSPDKLSASRRALADYGNASSNTIVYVLEYMLEENKGKKKENQEH  365

Query  1146  SDWGLILAFGPGITLEGILTRNLT  1217
             SDWGLILAFGPGIT EGILT+NLT
Sbjct  366   SDWGLILAFGPGITFEGILTKNLT  389



>ref|XP_009621338.1| PREDICTED: chalcone synthase [Nicotiana tomentosiformis]
Length=390

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/384 (84%), Positives = 361/384 (94%), Gaps = 3/384 (1%)
 Frame = +3

Query  72    LQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVK  251
             ++G KK + G A+I+ALGKAFPHQLVMQEFLVDGYFKNTNCDDP LKQ+LTRLCKTTTVK
Sbjct  7     MEGRKKTNTGNATILALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQRLTRLCKTTTVK  66

Query  252   TRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITH  431
             TRYVVMSEEILKKYPELA+EGLPTVKQRLDICN+AVT+MAIEAS +CI KWGR  ++ITH
Sbjct  67    TRYVVMSEEILKKYPELAVEGLPTVKQRLDICNAAVTEMAIEASQSCINKWGRPISDITH  126

Query  432   LVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRV  611
             +VYVSSSEARLPGGDLYLAKGLGL P+T+RVMLYF+GCSGGVAG+RVAKDIAENNPGSRV
Sbjct  127   VVYVSSSEARLPGGDLYLAKGLGLSPETKRVMLYFAGCSGGVAGIRVAKDIAENNPGSRV  186

Query  612   LVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHF  791
             L+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGSNP+Q++ERPLFELHTAIQHF
Sbjct  187   LLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSNPIQDIERPLFELHTAIQHF  246

Query  792   VPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVH  971
             +PDTEKIIDG+LTEEGISFKLERELPQIIE+NI++FC KL+ + GY+ + ++NKLFWAVH
Sbjct  247   LPDTEKIIDGRLTEEGISFKLERELPQIIEENIEDFCDKLISITGYNDR-EYNKLFWAVH  305

Query  972   PGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYML--EEKKRESEAED  1145
             PGGPAILNRLEKKLELSPEKLSASRRALADYGNASSNTIVYVLEYML  ++ K++   ED
Sbjct  306   PGGPAILNRLEKKLELSPEKLSASRRALADYGNASSNTIVYVLEYMLEEKKDKKKENQED  365

Query  1146  SDWGLILAFGPGITLEGILTRNLT  1217
             S+WGLILAFGPGIT EGILT+NLT
Sbjct  366   SNWGLILAFGPGITFEGILTKNLT  389



>ref|XP_004230925.1| PREDICTED: chalcone synthase [Solanum lycopersicum]
Length=383

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/382 (84%), Positives = 358/382 (94%), Gaps = 6/382 (2%)
 Frame = +3

Query  72    LQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVK  251
             ++G  + + G A+I+ALGKAFPHQLVMQEFLVDGYFKNTNCDDP LKQ+LTRLCKTTTVK
Sbjct  7     MEGRNEINFGNATILALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQRLTRLCKTTTVK  66

Query  252   TRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITH  431
             TRYVVMSEEILKKYPELA+EGLPTVKQRLDICN+AVT+MAIEAS +CIKKWGR  ++ITH
Sbjct  67    TRYVVMSEEILKKYPELAVEGLPTVKQRLDICNAAVTEMAIEASQSCIKKWGRPISDITH  126

Query  432   LVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRV  611
             +VYVSSSEARLPGGDLYLAKGLGL P+T+RVMLYF+GCSGGVAGLRVAKDIAENNPGSRV
Sbjct  127   VVYVSSSEARLPGGDLYLAKGLGLNPETKRVMLYFAGCSGGVAGLRVAKDIAENNPGSRV  186

Query  612   LVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHF  791
             L+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGSNP++++ERPLFELHTAIQHF
Sbjct  187   LLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSNPIRDIERPLFELHTAIQHF  246

Query  792   VPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVH  971
             +PDTEKIIDG+LTEEGISFKLERELPQIIEDNI++FC KL+ ++G   + ++NKLFWAVH
Sbjct  247   LPDTEKIIDGRLTEEGISFKLERELPQIIEDNIEDFCDKLINISGIKDR-EYNKLFWAVH  305

Query  972   PGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSD  1151
             PGGPAILNRLEKKL+LSP+KLSASRRALADYGNASSNTIVYVLEYMLEEKK     + +D
Sbjct  306   PGGPAILNRLEKKLDLSPDKLSASRRALADYGNASSNTIVYVLEYMLEEKK-----DITD  360

Query  1152  WGLILAFGPGITLEGILTRNLT  1217
             WGLILAFGPGIT EGILT+NLT
Sbjct  361   WGLILAFGPGITFEGILTKNLT  382



>ref|XP_006359643.1| PREDICTED: chalcone synthase 2-like [Solanum tuberosum]
Length=380

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/382 (84%), Positives = 358/382 (94%), Gaps = 6/382 (2%)
 Frame = +3

Query  72    LQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVK  251
             ++G  + + G A+I+ALGKAFPHQLVMQEFLVDGYFKNTNCDDP LKQ+LTRLCKTTTVK
Sbjct  4     MEGRNEINFGNATILALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQRLTRLCKTTTVK  63

Query  252   TRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITH  431
             TRYVVMSEEILKKYPELA+EGLPTVKQRLDICN+AVT+MAIEAS +CIKKWGR  ++ITH
Sbjct  64    TRYVVMSEEILKKYPELAVEGLPTVKQRLDICNAAVTEMAIEASQSCIKKWGRPISDITH  123

Query  432   LVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRV  611
             +VYVSSSEARLPGGDLYLAKGLGL P+T+RVMLYF+GCSGGVAGLRVAKDIAENNPGSRV
Sbjct  124   VVYVSSSEARLPGGDLYLAKGLGLSPETKRVMLYFAGCSGGVAGLRVAKDIAENNPGSRV  183

Query  612   LVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHF  791
             L+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGSNP++++ERPLFELHTAIQHF
Sbjct  184   LLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSNPIRDIERPLFELHTAIQHF  243

Query  792   VPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVH  971
             +PDTEKIIDG+LTEEGISFKLERELPQIIEDNI+ FC KL+ ++G + + ++NKLFWAVH
Sbjct  244   LPDTEKIIDGRLTEEGISFKLERELPQIIEDNIEGFCDKLISISGINDR-EYNKLFWAVH  302

Query  972   PGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSD  1151
             PGGPAILNRLEKKL+LSPEKLSASRRALADYGNASSNTIVYVLEYMLEEKK     + +D
Sbjct  303   PGGPAILNRLEKKLDLSPEKLSASRRALADYGNASSNTIVYVLEYMLEEKK-----DITD  357

Query  1152  WGLILAFGPGITLEGILTRNLT  1217
             WGLILAFGPGIT EGILT+NLT
Sbjct  358   WGLILAFGPGITFEGILTKNLT  379



>ref|XP_011092869.1| PREDICTED: chalcone synthase [Sesamum indicum]
Length=390

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/387 (83%), Positives = 351/387 (91%), Gaps = 3/387 (1%)
 Frame = +3

Query  63    DAVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTT  242
             +   Q  + A   KA+I+ALGKAFPHQLVMQEFLVDGYF++TNCDDP LKQKL RLCK+T
Sbjct  4     EVTFQCSRSADSRKAAILALGKAFPHQLVMQEFLVDGYFRDTNCDDPELKQKLARLCKST  63

Query  243   TVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTE  422
             TVKTRYVVMSEEIL KYPELAIEGLPTVKQRL+ICNSAVTQMAIEAS +CIKKWGR  ++
Sbjct  64    TVKTRYVVMSEEILTKYPELAIEGLPTVKQRLEICNSAVTQMAIEASESCIKKWGRPVSD  123

Query  423   ITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPG  602
             ITHLVYVSSSEARLPGGDLYLAKGLGLRPDT+R MLYFSGCSGGVAGLRVAKDIAENNPG
Sbjct  124   ITHLVYVSSSEARLPGGDLYLAKGLGLRPDTRRTMLYFSGCSGGVAGLRVAKDIAENNPG  183

Query  603   SRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAI  782
             SRVL+ATSETTIIGF+PPSADRPYDLVGVALFGDGAGAM+IGSNPV + ERPLFEL+ A+
Sbjct  184   SRVLLATSETTIIGFRPPSADRPYDLVGVALFGDGAGAMIIGSNPVVKTERPLFELYAAL  243

Query  783   QHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFW  962
             QHF+P TEK+IDG+LTEEGISFKLER+LPQIIE+NI +FC +LM  AGYS K DFNKLFW
Sbjct  244   QHFLPGTEKVIDGKLTEEGISFKLERQLPQIIENNIQDFCVQLMGSAGYSEK-DFNKLFW  302

Query  963   AVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK--RESE  1136
             AVHPGGPAILNRLEKKLEL PEKL+ASRRAL DYGNASSNTIVYVLEYMLEE K  R+ E
Sbjct  303   AVHPGGPAILNRLEKKLELLPEKLNASRRALTDYGNASSNTIVYVLEYMLEEAKNVRKDE  362

Query  1137  AEDSDWGLILAFGPGITLEGILTRNLT  1217
                ++WGLILAFGPGIT EGILT+NLT
Sbjct  363   QGHNEWGLILAFGPGITFEGILTKNLT  389



>ref|XP_007041944.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
 gb|EOX97775.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
Length=391

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 354/381 (93%), Gaps = 3/381 (1%)
 Frame = +3

Query  81    GKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRY  260
              K+A+PGKA+I+ALGKAFPHQLVMQ+FLVDGYFKNTNCDDP LKQKL+RLCKTTTVKTRY
Sbjct  10    AKRANPGKATILALGKAFPHQLVMQDFLVDGYFKNTNCDDPELKQKLSRLCKTTTVKTRY  69

Query  261   VVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVY  440
             VVMS+EILKKYPELAIEGLPTVKQRLDICN+AVT+MAIEAS  CIKKWGR  ++ITHLVY
Sbjct  70    VVMSDEILKKYPELAIEGLPTVKQRLDICNNAVTEMAIEASRACIKKWGRPMSDITHLVY  129

Query  441   VSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVA  620
             VSSSEARLPGGDL+LAKGLGL P+TQRVMLYF GCSGGVAGLRVAKDIAENNPGSRVL+A
Sbjct  130   VSSSEARLPGGDLFLAKGLGLSPETQRVMLYFMGCSGGVAGLRVAKDIAENNPGSRVLLA  189

Query  621   TSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPD  800
             TSETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS+PV  +ERPLFELHTAIQ+F+P+
Sbjct  190   TSETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPVLSIERPLFELHTAIQNFLPN  249

Query  801   TEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGG  980
             TEK IDG+LTEEGISFKL RELPQIIEDN++ FC KLM + G + K D+N +FWAVHPGG
Sbjct  250   TEKTIDGKLTEEGISFKLARELPQIIEDNVEGFCEKLMGIVGLTDK-DYNNMFWAVHPGG  308

Query  981   PAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEK-KRESEA-EDSDW  1154
             PAILNR+EK+L+L PEKL+ASRRAL DYGNASSNTIVYVLEYM+EE  KR++E+ EDS+W
Sbjct  309   PAILNRMEKRLDLFPEKLNASRRALMDYGNASSNTIVYVLEYMIEESLKRKTESREDSEW  368

Query  1155  GLILAFGPGITLEGILTRNLT  1217
             GLILAFGPG+T EGIL RNLT
Sbjct  369   GLILAFGPGVTFEGILARNLT  389



>ref|XP_006487398.1| PREDICTED: chalcone synthase 6-like [Citrus sinensis]
Length=387

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/380 (83%), Positives = 349/380 (92%), Gaps = 4/380 (1%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             KKASPGKA+++ALGKAFPHQLVMQEFLVDGYFKNTNCDDP LKQKLTRLCKTTTVKTRYV
Sbjct  9     KKASPGKATVLALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQKLTRLCKTTTVKTRYV  68

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMS+EILKKYPELA+EGLPTVKQRLDICN AVTQMAIEAS  CIK WGR  T+ITH+VYV
Sbjct  69    VMSDEILKKYPELAMEGLPTVKQRLDICNKAVTQMAIEASQACIKSWGRPITDITHVVYV  128

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSEARLPGGDLYLA+GLGL P+TQRVMLYF GCSGGV+GLRVAKDIAENNPGSRVL+AT
Sbjct  129   SSSEARLPGGDLYLARGLGLSPETQRVMLYFMGCSGGVSGLRVAKDIAENNPGSRVLLAT  188

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETTIIGFKPPSA+RPYDLVGVALFGDGAGAM++GS+PV   ERPLFELHTAIQ+F+P+T
Sbjct  189   SETTIIGFKPPSAERPYDLVGVALFGDGAGAMIVGSDPVPS-ERPLFELHTAIQNFLPNT  247

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             EK IDG+LTEEGISFKL RELPQIIEDNI+ FC KLM   G+++ +D+NK+FWAVHPGGP
Sbjct  248   EKTIDGRLTEEGISFKLARELPQIIEDNIEGFCGKLMGNIGFTN-NDYNKMFWAVHPGGP  306

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWG  1157
             AILN+LEK+L L P+KL+ASRRAL DYGNASSNTIVYVLEYMLEE  K +  + ED+DWG
Sbjct  307   AILNKLEKRLNLLPDKLNASRRALMDYGNASSNTIVYVLEYMLEESLKMKSQDHEDTDWG  366

Query  1158  LILAFGPGITLEGILTRNLT  1217
             LILAFGPGIT EGIL RNLT
Sbjct  367   LILAFGPGITFEGILARNLT  386



>ref|XP_006423581.1| hypothetical protein CICLE_v10028633mg [Citrus clementina]
 gb|ESR36821.1| hypothetical protein CICLE_v10028633mg [Citrus clementina]
 gb|KDO44184.1| hypothetical protein CISIN_1g016569mg [Citrus sinensis]
Length=387

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/380 (83%), Positives = 348/380 (92%), Gaps = 4/380 (1%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
              KASPGKA+I+ALGKAFPHQLVMQEFLVDGYFKNTNCDDP LKQKLTRLCKTTTVKTRYV
Sbjct  9     NKASPGKATILALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQKLTRLCKTTTVKTRYV  68

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMS+EILKKYPELAIEGLPTVKQRLDICN AVTQMAIEAS  CIK WGR  T+ITH+VYV
Sbjct  69    VMSDEILKKYPELAIEGLPTVKQRLDICNKAVTQMAIEASQACIKSWGRPITDITHVVYV  128

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSEARLPGGDLYLA+GLGL P+TQRVMLYF GCSGGV+GLRVAKDIAENNPGSRVL+AT
Sbjct  129   SSSEARLPGGDLYLARGLGLSPETQRVMLYFMGCSGGVSGLRVAKDIAENNPGSRVLLAT  188

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETTIIGFKPPSA+RPYDLVGVALFGDGAGAM++GS+PV   ERPLFELHTAIQ+F+P+T
Sbjct  189   SETTIIGFKPPSAERPYDLVGVALFGDGAGAMIVGSDPVPS-ERPLFELHTAIQNFLPNT  247

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             EK IDG+LTEEGISFKL RELPQIIEDNI+ FC KLM   G+++ +D+NK+FWAVHPGGP
Sbjct  248   EKTIDGRLTEEGISFKLARELPQIIEDNIEGFCGKLMGNIGFTN-NDYNKMFWAVHPGGP  306

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWG  1157
             AILN+LEK+L L P+KL+ASRRAL DYGNASSNTIVYVLEYMLEE  K +  + ED+DWG
Sbjct  307   AILNKLEKRLNLLPDKLNASRRALMDYGNASSNTIVYVLEYMLEESLKMKSQDHEDTDWG  366

Query  1158  LILAFGPGITLEGILTRNLT  1217
             LILAFGPGIT EGIL RNLT
Sbjct  367   LILAFGPGITFEGILARNLT  386



>ref|XP_002305482.1| hypothetical protein POPTR_0004s17460g [Populus trichocarpa]
 gb|EEE85993.1| hypothetical protein POPTR_0004s17460g [Populus trichocarpa]
Length=391

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/384 (83%), Positives = 350/384 (91%), Gaps = 4/384 (1%)
 Frame = +3

Query  75    QGG--KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTV  248
             QGG   KASPGKA+I+ALGKAFPHQLVMQEFLVDGYFKNTNCDDP LKQKLTRLCKTTTV
Sbjct  8     QGGLTSKASPGKATILALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQKLTRLCKTTTV  67

Query  249   KTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEIT  428
             KTRYVVMS+EIL KYPELAIEG+PT+KQRLDICN AVTQMAI AS  CIKKWGRS ++IT
Sbjct  68    KTRYVVMSDEILNKYPELAIEGIPTIKQRLDICNDAVTQMAIGASRACIKKWGRSVSDIT  127

Query  429   HLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSR  608
             H+VYVSSSEARLPGGDLYLA GLGL P+TQRVMLYFSGCSGGVAGLRVAKDIAENNPGSR
Sbjct  128   HMVYVSSSEARLPGGDLYLAGGLGLSPETQRVMLYFSGCSGGVAGLRVAKDIAENNPGSR  187

Query  609   VLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQH  788
             VL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAMVIG++PV   E PLFELHTAIQ+
Sbjct  188   VLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMVIGTDPVPVTESPLFELHTAIQN  247

Query  789   FVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAV  968
             F+P+TEK IDG+LTEEGISFKL RELPQIIEDNI+ FC KL+ VAG + K D+NK+FWAV
Sbjct  248   FLPNTEKTIDGRLTEEGISFKLARELPQIIEDNIEGFCHKLIGVAGLTDK-DYNKMFWAV  306

Query  969   HPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE-KKRESEAED  1145
             HPGGPAILNR+EK+L+L P+KL+ASRRAL DYGNASSNTIVYVLEYM+EE +K ++ A +
Sbjct  307   HPGGPAILNRMEKRLDLLPDKLNASRRALMDYGNASSNTIVYVLEYMIEESRKMKAGAAN  366

Query  1146  SDWGLILAFGPGITLEGILTRNLT  1217
              DWGLILAFGPGIT EGIL RNLT
Sbjct  367   CDWGLILAFGPGITFEGILARNLT  390



>emb|CDO96957.1| unnamed protein product [Coffea canephora]
Length=391

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/391 (81%), Positives = 353/391 (90%), Gaps = 5/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRL  230
             MG  DAV  G    +PGKA+I+ALGKAFP QLVMQEFLVDGYF+NTNCDDP LKQKLTRL
Sbjct  1     MGIEDAV-HGSTTVTPGKATILALGKAFPPQLVMQEFLVDGYFRNTNCDDPDLKQKLTRL  59

Query  231   CKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGR  410
             CKTTTVKTRYVVMSEEIL +YPEL +EGLPTVKQRLDICN AVT+MAIEA+ +CIK WGR
Sbjct  60    CKTTTVKTRYVVMSEEILNQYPELVVEGLPTVKQRLDICNPAVTEMAIEAAQSCIKNWGR  119

Query  411   SPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAE  590
               ++ITHLVYVSSSE RLPGGDLYLAKGLGLRP+TQRVML FSGCSGGVAG+RVAKDIAE
Sbjct  120   PISDITHLVYVSSSEVRLPGGDLYLAKGLGLRPETQRVMLNFSGCSGGVAGIRVAKDIAE  179

Query  591   NNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFEL  770
             NNPGSRVL+ATSETTIIGF+PPSA+RPYDLVGVALFGDGAGAM++GS+P   +ERPLFEL
Sbjct  180   NNPGSRVLLATSETTIIGFRPPSAERPYDLVGVALFGDGAGAMIVGSSPEPSIERPLFEL  239

Query  771   HTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFN  950
             HT++QHF+PDTEKIIDG+LTEEGISFKL RELPQIIEDNI+ FCA+LM VAGYS K D+N
Sbjct  240   HTSMQHFLPDTEKIIDGRLTEEGISFKLGRELPQIIEDNIEGFCARLMDVAGYSEK-DYN  298

Query  951   KLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK--  1124
             K+FWAVHPGGPAILNR+EKKL+L PEKL+ASRRALAD+GNASSNTIVYVLEYMLEE K  
Sbjct  299   KMFWAVHPGGPAILNRMEKKLDLLPEKLNASRRALADFGNASSNTIVYVLEYMLEENKIA  358

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              +E +  + +WGLILAFGPGIT EGILTR L
Sbjct  359   RKEDQKGNEEWGLILAFGPGITFEGILTRTL  389



>ref|XP_002276653.1| PREDICTED: chalcone synthase [Vitis vinifera]
Length=392

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/380 (83%), Positives = 345/380 (91%), Gaps = 3/380 (1%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             KKA+PGKA+I+ALGKAFPHQLVMQEFLVDGYF+NTNCDDP LK+KL RLCKTTTVKTRYV
Sbjct  13    KKANPGKATILALGKAFPHQLVMQEFLVDGYFRNTNCDDPDLKEKLARLCKTTTVKTRYV  72

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMSEEIL+KYPEL IEG PTVKQRLDICN AVTQMAI+AS  CIKKWGRS +EITHLVYV
Sbjct  73    VMSEEILRKYPELVIEGQPTVKQRLDICNKAVTQMAIDASKACIKKWGRSVSEITHLVYV  132

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSEARLPGGDLYLAKGLGL P+T RV LYF GCSGGVAGLRVAKDIAENNP SRVL+AT
Sbjct  133   SSSEARLPGGDLYLAKGLGLSPETHRVQLYFMGCSGGVAGLRVAKDIAENNPESRVLLAT  192

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS+P+   ERPLFELHTAIQ+F+PDT
Sbjct  193   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPIPSTERPLFELHTAIQNFLPDT  252

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             EK IDG+LTEEGISFKL RELPQIIED+I+ FC KL+R  G+S  +D+NK+FWAVHPGGP
Sbjct  253   EKTIDGRLTEEGISFKLARELPQIIEDHIEAFCDKLIRNVGFSD-EDYNKIFWAVHPGGP  311

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWG  1157
             AILNR+EK+L+L PEKL+ASRRALADYGNASSNTIVYVLEYMLEE  K +  +  D +WG
Sbjct  312   AILNRMEKRLDLLPEKLNASRRALADYGNASSNTIVYVLEYMLEESSKTKRQDQGDGEWG  371

Query  1158  LILAFGPGITLEGILTRNLT  1217
             LILAFGPGIT EGIL RNLT
Sbjct  372   LILAFGPGITFEGILARNLT  391



>ref|XP_002529257.1| Chalcone synthase, putative [Ricinus communis]
 gb|EEF33135.1| Chalcone synthase, putative [Ricinus communis]
Length=387

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/379 (83%), Positives = 347/379 (92%), Gaps = 2/379 (1%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             K A+PGKA+I+ALGKAFPHQLVMQEFLVDGYFKNTNCDDP LKQKLTRLCKTTTVKTRYV
Sbjct  9     KMANPGKATILALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQKLTRLCKTTTVKTRYV  68

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMSEEIL+KYPELA+EGLPT+KQRLDICN AVT+MAIEAS  CIK WGR  ++ITHLVYV
Sbjct  69    VMSEEILEKYPELAVEGLPTLKQRLDICNEAVTKMAIEASQKCIKNWGRPISDITHLVYV  128

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSEARLPGGDL+LA+GLGL P+TQRV LYF GCSGGV+GLR+AKDIAENNPGSRVL+AT
Sbjct  129   SSSEARLPGGDLHLARGLGLSPETQRVTLYFMGCSGGVSGLRIAKDIAENNPGSRVLLAT  188

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IG++PV + E PLFELHTAIQ+F+PDT
Sbjct  189   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGTDPVSKTESPLFELHTAIQNFLPDT  248

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             EKIIDG+LTEEGISFKL RELP IIEDNI+ FC KLM VAG + K D+NKLFWAVHPGGP
Sbjct  249   EKIIDGRLTEEGISFKLARELPHIIEDNIEGFCQKLMGVAGLTDK-DYNKLFWAVHPGGP  307

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEK-KRESEAEDSDWGL  1160
             AILNR+EK+L+L PEKL+ASRRAL DYGNASSNTIVYVLEYM+EE  K + E  +++WGL
Sbjct  308   AILNRMEKRLDLFPEKLNASRRALMDYGNASSNTIVYVLEYMIEESLKMKEENVNNEWGL  367

Query  1161  ILAFGPGITLEGILTRNLT  1217
             ILAFGPGIT EGIL RNLT
Sbjct  368   ILAFGPGITFEGILARNLT  386



>gb|KDP27594.1| hypothetical protein JCGZ_19599 [Jatropha curcas]
Length=391

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/391 (81%), Positives = 347/391 (89%), Gaps = 3/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQG-GKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  + V  G  KKA PG A+I+ALGKAFPHQLVMQEFLVDGYFKNTNC DP LKQKLTR
Sbjct  1     MGSEEIVQTGLSKKAKPGTATILALGKAFPHQLVMQEFLVDGYFKNTNCYDPDLKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LC+TTTVKTRYVVMSEEIL KYPELAIEG+PTVKQRLDICN AVTQMAIEAS TCIKKWG
Sbjct  61    LCQTTTVKTRYVVMSEEILNKYPELAIEGIPTVKQRLDICNDAVTQMAIEASETCIKKWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             R  ++ITHLVYVSSSEARLPGGDL+LA+GLGL P+TQRVMLYF GCSGGVAGLRVAKDIA
Sbjct  121   RPISDITHLVYVSSSEARLPGGDLHLARGLGLSPETQRVMLYFMGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGF+PP+ADRPYDLVGVALFGDGAGAM+IG++PV  +E PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFRPPNADRPYDLVGVALFGDGAGAMIIGTDPVSNVESPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEKIIDG++TEEGISFKL RELP IIEDNI+ FC KLMR AG   K  +
Sbjct  241   LHTAIQNFLPDTEKIIDGRMTEEGISFKLARELPHIIEDNIESFCQKLMRGAGVGDK-GY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEK-K  1124
             N  FWAVHPGGPAILNR+EK+L+L PEKL+ASRRAL DYGNASSNTIVYVLEYM+EE  K
Sbjct  300   NNFFWAVHPGGPAILNRIEKRLQLLPEKLNASRRALMDYGNASSNTIVYVLEYMIEESLK  359

Query  1125  RESEAEDSDWGLILAFGPGITLEGILTRNLT  1217
                E ED  WGLILAFGPGITLEG+L RNL+
Sbjct  360   INKENEDCQWGLILAFGPGITLEGVLARNLS  390



>ref|XP_009350954.1| PREDICTED: chalcone synthase [Pyrus x bretschneideri]
 ref|XP_011037255.1| PREDICTED: chalcone synthase [Populus euphratica]
Length=391

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/384 (82%), Positives = 348/384 (91%), Gaps = 4/384 (1%)
 Frame = +3

Query  75    QGG--KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTV  248
             QGG   KASPGKA+I+ALGKAFPHQLVMQEFLVDGYF+NTNCDDP LKQKLTRLCKTTTV
Sbjct  8     QGGLTSKASPGKATILALGKAFPHQLVMQEFLVDGYFRNTNCDDPELKQKLTRLCKTTTV  67

Query  249   KTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEIT  428
             KTRYVVMS+EIL KYPELAIEG+PT+KQRLDICN AVT+MAI AS  CIKKWGRS ++IT
Sbjct  68    KTRYVVMSDEILNKYPELAIEGIPTIKQRLDICNDAVTRMAIGASRACIKKWGRSVSDIT  127

Query  429   HLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSR  608
             H+VYVSSSEARLPGGDLYLA GLGL P+TQRVMLYFSGCSGGVAGLRVAKDIAENNPGSR
Sbjct  128   HMVYVSSSEARLPGGDLYLAGGLGLSPETQRVMLYFSGCSGGVAGLRVAKDIAENNPGSR  187

Query  609   VLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQH  788
             VL+ATSETTIIGFKPPS DRPYDLVGVALFGDGA AMVIG++PV   E PLFELHTAIQ+
Sbjct  188   VLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAAAMVIGTDPVPVTESPLFELHTAIQN  247

Query  789   FVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAV  968
             F+P+TEK IDG+LTEEGISFKL RELPQIIE+NI+ FC KL+ VAG + K D+NK+FWAV
Sbjct  248   FLPNTEKTIDGRLTEEGISFKLARELPQIIEENIEGFCRKLIGVAGLTDK-DYNKMFWAV  306

Query  969   HPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE-KKRESEAED  1145
             HPGGPAILNR+EK+L+L P+KL+ASRRAL DYGNASSNTIVYVLEYM+EE +K ++   +
Sbjct  307   HPGGPAILNRMEKRLDLLPDKLNASRRALMDYGNASSNTIVYVLEYMIEESRKMKAGIAN  366

Query  1146  SDWGLILAFGPGITLEGILTRNLT  1217
              DWGLILAFGPGIT EGIL RNLT
Sbjct  367   CDWGLILAFGPGITFEGILARNLT  390



>ref|XP_006379273.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
 gb|ERP57070.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
Length=391

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/391 (80%), Positives = 353/391 (90%), Gaps = 5/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG--KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLT  224
             MG+ + ++QGG   KA+PGKA+I+ALGKAFPHQLVMQEFLVDGYFKNTNCDD  LKQKLT
Sbjct  1     MGY-EQIVQGGLTTKANPGKATILALGKAFPHQLVMQEFLVDGYFKNTNCDDLELKQKLT  59

Query  225   RLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKW  404
             RLCKTTTVKTRYVVMS+EILKKYPELAIEGLPTVKQRLDICN AVT+MAI+AS  CIKKW
Sbjct  60    RLCKTTTVKTRYVVMSDEILKKYPELAIEGLPTVKQRLDICNDAVTRMAIDASRACIKKW  119

Query  405   GRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDI  584
             GR  ++ITHLVYVSSSEARLPGGDLYLA GLGL P+TQRVMLYF+GCSGGVAGLRVAKDI
Sbjct  120   GRPVSDITHLVYVSSSEARLPGGDLYLAGGLGLSPETQRVMLYFAGCSGGVAGLRVAKDI  179

Query  585   AENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLF  764
             AENNPGSRVL+ATSETTIIGFKPPSADRPYDLVGVALFGDGAGAM++G++P+   E PLF
Sbjct  180   AENNPGSRVLLATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMIVGTDPIPVTESPLF  239

Query  765   ELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDD  944
             ELHTAIQ+F+P+TEK IDG+LTEEGISFKL RELPQIIEDNI+ FC KL+  AG + K D
Sbjct  240   ELHTAIQNFLPNTEKTIDGRLTEEGISFKLSRELPQIIEDNIEGFCHKLIGNAGLTDK-D  298

Query  945   FNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK  1124
             +NK+FWAVHPGGPAILNR+EK+ +L P+KL+ASRRAL DYGNASSNTIVYVLEYM+EE +
Sbjct  299   YNKMFWAVHPGGPAILNRMEKRFDLLPDKLNASRRALMDYGNASSNTIVYVLEYMIEECR  358

Query  1125  RESE-AEDSDWGLILAFGPGITLEGILTRNL  1214
             +  E +E+ DWGLILAFGPGIT EGIL R L
Sbjct  359   KMKEGSENCDWGLILAFGPGITFEGILARKL  389



>gb|EYU40405.1| hypothetical protein MIMGU_mgv1a008045mg [Erythranthe guttata]
Length=386

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/375 (82%), Positives = 343/375 (91%), Gaps = 4/375 (1%)
 Frame = +3

Query  102   KASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEEI  281
             KA+I+ALGKAFPHQLVMQEFLVDGY +NTNCDDP LKQKLTRLCK TTVKTRYVVMSEEI
Sbjct  12    KAAILALGKAFPHQLVMQEFLVDGYLRNTNCDDPDLKQKLTRLCKATTVKTRYVVMSEEI  71

Query  282   LKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSEAR  461
             L KYPELA EG+PT+ QRL+ICNSAVT+MAIEAS +CI+KWGR  ++ITH+VYVSSSEAR
Sbjct  72    LNKYPELAAEGVPTLNQRLEICNSAVTKMAIEASRSCIEKWGRPVSDITHVVYVSSSEAR  131

Query  462   LPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETTII  641
             LPGGDLYLA+GLGLRPDT+RVMLYFSGCSGGVAGLRVAKDIAENNP SRVL+ATSETTII
Sbjct  132   LPGGDLYLARGLGLRPDTRRVMLYFSGCSGGVAGLRVAKDIAENNPNSRVLLATSETTII  191

Query  642   GFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKIIDG  821
             GFKPPSADRPYDLVGVALFGDGAGAM+IGS PV E+E+PLFELHTAIQHF+PDTEKIIDG
Sbjct  192   GFKPPSADRPYDLVGVALFGDGAGAMIIGSGPVSEIEKPLFELHTAIQHFLPDTEKIIDG  251

Query  822   QLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILNRl  1001
             +LTEEGISFKLE++LPQIIEDNI +FC +LM   G+  K DFN+LFWAVHPGGPAILN+L
Sbjct  252   KLTEEGISFKLEKQLPQIIEDNIQDFCVELMGYGGFCEK-DFNELFWAVHPGGPAILNKL  310

Query  1002  ekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEK---KRESEAEDSDWGLILAF  1172
             EKKLEL PEKL +SRRAL+DYGNASSNTIVYVLEYMLEE    K + +  + +WGLILAF
Sbjct  311   EKKLELLPEKLKSSRRALSDYGNASSNTIVYVLEYMLEEAKNFKNKGQNGNCEWGLILAF  370

Query  1173  GPGITLEGILTRNLT  1217
             GPGITLEGIL +NLT
Sbjct  371   GPGITLEGILAKNLT  385



>ref|XP_010690460.1| PREDICTED: chalcone synthase [Beta vulgaris subsp. vulgaris]
Length=395

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/380 (81%), Positives = 340/380 (89%), Gaps = 3/380 (1%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
              KA+ GKA+I+ALGK FPHQLVMQEFLVDGYF+NTNCDDP LK+KL RLCKTTTVKTRYV
Sbjct  16    NKANIGKATILALGKGFPHQLVMQEFLVDGYFRNTNCDDPELKEKLMRLCKTTTVKTRYV  75

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMSEEIL KYPELAIEG PTV QRLDICN AVTQMAIEAS  CI  WGR  ++ITHLVYV
Sbjct  76    VMSEEILNKYPELAIEGQPTVTQRLDICNEAVTQMAIEASKACISNWGRPISDITHLVYV  135

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSEARLPGGD+YLAKGLGL+P+T RVMLYF+GCSGGVAGLRVAKDIAENNPGSRVL+AT
Sbjct  136   SSSEARLPGGDIYLAKGLGLKPETNRVMLYFAGCSGGVAGLRVAKDIAENNPGSRVLLAT  195

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETTIIGFKPPSA+RPYDLVGVALFGDGAGAM+IGS+P   +ERPLFELHTAIQHF+PDT
Sbjct  196   SETTIIGFKPPSANRPYDLVGVALFGDGAGAMLIGSDPDLSIERPLFELHTAIQHFLPDT  255

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             EKIIDG+LTEEGISFKL+R LPQIIEDNI+ FC KLM   G S+K D+NK+FWAVHPGGP
Sbjct  256   EKIIDGRLTEEGISFKLDRALPQIIEDNIESFCGKLMENIGLSNK-DYNKIFWAVHPGGP  314

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWG  1157
             AILNRLEK+L+LSP+KL ASRRALADYGNASSNTIVYV+EYM+EE  K  +    D  WG
Sbjct  315   AILNRLEKRLDLSPDKLIASRRALADYGNASSNTIVYVMEYMMEEGAKMNKEHKNDDQWG  374

Query  1158  LILAFGPGITLEGILTRNLT  1217
             LILAFGPG+T EGIL +NLT
Sbjct  375   LILAFGPGVTFEGILAKNLT  394



>ref|XP_011046865.1| PREDICTED: chalcone synthase-like [Populus euphratica]
 ref|XP_011046870.1| PREDICTED: chalcone synthase-like [Populus euphratica]
Length=391

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/391 (79%), Positives = 352/391 (90%), Gaps = 5/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG--KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLT  224
             MG+ + ++QGG   KA+P KA+I+ALGKAFP QLVMQEFLVDGYFKNTNCDD  LKQKLT
Sbjct  1     MGY-EQIVQGGLTTKANPSKATILALGKAFPPQLVMQEFLVDGYFKNTNCDDLELKQKLT  59

Query  225   RLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKW  404
             RLCK+TTVKTRYVVMS+EILKKYPELAIEGLPTVKQRL ICN AVT+MAI+AS  CIKKW
Sbjct  60    RLCKSTTVKTRYVVMSDEILKKYPELAIEGLPTVKQRLSICNDAVTRMAIDASRACIKKW  119

Query  405   GRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDI  584
             GR  ++ITHLVYVSSSEARLPGGDLYLA GLGL P+TQRVMLYF+GCSGGVAG+RVAKDI
Sbjct  120   GRPVSDITHLVYVSSSEARLPGGDLYLAGGLGLSPETQRVMLYFAGCSGGVAGIRVAKDI  179

Query  585   AENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLF  764
             AENNPGSRVL+ATSETTIIGFKPPSADRPYDLVGVALFGDGAGAM++G++P+   E PLF
Sbjct  180   AENNPGSRVLLATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMIVGTDPIPVTESPLF  239

Query  765   ELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDD  944
             ELHTAIQ+F+P+TEK IDG+LTEEGISFKL RELPQIIEDNI+ FC KL+ +AG + K D
Sbjct  240   ELHTAIQNFLPNTEKTIDGRLTEEGISFKLSRELPQIIEDNIEGFCHKLIGIAGLTDK-D  298

Query  945   FNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK  1124
             +NK+FWAVHPGGPAILNR+EK+ +L P+KL+ASRRAL DYGNASSNTIVYVLEYM+EE +
Sbjct  299   YNKMFWAVHPGGPAILNRMEKRFDLLPDKLNASRRALMDYGNASSNTIVYVLEYMIEECR  358

Query  1125  RESE-AEDSDWGLILAFGPGITLEGILTRNL  1214
             +  E +E+ DWGLILAFGPGIT EGIL RNL
Sbjct  359   KMKEGSENCDWGLILAFGPGITFEGILARNL  389



>ref|XP_002869122.1| chalcone synthase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45381.1| chalcone synthase family protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/391 (80%), Positives = 346/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA + G  KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK TNCDDP LKQKLTR
Sbjct  1     MGSIDAAVLGSVKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS +EITHLVYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISEITHLVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM++GS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIVGSDPDPICEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+ +WGLILAFGPG+T EGI+ RNL
Sbjct  360   VRNMNEEEDEWGLILAFGPGVTFEGIIARNL  390



>gb|AAZ23686.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ23687.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/391 (80%), Positives = 346/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDA-VLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA VL   KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDAEVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS +EITHLVYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISEITHLVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+ RNL
Sbjct  360   VRNMNEEENEWGLILAFGPGVTFEGIIARNL  390



>ref|XP_003537759.1| PREDICTED: chalcone synthase-like [Glycine max]
Length=387

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/378 (81%), Positives = 342/378 (90%), Gaps = 3/378 (1%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALGKAFPHQLVMQE+LVDGYF++TNCD P LKQKLTRLCKTTTVKTRYVVMS
Sbjct  11    TPGKATILALGKAFPHQLVMQEYLVDGYFRDTNCDSPELKQKLTRLCKTTTVKTRYVVMS  70

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             EEILKKYPELA EG+PTVKQRL+ICN AVT+MAIEAS  CI  WG S ++ITHLVYVSSS
Sbjct  71    EEILKKYPELAAEGIPTVKQRLEICNEAVTEMAIEASQACINNWGGSLSDITHLVYVSSS  130

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EARLPGGDLYLAKGLGL PDTQRVMLYF+GCSGGVAGLRVAKDIAENNPGSRVL+ATSET
Sbjct  131   EARLPGGDLYLAKGLGLSPDTQRVMLYFAGCSGGVAGLRVAKDIAENNPGSRVLIATSET  190

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS+P+ E E+PLFELHTA+Q F+P TEK 
Sbjct  191   TIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPILESEKPLFELHTAVQEFLPHTEKK  250

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+LTEEGISFKL RELPQIIEDN++ FC KL+ V G+ +K ++NK+FWAVHPGGPAIL
Sbjct  251   IDGRLTEEGISFKLARELPQIIEDNVEGFCDKLISVVGFENK-EYNKMFWAVHPGGPAIL  309

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWGLIL  1166
             NR+EK+L+L PEKLSASRRAL DYGNASSNTIVYVLEYM+EE  K R+    D +WGLIL
Sbjct  310   NRIEKRLDLLPEKLSASRRALMDYGNASSNTIVYVLEYMIEEGLKIRKDARGDLEWGLIL  369

Query  1167  AFGPGITLEGILTRNLTA  1220
             AFGPGIT EGIL RNL A
Sbjct  370   AFGPGITFEGILARNLCA  387



>ref|XP_010088676.1| Chalcone synthase 9 [Morus notabilis]
 gb|EXB36843.1| Chalcone synthase 9 [Morus notabilis]
Length=393

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/386 (80%), Positives = 347/386 (90%), Gaps = 2/386 (1%)
 Frame = +3

Query  63    DAVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTT  242
             DA L   KKA+PGKA+I+ALGKAFPHQLVMQE+LVDGYF++TNCDDP LK+KLTRLCKTT
Sbjct  6     DARLTSPKKATPGKATILALGKAFPHQLVMQEYLVDGYFRDTNCDDPELKRKLTRLCKTT  65

Query  243   TVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTE  422
             TVKTRYVVMSEEILKKYPELA+EG  TVKQRLDICN AVTQMAIEAS  CIK WGR  ++
Sbjct  66    TVKTRYVVMSEEILKKYPELALEGRSTVKQRLDICNDAVTQMAIEASQACIKNWGRPVSD  125

Query  423   ITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPG  602
             ITHLVYVSSSE RLPGGDLYLA GLGL P+TQRVMLYF GCSGGVAGLRVAKDIAENNPG
Sbjct  126   ITHLVYVSSSEIRLPGGDLYLASGLGLSPETQRVMLYFVGCSGGVAGLRVAKDIAENNPG  185

Query  603   SRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAI  782
             SR+L+ATSETTIIG+KPPSADRPYDLVGVALFGDGAGAM+IGS+PV E E+PLFELH+A+
Sbjct  186   SRILLATSETTIIGYKPPSADRPYDLVGVALFGDGAGAMIIGSDPVSETEKPLFELHSAM  245

Query  783   QHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFW  962
             Q F+P T+K IDG+LTEEGISFKL RELPQ+IED+++ FC KLM V G+  K+ +NK+FW
Sbjct  246   QRFLPGTDKTIDGRLTEEGISFKLARELPQVIEDSVEGFCEKLMGVKGFD-KEWYNKMFW  304

Query  963   AVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE-KKRESEA  1139
             AVHPGGPAILNR+EK+L+L PEKL+ASR+AL DYGNASSNTIVYVLEYMLEE  K + + 
Sbjct  305   AVHPGGPAILNRIEKRLDLDPEKLNASRKALMDYGNASSNTIVYVLEYMLEESSKMKVDQ  364

Query  1140  EDSDWGLILAFGPGITLEGILTRNLT  1217
             E+++WGLILAFGPGIT EGIL RNLT
Sbjct  365   EENEWGLILAFGPGITFEGILARNLT  390



>ref|XP_010437562.1| PREDICTED: chalcone synthase-like [Camelina sativa]
Length=392

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/391 (80%), Positives = 345/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA   G  KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDATELGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHLVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK D+
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+ RNL
Sbjct  360   VRSMNEEENEWGLILAFGPGVTFEGIIARNL  390



>gb|AAZ23705.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23709.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/391 (79%), Positives = 347/391 (89%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA + G  KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK TNCDDP LKQKLTR
Sbjct  1     MGSIDAAVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITH+VYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHVVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+P+TEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++
Sbjct  241   LHTAIQNFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+ RNL
Sbjct  360   VRNMNEEENEWGLILAFGPGVTFEGIIARNL  390



>ref|XP_006285956.1| hypothetical protein CARUB_v10007475mg [Capsella rubella]
 gb|EOA18854.1| hypothetical protein CARUB_v10007475mg [Capsella rubella]
Length=396

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/391 (79%), Positives = 348/391 (89%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA   G  KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK TNCDDP LKQKLTR
Sbjct  5     MGSIDATELGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTR  64

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV+QRLDICN AVT+MA+EAS  CIK WG
Sbjct  65    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVEQRLDICNDAVTEMAVEASRACIKNWG  124

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDLYLAKGLGL P+T RV+LYF GCSGGVAGLRVAKDIA
Sbjct  125   RSISDITHLVYVSSSEARLPGGDLYLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIA  184

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  185   ENNPGSRVLLATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPDPISEKPLFE  244

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG ++K D+
Sbjct  245   LHTAIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAYK-DY  303

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+I+YVLEYMLEE K 
Sbjct  304   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIIYVLEYMLEESKK  363

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+ RNL
Sbjct  364   VRSMNKEENEWGLILAFGPGVTFEGIIARNL  394



>ref|XP_010447028.1| PREDICTED: chalcone synthase [Camelina sativa]
Length=392

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/391 (80%), Positives = 346/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA   G  KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDATELGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS TCIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRTCIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHLVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGA++IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSMDRPYDLVGVALFGDGAGAVIIGSDPDPICEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK D+
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIVKAGLAHK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+ RNL
Sbjct  360   VRSLNEEENEWGLILAFGPGVTFEGIIARNL  390



>gb|AAZ23684.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ23689.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ23690.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ23691.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/391 (80%), Positives = 345/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDA-VLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA VL   KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDAEVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS +EITHLVYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISEITHLVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+  NL
Sbjct  360   VRNMNEEENEWGLILAFGPGVTFEGIIAINL  390



>ref|XP_010432375.1| PREDICTED: chalcone synthase-like [Camelina sativa]
Length=392

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/391 (79%), Positives = 345/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAV-LQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA  L   KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDATGLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHLVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM++GS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMILGSDPDPICEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK D+
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+ RNL
Sbjct  360   VRSLNEEENEWGLILAFGPGVTFEGIIARNL  390



>gb|AAZ23683.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/391 (79%), Positives = 345/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDA-VLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA VL   KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDAEVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS +EITHLVYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISEITHLVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+E++L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRMERRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+  NL
Sbjct  360   VRNMNEEENEWGLILAFGPGVTFEGIIAINL  390



>ref|XP_010530789.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010530790.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
Length=392

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/392 (79%), Positives = 349/392 (89%), Gaps = 6/392 (2%)
 Frame = +3

Query  51    MGFGDAVLQG-GKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  D    G GKKASPGKA+I+ALGKAFPHQLVMQE+LVDGYFK TNCDDP LKQKL R
Sbjct  1     MGSIDVAEMGSGKKASPGKATILALGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLAR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEIL+KYPEL IEG PTVKQRLDICN AVT+MA+EAS TCI  WG
Sbjct  61    LCKTTTVKTRYVVMSEEILRKYPELTIEGQPTVKQRLDICNDAVTEMAVEASRTCINNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             R  ++ITH+VYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RPASDITHVVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFIGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+AT+ETTIIGFKPPSA+RPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATAETTIIGFKPPSAERPYDLVGVALFGDGAGAMIIGSDPDPVHEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+P+TEK I G+LTEEGI+FKL RELPQIIEDN++ FC+KLM+VAG +  DD+
Sbjct  241   LHTAIQNFLPETEKTIVGRLTEEGINFKLARELPQIIEDNVENFCSKLMKVAGLT-PDDY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKR  1127
             N++FWAVHPGGPAILNR+EK+L+LSPEKLS SRRAL DYGNASSN+IVYVLEY+LEE  R
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLDLSPEKLSPSRRALMDYGNASSNSIVYVLEYLLEE-SR  358

Query  1128  ESEAED---SDWGLILAFGPGITLEGILTRNL  1214
             +++ ED    +WGLILAFGPG+T EGIL RNL
Sbjct  359   KAKNEDERGEEWGLILAFGPGVTFEGILARNL  390



>gb|AAZ23702.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23708.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/391 (79%), Positives = 347/391 (89%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA + G  KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDAAVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITH+VYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHVVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+P+TEK+IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++
Sbjct  241   LHTAIQNFLPETEKMIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+ RNL
Sbjct  360   VRNMNEEENEWGLILAFGPGVTFEGIIARNL  390



>ref|NP_567971.1| protein LESS ADHESIVE POLLEN 5 [Arabidopsis thaliana]
 gb|AAM63130.1| chalcone synthase-like protein [Arabidopsis thaliana]
 gb|AAZ23694.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23695.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23696.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23697.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23698.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23700.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23701.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23703.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23706.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23707.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23710.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23711.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23712.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23713.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23714.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23715.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23716.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23718.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23719.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23720.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23722.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23723.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23724.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23725.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|ABE66111.1| chalcone and stilbene synthase family protein [Arabidopsis thaliana]
 gb|AEE86428.1| Chalcone and stilbene synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/391 (79%), Positives = 346/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA + G  KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDAAVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITH+VYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHVVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+P+TEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++
Sbjct  241   LHTAIQNFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+ RNL
Sbjct  360   VRNMNEEENEWGLILAFGPGVTFEGIIARNL  390



>gb|AAZ23693.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/391 (79%), Positives = 345/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDA-VLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA VL   KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDAEVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS +EITHLVYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISEITHLVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+FKL RELPQIIEDN++ FC +L+  AG +HK ++
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKRLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+  NL
Sbjct  360   VRNMNEEENEWGLILAFGPGVTFEGIIAINL  390



>ref|XP_004505681.1| PREDICTED: chalcone synthase-like [Cicer arietinum]
Length=391

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/381 (81%), Positives = 340/381 (89%), Gaps = 3/381 (1%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             KK +PGKA+I++LGKAFPHQLVMQE+LVDGYF++TNCD+P LKQKL RLCKTTTVKTRYV
Sbjct  12    KKVNPGKATILSLGKAFPHQLVMQEYLVDGYFRDTNCDNPELKQKLARLCKTTTVKTRYV  71

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMSEEILKKYPELA+EG  TVKQRL+ICN AVTQMAIEAS  CIK WGRS ++ITH+VYV
Sbjct  72    VMSEEILKKYPELAVEGAATVKQRLEICNKAVTQMAIEASQVCIKNWGRSLSDITHVVYV  131

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSEARLPGGDLYL+KGLGL P  QR MLYF+GCSGGVAGLRVAKDIAENNPGSRVL+AT
Sbjct  132   SSSEARLPGGDLYLSKGLGLNPIIQRTMLYFAGCSGGVAGLRVAKDIAENNPGSRVLLAT  191

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS+PV E E PLFELHTA Q F+PDT
Sbjct  192   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPVSETETPLFELHTAAQEFLPDT  251

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             EK IDG+LTEEGISFKL RELPQIIEDN++ FC KL+ V G  +K D+NKLFWAVHPGGP
Sbjct  252   EKKIDGRLTEEGISFKLARELPQIIEDNVEGFCDKLIDVVGLQNK-DYNKLFWAVHPGGP  310

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWG  1157
             AILNR+EK+L+L PEKL+ASRRAL DYGNASSNTIVYVLEYM+EE  K R+    D +WG
Sbjct  311   AILNRMEKRLDLLPEKLNASRRALMDYGNASSNTIVYVLEYMIEEGLKIRKEGGGDPEWG  370

Query  1158  LILAFGPGITLEGILTRNLTA  1220
             LILAFGPGIT EGIL RN+ A
Sbjct  371   LILAFGPGITFEGILARNMCA  391



>gb|ABK28665.1| unknown [Arabidopsis thaliana]
Length=393

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/385 (79%), Positives = 343/385 (89%), Gaps = 3/385 (1%)
 Frame = +3

Query  66    AVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTT  245
             AVL   KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTRLCKTTT
Sbjct  7     AVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTT  66

Query  246   VKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEI  425
             VKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WGRS ++I
Sbjct  67    VKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDI  126

Query  426   THLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGS  605
             TH+VYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIAENNPGS
Sbjct  127   THVVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGS  186

Query  606   RVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQ  785
             RVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFELHTAIQ
Sbjct  187   RVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFELHTAIQ  246

Query  786   HFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWA  965
             +F+P+TEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++N++FWA
Sbjct  247   NFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK-NYNQMFWA  305

Query  966   VHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK--RESEA  1139
             VHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K  R    
Sbjct  306   VHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE  365

Query  1140  EDSDWGLILAFGPGITLEGILTRNL  1214
             E+++WGLILAFGPG+T EGI+ RNL
Sbjct  366   EENEWGLILAFGPGVTFEGIIARNL  390



>gb|AAZ23704.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/385 (79%), Positives = 343/385 (89%), Gaps = 3/385 (1%)
 Frame = +3

Query  66    AVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTT  245
             AVL   KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTRLCKTTT
Sbjct  7     AVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTT  66

Query  246   VKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEI  425
             VKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WGRS ++I
Sbjct  67    VKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDI  126

Query  426   THLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGS  605
             TH+VYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIAENNPGS
Sbjct  127   THVVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGS  186

Query  606   RVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQ  785
             RVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFELH+AIQ
Sbjct  187   RVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFELHSAIQ  246

Query  786   HFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWA  965
             +F+P+TEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++N++FWA
Sbjct  247   NFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK-NYNQMFWA  305

Query  966   VHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK--RESEA  1139
             VHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K  R    
Sbjct  306   VHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE  365

Query  1140  EDSDWGLILAFGPGITLEGILTRNL  1214
             E+++WGLILAFGPG+T EGI+ RNL
Sbjct  366   EENEWGLILAFGPGVTFEGIIARNL  390



>gb|AAZ23685.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/391 (79%), Positives = 344/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDA-VLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA VL   KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDAEVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS +EITHLVYVSSSEARLPGGDLYLAKGLGL PD  RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISEITHLVYVSSSEARLPGGDLYLAKGLGLSPDKHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+  NL
Sbjct  360   VRNMNEEENEWGLILAFGPGVTFEGIIAINL  390



>gb|AAZ23692.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/391 (79%), Positives = 344/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDA-VLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA VL   KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDAEVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTT VKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTMVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS +EITHLVYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISEITHLVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+  NL
Sbjct  360   VRNMNEEENEWGLILAFGPGVTFEGIIAINL  390



>gb|AAZ23682.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/391 (79%), Positives = 344/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDA-VLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA VL   KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDAEVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS +EITHLVYVSSSEARLPGGDLYLAKGLGL PD  RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISEITHLVYVSSSEARLPGGDLYLAKGLGLSPDIHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+  NL
Sbjct  360   VRNMNEEENEWGLILAFGPGVTFEGIIAINL  390



>ref|XP_007131762.1| hypothetical protein PHAVU_011G039700g [Phaseolus vulgaris]
 gb|ESW03756.1| hypothetical protein PHAVU_011G039700g [Phaseolus vulgaris]
Length=392

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/381 (81%), Positives = 342/381 (90%), Gaps = 3/381 (1%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             K  +PGKA+I+ALGKAFP QLVMQE+LVDGYF++TNCD+P LKQKLTRLCKTTTVKTRYV
Sbjct  13    KGVNPGKATILALGKAFPPQLVMQEYLVDGYFRSTNCDNPELKQKLTRLCKTTTVKTRYV  72

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMSEEIL KYPEL  EG PTVKQRL+ICN AVT+MAIEA+  CIK WG S ++ITHLVYV
Sbjct  73    VMSEEILIKYPELVTEGTPTVKQRLEICNEAVTEMAIEAALGCIKNWGGSLSDITHLVYV  132

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSEARLPGGDLYLAKGLGL PDTQR+MLYF+GCSGGVAGLRVAKDIAENNPGSRVL+AT
Sbjct  133   SSSEARLPGGDLYLAKGLGLSPDTQRIMLYFAGCSGGVAGLRVAKDIAENNPGSRVLLAT  192

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS+P+ E E+PLFELHTA+Q F+P T
Sbjct  193   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPILEYEKPLFELHTAVQEFLPHT  252

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             EK IDG+LTEEGISFKL RELPQIIEDN++ FC KLM V G+ +K ++NK+FWAVHPGGP
Sbjct  253   EKKIDGRLTEEGISFKLARELPQIIEDNVEGFCEKLMSVVGFQNK-EYNKVFWAVHPGGP  311

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWG  1157
             AILNR+EK+L+L PEKLSASRRAL DYGNASSNTIVYVLEYM+EE  K R+    DS+WG
Sbjct  312   AILNRIEKRLDLLPEKLSASRRALMDYGNASSNTIVYVLEYMIEEALKTRKDGRGDSEWG  371

Query  1158  LILAFGPGITLEGILTRNLTA  1220
             LILAFGPGIT EGIL RNL A
Sbjct  372   LILAFGPGITFEGILARNLCA  392



>ref|XP_006412179.1| hypothetical protein EUTSA_v10025417mg [Eutrema salsugineum]
 gb|ESQ53632.1| hypothetical protein EUTSA_v10025417mg [Eutrema salsugineum]
Length=392

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/391 (79%), Positives = 344/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA   G  KK +PGKA+I+ALGKAFPHQLVMQE+LVDGYFK TNC+DP LKQKLTR
Sbjct  1     MGSIDAAELGSEKKPNPGKATILALGKAFPHQLVMQEYLVDGYFKTTNCEDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TVKQRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDLYLAKGLGL P+T RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHLVYVSSSEARLPGGDLYLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSEPDPISEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE GI+F L RELPQIIEDN++ FC KL+  AG +HK D+
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEAGINFTLSRELPQIIEDNVESFCKKLIGKAGLAHK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--K  1121
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE  K
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRK  359

Query  1122  KRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R +   +++WGLILAFGPG+T EGI+ RNL
Sbjct  360   VRNTSEGENEWGLILAFGPGVTFEGIVARNL  390



>gb|AAZ23688.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/391 (79%), Positives = 343/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDA-VLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA VL   KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDAEVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  T  QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTATQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS +EITHLVYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISEITHLVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRR L DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRVLMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+  NL
Sbjct  360   VRNMNEEENEWGLILAFGPGVTFEGIIAINL  390



>gb|AAZ23717.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/391 (79%), Positives = 345/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA + G  KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDAAVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITH+VYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHVVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+P+TEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++
Sbjct  241   LHTAIQNFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYM EE K 
Sbjct  300   NQMFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMWEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+ RNL
Sbjct  360   VRNMNEEENEWGLILAFGPGVTFEGIIARNL  390



>gb|AAZ23721.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/391 (79%), Positives = 345/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA + G  KK++P KA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDAAVLGSEKKSNPEKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITH+VYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHVVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+P+TEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++
Sbjct  241   LHTAIQNFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+++WGLILAFGPG+T EGI+ RNL
Sbjct  360   VRNMNEEENEWGLILAFGPGVTFEGIIARNL  390



>emb|CDX75466.1| BnaA01g02360D [Brassica napus]
Length=392

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/391 (79%), Positives = 345/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA   G  KK +PGKA+I+A+GKAFPHQLVMQE+LVDGYFK TNCDDP LKQKLTR
Sbjct  1     MGSIDATELGSEKKPNPGKATILAIGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEIL KYPELAIEG  TVKQRLDICN AVT+MA+EAS  CIKKWG
Sbjct  61    LCKTTTVKTRYVVMSEEILTKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRACIKKWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDLYLAKGLGL P+T RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHLVYVSSSEARLPGGDLYLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPDPISEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTEEGI+F L RELPQIIEDN++ FC KL+  AG + K D+
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEEGINFTLSRELPQIIEDNVESFCKKLIGKAGLTPK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--K  1121
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE  K
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRK  359

Query  1122  KRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R  +  +++WGLILAFGPG+T EGI+ RNL
Sbjct  360   ARNMKEVENEWGLILAFGPGVTFEGIVARNL  390



>ref|XP_009108194.1| PREDICTED: chalcone synthase-like [Brassica rapa]
Length=392

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/391 (79%), Positives = 344/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA   G  KK +PGKA+I+A+GKAFPHQLVMQE+LVDGYFK TNCDDP LKQKLTR
Sbjct  1     MGSIDATELGSEKKPNPGKATILAIGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEIL KYPELAIEG  TVKQRLDICN AVT+MA+EAS  CIKKWG
Sbjct  61    LCKTTTVKTRYVVMSEEILTKYPELAIEGGSTVKQRLDICNDAVTEMAVEASKACIKKWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDLYLAKGLGL P+T RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHLVYVSSSEARLPGGDLYLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPNPISEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTEEGI+F L RELPQIIEDN++ FC KL+  AG + K D+
Sbjct  241   LHTAIQNFLPDTEKTIDGKLTEEGINFTLSRELPQIIEDNVESFCKKLIGKAGLTPK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--K  1121
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE  K
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRK  359

Query  1122  KRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R     +++WGLILAFGPG+T EGI+ RNL
Sbjct  360   ARNMNEGENEWGLILAFGPGVTFEGIVARNL  390



>gb|EPS66734.1| hypothetical protein M569_08037, partial [Genlisea aurea]
Length=381

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/375 (82%), Positives = 339/375 (90%), Gaps = 4/375 (1%)
 Frame = +3

Query  102   KASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEEI  281
             KA+I+ALGKAFPHQL++Q+ LVD YF+NTN  DP LKQKL +LCK TTVKTRYVVM EEI
Sbjct  7     KANILALGKAFPHQLLIQDLLVDAYFRNTNSHDPHLKQKLIQLCKATTVKTRYVVMCEEI  66

Query  282   LKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSEAR  461
             L KYPELA +GLPTVKQRL+ICNSAVTQMAIEAS +CI KWGR  +EITHLVYVSSSEAR
Sbjct  67    LTKYPELATQGLPTVKQRLEICNSAVTQMAIEASNSCIHKWGRQVSEITHLVYVSSSEAR  126

Query  462   LPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETTII  641
             LPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENN GSRVL+ATSETTII
Sbjct  127   LPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNYGSRVLLATSETTII  186

Query  642   GFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKIIDG  821
             GF+PPSADRPYDLVGVALFGDGAGA++IGSNPV ++ERPLFELHTAIQHF+PDTEK+IDG
Sbjct  187   GFRPPSADRPYDLVGVALFGDGAGAVIIGSNPVMKIERPLFELHTAIQHFLPDTEKVIDG  246

Query  822   QLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILNRl  1001
             QLTEEGISFKLE++LP IIE NI +FC KLM  A +S K DFNK+FWAVHPGGPAILNRL
Sbjct  247   QLTEEGISFKLEKQLPCIIEHNIQDFCEKLMGHAEFS-KPDFNKMFWAVHPGGPAILNRL  305

Query  1002  ekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE---KKRESEAEDSDWGLILAF  1172
             EK+LELSPEKL ASRRALADYGNASSNTIVYVLEY+LEE    +   E E+++WG ILAF
Sbjct  306   EKRLELSPEKLGASRRALADYGNASSNTIVYVLEYLLEEGNNTRTNGEIEENEWGFILAF  365

Query  1173  GPGITLEGILTRNLT  1217
             GPGITLEGILTR LT
Sbjct  366   GPGITLEGILTRKLT  380



>gb|AAZ23699.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/391 (79%), Positives = 344/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA + G  KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR
Sbjct  1     MGSIDAAVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITH+VYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHVVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+P+TEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++
Sbjct  241   LHTAIQNFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK-NY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK-  1124
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL D GNASSN+IVYVLEYMLEE K 
Sbjct  300   NQMFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDCGNASSNSIVYVLEYMLEESKK  359

Query  1125  -RESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R    E+ +WGLILAFGPG+T EGI+ RNL
Sbjct  360   VRNMNEEEDEWGLILAFGPGVTFEGIIARNL  390



>ref|XP_010028685.1| PREDICTED: chalcone synthase [Eucalyptus grandis]
 gb|KCW55471.1| hypothetical protein EUGRSUZ_I01371 [Eucalyptus grandis]
Length=393

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/381 (80%), Positives = 349/381 (92%), Gaps = 5/381 (1%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             KKA  GKA+I+ALGKAFP+QLVMQEFLVDGYF+NTNCDDP LKQKLTRLCKTTTVKTRYV
Sbjct  14    KKAGRGKATILALGKAFPNQLVMQEFLVDGYFRNTNCDDPDLKQKLTRLCKTTTVKTRYV  73

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMSEEIL+KYPELA+EGLPTVKQRLDICN AVT+MAI+AS  CIKKWGR  ++ITHLVYV
Sbjct  74    VMSEEILEKYPELAMEGLPTVKQRLDICNEAVTEMAIKASQDCIKKWGRPASDITHLVYV  133

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSEARLPGGDLYLAKG+ L P+T+RV+LYF GCSGGVAGLRVAKDIAENNPGSR+L+AT
Sbjct  134   SSSEARLPGGDLYLAKGIKLSPETRRVLLYFVGCSGGVAGLRVAKDIAENNPGSRILLAT  193

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETTIIG+KPPSA+RPYDLVGVALFGDGAGAM+IG++P   +E+PLFEL+TAIQHF+PDT
Sbjct  194   SETTIIGYKPPSAERPYDLVGVALFGDGAGAMIIGADPDLSIEKPLFELNTAIQHFLPDT  253

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             EKIIDG+LTEEGISFKL RELPQIIEDNI+ FC+KLM   G S+K D+N++FWAVHPGGP
Sbjct  254   EKIIDGRLTEEGISFKLARELPQIIEDNIEGFCSKLMEPIGLSNK-DYNRIFWAVHPGGP  312

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEK---KRESEAEDSDW  1154
             AILNRLEK+L+L P+KL ASR+AL DYGNASSNTIVYVL+YMLEE    K++ +++D ++
Sbjct  313   AILNRLEKRLDLLPDKLRASRQALKDYGNASSNTIVYVLDYMLEESMKMKKDDQSQD-EF  371

Query  1155  GLILAFGPGITLEGILTRNLT  1217
             GLILAFGPG+T EGIL RNLT
Sbjct  372   GLILAFGPGVTFEGILARNLT  392



>gb|KFK30118.1| hypothetical protein AALP_AA7G219100 [Arabis alpina]
Length=392

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/391 (79%), Positives = 342/391 (87%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAV-LQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA  L   KK++PGKA+I+A GKAFPHQLVMQE+LVDGYFK TNCDDP LKQKLTR
Sbjct  1     MGSIDAAELGSAKKSNPGKATILAFGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASKACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDLYLAKGLGL P+T RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHLVYVSSSEARLPGGDLYLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+I S+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIASDPDPICEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+F L RELPQIIEDN++ FC KL+  AG  HK D+
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEQGINFTLSRELPQIIEDNVEGFCKKLIGKAGLGHK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--K  1121
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE  K
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRK  359

Query  1122  KRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R +   +++WGLILAFGPG+T EGI+ RNL
Sbjct  360   ARNANEGENEWGLILAFGPGVTFEGIVARNL  390



>ref|XP_009108697.1| PREDICTED: chalcone synthase-like [Brassica rapa]
 ref|XP_009108700.1| PREDICTED: chalcone synthase-like [Brassica rapa]
Length=392

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/391 (79%), Positives = 343/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA   G  KK +PGKA+I+A+GKAFP QLVMQE+LVDGYFK TNCDDP LKQKLTR
Sbjct  1     MGSIDATELGSEKKPNPGKATIIAIGKAFPQQLVMQEYLVDGYFKTTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEIL KYPELAIEG  TVKQRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILNKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDL+LAKGLGL P+T RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHLVYVSSSEARLPGGDLFLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS+P   LE+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPDPILEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+F L RELPQIIEDN++ FC KL+  AG +HK D+
Sbjct  241   LHTAIQNFLPDTEKTIDGKLTEQGINFTLSRELPQIIEDNVESFCKKLIGKAGLAHK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--K  1121
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE  K
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRK  359

Query  1122  KRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R      ++WGLILAFGPG+T EGI+ RNL
Sbjct  360   ARNMNEGGNEWGLILAFGPGVTFEGIVARNL  390



>emb|CDY40656.1| BnaA03g53070D [Brassica napus]
Length=392

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/391 (78%), Positives = 344/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA   G  KK +PGKA+I+A+GKAFPHQLVMQE+LVDGYFK TNCDDP LKQKLTR
Sbjct  1     MGSIDATELGSEKKPNPGKATILAIGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEIL KYPELAIEG  TVKQRLDICN AVT+MA+EAS +CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILTKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRSCIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDL+LAKGLGL P+T RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSVSDITHLVYVSSSEARLPGGDLFLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSKDRPYDLVGVALFGDGAGAMIIGSDPDPVSEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE GI+F L RELPQIIEDN++ FC KL+  AG +HK D+
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTESGINFTLSRELPQIIEDNVESFCKKLLGKAGLAHK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--K  1121
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRR+L DYGNASSN+IVYVLEYMLEE  K
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRSLMDYGNASSNSIVYVLEYMLEESRK  359

Query  1122  KRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R+    +++WGLILAFGPG+T EGI+ RNL
Sbjct  360   ARKMNEGENEWGLILAFGPGVTFEGIVARNL  390



>ref|XP_009138330.1| PREDICTED: chalcone synthase-like [Brassica rapa]
Length=392

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/391 (78%), Positives = 344/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA   G  KK +PGKA+I+A+GKAFPHQLVMQE+LVDGYFK TNCDDP LKQKLTR
Sbjct  1     MGSIDATELGSEKKPNPGKATILAIGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEIL KYPELAIEG  TVKQRLDICN AVT+MA+EAS +CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILTKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRSCIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDL+LAKGLGL P+T RV+L F GCSGGVAGLRVAKDIA
Sbjct  121   RSVSDITHLVYVSSSEARLPGGDLFLAKGLGLSPETHRVLLSFGGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P +  E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSKDRPYDLVGVALFGDGAGAMIIGSDPARVSEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE GI+F L RELPQIIEDN++ FC KL+  AG +HK D+
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTESGINFTLSRELPQIIEDNVESFCKKLLGKAGLAHK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--K  1121
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRR+L DYGNASSN+IVYVLEYMLEE  K
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRSLMDYGNASSNSIVYVLEYMLEESRK  359

Query  1122  KRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R+    +++WGLILAFGPG+T EGI+ RNL
Sbjct  360   ARKMNEGENEWGLILAFGPGVTFEGIVARNL  390



>ref|XP_007199914.1| hypothetical protein PRUPE_ppa006852mg [Prunus persica]
 gb|EMJ01113.1| hypothetical protein PRUPE_ppa006852mg [Prunus persica]
Length=393

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/389 (79%), Positives = 345/389 (89%), Gaps = 6/389 (2%)
 Frame = +3

Query  63    DAVLQGGK--KASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCK  236
             + V QGG   KA+ G+A+I+ALGKAFPHQLVMQ+FLVDGYF++TNCDDP LKQKL RLCK
Sbjct  4     EHVGQGGSIMKANGGRATILALGKAFPHQLVMQDFLVDGYFRDTNCDDPELKQKLARLCK  63

Query  237   TTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSP  416
             TTTVKTRYVVMS+EIL+KYPEL  EG PT+KQRL ICN AVTQMAIEAS  CIK WGR  
Sbjct  64    TTTVKTRYVVMSDEILEKYPELTTEGTPTIKQRLHICNEAVTQMAIEASGACIKNWGRPI  123

Query  417   TEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENN  596
             ++ITHLVYVSSSEARLPGGD+YLAKGLGLRP+TQRV+LYFSGCSGGVAGLRVAKDIAENN
Sbjct  124   SDITHLVYVSSSEARLPGGDIYLAKGLGLRPETQRVLLYFSGCSGGVAGLRVAKDIAENN  183

Query  597   PGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHT  776
             PGSRVL+ATSETTIIG+KPPSA RPYDLVGVALFGDGAGAM+IGS+P    E+PLFELHT
Sbjct  184   PGSRVLLATSETTIIGYKPPSAHRPYDLVGVALFGDGAGAMLIGSDPDLISEKPLFELHT  243

Query  777   AIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKL  956
             AIQ F+PDTEK IDG++TEEGISFKL RELPQIIED+I+ FC +LM V GY +K ++NK+
Sbjct  244   AIQEFLPDTEKTIDGRVTEEGISFKLGRELPQIIEDHIEGFCGRLMGVLGYDNK-EYNKM  302

Query  957   FWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEK---KR  1127
             FWAVHPGGPAILNRLEK+L+L PEKL+ASRRAL DYGNASSNTIVYVLEYM+EE    K+
Sbjct  303   FWAVHPGGPAILNRLEKRLDLFPEKLNASRRALTDYGNASSNTIVYVLEYMIEESKKIKK  362

Query  1128  ESEAEDSDWGLILAFGPGITLEGILTRNL  1214
             E +  D +WGLILAFGPGIT EGIL RNL
Sbjct  363   EQQEGDGEWGLILAFGPGITFEGILARNL  391



>emb|CDX69091.1| BnaC01g03620D [Brassica napus]
Length=392

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/391 (79%), Positives = 346/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  D+   G  KK +PGKA+I+A+GKAFPHQLVMQE+LVDGYFK TNCDDP LKQKLTR
Sbjct  1     MGSIDSTELGSEKKPNPGKATILAIGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEIL KYPELAIEG  TVKQRLDICN AVT+MA+EAS  CIKKWG
Sbjct  61    LCKTTTVKTRYVVMSEEILTKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRACIKKWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDLYLAKGLGL P+T RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHLVYVSSSEARLPGGDLYLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPDPISEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTEEGI+F L RELP++IEDN++ FC KL+  AG + K D+
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEEGINFTLSRELPKLIEDNVESFCKKLIGKAGLTPK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--K  1121
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE  K
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRK  359

Query  1122  KRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R+ +  +++WGLILAFGPG+T EGI+ RNL
Sbjct  360   ARKMKEVENEWGLILAFGPGVTFEGIVARNL  390



>emb|CDX72506.1| BnaC07g45280D [Brassica napus]
Length=392

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/391 (78%), Positives = 342/391 (87%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAV-LQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA  L   KK +PGKA+I+A+GKAFPHQLVMQE+LVDGYFK TNCDDP LKQKLTR
Sbjct  1     MGSIDATELASEKKPNPGKATILAIGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEIL KYPE+AIEG  TVKQRLDICN AVT+MA+EAS +CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILTKYPEIAIEGGSTVKQRLDICNDAVTEMAVEASRSCIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDL+LAKGLGL P+T RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSVSDITHLVYVSSSEARLPGGDLFLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSKDRPYDLVGVALFGDGAGAMIIGSDPDPVSEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE GI+F L RELPQIIEDN++ FC KL+  AG + K D+
Sbjct  241   LHTAIQNFIPDTEKTIDGRLTETGINFTLSRELPQIIEDNVESFCKKLIGKAGLADK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--K  1121
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRR+L DYGNASSN+IVYVLEYMLEE  K
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRSLMDYGNASSNSIVYVLEYMLEESRK  359

Query  1122  KRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R     +++WGLILAFGPG+T EGI+ RNL
Sbjct  360   SRSMSGSENEWGLILAFGPGVTFEGIVARNL  390



>ref|XP_008236187.1| PREDICTED: chalcone synthase [Prunus mume]
Length=393

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/389 (78%), Positives = 343/389 (88%), Gaps = 6/389 (2%)
 Frame = +3

Query  63    DAVLQGGK--KASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCK  236
             + V QGG   KA+ GKA+I+ALGKAFPHQLVMQ+FLVDGYF++TNCDDP LKQKL RLCK
Sbjct  4     EHVGQGGSIMKANGGKATILALGKAFPHQLVMQDFLVDGYFRDTNCDDPELKQKLARLCK  63

Query  237   TTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSP  416
             TTTVKTRYVVMS+EIL+KYPEL  EG PT+KQRL ICN AVTQMAIEAS  CIK WGR  
Sbjct  64    TTTVKTRYVVMSDEILEKYPELTTEGTPTIKQRLHICNEAVTQMAIEASRACIKNWGRPT  123

Query  417   TEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENN  596
             ++ITHLVYVSSSEARLPGGD+YLAKGLGLRP+TQRV+LYFSGCSGGVAGLRVAKDIAENN
Sbjct  124   SDITHLVYVSSSEARLPGGDVYLAKGLGLRPETQRVLLYFSGCSGGVAGLRVAKDIAENN  183

Query  597   PGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHT  776
             PGSRVL+ATSETTIIG+KPPS  RPYDLVGVALFGDGAGAM+IGS+P    E+PLFELH 
Sbjct  184   PGSRVLLATSETTIIGYKPPSTHRPYDLVGVALFGDGAGAMLIGSDPDLISEKPLFELHN  243

Query  777   AIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKL  956
             AIQ F+PDTEK IDG++TEEGISFKL RELPQIIED+I+ FC +LM V GY +K ++NK+
Sbjct  244   AIQEFLPDTEKTIDGRVTEEGISFKLARELPQIIEDHIEGFCGRLMGVLGYDNK-EYNKM  302

Query  957   FWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEK---KR  1127
             FWAVHPGGPAILNRLEK+L+L P+KL+ASRRAL DYGNASSNTIVYVLEYM+EE    K+
Sbjct  303   FWAVHPGGPAILNRLEKRLDLFPDKLNASRRALTDYGNASSNTIVYVLEYMIEESKKIKK  362

Query  1128  ESEAEDSDWGLILAFGPGITLEGILTRNL  1214
             E +  D +WGLILAFGPGIT EGIL RNL
Sbjct  363   EQQEGDGEWGLILAFGPGITFEGILARNL  391



>gb|ADF43047.1| chalcone synthase 6 protein [Brassica rapa subsp. rapa]
Length=392

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/391 (78%), Positives = 343/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA   G  KK +PGKA+I+A+GKAFPHQLV QE+LVDGYFK TNCDDP LKQKLTR
Sbjct  1     MGSIDATELGSEKKPNPGKATILAIGKAFPHQLVKQEYLVDGYFKTTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEIL KYPELAIEG  TVKQRLDICN AVT+MA+EAS +CIK WG
Sbjct  61    LCKTTTVKTRYVVMSEEILTKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRSCIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDL+LAKGLGL P+T RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSVSDITHLVYVSSSEARLPGGDLFLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSKDRPYDLVGVALFGDGAGAMIIGSDPDPVSEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE GI+F L RELPQIIEDN++ FC KL+  AG +HK D+
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTESGINFTLSRELPQIIEDNVESFCKKLLGKAGLAHK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--K  1121
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRR+L DYGNASSN+IVYVLEYMLEE  K
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRSLMDYGNASSNSIVYVLEYMLEESRK  359

Query  1122  KRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R+    +++WGLILAFGPG+T EGI+ RNL
Sbjct  360   ARKMNEGENEWGLILAFGPGVTFEGIVARNL  390



>emb|CDY34811.1| BnaA09g41780D [Brassica napus]
Length=392

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/391 (79%), Positives = 344/391 (88%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA   G  KK +PGKA+I+A+GKAFPHQLVMQE+LVDGYFK TNCDDP LKQKLTR
Sbjct  1     MGSIDATELGSEKKPNPGKATILAIGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMSEEIL KYPELAIEG  TVKQRLDICN AVT+MA+EAS  CIKKWG
Sbjct  61    LCKTTTVKTRYVVMSEEILTKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRACIKKWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDLYLAKGLGL P+T  V+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHLVYVSSSEARLPGGDLYLAKGLGLSPETHPVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPDPISEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTEEGI+F L RELP++IEDN++ FC KL+  AG + K D+
Sbjct  241   LHTAIQNFLPDTEKTIDGRLTEEGINFTLSRELPKLIEDNVESFCKKLIGKAGLTPK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--K  1121
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE  K
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRK  359

Query  1122  KRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R  +  +++WGLILAFGPG+T EGI+ RNL
Sbjct  360   ARNMKEVENEWGLILAFGPGVTFEGIVARNL  390



>emb|CDY17490.1| BnaC03g65730D [Brassica napus]
Length=392

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/391 (78%), Positives = 340/391 (87%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA   G  KK +PGKA+I+A+GKAFP QLVMQE+LVDGYFK TNCDDP LKQKLTR
Sbjct  1     MGSIDATELGSEKKPNPGKATILAIGKAFPQQLVMQEYLVDGYFKTTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LC TTTVKTRYVVMSEEIL KYPELA EG  TVKQRLDICN AVT+MA+EAS  CI+ WG
Sbjct  61    LCNTTTVKTRYVVMSEEILNKYPELATEGGSTVKQRLDICNDAVTEMAVEASRACIENWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLPGGDLYLAKGLGL P+T RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHLVYVSSSEARLPGGDLYLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS+P    E+PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPDPVREKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+F L RELPQIIEDN+D FC KL+  AG +HK D+
Sbjct  241   LHTAIQNFLPDTEKTIDGKLTEQGINFTLSRELPQIIEDNVDSFCKKLIGKAGLAHK-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--K  1121
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE  K
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRK  359

Query  1122  KRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R      ++WGLILAFGPG+T EGI+ RN+
Sbjct  360   ARNMNEGGNEWGLILAFGPGVTFEGIVARNI  390



>ref|XP_008372871.1| PREDICTED: chalcone synthase [Malus domestica]
Length=392

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/388 (79%), Positives = 344/388 (89%), Gaps = 5/388 (1%)
 Frame = +3

Query  63    DAVLQGG--KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCK  236
             + V+QGG   KA+ G A+I+ALGKAFPHQLVMQ+FLVDGYFK+TN DDP LKQKL RLCK
Sbjct  4     EHVVQGGFPMKANAGNATILALGKAFPHQLVMQDFLVDGYFKDTNSDDPQLKQKLARLCK  63

Query  237   TTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSP  416
             TTTVKTRYVVMSEEIL+KYPEL  EG PT+KQRL ICN AVT+MAIEAS  CI KWGR  
Sbjct  64    TTTVKTRYVVMSEEILEKYPELTTEGTPTIKQRLHICNEAVTKMAIEASQACITKWGRPT  123

Query  417   TEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENN  596
             ++ITHLVYVSSSEARLPGGDLYLAKGLGL P T+RVMLYFSGCSGGVAG+RVAKDIAENN
Sbjct  124   SDITHLVYVSSSEARLPGGDLYLAKGLGLSPQTKRVMLYFSGCSGGVAGVRVAKDIAENN  183

Query  597   PGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHT  776
             PGSRVL+ATSETTIIG+KPPSA+RPYDLVGVALFGDGAGAM+IGS+P    E PLFELHT
Sbjct  184   PGSRVLLATSETTIIGYKPPSANRPYDLVGVALFGDGAGAMMIGSDPELVSENPLFELHT  243

Query  777   AIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKL  956
             A+Q F+P TEK IDG++TEEGISFKLERELPQIIED+I+ FC +LM V GY +K ++NK+
Sbjct  244   ALQEFLPGTEKTIDGRVTEEGISFKLERELPQIIEDHIEGFCGRLMGVVGYDNK-EYNKM  302

Query  957   FWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE-KKRES  1133
             FWAVHPGGPAILNR+EK+L+LSPEKL+ASRRALADYGNASSNTIVYVLEY++EE KK + 
Sbjct  303   FWAVHPGGPAILNRMEKRLDLSPEKLNASRRALADYGNASSNTIVYVLEYIIEESKKMKK  362

Query  1134  EAE-DSDWGLILAFGPGITLEGILTRNL  1214
             E E D  WG+ILAFGPG+T EGIL RNL
Sbjct  363   EGEGDGGWGMILAFGPGVTFEGILARNL  390



>emb|CDY58814.1| BnaAnng15370D [Brassica napus]
Length=392

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/391 (78%), Positives = 340/391 (87%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MGFGDAVLQGG-KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MG  DA   G  KK +PGKA+I+A+GKAFP QLVMQE+LVDGYFK TNCDDP LKQKLTR
Sbjct  1     MGSIDATELGSEKKPNPGKATILAIGKAFPQQLVMQEYLVDGYFKTTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LC TTTVKTRYVVMSEEIL KYPELAIEG  TVKQRLDICN AVT+MA+EAS  CIK WG
Sbjct  61    LCNTTTVKTRYVVMSEEILNKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRACIKNWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             RS ++ITHLVYVSSSEARLP GDL+LAKGLGL P+T RV+LYF GCSGGVAGLRVAKDIA
Sbjct  121   RSISDITHLVYVSSSEARLPSGDLFLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETT+IGFKPPSADRPYDLVGVALFGDGAGAM+IGS+P   LE+PLFE
Sbjct  181   ENNPGSRVLLATSETTVIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPDPILEKPLFE  240

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQ+F+PDTEK IDG+LTE+GI+F L RELPQIIEDN++ FC KL+  AG +H  D+
Sbjct  241   LHTAIQNFLPDTEKTIDGKLTEQGINFTLSRELPQIIEDNVESFCKKLIGKAGLAHI-DY  299

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--K  1121
             N++FWAVHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE  K
Sbjct  300   NQMFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRK  359

Query  1122  KRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              R      ++WGLILAFGPG+T EGI+ RNL
Sbjct  360   ARNMNEGGNEWGLILAFGPGVTFEGIVARNL  390



>ref|XP_010268693.1| PREDICTED: chalcone synthase [Nelumbo nucifera]
 ref|XP_010268695.1| PREDICTED: chalcone synthase [Nelumbo nucifera]
Length=398

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/393 (77%), Positives = 346/393 (88%), Gaps = 9/393 (2%)
 Frame = +3

Query  60    GDAVLQGG---KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRL  230
             GD + QGG   KK SPGK  ++ALGKAFP+QLV+QE+LVDGYF+NTNCDDP LKQKL RL
Sbjct  5     GDTI-QGGLLPKKVSPGKTKLLALGKAFPNQLVIQEYLVDGYFRNTNCDDPDLKQKLARL  63

Query  231   CKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGR  410
             CKTTTVKTRYVVMSEEIL KYPELA+EGLPTVKQRLDI N AVTQMAIEAS  CIK WGR
Sbjct  64    CKTTTVKTRYVVMSEEILAKYPELAVEGLPTVKQRLDISNKAVTQMAIEASQACIKNWGR  123

Query  411   SPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAE  590
               ++ITHLVYVSSSEARLPGGDLYLA+GLGL P+ +RVMLYF GCSGGVAGLRVAKDIAE
Sbjct  124   PSSDITHLVYVSSSEARLPGGDLYLARGLGLSPEVRRVMLYFMGCSGGVAGLRVAKDIAE  183

Query  591   NNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFEL  770
             NNPGSRVL+ATSETTIIGFKPPSA+RPYDLVGVALFGDGAGAM++G +P+  +ERPLFEL
Sbjct  184   NNPGSRVLLATSETTIIGFKPPSANRPYDLVGVALFGDGAGAMILGRDPIPGIERPLFEL  243

Query  771   HTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRV--AGYSHKD-  941
             HTAIQ+F+PDTEK IDG+LTEEGI+FKLER+LP IIE+++  FC KL++   +G S+ D 
Sbjct  244   HTAIQNFLPDTEKTIDGRLTEEGINFKLERDLPNIIENHVQGFCDKLIQAVGSGSSYDDN  303

Query  942   DFNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE-  1118
             D+N +FWAVHPGGPAILNRLEK+L L PEKLSASRRAL ++GNASSNTIVYVLEYM+EE 
Sbjct  304   DYNNMFWAVHPGGPAILNRLEKRLNLLPEKLSASRRALMNFGNASSNTIVYVLEYMVEES  363

Query  1119  -KKRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
              K ++   +DS+WGLILAFGPGIT EGIL RNL
Sbjct  364   LKMKKEGKQDSEWGLILAFGPGITFEGILARNL  396



>dbj|BAE80096.1| Chalcone synthase [Silene latifolia]
Length=379

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/381 (78%), Positives = 334/381 (88%), Gaps = 5/381 (1%)
 Frame = +3

Query  51    MGFGDAVLQG-GKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTR  227
             MGF +  L G GKK +PGKA++++LGK FPH LVMQEFLVDGYF+NTNCDDP LKQKLTR
Sbjct  1     MGFENIKLNGMGKKPTPGKATVLSLGKGFPHTLVMQEFLVDGYFRNTNCDDPELKQKLTR  60

Query  228   LCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWG  407
             LCKTTTVKTRYVVMS+EILKK PELA+ G  TVKQRLDICN AVT+MAI+AS  CI  WG
Sbjct  61    LCKTTTVKTRYVVMSDEILKKCPELAMAGQATVKQRLDICNDAVTEMAIDASKACISDWG  120

Query  408   RSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIA  587
             R  ++ITHLVYVSSSEARLPGGDLYLAKGLGL P+T RVMLYFSGCSGGVAG RVAKDIA
Sbjct  121   RPISDITHLVYVSSSEARLPGGDLYLAKGLGLSPETNRVMLYFSGCSGGVAGFRVAKDIA  180

Query  588   ENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFE  767
             ENNPGSRVL+ATSETTIIGFKPP+ DRPYDLVGVALFGDGAGAM+IGS+P    E PLFE
Sbjct  181   ENNPGSRVLLATSETTIIGFKPPNPDRPYDLVGVALFGDGAGAMIIGSDP-NSSENPLFE  239

Query  768   LHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDF  947
             LHTAIQHF+PDTEKIIDG+LTEEGISF L+R LPQIIEDNI+ FC KLM   G + K D+
Sbjct  240   LHTAIQHFLPDTEKIIDGRLTEEGISFTLDRALPQIIEDNIEAFCDKLMSSVGLTSK-DY  298

Query  948   NKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--K  1121
             N +FWAVHPGGPAILNRLEK+L+LSP+KLSASRRAL DYGNASSNTIVYV+EYM+EE  K
Sbjct  299   NDMFWAVHPGGPAILNRLEKRLDLSPDKLSASRRALTDYGNASSNTIVYVMEYMIEEGLK  358

Query  1122  KRESEAEDSDWGLILAFGPGI  1184
             ++  +  D+DWGLILAFGPG+
Sbjct  359   RKNGDKNDNDWGLILAFGPGL  379



>gb|KEH30597.1| chalcone synthase family protein [Medicago truncatula]
Length=390

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/378 (79%), Positives = 333/378 (88%), Gaps = 2/378 (1%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             K+ + GKA+I+ALGKAFPHQLVMQE+LVDGYF++TNCD+P LKQKL RLCKTTTVKTRYV
Sbjct  12    KQVTAGKATILALGKAFPHQLVMQEYLVDGYFRDTNCDNPELKQKLARLCKTTTVKTRYV  71

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VM+EEILKKYPELA+EG  TVKQRL+ICN AVTQMAIEAS  CIK WG S ++ITH+VYV
Sbjct  72    VMNEEILKKYPELAVEGASTVKQRLEICNEAVTQMAIEASQVCIKNWGGSLSDITHVVYV  131

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSEARLPGGDLYL+KGLGL P  +R MLYFSGCSGGVAGLRVAKDIAENNPGSRVL+AT
Sbjct  132   SSSEARLPGGDLYLSKGLGLNPTIRRTMLYFSGCSGGVAGLRVAKDIAENNPGSRVLLAT  191

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS+P  E E PLFELHT+ Q F+PDT
Sbjct  192   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPKLETEMPLFELHTSAQEFIPDT  251

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             EK IDG+LTEEGISF L RELPQIIEDN++ FC +LM      +K ++NKLFWAVHPGGP
Sbjct  252   EKKIDGRLTEEGISFTLARELPQIIEDNVEGFCDRLMDAVELENK-EYNKLFWAVHPGGP  310

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKR-ESEAEDSDWGL  1160
             AILNR+EK+LELSPEKL+ASR+AL DYGNASSNTI+YVLEYML+E K+   E    +WGL
Sbjct  311   AILNRVEKRLELSPEKLNASRKALMDYGNASSNTIIYVLEYMLDESKKIRKEGGYPEWGL  370

Query  1161  ILAFGPGITLEGILTRNL  1214
             ILAFGPGIT EGIL RNL
Sbjct  371   ILAFGPGITFEGILARNL  388



>ref|XP_004289833.1| PREDICTED: chalcone synthase-like [Fragaria vesca subsp. vesca]
Length=393

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/394 (75%), Positives = 341/394 (87%), Gaps = 8/394 (2%)
 Frame = +3

Query  45    ESMGFGDAVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLT  224
             E +  GD+ +    KA+ G+A+I+ALGKAFPHQLVMQ++LV+GYF++ NCDDP LK+KL 
Sbjct  4     EGIAPGDSTM----KANAGRATILALGKAFPHQLVMQDYLVEGYFRDNNCDDPDLKEKLA  59

Query  225   RLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKW  404
             RLCKTTTVKTRYVVMS+E+LK+YPEL +EG+PTVKQRLDIC+ AVTQMAIEAS  CIK W
Sbjct  60    RLCKTTTVKTRYVVMSDEVLKRYPELTLEGIPTVKQRLDICHDAVTQMAIEASHACIKNW  119

Query  405   GRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDI  584
             GR  ++ITHLVYVSSSEARLPGGDLYLA+GL L P T+RVMLYFSGCSGGVAGLRVAKDI
Sbjct  120   GRPASDITHLVYVSSSEARLPGGDLYLARGLELSPRTKRVMLYFSGCSGGVAGLRVAKDI  179

Query  585   AENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLF  764
             AENNP SRVL+ATSETTIIG+KPPSA RPYDLVGVALFGDGAGAM+IGS+P    E PLF
Sbjct  180   AENNPLSRVLLATSETTIIGYKPPSAHRPYDLVGVALFGDGAGAMIIGSDPELVSENPLF  239

Query  765   ELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDD  944
             ELHTA+Q F+P TEK IDG+LTEEGISFKL RELPQIIEDN++ FC +LM V G+  K +
Sbjct  240   ELHTALQEFLPGTEKTIDGRLTEEGISFKLARELPQIIEDNVEGFCERLMDVVGFDKK-E  298

Query  945   FNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEK-  1121
             +NK+FWAVHPGGPAILNR+EK+L+L PEKL ASRRAL DYGNASSNTIVYVLEYM+EE  
Sbjct  299   YNKMFWAVHPGGPAILNRMEKRLDLFPEKLDASRRALMDYGNASSNTIVYVLEYMIEESK  358

Query  1122  --KRESEAEDSDWGLILAFGPGITLEGILTRNLT  1217
               K++ E  + +WGLILAFGPGIT EGIL RNLT
Sbjct  359   KKKKKKEQSNGEWGLILAFGPGITFEGILARNLT  392



>gb|KHN32314.1| Chalcone synthase [Glycine soja]
Length=358

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/359 (81%), Positives = 323/359 (90%), Gaps = 3/359 (1%)
 Frame = +3

Query  150   MQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVK  329
             MQE+LVDGYF++TNCD P LKQKLTRLCKTTTVKTRYVVMSEEILKKYPELA EG+PTVK
Sbjct  1     MQEYLVDGYFRDTNCDSPELKQKLTRLCKTTTVKTRYVVMSEEILKKYPELAAEGIPTVK  60

Query  330   QRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRP  509
             QRL+ICN AVT+MAIEAS  CI  WG S ++ITHLVYVSSSEARLPGGDLYLAKGLGL P
Sbjct  61    QRLEICNEAVTEMAIEASQACINNWGGSLSDITHLVYVSSSEARLPGGDLYLAKGLGLSP  120

Query  510   DTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETTIIGFKPPSADRPYDLVGV  689
             DTQRVMLYF+GCSGGVAGLRVAKDIAENNPGSRVL+ATSETTIIGFKPPSADRPYDLVGV
Sbjct  121   DTQRVMLYFAGCSGGVAGLRVAKDIAENNPGSRVLIATSETTIIGFKPPSADRPYDLVGV  180

Query  690   ALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELP  869
             ALFGDGAGAM+IGS+P+ E E+PLFELHTA+Q F+P TEK IDG+LTEEGISFKL RELP
Sbjct  181   ALFGDGAGAMIIGSDPILESEKPLFELHTAVQEFLPHTEKKIDGRLTEEGISFKLARELP  240

Query  870   QIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILNRlekklelspeklsasRR  1049
             QIIEDN++ FC KL+ V G+ +K ++NK+FWAVHPGGPAILNR+EK+L+L PEKLSASRR
Sbjct  241   QIIEDNVEGFCDKLISVVGFENK-EYNKMFWAVHPGGPAILNRIEKRLDLLPEKLSASRR  299

Query  1050  ALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWGLILAFGPGITLEGILTRNLTA  1220
             AL DYGNASSNTIVYVLEYM+EE  K R+    D +WGLILAFGPGIT EGIL RNL A
Sbjct  300   ALMDYGNASSNTIVYVLEYMIEEGLKIRKDARGDLEWGLILAFGPGITFEGILARNLCA  358



>emb|CAB45446.1| chalcone synthase-like protein [Arabidopsis thaliana]
 emb|CAB80202.1| chalcone synthase-like protein [Arabidopsis thaliana]
Length=390

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/385 (79%), Positives = 341/385 (89%), Gaps = 5/385 (1%)
 Frame = +3

Query  66    AVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTT  245
             AVL   KK++PGKA+I+ALGKAFPHQLVMQE+LVDGYFK T CDDP LKQKLTR  KTTT
Sbjct  7     AVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR--KTTT  64

Query  246   VKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEI  425
             VKTRYVVMSEEILKKYPELAIEG  TV QRLDICN AVT+MA+EAS  CIK WGRS ++I
Sbjct  65    VKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDI  124

Query  426   THLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGS  605
             TH+VYVSSSEARLPGGDLYLAKGLGL PDT RV+LYF GCSGGVAGLRVAKDIAENNPGS
Sbjct  125   THVVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGS  184

Query  606   RVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQ  785
             RVL+ATSETTIIGFKPPS DRPYDLVGVALFGDGAGAM+IGS+P    E+PLFELHTAIQ
Sbjct  185   RVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFELHTAIQ  244

Query  786   HFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWA  965
             +F+P+TEK IDG+LTE+GI+FKL RELPQIIEDN++ FC KL+  AG +HK ++N++FWA
Sbjct  245   NFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK-NYNQMFWA  303

Query  966   VHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK--RESEA  1139
             VHPGGPAILNR+EK+L LSPEKLS SRRAL DYGNASSN+IVYVLEYMLEE K  R    
Sbjct  304   VHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE  363

Query  1140  EDSDWGLILAFGPGITLEGILTRNL  1214
             E+++WGLILAFGPG+T EGI+ RNL
Sbjct  364   EENEWGLILAFGPGVTFEGIIARNL  388



>ref|XP_004138289.1| PREDICTED: chalcone synthase A-like [Cucumis sativus]
 ref|XP_004155075.1| PREDICTED: chalcone synthase A-like [Cucumis sativus]
 gb|KGN63621.1| hypothetical protein Csa_1G006310 [Cucumis sativus]
Length=392

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/378 (76%), Positives = 329/378 (87%), Gaps = 3/378 (1%)
 Frame = +3

Query  87    KASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVV  266
             KA+PGKA+I+ALGKAFP QLV+Q++LVDGYFK+T+CDD  LKQKLTRLCKTTTVKTRYVV
Sbjct  14    KANPGKATILALGKAFPPQLVLQDYLVDGYFKDTSCDDIDLKQKLTRLCKTTTVKTRYVV  73

Query  267   MSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVS  446
             MSEEILKKYPELA EG PT+KQRL+ICN AVT+MAIEAS   I  WGR  ++ITHLVYVS
Sbjct  74    MSEEILKKYPELAKEGQPTIKQRLEICNKAVTEMAIEASQAAINNWGRPASDITHLVYVS  133

Query  447   SSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATS  626
             SSEARLPGGDL+LA+GLGL P TQRVMLYF+GCSGGVAGLRVAKD+AENNPGSRVL+ TS
Sbjct  134   SSEARLPGGDLFLARGLGLSPQTQRVMLYFTGCSGGVAGLRVAKDLAENNPGSRVLLVTS  193

Query  627   ETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTE  806
             ETTIIGFKPPS +RPYDLVGVALFGDGAGAMVIG +P   +ERPLFELHT  Q F+PDT+
Sbjct  194   ETTIIGFKPPSVNRPYDLVGVALFGDGAGAMVIGRDPFLGIERPLFELHTTTQKFIPDTQ  253

Query  807   KIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPA  986
              IIDG+L+EEGISF + RELPQIIEDNI+ FC   ++  G  H+ ++NK+FWAVHPGGPA
Sbjct  254   NIIDGKLSEEGISFTITRELPQIIEDNIESFCETFLQTLGL-HEKEYNKIFWAVHPGGPA  312

Query  987   ILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWGL  1160
             ILNRLEK+LEL PEKL+ASRRAL DYGNASSNTIVYVLEYM+EE  K +    +  +WGL
Sbjct  313   ILNRLEKRLELLPEKLTASRRALMDYGNASSNTIVYVLEYMMEESLKMKMEGRKIEEWGL  372

Query  1161  ILAFGPGITLEGILTRNL  1214
             ILAFGPGI+ EGIL RNL
Sbjct  373   ILAFGPGISFEGILARNL  390



>ref|XP_008453147.1| PREDICTED: chalcone synthase [Cucumis melo]
Length=395

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/378 (76%), Positives = 328/378 (87%), Gaps = 3/378 (1%)
 Frame = +3

Query  87    KASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVV  266
             K + GKA+I+ALGKAFP QLV+Q++LVDGYFK+T+CDD  LKQKLTRLCKTTTVKTRYVV
Sbjct  17    KTNLGKATILALGKAFPPQLVLQDYLVDGYFKDTSCDDIDLKQKLTRLCKTTTVKTRYVV  76

Query  267   MSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVS  446
             MSEEILKKYPELA EG PT+KQRL+ICN AVT+MAIEAS   I  WGRS  +ITHLVYVS
Sbjct  77    MSEEILKKYPELAKEGQPTIKQRLEICNKAVTEMAIEASQAAINNWGRSVLDITHLVYVS  136

Query  447   SSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATS  626
             SSEARLPGGDL+LA+GLGL P TQRVMLYF+GCSGGVAGLRVAKD+AENNPGSRVL+ TS
Sbjct  137   SSEARLPGGDLFLARGLGLSPQTQRVMLYFTGCSGGVAGLRVAKDLAENNPGSRVLLVTS  196

Query  627   ETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTE  806
             ETTIIGFKPPSA+RPYDLVGVALFGDGAGAM+IG +P   +ERPLFELHT  Q F+PDT+
Sbjct  197   ETTIIGFKPPSANRPYDLVGVALFGDGAGAMLIGRDPFLGIERPLFELHTTTQKFIPDTQ  256

Query  807   KIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPA  986
              IIDG+L+EEGISF + RELPQIIEDNI+ FC   ++  G  H+ ++NK+FWAVHPGGPA
Sbjct  257   NIIDGKLSEEGISFTITRELPQIIEDNIESFCETFLQTLGL-HEKEYNKMFWAVHPGGPA  315

Query  987   ILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWGL  1160
             ILNRLEK+LEL PEKL+ASRRAL DYGNASSNTIVYVLEYM+EE  K +    +  +WGL
Sbjct  316   ILNRLEKRLELLPEKLTASRRALMDYGNASSNTIVYVLEYMMEESLKMKMDGRKTEEWGL  375

Query  1161  ILAFGPGITLEGILTRNL  1214
             ILAFGPGI+ EGIL RNL
Sbjct  376   ILAFGPGISFEGILARNL  393



>ref|XP_007131590.1| hypothetical protein PHAVU_011G026000g [Phaseolus vulgaris]
 gb|ESW03584.1| hypothetical protein PHAVU_011G026000g [Phaseolus vulgaris]
Length=376

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/381 (75%), Positives = 325/381 (85%), Gaps = 19/381 (5%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             K  +PGKA+I+ALGKAFP QLVMQE+LVDGYF++TNCD+P LKQKLTRLCKTTTVKTRYV
Sbjct  13    KGVNPGKATILALGKAFPPQLVMQEYLVDGYFRSTNCDNPELKQKLTRLCKTTTVKTRYV  72

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMSEEIL KYPEL  EG PTVKQRL+ICN AVT+MAIEA+  CIK WG + ++ITH    
Sbjct  73    VMSEEILIKYPELVTEGTPTVKQRLEICNEAVTEMAIEAALGCIKNWGGALSDITH----  128

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
                         +++KGLGL PDTQR+MLYF+GCSGGVAGLRVAKDIAENNPGSRVL+AT
Sbjct  129   ------------FMSKGLGLSPDTQRIMLYFAGCSGGVAGLRVAKDIAENNPGSRVLLAT  176

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETTIIGFKPPSADRPYDLVGVALFGDGAGAM+IGS+P+ E E+PLFELHTA+Q F+P T
Sbjct  177   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPILEHEKPLFELHTAVQEFLPHT  236

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             EK IDG+LTEEGISFKL RELPQIIEDN++ FC KLM V  + +K ++NKLFWAVHPGGP
Sbjct  237   EKKIDGRLTEEGISFKLARELPQIIEDNVEGFCDKLMSVVEFQNK-EYNKLFWAVHPGGP  295

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWG  1157
             AILNR+EK+L+L PEKLSASRRAL DYGNASSNTIVYVLEYM+EE  K R+   ED +WG
Sbjct  296   AILNRIEKRLDLLPEKLSASRRALMDYGNASSNTIVYVLEYMIEEGLKTRKDGREDPEWG  355

Query  1158  LILAFGPGITLEGILTRNLTA  1220
             LILAFGPGIT EGIL RNL A
Sbjct  356   LILAFGPGITFEGILARNLCA  376



>ref|XP_006664811.1| PREDICTED: chalcone synthase LF2-like [Oryza brachyantha]
Length=407

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/381 (70%), Positives = 317/381 (83%), Gaps = 6/381 (2%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++V+G+ +NTNCDDP LK+KLTRLCKTTTVKTRYVVMS
Sbjct  20    NPGKATILALGHAFPQQLVMQDYVVEGFMRNTNCDDPELKEKLTRLCKTTTVKTRYVVMS  79

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             EEIL+ YPELA EG PT+KQRLDI N AVTQMA EAS  C++ WG + +EITHLVYVSSS
Sbjct  80    EEILRSYPELAQEGQPTMKQRLDISNKAVTQMATEASLACVRSWGGALSEITHLVYVSSS  139

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  140   EARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSET  199

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PPS DRPYDLVGVALFGDGAGA ++G++P   LERPLFELH+A+Q F+PDT+K 
Sbjct  200   TIVGFRPPSPDRPYDLVGVALFGDGAGAAIVGADPT-PLERPLFELHSALQRFLPDTDKT  258

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+LTEEGI F+L RELP IIE N++ FC KLM+      +  ++ +FWAVHPGGPAIL
Sbjct  259   IDGRLTEEGIKFQLGRELPHIIEANVEAFCQKLMQEHPQQRQLTYDDMFWAVHPGGPAIL  318

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--KKRES---EAEDSDWG  1157
              ++E +L L   KL ASR AL D+GNASSNTIVYVLE M+EE  ++RE+   E ED +WG
Sbjct  319   TKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEETRQRRETATAEEEDCEWG  378

Query  1158  LILAFGPGITLEGILTRNLTA  1220
             LILAFGPGIT EGIL RNL A
Sbjct  379   LILAFGPGITFEGILARNLEA  399



>ref|XP_002461886.1| hypothetical protein SORBIDRAFT_02g009850 [Sorghum bicolor]
 gb|EER98407.1| hypothetical protein SORBIDRAFT_02g009850 [Sorghum bicolor]
Length=418

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/390 (69%), Positives = 317/390 (81%), Gaps = 15/390 (4%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++VDG+ KNTNCDDP LK+KLTRLCKTTTVKTRYVVMS
Sbjct  22    NPGKATILALGHAFPQQLVMQDYVVDGFMKNTNCDDPELKEKLTRLCKTTTVKTRYVVMS  81

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             EEILK YPELA EGLPT+KQRLDI N+AVTQMA EAS +C++ WG + + ITHLVYVSSS
Sbjct  82    EEILKNYPELAQEGLPTMKQRLDISNAAVTQMATEASLSCVRSWGGALSSITHLVYVSSS  141

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAEN-NPGSRVLVATSE  629
             EAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+  PG+RVL+ATSE
Sbjct  142   EARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCGPGARVLLATSE  201

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PPS DRPYDLVGVALFGDGAGA VIG++P    ERPLFELH+A+Q F+PDTEK
Sbjct  202   TTIVGFRPPSPDRPYDLVGVALFGDGAGAAVIGTDPAPG-ERPLFELHSALQRFLPDTEK  260

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDD------FNKLFWAVH  971
              I+G+LTEEGI F+L RELP IIE ++++FC KLM+       DD      +  +FWAVH
Sbjct  261   TIEGRLTEEGIKFQLGRELPHIIEAHVEDFCHKLMKEREEVGDDDRGPELSYGDMFWAVH  320

Query  972   PGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE-------  1130
             PGGPAIL ++E +L L  +KL ASR AL D+GNASSNTIVYVLE M+EE +R        
Sbjct  321   PGGPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMVEETRRRKLLAAPA  380

Query  1131  SEAEDSDWGLILAFGPGITLEGILTRNLTA  1220
              + ED +WGLILAFGPGIT EGIL RNL A
Sbjct  381   GDGEDCEWGLILAFGPGITFEGILARNLQA  410



>ref|NP_001059449.2| Os07g0411300 [Oryza sativa Japonica Group]
 dbj|BAC21541.1| putative chalcone synthase [Oryza sativa Japonica Group]
 dbj|BAF21363.2| Os07g0411300 [Oryza sativa Japonica Group]
Length=405

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/381 (70%), Positives = 315/381 (83%), Gaps = 6/381 (2%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++VDG+ +NTNCDDP LK+KLTRLCKTTTVKTRYVVMS
Sbjct  20    NPGKATILALGHAFPQQLVMQDYVVDGFMRNTNCDDPELKEKLTRLCKTTTVKTRYVVMS  79

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             EEILK YPELA EG PT+KQRLDI N AVTQMA EAS  C++ WG + +EITHLVYVSSS
Sbjct  80    EEILKSYPELAQEGQPTMKQRLDISNKAVTQMATEASLACVRSWGGALSEITHLVYVSSS  139

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  140   EARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSET  199

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PPS DRPYDLVGVALFGDGAGA V+G++P   +ERPLFELH+A+Q F+PDT+K 
Sbjct  200   TIVGFRPPSPDRPYDLVGVALFGDGAGAAVVGADPT-PVERPLFELHSALQRFLPDTDKT  258

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRV-AGYSHKDDFNKLFWAVHPGGPAI  989
             IDG+LTEEGI F+L RELP IIE N++ FC KLM+     + K  +  +FWAVHPGGPAI
Sbjct  259   IDGRLTEEGIKFQLGRELPHIIEANVEAFCQKLMQEHPQAADKLTYGDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKR----ESEAEDSDWG  1157
             L ++E +L L   KL ASR AL D+GNASSNTIVYVLE M+EE ++     +E ED +WG
Sbjct  319   LTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEETRQRREEAAEEEDCEWG  378

Query  1158  LILAFGPGITLEGILTRNLTA  1220
             LILAFGPGIT EGIL RNL A
Sbjct  379   LILAFGPGITFEGILARNLQA  399



>gb|EEC81903.1| hypothetical protein OsI_25733 [Oryza sativa Indica Group]
Length=405

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/381 (70%), Positives = 315/381 (83%), Gaps = 6/381 (2%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++VDG+ +NTNCDDP LK+KLTRLCKTTTVKTRYVVMS
Sbjct  20    NPGKATILALGHAFPQQLVMQDYVVDGFMRNTNCDDPELKEKLTRLCKTTTVKTRYVVMS  79

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             EEILK YPELA EG PT+KQRLDI N AVTQMA EAS  C++ WG + +EITHLVYVSSS
Sbjct  80    EEILKSYPELAQEGQPTMKQRLDISNKAVTQMATEASLACVRSWGGALSEITHLVYVSSS  139

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  140   EARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSET  199

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PPS DRPYDLVGVALFGDGAGA V+G++P   +ERPLFELH+A+Q F+PDT+K 
Sbjct  200   TIVGFRPPSPDRPYDLVGVALFGDGAGAAVVGADPT-PVERPLFELHSALQRFLPDTDKT  258

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRV-AGYSHKDDFNKLFWAVHPGGPAI  989
             IDG+LTEEGI F+L RELP IIE N++ FC KLM+     + K  +  +FWAVHPGGPAI
Sbjct  259   IDGRLTEEGIKFQLGRELPHIIEANVEAFCQKLMQEHPQAADKLTYGDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKR----ESEAEDSDWG  1157
             L ++E +L L   KL ASR AL D+GNASSNTIVYVLE M+EE ++     +E ED +WG
Sbjct  319   LTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEETRQRREEAAEEEDCEWG  378

Query  1158  LILAFGPGITLEGILTRNLTA  1220
             LILAFGPGIT EGIL RNL A
Sbjct  379   LILAFGPGITFEGILARNLQA  399



>emb|CAJ13548.1| unnamed protein product [Triticum turgidum]
Length=418

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/390 (68%), Positives = 319/390 (82%), Gaps = 15/390 (4%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++V+G+ +NTNC+DP LK+KLTRLCKTTTVKTRYVVMS
Sbjct  25    NPGKATILALGHAFPQQLVMQDYVVEGFMRNTNCNDPELKEKLTRLCKTTTVKTRYVVMS  84

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EILK YPELA EGLPT+KQRLDI N AVTQMA EAS  CIK WG   + ITHLVYVSSS
Sbjct  85    DEILKSYPELAQEGLPTMKQRLDISNKAVTQMATEASLACIKAWGGDLSAITHLVYVSSS  144

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  145   EARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSET  204

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             T+ GF+PPS DRPYDLVGVALFGDGAGA V+G++P  + ERPLFEL++A+Q F+PDTEK 
Sbjct  205   TVAGFRPPSPDRPYDLVGVALFGDGAGAAVVGTDPTDQ-ERPLFELYSALQRFLPDTEKT  263

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMR---VAGYSHKDD---FNKLFWAVHP  974
             IDG+LTEEGI F+L RELP IIE +++ FC KL++    A  +  D+   ++K+FWAVHP
Sbjct  264   IDGRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDNMLTYDKMFWAVHP  323

Query  975   GGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEA-----  1139
             GGPAIL ++E +L L   KL ASR AL D+GNASSNTIVYVLE M+EE ++ +EA     
Sbjct  324   GGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESRQRTEAPEPEA  383

Query  1140  ---EDSDWGLILAFGPGITLEGILTRNLTA  1220
                ++ +WGLILAFGPGITLEGIL RNL A
Sbjct  384   EGGQECEWGLILAFGPGITLEGILARNLQA  413



>tpg|DAA60355.1| TPA: chalcone synthase [Zea mays]
Length=427

 Score =   525 bits (1351),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 262/390 (67%), Positives = 315/390 (81%), Gaps = 15/390 (4%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++VDG+ KNTNCDDP LK+KLTRLCKTTTV+TRYVVMS
Sbjct  31    NPGKATILALGHAFPQQLVMQDYVVDGFMKNTNCDDPELKEKLTRLCKTTTVRTRYVVMS  90

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EILK YPELA EGLPT+ QRLDI N+AVTQMA EAS +C++ WG + + ITHLVYVSSS
Sbjct  91    DEILKNYPELAQEGLPTMNQRLDISNAAVTQMATEASLSCVRSWGGALSSITHLVYVSSS  150

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  151   EARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSET  210

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PPS DRPYDLVGVALFGDGAGA VIG++P    ERPLFELH+A+Q F+PDTE+ 
Sbjct  211   TIVGFRPPSPDRPYDLVGVALFGDGAGAAVIGTDPAPA-ERPLFELHSALQRFLPDTERT  269

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDD--------FNKLFWAV  968
             I+G+LTEEGI F+L RELP IIE ++++FC KLM+        D        +  +FWAV
Sbjct  270   IEGRLTEEGIKFQLGRELPHIIEAHVEDFCQKLMKERQSGEDADGGGPEPMSYGDMFWAV  329

Query  969   HPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKR------E  1130
             HPGGPAIL ++E +L L  +KL ASR AL D+GNASSNTIVYVLE M+E+ +R      +
Sbjct  330   HPGGPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMVEDTRRRRLLAAD  389

Query  1131  SEAEDSDWGLILAFGPGITLEGILTRNLTA  1220
                ED +WGLILAFGPGIT EGIL RNL A
Sbjct  390   DGGEDCEWGLILAFGPGITFEGILARNLQA  419



>tpg|DAA60357.1| TPA: hypothetical protein ZEAMMB73_750242 [Zea mays]
Length=412

 Score =   524 bits (1349),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 262/390 (67%), Positives = 315/390 (81%), Gaps = 15/390 (4%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++VDG+ KNTNCDDP LK+KLTRLCKTTTV+TRYVVMS
Sbjct  16    NPGKATILALGHAFPQQLVMQDYVVDGFMKNTNCDDPELKEKLTRLCKTTTVRTRYVVMS  75

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EILK YPELA EGLPT+ QRLDI N+AVTQMA EAS +C++ WG + + ITHLVYVSSS
Sbjct  76    DEILKNYPELAQEGLPTMNQRLDISNAAVTQMATEASLSCVRSWGGALSSITHLVYVSSS  135

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  136   EARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSET  195

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PPS DRPYDLVGVALFGDGAGA VIG++P    ERPLFELH+A+Q F+PDTE+ 
Sbjct  196   TIVGFRPPSPDRPYDLVGVALFGDGAGAAVIGTDPAPA-ERPLFELHSALQRFLPDTERT  254

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDD--------FNKLFWAV  968
             I+G+LTEEGI F+L RELP IIE ++++FC KLM+        D        +  +FWAV
Sbjct  255   IEGRLTEEGIKFQLGRELPHIIEAHVEDFCQKLMKERQSGEDADGGGPEPMSYGDMFWAV  314

Query  969   HPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKR------E  1130
             HPGGPAIL ++E +L L  +KL ASR AL D+GNASSNTIVYVLE M+E+ +R      +
Sbjct  315   HPGGPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMVEDTRRRRLLAAD  374

Query  1131  SEAEDSDWGLILAFGPGITLEGILTRNLTA  1220
                ED +WGLILAFGPGIT EGIL RNL A
Sbjct  375   DGGEDCEWGLILAFGPGITFEGILARNLQA  404



>ref|NP_001149508.1| chalcone synthase [Zea mays]
 gb|ACF88048.1| unknown [Zea mays]
 gb|ACG35664.1| chalcone synthase [Zea mays]
 gb|ACN27825.1| unknown [Zea mays]
 tpg|DAA60356.1| TPA: chalcone synthase [Zea mays]
Length=417

 Score =   524 bits (1349),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 262/390 (67%), Positives = 315/390 (81%), Gaps = 15/390 (4%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++VDG+ KNTNCDDP LK+KLTRLCKTTTV+TRYVVMS
Sbjct  21    NPGKATILALGHAFPQQLVMQDYVVDGFMKNTNCDDPELKEKLTRLCKTTTVRTRYVVMS  80

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EILK YPELA EGLPT+ QRLDI N+AVTQMA EAS +C++ WG + + ITHLVYVSSS
Sbjct  81    DEILKNYPELAQEGLPTMNQRLDISNAAVTQMATEASLSCVRSWGGALSSITHLVYVSSS  140

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  141   EARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSET  200

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PPS DRPYDLVGVALFGDGAGA VIG++P    ERPLFELH+A+Q F+PDTE+ 
Sbjct  201   TIVGFRPPSPDRPYDLVGVALFGDGAGAAVIGTDPAPA-ERPLFELHSALQRFLPDTERT  259

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDD--------FNKLFWAV  968
             I+G+LTEEGI F+L RELP IIE ++++FC KLM+        D        +  +FWAV
Sbjct  260   IEGRLTEEGIKFQLGRELPHIIEAHVEDFCQKLMKERQSGEDADGGGPEPMSYGDMFWAV  319

Query  969   HPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKR------E  1130
             HPGGPAIL ++E +L L  +KL ASR AL D+GNASSNTIVYVLE M+E+ +R      +
Sbjct  320   HPGGPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMVEDTRRRRLLAAD  379

Query  1131  SEAEDSDWGLILAFGPGITLEGILTRNLTA  1220
                ED +WGLILAFGPGIT EGIL RNL A
Sbjct  380   DGGEDCEWGLILAFGPGITFEGILARNLQA  409



>ref|XP_010933363.1| PREDICTED: chalcone synthase [Elaeis guineensis]
Length=360

 Score =   521 bits (1342),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 263/360 (73%), Positives = 308/360 (86%), Gaps = 3/360 (1%)
 Frame = +3

Query  150   MQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVK  329
             MQ+F+VDGYF NT C DP LKQ+LTRLCKTTTVKTRYVVMSEEIL+ YPELA EGLPTVK
Sbjct  1     MQDFVVDGYFNNTKCHDPELKQRLTRLCKTTTVKTRYVVMSEEILRNYPELATEGLPTVK  60

Query  330   QRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRP  509
             QRLDI N AVTQMAIEAS +CIK  GR  + ITHLVYVSSSEAR PGGDL+LA GLGL P
Sbjct  61    QRLDISNKAVTQMAIEASLSCIKALGRPLSCITHLVYVSSSEARFPGGDLHLALGLGLSP  120

Query  510   DTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETTIIGFKPPSADRPYDLVGV  689
             D +R+ML F+GCSGGVAGLRVAKD+AENNPGSRVL+ATSETTI+GF+PPSADRPYDLVGV
Sbjct  121   DVRRIMLSFTGCSGGVAGLRVAKDLAENNPGSRVLLATSETTIVGFRPPSADRPYDLVGV  180

Query  690   ALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELP  869
             ALFGDGAGA V+G +P+   E  LFELH+A+Q ++P TEK IDG+LTEEGI+F+L RELP
Sbjct  181   ALFGDGAGAAVLGVDPIPGAETALFELHSAVQRYLPGTEKTIDGRLTEEGINFQLGRELP  240

Query  870   QIIEDNIDEFCAKLMRVAGYSHKD-DFNKLFWAVHPGGPAILNRlekklelspeklsasR  1046
             Q+IED+++ FC K+MR      ++  ++++FWAVHPGGPAIL+R+E +LEL PEKL+ASR
Sbjct  241   QVIEDHVEGFCKKVMREGREGGENTKYDEMFWAVHPGGPAILSRVESRLELGPEKLNASR  300

Query  1047  RALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWGLILAFGPGITLEGILTRNLTA  1220
             +AL DYGNASSNTIVYVLEYM+EE  K+RE   +D +WGLILAFGPG+T EGIL RNL A
Sbjct  301   KALRDYGNASSNTIVYVLEYMVEESRKRREKGEKDCEWGLILAFGPGVTFEGILARNLVA  360



>ref|XP_008780014.1| PREDICTED: chalcone synthase [Phoenix dactylifera]
Length=360

 Score =   520 bits (1340),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 260/360 (72%), Positives = 307/360 (85%), Gaps = 3/360 (1%)
 Frame = +3

Query  150   MQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVK  329
             MQ+FLVDGYFKNT CDDP LKQ+LTRLCKTTTVKTRYVVMSEEIL+ YPELA EGLPTVK
Sbjct  1     MQDFLVDGYFKNTKCDDPELKQRLTRLCKTTTVKTRYVVMSEEILRNYPELAAEGLPTVK  60

Query  330   QRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRP  509
             QRL+I N AVTQMA+EAS +CIK  GR  + +THLVYVSSSEAR PGGDL+LA GLGL P
Sbjct  61    QRLEISNKAVTQMAVEASLSCIKALGRPLSAVTHLVYVSSSEARFPGGDLHLALGLGLSP  120

Query  510   DTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETTIIGFKPPSADRPYDLVGV  689
             D +R+ML F+GCSGGVAGLRVAKD+AENNPGSRVL+ATSETTI+GF+PPSA RPYDLVG 
Sbjct  121   DVRRIMLSFTGCSGGVAGLRVAKDLAENNPGSRVLLATSETTIVGFRPPSASRPYDLVGA  180

Query  690   ALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELP  869
             ALFGDGAGA ++G +P+  +E  LFELH+A Q ++P TEK IDG+LTEEGI+F+L RELP
Sbjct  181   ALFGDGAGAAILGVDPIPGVETALFELHSAAQQYLPGTEKTIDGRLTEEGINFRLGRELP  240

Query  870   QIIEDNIDEFCAKLMRVAGYSHKD-DFNKLFWAVHPGGPAILNRlekklelspeklsasR  1046
             Q+IED+++ FC KLMR      +D + N++FWAVHPGGPAIL+++E +LEL P+KL+ASR
Sbjct  241   QVIEDHVEAFCKKLMREGREGGEDAENNEMFWAVHPGGPAILSKVESRLELWPDKLNASR  300

Query  1047  RALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWGLILAFGPGITLEGILTRNLTA  1220
             +AL DYGNASSNTIVYVL YM+EE  K+RE   +D +WGLILAFGPG+T EGIL RNL A
Sbjct  301   KALRDYGNASSNTIVYVLNYMVEESRKRREKGEKDCEWGLILAFGPGVTFEGILARNLVA  360



>gb|ACJ22498.1| chalcone synthase [Triticum aestivum]
Length=422

 Score =   521 bits (1343),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 263/394 (67%), Positives = 316/394 (80%), Gaps = 19/394 (5%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++V+G+ +NTNC DP LK+KLTRLCKTTTVKTRYVVMS
Sbjct  25    NPGKATILALGHAFPQQLVMQDYVVEGFMRNTNCKDPELKEKLTRLCKTTTVKTRYVVMS  84

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EILK YPELA EGLPT+KQRLDI N AVTQMA EAS  CIK WG   + ITHLVYVSSS
Sbjct  85    DEILKSYPELAQEGLPTMKQRLDISNKAVTQMATEASLACIKAWGGDLSAITHLVYVSSS  144

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  145   EARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSET  204

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             T+ GF+PPS DRPYDLVGVALFGDGAGA V+G++P  + ERPLFEL++A+Q F+PDTEK 
Sbjct  205   TVAGFRPPSPDRPYDLVGVALFGDGAGAAVVGTDPTDQ-ERPLFELYSALQRFLPDTEKT  263

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMR---VAGYSHKDD-----FNKLFWAV  968
             IDG+LTEEGI F+L RELP IIE +++ FC KL++    A  +  D      ++K+FWAV
Sbjct  264   IDGRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDHGEQLTYDKMFWAV  323

Query  969   HPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEA---  1139
             HPGGPAIL ++E +L L   KL ASR AL D+GNASSNTIVYVLE M+EE ++ +EA   
Sbjct  324   HPGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESRQRTEAPEP  383

Query  1140  -------EDSDWGLILAFGPGITLEGILTRNLTA  1220
                    ++ +WGLILAFGPGIT EGIL RNL A
Sbjct  384   EPEPEGGQECEWGLILAFGPGITFEGILARNLQA  417



>dbj|BAJ95097.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=429

 Score =   521 bits (1341),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 264/403 (66%), Positives = 317/403 (79%), Gaps = 28/403 (7%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++V+G+ +NTNC+DP LK+KLTRLCKTTTVKTRYVVMS
Sbjct  23    NPGKATILALGHAFPQQLVMQDYVVEGFMRNTNCNDPELKEKLTRLCKTTTVKTRYVVMS  82

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             EEILK YPELA EGLPT+KQRLDI N AVTQMA EAS  C++ WG   + ITHLVYVSSS
Sbjct  83    EEILKSYPELAQEGLPTMKQRLDISNKAVTQMATEASLACVEAWGGDLSAITHLVYVSSS  142

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  143   EARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSET  202

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             T+ GF+PPS DRPYDLVGVALFGDGAGA V+G++P   +ERPLFELH+A+Q F+PDTEK 
Sbjct  203   TVAGFRPPSPDRPYDLVGVALFGDGAGAAVVGADPTA-VERPLFELHSALQRFLPDTEKT  261

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRV-AGYSHKDD---FNKLFWAVHPGG  980
             IDG+LTEEGI F+L RELP IIE +++ FC KL++   G +  +D   ++K+FWAVHPGG
Sbjct  262   IDGRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPGAAAAEDVLTYDKMFWAVHPGG  321

Query  981   PAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAE------  1142
             PAIL ++E +L L   KL ASR AL D+GNASSNTIVYVLE M+EE +R+S  E      
Sbjct  322   PAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESRRQSMTEAPVLEN  381

Query  1143  -----------------DSDWGLILAFGPGITLEGILTRNLTA  1220
                              + +WGLILAFGPGIT EGIL RNL A
Sbjct  382   MVEESRRQRTTEPEMEPECEWGLILAFGPGITFEGILARNLQA  424



>emb|CAJ13966.1| unnamed protein product [Aegilops tauschii]
Length=420

 Score =   518 bits (1333),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 262/392 (67%), Positives = 315/392 (80%), Gaps = 17/392 (4%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++V+G+ +NTNC+DP LK+KL RLCKTTTVKTRYVVMS
Sbjct  25    NPGKATILALGHAFPQQLVMQDYVVEGFMRNTNCNDPELKEKLARLCKTTTVKTRYVVMS  84

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EILK YPELA EGLPT+KQRLDI N AVTQMA EAS  C+K WG   + ITHLVYVSSS
Sbjct  85    DEILKSYPELAQEGLPTMKQRLDISNKAVTQMATEASLACVKAWGGDLSAITHLVYVSSS  144

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  145   EARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSET  204

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             T+ GF+PPS DRPYDLVGVALFGDGAGA V+G++P   LERPLFELH+A+Q F+PDTEK 
Sbjct  205   TVAGFRPPSPDRPYDLVGVALFGDGAGAAVVGTDPT-PLERPLFELHSALQRFLPDTEKT  263

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMR---VAGYSHKDD---FNKLFWAVHP  974
             IDG+LTEEGI F+L RELP IIE +++ FC KL++    A  +  D+   ++K+FWAVHP
Sbjct  264   IDGRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDNMLTYDKMFWAVHP  323

Query  975   GGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRES-------  1133
             GGPAIL ++E +L L   KL ASR AL D+GNASSNTIVYVLE M+EE ++ +       
Sbjct  324   GGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESRQRAEAPEPEP  383

Query  1134  ---EAEDSDWGLILAFGPGITLEGILTRNLTA  1220
                  E+ +WGLILAFGPGIT EGIL RNL A
Sbjct  384   EPEGEEECEWGLILAFGPGITFEGILARNLQA  415



>gb|AAV49989.1| putative chalcone synthase [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   518 bits (1334),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 316/404 (78%), Gaps = 29/404 (7%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++V+G+ +NTNC+DP LK+KLTRLCKTTTVKTRYVVMS
Sbjct  25    NPGKATILALGHAFPQQLVMQDYVVEGFMRNTNCNDPELKEKLTRLCKTTTVKTRYVVMS  84

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             EEILK YPELA EGLPT+KQRLDI N AVTQMA EAS  C++ WG   + ITHLVYVSSS
Sbjct  85    EEILKSYPELAQEGLPTMKQRLDISNKAVTQMATEASLACVEAWGGDLSAITHLVYVSSS  144

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  145   EARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSET  204

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             T+ GF+PPS DRPYDLVGVALFGDGAGA V+G++P   +ERPLFELH+A+Q F+PDTEK 
Sbjct  205   TVAGFRPPSPDRPYDLVGVALFGDGAGAAVVGADPTA-VERPLFELHSALQRFLPDTEKT  263

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRV-AGYSHKDD----FNKLFWAVHPG  977
             IDG+LTEEGI F+L RELP IIE +++ FC KL++   G +  +D    ++K+FWAVHPG
Sbjct  264   IDGRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPGAAAAEDVPLTYDKMFWAVHPG  323

Query  978   GPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAE-----  1142
             GPAIL ++E +L L   KL ASR AL D+GNASSNTIVYVLE M+EE +R+   E     
Sbjct  324   GPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESRRQRMTEAPVLE  383

Query  1143  ------------------DSDWGLILAFGPGITLEGILTRNLTA  1220
                               + +WGLILAFGPGIT EGIL RNL A
Sbjct  384   NMVEESRRQRTTEPEMEPECEWGLILAFGPGITFEGILARNLQA  427



>ref|XP_004956033.1| PREDICTED: chalcone synthase 1-like [Setaria italica]
Length=409

 Score =   516 bits (1330),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 262/387 (68%), Positives = 315/387 (81%), Gaps = 12/387 (3%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++VDG+ KNTNCDDP LK+KLTRLCKTTTVKTRYVVMS
Sbjct  20    NPGKATILALGHAFPQQLVMQDYVVDGFMKNTNCDDPELKEKLTRLCKTTTVKTRYVVMS  79

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EILK YPELA EGLPT+KQRLDI N AVTQMA EAS  C++ WG + + ITHLVYVSSS
Sbjct  80    DEILKSYPELAQEGLPTMKQRLDISNKAVTQMATEASLACVRSWGGALSSITHLVYVSSS  139

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EAR PGGDL+LA+ +GL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  140   EARFPGGDLHLARAMGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSET  199

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             T++GF+PPSADRPYDLVGVALFGDGAGA V+G++P    ERPLFELH+A+Q F+P T+K 
Sbjct  200   TVVGFRPPSADRPYDLVGVALFGDGAGAAVVGADPAPH-ERPLFELHSALQCFLPGTDKT  258

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLM---RVAGYSHKDDFNKLFWAVHPGGP  983
             I+G+LTEEGI F+L RELP IIE +++EFC KLM      G   +  ++ +FWAVHPGGP
Sbjct  259   IEGRLTEEGIKFQLGRELPHIIEAHVEEFCRKLMAEREGGGGEEEMGYDDMFWAVHPGGP  318

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRES--------EA  1139
             AIL ++E +L L  +KL ASR AL D+GNASSNTIVYVLE M+EE +R          + 
Sbjct  319   AILTKMEGRLGLGGDKLRASRCALRDFGNASSNTIVYVLENMVEETRRRKAAAAAGDSDG  378

Query  1140  EDSDWGLILAFGPGITLEGILTRNLTA  1220
             +D +WGLILAFGPGIT EGIL RNL A
Sbjct  379   DDCEWGLILAFGPGITFEGILARNLQA  405



>gb|AAB80804.1| chalcone synthase homolog PrChS1 [Pinus radiata]
Length=390

 Score =   515 bits (1326),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 267/386 (69%), Positives = 311/386 (81%), Gaps = 6/386 (2%)
 Frame = +3

Query  60    GDAVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKT  239
             G   ++  ++  PGK + MA G+AFP QLVMQEFLVDGYF+NTNC DPVL+QKL RLCKT
Sbjct  9     GVVAVKSRRQHRPGKTTAMAFGRAFPDQLVMQEFLVDGYFRNTNCQDPVLRQKLERLCKT  68

Query  240   TTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPT  419
             TTVKTRYVVMS+EIL ++PELA+EG  TV+QRL+I N AVT MA++A   C+K+WGR  +
Sbjct  69    TTVKTRYVVMSDEILAQHPELAVEGSATVRQRLEISNVAVTDMAVDACRDCLKEWGRPVS  128

Query  420   EITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNP  599
             EITHLVYVSSSE RLPGGDLYLA  LGLR D  RVMLYF GC GGV GLRVAKD+AENNP
Sbjct  129   EITHLVYVSSSEIRLPGGDLYLASRLGLRSDVSRVMLYFLGCYGGVTGLRVAKDLAENNP  188

Query  600   GSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQEL-ERPLFELHT  776
             GSRVL+ATSETTI+GF+PP+ +RPYDLVG ALFGDGA AMV+G++P  E  E+   EL  
Sbjct  189   GSRVLLATSETTILGFRPPNPERPYDLVGAALFGDGAAAMVLGTDPRPEAGEQGFLELDW  248

Query  777   AIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKL  956
             A+Q F+PDT   I+G+LTEEGI+FKL RELPQIIED+I+ FC KLM  AG    DD+N+L
Sbjct  249   AVQQFLPDTHGTINGRLTEEGINFKLGRELPQIIEDHIEGFCRKLMDKAGV---DDYNEL  305

Query  957   FWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESE  1136
             FW VHPGGPAILNRLEKKL L PEKL  SR+ALADYGNASSNTIVYVL+ M + K    E
Sbjct  306   FWGVHPGGPAILNRLEKKLSLGPEKLYYSRQALADYGNASSNTIVYVLDAMRQLKG--GE  363

Query  1137  AEDSDWGLILAFGPGITLEGILTRNL  1214
              +  +WGLILAFGPGIT EGIL R+L
Sbjct  364   KQSPEWGLILAFGPGITFEGILARSL  389



>emb|CAJ15412.1| unnamed protein product [Triticum aestivum]
Length=421

 Score =   513 bits (1321),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 261/393 (66%), Positives = 315/393 (80%), Gaps = 18/393 (5%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++V+G+ +NTNC+DP LK+KL RLCKTTTVKTRYVVMS
Sbjct  25    NPGKATILALGHAFPQQLVMQDYVVEGFMRNTNCNDPELKEKLARLCKTTTVKTRYVVMS  84

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EILK YPELA EGLPT+KQRLDI N AVTQMA EAS  C+K WG   + ITHLVYVSSS
Sbjct  85    DEILKSYPELAQEGLPTMKQRLDISNKAVTQMATEASLACVKAWGGDLSAITHLVYVSSS  144

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  145   EARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSET  204

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             T+ GF+PPS DRPYDLVGVALFGDGAGA V+G++P   LE PLFELH+A+Q F+P TEK 
Sbjct  205   TVAGFRPPSPDRPYDLVGVALFGDGAGAAVVGTDPT-PLECPLFELHSALQRFLPGTEKT  263

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMR---VAGYSHKDD---FNKLFWAVHP  974
             IDG+LTEEGI F+L RELP IIE +++ FC KL++    A  +  D+   ++K+FWAVHP
Sbjct  264   IDGRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDNMLTYDKMFWAVHP  323

Query  975   GGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEA-----  1139
             GGPAIL ++E +L L   KL ASR AL D+GNASSNTIVYVLE M+EE ++ +EA     
Sbjct  324   GGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESRQRAEAPEPEP  383

Query  1140  ------EDSDWGLILAFGPGITLEGILTRNLTA  1220
                   ++ +WGLILAFGPGIT EGIL RNL A
Sbjct  384   EPEGADQECEWGLILAFGPGITFEGILARNLQA  416



>ref|XP_006375238.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
 gb|ERP53035.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
Length=389

 Score =   506 bits (1303),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 258/377 (68%), Positives = 301/377 (80%), Gaps = 6/377 (2%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             +  +PGKA+I+A GKAFP QLV QE LV+GY ++T CDD  +K+KL RLCKTTTVKTRY 
Sbjct  19    RAPTPGKATILATGKAFPSQLVPQECLVEGYMRDTKCDDASIKEKLERLCKTTTVKTRYT  78

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMS+EIL+KYPELA EG PT+KQRL+I N AV +MA++AS  CI +WG S  +ITH+VYV
Sbjct  79    VMSKEILEKYPELATEGSPTIKQRLEIANPAVVEMALKASIACINEWGGSVKDITHVVYV  138

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSE RLPGGDLYLA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSR+L+ T
Sbjct  139   SSSEIRLPGGDLYLASQLGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRILLTT  198

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETTI+GF+PP+  RPYDLVG ALFGDGA A++IG++PV   E P  EL  A+Q F+P T
Sbjct  199   SETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADPVIGKESPFMELSYAVQQFLPGT  258

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             + +IDG+L+EEGI+FKL R+LPQ IEDNI+EFC KLM  AG +   +FN LFWAVHPGGP
Sbjct  259   QNVIDGRLSEEGINFKLGRDLPQKIEDNIEEFCRKLMSKAGLT---EFNDLFWAVHPGGP  315

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLI  1163
             AILNRLE  L+L+ EKL  SRRAL +YGN SSNTIVYVLEYM EE KRE   E   WGL 
Sbjct  316   AILNRLESNLKLNTEKLECSRRALINYGNVSSNTIVYVLEYMKEELKREGGEE---WGLA  372

Query  1164  LAFGPGITLEGILTRNL  1214
             LAFGPGIT EGIL R+L
Sbjct  373   LAFGPGITFEGILLRSL  389



>ref|XP_002889339.1| chalcone synthase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65598.1| chalcone synthase family protein [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   506 bits (1302),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 253/377 (67%), Positives = 305/377 (81%), Gaps = 2/377 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+PGKA+++ALGKAFP Q+V QE LV+G+ ++T C+D  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANPGKATLLALGKAFPSQVVPQENLVEGFLRDTKCEDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDESMEFNDMFWAVHPGGPAI  319

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM EE K++ + E  +WGL LA
Sbjct  320   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREELKKKGD-EAQEWGLGLA  378

Query  1170  FGPGITLEGILTRNLTA  1220
             FGPGIT EG+L R+LT+
Sbjct  379   FGPGITFEGLLIRSLTS  395



>ref|XP_010107936.1| Chalcone synthase A [Morus notabilis]
 gb|EXC17336.1| Chalcone synthase A [Morus notabilis]
Length=385

 Score =   504 bits (1299),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 251/374 (67%), Positives = 303/374 (81%), Gaps = 5/374 (1%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PG+A+I+A+GKAFP QL+ QE LV+GY ++TNC D  +K+KL RLCKTTTVKTRY VM 
Sbjct  17    TPGRATILAIGKAFPSQLIPQECLVEGYIRDTNCQDASIKEKLERLCKTTTVKTRYTVMC  76

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             ++IL+KYPELA EG PT+ QRL+I N AV +MA EAS  CIK+WGR P +ITH+VYVSSS
Sbjct  77    KDILEKYPELAREGTPTINQRLEIANPAVVEMAKEASLACIKEWGRPPQDITHIVYVSSS  136

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDL+LA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSET
Sbjct  137   EIRLPGGDLHLASQLGLRTDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  196

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGA A++IG++P+ +LE P  EL++A+Q F+P+T  +
Sbjct  197   TILGFRPPNMSRPYDLVGAALFGDGAAAVIIGADPITDLESPFMELNSAVQQFLPNTHDV  256

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+L+EEGI+F+L R+LPQ IEDNI+EFC KLM  AG   K ++N+LFWAVHPGGPAIL
Sbjct  257   IDGKLSEEGINFRLGRDLPQKIEDNIEEFCKKLMAKAGL--KFEYNELFWAVHPGGPAIL  314

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAF  1172
             N+LE  L+L  EKL +SRRAL DYGN SSNTI+YV+E M EE KRE   E   WG  LAF
Sbjct  315   NKLESCLKLRSEKLVSSRRALMDYGNVSSNTILYVIENMREELKREGSEE---WGFGLAF  371

Query  1173  GPGITLEGILTRNL  1214
             GPGIT EGIL R+L
Sbjct  372   GPGITFEGILIRSL  385



>ref|XP_010474836.1| PREDICTED: chalcone synthase isoform X2 [Camelina sativa]
Length=387

 Score =   504 bits (1299),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 253/377 (67%), Positives = 305/377 (81%), Gaps = 3/377 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+PGKA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  13    ANPGKATVLALGKAFPSQVVPQENLVEGFLRDTKCDDAYIKEKLEHLCKTTTVKTRYTVL  72

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  73    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  132

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  133   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  192

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG+NP +E E P  ELH A+Q F+P T+ 
Sbjct  193   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGANP-KECEAPFMELHYAVQQFLPGTQN  251

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+L+EEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  252   VIDGRLSEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  310

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL +YGN SSNTI+YV+EYM +E K++ EA   +WGL LA
Sbjct  311   LNRLETKLKLEREKLESSRRALVNYGNVSSNTILYVMEYMRDELKKKGEAA-QEWGLGLA  369

Query  1170  FGPGITLEGILTRNLTA  1220
             FGPGIT EG+L R+LT+
Sbjct  370   FGPGITFEGLLIRSLTS  386



>ref|XP_010474834.1| PREDICTED: chalcone synthase isoform X1 [Camelina sativa]
 ref|XP_010474835.1| PREDICTED: chalcone synthase isoform X1 [Camelina sativa]
Length=392

 Score =   504 bits (1299),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 253/377 (67%), Positives = 305/377 (81%), Gaps = 3/377 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+PGKA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  18    ANPGKATVLALGKAFPSQVVPQENLVEGFLRDTKCDDAYIKEKLEHLCKTTTVKTRYTVL  77

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  78    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  137

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  138   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  197

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG+NP +E E P  ELH A+Q F+P T+ 
Sbjct  198   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGANP-KECEAPFMELHYAVQQFLPGTQN  256

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+L+EEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  257   VIDGRLSEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  315

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL +YGN SSNTI+YV+EYM +E K++ EA   +WGL LA
Sbjct  316   LNRLETKLKLEREKLESSRRALVNYGNVSSNTILYVMEYMRDELKKKGEAA-QEWGLGLA  374

Query  1170  FGPGITLEGILTRNLTA  1220
             FGPGIT EG+L R+LT+
Sbjct  375   FGPGITFEGLLIRSLTS  391



>gb|AAZ81860.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   504 bits (1297),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 303/375 (81%), Gaps = 2/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+PGKA+++ALGKAFP Q+V QE LV+G+ ++T C+D  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANPGKATLLALGKAFPSQVVPQENLVEGFLRDTKCEDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDESMEFNDMFWAVHPGGPAI  319

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM EE K++ +A   +WGL LA
Sbjct  320   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTIMYVMEYMREELKKKGDAA-QEWGLGLA  378

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  379   FGPGITFEGLLIRSL  393



>ref|XP_002302511.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
 ref|XP_006387497.1| hypothetical protein POPTR_0955s00200g [Populus trichocarpa]
 gb|EEE81784.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
 gb|ERP46411.1| hypothetical protein POPTR_0955s00200g [Populus trichocarpa]
Length=388

 Score =   503 bits (1296),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 256/372 (69%), Positives = 298/372 (80%), Gaps = 7/372 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEE  278
             GKA+++A+GKAFP QL+ QE LV+GY ++T CDD  +K+KL RLCKTTTVKTRY VMS E
Sbjct  24    GKATLLAIGKAFPSQLIPQECLVEGYIRDTKCDDASIKEKLERLCKTTTVKTRYTVMSRE  83

Query  279   ILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSEA  458
             IL KYPELA EG PT++QRL+I N AV +MA++AS  CI +WG S  +ITH+VYVSSSE 
Sbjct  84    ILDKYPELATEGTPTIRQRLEIANPAVVEMALKASMACINEWGGSVEDITHIVYVSSSEV  143

Query  459   RLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETTI  638
             RLPGGDLYLA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSETTI
Sbjct  144   RLPGGDLYLASQLGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  639   IGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKIID  818
             +GF+PPS  RPYDLVG ALFGDGA A++IG+NPV   E P  EL+ ++Q F+P T+ +ID
Sbjct  204   LGFRPPSKARPYDLVGAALFGDGAAAVIIGANPVIGKESPFMELNYSVQQFLPGTQNVID  263

Query  819   GQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILNR  998
             G+L+EEGI FKL R+LPQ IEDNI+EFC KLM  AG +   DFN+LFWAVHPGGPAILNR
Sbjct  264   GRLSEEGIHFKLGRDLPQKIEDNIEEFCNKLMSKAGLT---DFNELFWAVHPGGPAILNR  320

Query  999   lekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAFGP  1178
             LE KL+L+ EKL  SRRAL DYGN SSNTIVYVLEYM +E KR       +WGL LAFGP
Sbjct  321   LESKLKLNEEKLECSRRALMDYGNVSSNTIVYVLEYMRDELKRGG----GEWGLALAFGP  376

Query  1179  GITLEGILTRNL  1214
             GIT EGIL R+L
Sbjct  377   GITFEGILLRSL  388



>gb|AAZ81859.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ81864.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   503 bits (1296),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 303/375 (81%), Gaps = 2/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+PGKA+++ALGKAFP Q+V QE LV+G+ ++T C+D  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANPGKATLLALGKAFPSQVVPQENLVEGFLRDTKCEDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDESMEFNDMFWAVHPGGPAI  319

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM EE K++ +A   +WGL LA
Sbjct  320   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTIMYVMEYMREELKKKGDAA-QEWGLGLA  378

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  379   FGPGITFEGLLIRSL  393



>ref|XP_010692112.1| PREDICTED: chalcone synthase [Beta vulgaris subsp. vulgaris]
Length=389

 Score =   503 bits (1296),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 251/377 (67%), Positives = 300/377 (80%), Gaps = 4/377 (1%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             + A+ GKA+++ALGKAFP QL+ QE LV+GY ++TNC D V+K+KL RLCKTTTVKTRY 
Sbjct  17    RTATLGKATVLALGKAFPKQLIPQEHLVEGYIRDTNCHDLVVKEKLERLCKTTTVKTRYT  76

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMS EIL  YPELA EG PT+KQ+L+I N AV +MA+EAS  CIK+WGR   +ITH+VYV
Sbjct  77    VMSREILNNYPELATEGTPTIKQKLEIANPAVVEMALEASIACIKEWGRPAQDITHIVYV  136

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSE RLPGGDLYL+  LGLRPD  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ T
Sbjct  137   SSSEIRLPGGDLYLSTELGLRPDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTT  196

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETTI+GF+PP+ DRPYDLVG ALFGDGA A++IGS+P    E+P  EL+ A+Q F+P T
Sbjct  197   SETTILGFRPPNKDRPYDLVGAALFGDGAAAVIIGSHPDLGREKPFMELNYAVQQFLPGT  256

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
               +IDG +TEEGI+FKL R+LP  IEDNI+EFC KLM  AG     D+N+LFWAVHPGGP
Sbjct  257   HNVIDGCITEEGINFKLGRDLPNKIEDNIEEFCKKLMSKAGLK---DYNELFWAVHPGGP  313

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLI  1163
             AILNR+E  L+L  +KL+ SRRAL DYGN SSNT+ YV+EYM +E K +    + +WGL 
Sbjct  314   AILNRVENTLKLKGDKLNCSRRALMDYGNVSSNTVFYVMEYMRDELKSKQNGGE-EWGLA  372

Query  1164  LAFGPGITLEGILTRNL  1214
             LAFGPGIT EGIL R+L
Sbjct  373   LAFGPGITFEGILLRSL  389



>gb|AAZ81863.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   503 bits (1295),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 303/375 (81%), Gaps = 2/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+PGKA+++ALGKAFP Q+V QE LV+G+ ++T C+D  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANPGKATLLALGKAFPSQVVPQENLVEGFLRDTKCEDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDESMEFNDMFWAVHPGGPAI  319

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM EE K++ +A   +WGL LA
Sbjct  320   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTIMYVMEYMREELKKKGDAA-QEWGLGLA  378

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  379   FGPGITFEGLLIRSL  393



>gb|AAZ81872.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   503 bits (1295),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 253/375 (67%), Positives = 302/375 (81%), Gaps = 2/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+P KA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANPRKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVLV TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLVTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDESMEFNDMFWAVHPGGPAI  319

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM EE K++ +A   +WGL LA
Sbjct  320   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREELKKKGDAA-QEWGLGLA  378

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  379   FGPGITFEGLLIRSL  393



>gb|AAZ81867.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   502 bits (1292),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 302/375 (81%), Gaps = 2/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+P KA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANPRKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDESMEFNDMFWAVHPGGPAI  319

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM EE K++ +A   +WGL LA
Sbjct  320   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREELKKKGDAA-QEWGLGLA  378

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  379   FGPGITFEGLLIRSL  393



>ref|XP_011017423.1| PREDICTED: chalcone synthase-like [Populus euphratica]
Length=451

 Score =   503 bits (1296),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 261/402 (65%), Positives = 308/402 (77%), Gaps = 9/402 (2%)
 Frame = +3

Query  15    FSNLFVKRLRESMGFGDAVLQGGKKASP--GKASIMALGKAFPHQLVMQEFLVDGYFKNT  188
             F NL      +S G          + +P  GKA+++A+GKAFP QL+ QE LV+GY ++T
Sbjct  57    FLNLLKMSETDSNGASKHCTSTPSRRAPTLGKATLLAIGKAFPSQLIPQECLVEGYIRDT  116

Query  189   NCDDPVLKQKLTRLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQM  368
              CDD  +K+KL RLCKTTTVKTRY VMS+EIL KYPELA EG PT++QRL+I N AV +M
Sbjct  117   KCDDASIKEKLERLCKTTTVKTRYTVMSKEILDKYPELATEGTPTIRQRLEIANPAVVEM  176

Query  369   AIEASWTCIKKWGRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCS  548
             A++AS  CI +WG    +ITH+VYVSSSE RLPGGDLYLA  LGLR D  RVMLYF GC 
Sbjct  177   ALKASMACINEWGGLVEDITHIVYVSSSEVRLPGGDLYLASQLGLRNDVGRVMLYFLGCY  236

Query  549   GGVAGLRVAKDIAENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIG  728
             GGV GLRVAKDIAENNPGSRVL+ TSETTI+GF+PPS  RPYDLVG ALFGDGA A++IG
Sbjct  237   GGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPSKARPYDLVGAALFGDGAAAVIIG  296

Query  729   SNPVQELERPLFELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAK  908
             +NPV   E P  EL+ ++Q F+P T+ +IDG+L+EEGI+FKL R+LPQ IEDNI+EFC K
Sbjct  297   ANPVMGKESPFMELNYSVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEDNIEEFCNK  356

Query  909   LMRVAGYSHKDDFNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTI  1088
             LM  AG +   DFN+LFWAVHPGGPAILNRLE KL+L+ EKL  SRRAL DYGN SSNTI
Sbjct  357   LMSKAGLT---DFNELFWAVHPGGPAILNRLESKLKLNEEKLECSRRALMDYGNVSSNTI  413

Query  1089  VYVLEYMLEEKKRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
             VYVLEYM +E KR       +WGL LAFGPGIT EGIL R+L
Sbjct  414   VYVLEYMRDELKRGG----GEWGLALAFGPGITFEGILLRSL  451



>gb|AAZ81870.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   501 bits (1290),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 302/375 (81%), Gaps = 2/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+P KA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANPRKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDEPMEFNDMFWAVHPGGPAI  319

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM EE K++ +A   +WGL LA
Sbjct  320   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREELKKKGDAA-QEWGLGLA  378

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  379   FGPGITFEGLLIRSL  393



>gb|ADF43044.1| chalcone synthase 3 protein [Brassica rapa subsp. rapa]
Length=393

 Score =   501 bits (1289),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 250/377 (66%), Positives = 302/377 (80%), Gaps = 3/377 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+PGKA+++ALGKAFP Q+V QE LV+G+ ++T CDDP +K+KL  LCKTTTVKTRY V+
Sbjct  19    ANPGKATVLALGKAFPSQVVPQEHLVEGFLRDTKCDDPFIKEKLEHLCKTTTVKTRYTVL  78

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR+  +ITH+VYVSS
Sbjct  79    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRTVEDITHIVYVSS  138

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGL+ D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  139   SEIRLPGGDLYLSAKLGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  198

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P+   E P  ELH A+Q FVP T+ 
Sbjct  199   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADPLPS-EAPFMELHYAVQQFVPGTQT  257

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FW VHPGGPAI
Sbjct  258   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMAKAG-DDSIEFNDMFWTVHPGGPAI  316

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL  SRRAL DYGN SSNTI+YV+EYM +E K++ +    +WGL LA
Sbjct  317   LNRLETKLKLGREKLECSRRALVDYGNVSSNTILYVMEYMRDELKKKGDGA-QEWGLGLA  375

Query  1170  FGPGITLEGILTRNLTA  1220
             FGPGIT EG+L R+L +
Sbjct  376   FGPGITFEGLLLRSLAS  392



>emb|CDY18415.1| BnaA04g21720D [Brassica napus]
Length=393

 Score =   501 bits (1289),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 250/377 (66%), Positives = 302/377 (80%), Gaps = 3/377 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+PGKA+++ALGKAFP Q+V QE LV+G+ ++T CDDP +K+KL  LCKTTTVKTRY V+
Sbjct  19    ANPGKATVLALGKAFPSQVVPQEHLVEGFLRDTKCDDPFIKEKLEHLCKTTTVKTRYTVL  78

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR+  +ITH+VYVSS
Sbjct  79    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRTVEDITHIVYVSS  138

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGL+ D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  139   SEIRLPGGDLYLSAKLGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  198

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P+   E P  ELH A+Q FVP T+ 
Sbjct  199   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADPLPS-EAPFMELHYAVQQFVPGTQT  257

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FW VHPGGPAI
Sbjct  258   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMAKAG-DDSIEFNDMFWTVHPGGPAI  316

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL  SRRAL DYGN SSNTI+YV+EYM +E K++ +    +WGL LA
Sbjct  317   LNRLETKLKLGREKLECSRRALVDYGNVSSNTILYVMEYMRDELKKKGDGA-QEWGLGLA  375

Query  1170  FGPGITLEGILTRNLTA  1220
             FGPGIT EG+L R+L +
Sbjct  376   FGPGITFEGLLLRSLAS  392



>ref|XP_009141701.1| PREDICTED: chalcone synthase [Brassica rapa]
Length=393

 Score =   500 bits (1288),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 250/377 (66%), Positives = 302/377 (80%), Gaps = 3/377 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+PGKA+++ALGKAFP Q+V QE LV+G+ ++T CDDP +K+KL  LCKTTTVKTRY V+
Sbjct  19    ANPGKATVLALGKAFPSQVVPQEHLVEGFLRDTKCDDPFIKEKLEHLCKTTTVKTRYTVL  78

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR+  +ITH+VYVSS
Sbjct  79    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRTVEDITHIVYVSS  138

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGL+ D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  139   SEIRLPGGDLYLSAKLGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  198

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P+   E P  ELH A+Q FVP T+ 
Sbjct  199   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADPLPS-EAPFMELHYAVQQFVPGTQT  257

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FW VHPGGPAI
Sbjct  258   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DDSMEFNDMFWTVHPGGPAI  316

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL  SRRAL DYGN SSNTI+YV+EYM +E K++ +    +WGL LA
Sbjct  317   LNRLETKLKLGREKLECSRRALVDYGNVSSNTILYVMEYMRDELKKKGDGA-QEWGLGLA  375

Query  1170  FGPGITLEGILTRNLTA  1220
             FGPGIT EG+L R+L +
Sbjct  376   FGPGITFEGLLLRSLAS  392



>ref|XP_006418482.1| hypothetical protein EUTSA_v10007831mg [Eutrema salsugineum]
 gb|ESQ36835.1| hypothetical protein EUTSA_v10007831mg [Eutrema salsugineum]
Length=395

 Score =   500 bits (1288),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 251/377 (67%), Positives = 305/377 (81%), Gaps = 3/377 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+PGKA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANPGKATVLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPAGDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RESEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+L+EEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLSEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EY+ +E K++ E+   +WGL LA
Sbjct  319   LNRLETKLKLEGEKLESSRRALRDYGNVSSNTILYVMEYVRDELKKKGESA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNLTA  1220
             FGPGIT EG+L R+LT+
Sbjct  378   FGPGITFEGLLIRSLTS  394



>gb|AAZ81871.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   500 bits (1288),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 301/375 (80%), Gaps = 2/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+P KA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANPRKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PPS  RPY LVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPSKARPYGLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDESMEFNDMFWAVHPGGPAI  319

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM EE K++ +A   +WGL LA
Sbjct  320   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREELKKKGDAA-QEWGLGLA  378

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  379   FGPGITFEGLLIRSL  393



>ref|XP_008375736.1| PREDICTED: chalcone synthase [Malus domestica]
Length=398

 Score =   499 bits (1286),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 248/375 (66%), Positives = 299/375 (80%), Gaps = 2/375 (1%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+++ALGKAFP QL+ Q+ LV+GY ++T C+D  +K+KL RLCKTTTVKTRY VMS
Sbjct  25    TPGKATVLALGKAFPSQLIPQDCLVEGYIRDTKCEDAAIKEKLERLCKTTTVKTRYTVMS  84

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL KYPELA EG  T+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSSS
Sbjct  85    KEILDKYPELATEGTATIKQRLEIANPAVVEMALEASLACIKEWGRPVEDITHIVYVSSS  144

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSET
Sbjct  145   EIRLPGGDLYLSSKLGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  204

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGA A++IGSNP+   E P  EL+ A+Q F+P T  +
Sbjct  205   TILGFRPPNKARPYDLVGAALFGDGAAAVIIGSNPIAGQESPFMELNYAVQQFLPGTHNV  264

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+L+EEGI+FKL R+LPQ I++NI+EFC KL  V   +   +FN+LFWAVHPGGPAIL
Sbjct  265   IDGRLSEEGINFKLGRDLPQKIDENIEEFCKKLT-VPAKAELKNFNELFWAVHPGGPAIL  323

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE-KKRESEAEDSDWGLILA  1169
             N++E  L+LS +KL  SRRAL DYGN SSNTI YV+E M EE K ++ E  D +WGL LA
Sbjct  324   NKMESTLKLSSDKLECSRRALMDYGNVSSNTIFYVMENMREELKLKKKEGRDEEWGLALA  383

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EGIL R+L
Sbjct  384   FGPGITFEGILLRSL  398



>gb|AAZ81868.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   499 bits (1284),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 251/375 (67%), Positives = 301/375 (80%), Gaps = 2/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+P KA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANPRKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDASIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KY EL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    SREILDKYSELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDESMEFNDMFWAVHPGGPAI  319

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM EE K++ +A   +WGL LA
Sbjct  320   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREELKKKGDAA-QEWGLGLA  378

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  379   FGPGITFEGLLIRSL  393



>gb|AAZ81873.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   498 bits (1283),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 251/375 (67%), Positives = 300/375 (80%), Gaps = 2/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A P KA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ADPRKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDESMEFNDMFWAVHPGGPAI  319

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DY N SSNTI+YV+EYM EE K++ +A   +WGL LA
Sbjct  320   LNRLETKLKLEKEKLESSRRALVDYENVSSNTILYVMEYMREELKKKGDAA-QEWGLGLA  378

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  379   FGPGITFEGLLIRSL  393



>emb|CDX93339.1| BnaC04g45570D [Brassica napus]
Length=393

 Score =   498 bits (1283),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 250/377 (66%), Positives = 301/377 (80%), Gaps = 3/377 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+PGKA+++ALGKAFP Q+V QE LV+G+ ++T CDDP +K+KL  LCKTTTVKTRY V+
Sbjct  19    ANPGKATVLALGKAFPSQVVPQEHLVEGFLRDTKCDDPFIKEKLEHLCKTTTVKTRYTVL  78

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  79    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  138

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGL+ D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  139   SEIRLPGGDLYLSAKLGLKNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  198

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P+   E P  ELH A+Q FVP T+ 
Sbjct  199   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADPLPS-ESPFMELHYAVQQFVPGTQT  257

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FW VHPGGPAI
Sbjct  258   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DDSMEFNDMFWTVHPGGPAI  316

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL  SRRAL DYGN SSNTI+YV+EYM +E K++ +    +WGL LA
Sbjct  317   LNRLETKLKLGREKLECSRRALVDYGNVSSNTILYVMEYMRDELKKKGDGA-QEWGLGLA  375

Query  1170  FGPGITLEGILTRNLTA  1220
             FGPGIT EG+L R+L +
Sbjct  376   FGPGITFEGLLLRSLAS  392



>ref|NP_171707.1| polyketide synthase A [Arabidopsis thaliana]
 gb|AAC24368.1| Similar to rice chalcone synthase homolog, gp|U90341|2507617 
and anther specific protein, gp|Y14507|2326772 [Arabidopsis 
thaliana]
 gb|ABO09877.1| At1g02050 [Arabidopsis thaliana]
 gb|AEE27371.1| Chalcone and stilbene synthase family protein [Arabidopsis thaliana]
Length=395

 Score =   498 bits (1283),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 250/377 (66%), Positives = 304/377 (81%), Gaps = 3/377 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             + EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    TREILAKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +I+G+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM +E K++ +A   +WGL LA
Sbjct  319   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNLTA  1220
             FGPGIT EG+L R+LT+
Sbjct  378   FGPGITFEGLLIRSLTS  394



>ref|XP_007052226.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
 gb|EOX96383.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
Length=386

 Score =   498 bits (1281),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 247/377 (66%), Positives = 298/377 (79%), Gaps = 6/377 (2%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             + ++ GKA+++A+GKAFP QL+ QE LV+GY ++T C+D  +K+KL RLCKTTTVKTRY 
Sbjct  16    RASTSGKATVLAMGKAFPSQLIPQECLVEGYIRDTKCEDASIKEKLERLCKTTTVKTRYT  75

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VM +EIL KYPELA EG  T+KQRL+I N AV +MA+EAS  CIK+WGR  T+ITH++YV
Sbjct  76    VMCKEILDKYPELATEGSSTIKQRLEIANPAVVEMALEASLACIKEWGRPATDITHIIYV  135

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSE RLPGGDLYLA  LGL+ D  RVMLYF GC GGV GLRVAKDIAENNPGSR+L+ T
Sbjct  136   SSSEIRLPGGDLYLASQLGLKNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRILLTT  195

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P+   E P  EL+ A+Q F+P T
Sbjct  196   SETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGTDPITNSESPFMELNYAVQQFLPGT  255

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             + +IDG+L+EEGI+FKL R+LPQ IEDNI+EFC KL+  A  +   +FN LFWAVHPGGP
Sbjct  256   QNVIDGRLSEEGINFKLGRDLPQKIEDNIEEFCRKLVSKANLT---EFNDLFWAVHPGGP  312

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLI  1163
             AILNRLE  L+L+  KL  SRRAL DYGN SSNTI YV+EYM EE K E   E   WGL 
Sbjct  313   AILNRLENTLKLNNGKLECSRRALMDYGNVSSNTIFYVMEYMREELKAEGGEE---WGLA  369

Query  1164  LAFGPGITLEGILTRNL  1214
             LAFGPGIT EGIL R+L
Sbjct  370   LAFGPGITFEGILLRSL  386



>ref|XP_002276642.1| PREDICTED: chalcone synthase isoform X2 [Vitis vinifera]
Length=389

 Score =   498 bits (1281),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 250/373 (67%), Positives = 297/373 (80%), Gaps = 6/373 (2%)
 Frame = +3

Query  96    PGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSE  275
             PGKA+++A+GKAFP QL+ QE LV+GYF++T C D  +K+KL RLCKTTTVKTRY VMS+
Sbjct  23    PGKATVLAMGKAFPSQLIPQECLVEGYFRDTKCQDLAIKEKLERLCKTTTVKTRYTVMSK  82

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EIL+KYPELA EG PT+KQ+L+I N AV QMA+EAS  CI++WGR   +ITH+VYVSSSE
Sbjct  83    EILEKYPELATEGSPTIKQKLEIANPAVLQMAMEASLACIEEWGRPVGDITHIVYVSSSE  142

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
              RLPGGDLYLA  LGLR D  R+MLYF GC GGV GLRVAKDIAENNPGSRVL+ TSETT
Sbjct  143   IRLPGGDLYLASQLGLRSDVGRIMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  202

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
             I+GF+PP+ +RPYDLVG ALFGDGA A+++G++P+   E P  EL+ A+Q F+P T  +I
Sbjct  203   ILGFRPPNKERPYDLVGAALFGDGAAAVIVGTDPIPGKECPFMELNHAVQQFLPGTHNVI  262

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG+L+EEGI+FKL R+LP  IE+NI+EFC KLM  AG     +FN LFWAVHPGGPAILN
Sbjct  263   DGRLSEEGINFKLGRDLPAKIEENIEEFCKKLMEKAGLV---EFNDLFWAVHPGGPAILN  319

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAFG  1175
             RLE  L+L  EKL  SRRAL DYGN SSNTI YV+EYM E  KR+   E   WGL LAFG
Sbjct  320   RLESTLKLRSEKLECSRRALMDYGNVSSNTIFYVMEYMREALKRKGGEE---WGLALAFG  376

Query  1176  PGITLEGILTRNL  1214
             PGIT EGIL R+L
Sbjct  377   PGITFEGILIRSL  389



>ref|XP_003557301.2| PREDICTED: probable inorganic phosphate transporter 1-3 [Brachypodium 
distachyon]
Length=930

 Score =   516 bits (1329),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 259/391 (66%), Positives = 317/391 (81%), Gaps = 16/391 (4%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++V+G+ +NTNC+DP LK+KLTRLCKTTTVKTRYVVMS
Sbjct  540   NPGKATIVALGHAFPQQLVMQDYVVEGFMRNTNCNDPELKEKLTRLCKTTTVKTRYVVMS  599

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL +YPELA EGLPT+KQRLDI N AVTQMA EAS +CI+ WG + + ITHLVYVSSS
Sbjct  600   DEILGRYPELAQEGLPTMKQRLDISNKAVTQMATEASLSCIRSWGGALSSITHLVYVSSS  659

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             EAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  660   EARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKALAESCPGARVLLATSET  719

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             T+ GF+PPS DRPYDLVGVALFGDGAGA ++ ++P   LERPLFELH+A+Q F+P TEK 
Sbjct  720   TVAGFRPPSPDRPYDLVGVALFGDGAGAAIVCTDPT-PLERPLFELHSALQRFLPGTEKT  778

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVA-----GYSHKD-DFNKLFWAVHP  974
             IDG+LTEEGI F+L RELP IIE ++++FC KL++       G++H    ++ +FWAVHP
Sbjct  779   IDGRLTEEGIKFQLGRELPHIIEAHVEDFCQKLIKERDQGGDGHTHAQLTYDDMFWAVHP  838

Query  975   GGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESE------  1136
             GGPAIL ++E +L L   KL+ASR AL D+GNASSNTIVYVLE M+EE +R  E      
Sbjct  839   GGPAILTKMEGRLGLDGAKLTASRSALRDFGNASSNTIVYVLENMVEESRRRRELQQAAG  898

Query  1137  ---AEDSDWGLILAFGPGITLEGILTRNLTA  1220
                 ++ +WGLILAFGPGIT EGIL RNL A
Sbjct  899   AEGGQECEWGLILAFGPGITFEGILARNLQA  929



>gb|AFN26935.1| polyketide synthase [Hypericum perforatum]
Length=386

 Score =   497 bits (1280),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 246/380 (65%), Positives = 298/380 (78%), Gaps = 6/380 (2%)
 Frame = +3

Query  75    QGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKT  254
             + G+  +PGKA+++A+GKAFP Q V QE LV+ +  +T C D  +K+KL RLC+TTTVKT
Sbjct  11    RNGRAPTPGKATVLAMGKAFPKQHVPQECLVEKFISDTKCTDAAIKEKLERLCETTTVKT  70

Query  255   RYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHL  434
             RY VM +E+L KYPELA+EG PT++QR +I NSAV +MAIEAS  CIK+WGR  +EITH+
Sbjct  71    RYTVMCKEVLDKYPELAVEGSPTIRQRFEIANSAVVEMAIEASHACIKEWGRPISEITHV  130

Query  435   VYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVL  614
             VYVSSSE RLPGGDLYLA  LGLR D +RVMLYF GC GGV GLRVAKDIAENNPGSRVL
Sbjct  131   VYVSSSELRLPGGDLYLASELGLRTDVRRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVL  190

Query  615   VATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFV  794
             + TSETTI+ F+PPS  RPYDLVG ALFGDGA A++IG+NPV   E P  EL+ A Q F+
Sbjct  191   LTTSETTILAFRPPSNARPYDLVGAALFGDGAAAVIIGTNPVAGKESPFMELNYATQQFL  250

Query  795   PDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHP  974
             P T+ I+DG+L EEGI+FKL R+LPQ IEDNI+EFC K+M  AG +    FN LFWAVHP
Sbjct  251   PGTQSIVDGKLHEEGINFKLGRDLPQKIEDNIEEFCKKIMSEAGLTQ---FNDLFWAVHP  307

Query  975   GGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDW  1154
             GGP ILNR+E +L L+ +KL  SRRAL D+GN SSNT++YV+EY+ EE KR+   E   W
Sbjct  308   GGPEILNRVESRLGLNADKLECSRRALMDFGNVSSNTVLYVMEYLREELKRKGSEE---W  364

Query  1155  GLILAFGPGITLEGILTRNL  1214
             GL LAFGPGIT EG+L R+L
Sbjct  365   GLALAFGPGITFEGVLLRSL  384



>ref|XP_009618741.1| PREDICTED: chalcone synthase [Nicotiana tomentosiformis]
Length=395

 Score =   497 bits (1280),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 252/374 (67%), Positives = 296/374 (79%), Gaps = 2/374 (1%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+A+GKAFP QLV Q+ LV+GY ++TNC D  +K+KL RLCKTTTVKTRY VMS
Sbjct  24    TPGKATILAMGKAFPAQLVPQDCLVEGYIRDTNCQDLAIKEKLERLCKTTTVKTRYTVMS  83

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL KYPELA EG PT++QRL+I N AV +MA +AS  CIK+WGRS  EITH+VYVSSS
Sbjct  84    KEILDKYPELATEGTPTIRQRLEIANPAVVEMAKQASQACIKEWGRSAEEITHIVYVSSS  143

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDLYLA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSET
Sbjct  144   EIRLPGGDLYLATELGLRNDIGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  203

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGA A++IG+ P+   E P  EL+ A Q F+P T  +
Sbjct  204   TILGFRPPNNARPYDLVGAALFGDGAAAVIIGTEPIVGKESPFMELNFATQQFLPGTNNV  263

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+LTEEGI+FKL R+LP+ I+DNI+EFC KLM  A    +  +N LFWAVHPGGPAIL
Sbjct  264   IDGRLTEEGINFKLGRDLPEKIQDNIEEFCKKLMAKADL-KETKYNDLFWAVHPGGPAIL  322

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAF  1172
             NRLE  L+L  EKL  SRRAL D+GN SSNTI YV+EYM EE K + + E  +WGL LAF
Sbjct  323   NRLENTLKLQSEKLDCSRRALMDFGNVSSNTIFYVMEYMREELKNKKD-EGEEWGLALAF  381

Query  1173  GPGITLEGILTRNL  1214
             GPGIT EGIL R+L
Sbjct  382   GPGITFEGILLRSL  395



>gb|KDP28845.1| hypothetical protein JCGZ_14616 [Jatropha curcas]
Length=392

 Score =   497 bits (1279),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 252/372 (68%), Positives = 297/372 (80%), Gaps = 6/372 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEE  278
             GKA+I+A+GKAFP QL+ Q+ LV+GY ++T CDD  +K+KL RLCKTTTVK RY VMS+E
Sbjct  27    GKATILAIGKAFPKQLIPQDCLVEGYIRDTKCDDVSIKEKLERLCKTTTVKKRYTVMSKE  86

Query  279   ILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSEA  458
             IL+KYPELA EG PT+KQRL+I N AV +MA EAS  CIK+WGR   +ITH+VYVSSSE 
Sbjct  87    ILEKYPELATEGTPTIKQRLEIANPAVVEMAKEASLACIKEWGRPVEDITHIVYVSSSEI  146

Query  459   RLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETTI  638
             RLPGGDL+LA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSETTI
Sbjct  147   RLPGGDLHLATQLGLRSDVSRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  206

Query  639   IGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKIID  818
             +GF+PP+  RPYDLVG ALFGDGA A++IG+NPV + E P  EL+ A+Q  +P T+ +ID
Sbjct  207   LGFRPPNKARPYDLVGAALFGDGAAAVIIGANPVIDKESPFLELNYAVQQSLPGTQNVID  266

Query  819   GQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILNR  998
             G L+EEGI+FKL R+LPQ IEDNI+EFC KLM  AG +   +FN LFWAVHPGGPAILNR
Sbjct  267   GCLSEEGINFKLGRDLPQRIEDNIEEFCKKLMSKAGLT---EFNDLFWAVHPGGPAILNR  323

Query  999   lekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAFGP  1178
             LE  L+L+ EKL  SRRAL DYGN SSNT+ YV++YM EE KR+   E   WGL LAFGP
Sbjct  324   LESTLKLNTEKLECSRRALMDYGNVSSNTVFYVIDYMREEMKRDGGEE---WGLALAFGP  380

Query  1179  GITLEGILTRNL  1214
             GIT EGIL R+L
Sbjct  381   GITFEGILLRSL  392



>emb|CDP09465.1| unnamed protein product [Coffea canephora]
Length=382

 Score =   496 bits (1278),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 250/374 (67%), Positives = 295/374 (79%), Gaps = 6/374 (2%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+++++GKAFP Q+V Q+ LV+GY ++T C DP +K+KL RLCKTTTVKTRY VMS
Sbjct  15    TPGKATVLSIGKAFPRQVVPQDCLVEGYVRDTKCVDPAIKEKLERLCKTTTVKTRYTVMS  74

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
              EIL +YPEL  EG PT+KQRL+I N AV +MA EAS  CIK+WGR   +ITH+VYVSSS
Sbjct  75    REILDQYPELTTEGSPTIKQRLEIANPAVVEMAKEASLACIKEWGRPADDITHVVYVSSS  134

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDLYLA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ATSET
Sbjct  135   EIRLPGGDLYLATELGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLATSET  194

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PPS  RPYDLVG ALFGDGA A++IG++P+   E P  EL+ A+Q F+P T  +
Sbjct  195   TILGFRPPSKARPYDLVGAALFGDGAAAVIIGADPIIGTESPFMELNYAVQQFLPGTNNV  254

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+L+EEGI+F+L R+LPQ IEDNI+ FC KLM  AG     DFN LFWAVHPGGPAIL
Sbjct  255   IDGRLSEEGINFRLGRDLPQKIEDNIEAFCKKLMAKAGLG---DFNDLFWAVHPGGPAIL  311

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAF  1172
             NRLE  L+L P KL  SRR L D+GN SSNTI+YV+EYM EE ++E   E   WGL LAF
Sbjct  312   NRLESTLKLKPGKLECSRRTLMDFGNVSSNTILYVMEYMREELQKEGGEE---WGLALAF  368

Query  1173  GPGITLEGILTRNL  1214
             GPGIT EGIL R+L
Sbjct  369   GPGITFEGILVRSL  382



>gb|KHF97528.1| Chalcone synthase 9 [Gossypium arboreum]
Length=386

 Score =   496 bits (1278),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 246/377 (65%), Positives = 297/377 (79%), Gaps = 6/377 (2%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             + ++PGKA+++A+GKAFP QL+ QE+LV+GY ++TNC D  +K+KL RLCKTTTVKTRY 
Sbjct  16    RASTPGKATVLAIGKAFPRQLIPQEYLVEGYIRDTNCQDVSIKEKLERLCKTTTVKTRYT  75

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VM +EIL +YPELA EG  T++QRL+I N AV +MA EAS  CI++WGR  T+ITH++YV
Sbjct  76    VMCKEILDQYPELATEGSSTIRQRLEIANPAVVEMAFEASLACIEEWGRPATDITHIIYV  135

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSE RLPGGDLYLA  LGLR D  RVMLYF GC GG  GLRVAKDIAENNPGSR+L+ T
Sbjct  136   SSSEIRLPGGDLYLASELGLRNDVSRVMLYFLGCYGGATGLRVAKDIAENNPGSRILLTT  195

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P+   E P  EL  A+Q F+P T
Sbjct  196   SETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGTDPITGKESPFMELSYAVQQFLPGT  255

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             + +IDG LTEEGI+FKL R+LPQ IEDNI+EFC KLM  A  +   DFN++FWAVHPGGP
Sbjct  256   QSVIDGCLTEEGINFKLGRDLPQKIEDNIEEFCRKLMSKASLT---DFNEMFWAVHPGGP  312

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLI  1163
             AILNRLE  L+L+  KL  SR+AL D+GN SSNTI YV+EYM EE KR    E   WGL 
Sbjct  313   AILNRLESTLKLNKGKLECSRKALKDFGNVSSNTIFYVMEYMREELKRGGGEE---WGLA  369

Query  1164  LAFGPGITLEGILTRNL  1214
             LAFGPGIT EGIL R+L
Sbjct  370   LAFGPGITFEGILLRSL  386



>ref|XP_010540240.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540242.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540243.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540244.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540245.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540246.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540247.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540248.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540249.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
Length=393

 Score =   497 bits (1279),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 253/384 (66%), Positives = 300/384 (78%), Gaps = 6/384 (2%)
 Frame = +3

Query  75    QGGKK-ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVK  251
             Q G++ A+PGKA++MALGKAFP Q+V QE LV+GY ++T CDD  +K+KL  LCKTTTVK
Sbjct  12    QSGRRVANPGKATVMALGKAFPSQVVPQENLVEGYLRDTKCDDSFIKEKLQHLCKTTTVK  71

Query  252   TRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITH  431
             TRY VMS E+L KYPEL  EG PT++QRLDI N AV +MA EAS  CI +WGR   +ITH
Sbjct  72    TRYTVMSREVLDKYPELTTEGSPTIRQRLDIANEAVVKMAFEASLACINEWGRPVEDITH  131

Query  432   LVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRV  611
             +VYVSSSE  LPGGDL+L+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRV
Sbjct  132   VVYVSSSEICLPGGDLHLSAQLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRV  191

Query  612   LVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHF  791
             L+ TSETTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P  E E P  ELH A+Q F
Sbjct  192   LLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADPT-ESETPFMELHYAVQQF  250

Query  792   VPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVH  971
             +P T+ +IDG+LTEEGI+FKL R+LPQ IEDNI+EFC KL   AG     + N +FWAVH
Sbjct  251   LPGTQNVIDGRLTEEGINFKLGRDLPQKIEDNIEEFCRKLKGKAG-GEALELNDMFWAVH  309

Query  972   PGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYM---LEEKKRESEAE  1142
             PGGPAILNRLE K++L P KL  SRRAL DYGN SSNTI YV+EY+   L +K  + EAE
Sbjct  310   PGGPAILNRLETKMKLKPGKLECSRRALMDYGNVSSNTIFYVMEYVRDDLRKKAIQGEAE  369

Query  1143  DSDWGLILAFGPGITLEGILTRNL  1214
             D +WGL LAFGPGIT EG+L R+L
Sbjct  370   DEEWGLALAFGPGITFEGVLMRSL  393



>emb|CBI16627.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   498 bits (1281),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 250/373 (67%), Positives = 297/373 (80%), Gaps = 6/373 (2%)
 Frame = +3

Query  96    PGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSE  275
             PGKA+++A+GKAFP QL+ QE LV+GYF++T C D  +K+KL RLCKTTTVKTRY VMS+
Sbjct  23    PGKATVLAMGKAFPSQLIPQECLVEGYFRDTKCQDLAIKEKLERLCKTTTVKTRYTVMSK  82

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EIL+KYPELA EG PT+KQ+L+I N AV QMA+EAS  CI++WGR   +ITH+VYVSSSE
Sbjct  83    EILEKYPELATEGSPTIKQKLEIANPAVLQMAMEASLACIEEWGRPVGDITHIVYVSSSE  142

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
              RLPGGDLYLA  LGLR D  R+MLYF GC GGV GLRVAKDIAENNPGSRVL+ TSETT
Sbjct  143   IRLPGGDLYLASQLGLRSDVGRIMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  202

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
             I+GF+PP+ +RPYDLVG ALFGDGA A+++G++P+   E P  EL+ A+Q F+P T  +I
Sbjct  203   ILGFRPPNKERPYDLVGAALFGDGAAAVIVGTDPIPGKECPFMELNHAVQQFLPGTHNVI  262

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG+L+EEGI+FKL R+LP  IE+NI+EFC KLM  AG     +FN LFWAVHPGGPAILN
Sbjct  263   DGRLSEEGINFKLGRDLPAKIEENIEEFCKKLMEKAGLV---EFNDLFWAVHPGGPAILN  319

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAFG  1175
             RLE  L+L  EKL  SRRAL DYGN SSNTI YV+EYM E  KR+   E   WGL LAFG
Sbjct  320   RLESTLKLRSEKLECSRRALMDYGNVSSNTIFYVMEYMREALKRKGGEE---WGLALAFG  376

Query  1176  PGITLEGILTRNL  1214
             PGIT EGIL R+L
Sbjct  377   PGITFEGILIRSL  389



>gb|AAY96720.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96722.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96724.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96727.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96733.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96734.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96737.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96738.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96740.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   496 bits (1278),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 250/375 (67%), Positives = 302/375 (81%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             + EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    TREILAKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM +E K++ +A   +WGL LA
Sbjct  319   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  378   FGPGITFEGLLIRSL  392



>gb|AEE69028.1| polyketide synthase [Hypericum perforatum]
Length=386

 Score =   496 bits (1278),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 246/380 (65%), Positives = 297/380 (78%), Gaps = 6/380 (2%)
 Frame = +3

Query  75    QGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKT  254
             + G+  +PGKA+++A+GKAFP Q V QE LVD +  +T C D  +K+KL RLC+TTTVKT
Sbjct  11    RNGRAPTPGKATVLAMGKAFPKQHVPQECLVDKFISDTKCTDAAIKEKLERLCETTTVKT  70

Query  255   RYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHL  434
             RY VM +E+L KYPELA+EG PT++QR +I NSAV +MA+EAS  CIK+WGR  +EITH+
Sbjct  71    RYTVMCKEVLDKYPELAVEGSPTIRQRFEIANSAVVEMALEASHACIKEWGRPISEITHV  130

Query  435   VYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVL  614
             VYVSSSE RLPGGDLYLA  LGLR D +RVMLYF GC GGV GLRVAKDIAENNPGSRVL
Sbjct  131   VYVSSSELRLPGGDLYLASELGLRTDVRRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVL  190

Query  615   VATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFV  794
             + TSETTI+ F+PPS  RPYDLVG ALFGDGA A++IG+NPV   E P  EL+ A Q F+
Sbjct  191   LTTSETTILAFRPPSNARPYDLVGAALFGDGAAAVIIGANPVAGKESPFMELNYATQQFL  250

Query  795   PDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHP  974
             P T+ I+DG+L EEGI+FKL R+LPQ IEDNI+EFC K+M  AG +    FN LFWAVHP
Sbjct  251   PGTQSIVDGKLHEEGINFKLGRDLPQKIEDNIEEFCKKIMSEAGLTQ---FNDLFWAVHP  307

Query  975   GGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDW  1154
             GGP ILNR+E +L L+ +KL  SRRAL D+GN SSNT+ YV+EY+ EE KR+   E   W
Sbjct  308   GGPEILNRVESRLGLNADKLECSRRALMDFGNVSSNTVFYVMEYLREELKRKGSEE---W  364

Query  1155  GLILAFGPGITLEGILTRNL  1214
             GL LAFGPGIT EG+L R+L
Sbjct  365   GLALAFGPGITFEGVLLRSL  384



>gb|AAY96723.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   496 bits (1278),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 250/375 (67%), Positives = 302/375 (81%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             + EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    TREILAKYPELTAEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM +E K++ +A   +WGL LA
Sbjct  319   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  378   FGPGITFEGLLIRSL  392



>gb|ABP98922.1| polyketide synthase [Hypericum perforatum]
Length=386

 Score =   496 bits (1277),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 246/380 (65%), Positives = 296/380 (78%), Gaps = 6/380 (2%)
 Frame = +3

Query  75    QGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKT  254
             + G   +PGKA+++A+GKAFP Q V QE LV+ +  +T C D  +K+KL RLC+TTTVKT
Sbjct  11    RNGHAPTPGKATVLAMGKAFPKQHVPQECLVEKFISDTKCTDAAIKEKLERLCETTTVKT  70

Query  255   RYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHL  434
             RY VM +E+L KYPELA+EG PT++QR +I NSAV +MAIEAS  CIK+WGR  +EITH+
Sbjct  71    RYTVMCKEVLDKYPELAVEGSPTIRQRFEIANSAVVEMAIEASHACIKEWGRPISEITHV  130

Query  435   VYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVL  614
             VYVSSSE RLPGGDLYLA  LGLR D +RVMLYF GC GGV GLRVAKDIAENNPGSRVL
Sbjct  131   VYVSSSELRLPGGDLYLASELGLRTDVRRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVL  190

Query  615   VATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFV  794
             + TSETTI+ F+PPS  RPYDLVG ALFGDGA A++IG+NPV   E P  EL+ A Q F+
Sbjct  191   LTTSETTILAFRPPSTARPYDLVGAALFGDGAAAVIIGTNPVTGKESPFMELNYATQQFL  250

Query  795   PDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHP  974
             P T+ I+DG+L EEGI+FKL R+LPQ IEDNI+EFC K+M  AG +    FN LFWAVHP
Sbjct  251   PGTQSIVDGKLHEEGINFKLGRDLPQKIEDNIEEFCKKIMSEAGLTQ---FNDLFWAVHP  307

Query  975   GGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDW  1154
             GGP ILNR+E +L L+ +KL  SRRAL D+GN SSNT+ YV+EY+ EE KR+   E   W
Sbjct  308   GGPEILNRVESRLGLNADKLECSRRALVDFGNVSSNTVFYVMEYLREELKRKGSEE---W  364

Query  1155  GLILAFGPGITLEGILTRNL  1214
             GL LAFGPGIT EG+L R+L
Sbjct  365   GLALAFGPGITFEGVLLRSL  384



>ref|XP_006445367.1| hypothetical protein CICLE_v10020530mg [Citrus clementina]
 ref|XP_006464463.1| PREDICTED: stilbene synthase 3-like [Citrus sinensis]
 gb|ESR58607.1| hypothetical protein CICLE_v10020530mg [Citrus clementina]
 gb|KDO85610.1| hypothetical protein CISIN_1g016361mg [Citrus sinensis]
Length=390

 Score =   496 bits (1276),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 248/378 (66%), Positives = 298/378 (79%), Gaps = 7/378 (2%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             +  +PGKA+++A+GKAFP QL+ QE LV+GY ++T C+D  +K+KL RLCKTTTVKTRY 
Sbjct  19    RTPTPGKATVLAIGKAFPSQLIPQECLVEGYLRDTKCEDESIKEKLERLCKTTTVKTRYT  78

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMS+ IL KYPEL  EG  T+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYV
Sbjct  79    VMSKAILDKYPELTTEGSATIKQRLEIANPAVVEMALEASLACIKEWGRPAEDITHIVYV  138

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ T
Sbjct  139   SSSEIRLPGGDLYLSSKLGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTT  198

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELE-RPLFELHTAIQHFVPD  800
             SETTI+GF+PP+  RPYDLVG ALFGDGA A+++G++P  + E  P  EL+ A+Q F+P 
Sbjct  199   SETTILGFRPPNKSRPYDLVGAALFGDGAAAVIVGADPFLDKESSPFMELNYAVQQFLPG  258

Query  801   TEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGG  980
             T+ +IDG+L+EEGI+FKL R+LPQ IE+NI+EFC KLM  AG     DFN LFWAVHPGG
Sbjct  259   TQNVIDGRLSEEGINFKLGRDLPQKIEENIEEFCKKLMAKAGLQ---DFNDLFWAVHPGG  315

Query  981   PAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGL  1160
             PAILNRLE  L+L+ +KL  SRRAL DYGN SSNTI YV++YM EE KR+    D +WGL
Sbjct  316   PAILNRLESNLKLNNQKLECSRRALMDYGNVSSNTIFYVMDYMREELKRKG---DEEWGL  372

Query  1161  ILAFGPGITLEGILTRNL  1214
              LAFGPGIT EGIL R L
Sbjct  373   ALAFGPGITFEGILLRGL  390



>ref|XP_009785374.1| PREDICTED: chalcone synthase [Nicotiana sylvestris]
Length=395

 Score =   496 bits (1276),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 251/374 (67%), Positives = 295/374 (79%), Gaps = 2/374 (1%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+A+GKAFP QLV Q+ LV+GY ++TNC D  +K+KL RLCKTTTVKTRY VMS
Sbjct  24    TPGKATILAMGKAFPAQLVPQDCLVEGYIRDTNCQDLAIKEKLERLCKTTTVKTRYTVMS  83

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL KYPELA EG PT+KQRL+I N AV +MA +AS  CIK+WGRS  EITH+VYVSSS
Sbjct  84    KEILDKYPELATEGTPTIKQRLEIANPAVVEMAKQASQACIKEWGRSAEEITHIVYVSSS  143

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDLYLA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSET
Sbjct  144   EIRLPGGDLYLATELGLRNDIGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  203

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGA A++IG+ P+   E P  EL+ A Q F+P T  +
Sbjct  204   TILGFRPPNNARPYDLVGAALFGDGAAAVIIGTEPIMGKESPFMELNFATQQFLPGTNNV  263

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+LTEEGI+FKL R+LP+ I+DNI+EFC K++  A    +  +N LFWAVHPGGPAIL
Sbjct  264   IDGRLTEEGINFKLGRDLPEKIQDNIEEFCKKIIAKADL-REAKYNDLFWAVHPGGPAIL  322

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAF  1172
             NRLE  L+L  EKL  SRRAL DYGN SSNTI YV+EYM EE K +    + +WGL LAF
Sbjct  323   NRLENTLKLQSEKLDCSRRALMDYGNVSSNTIFYVMEYMREELKNKKNGGE-EWGLALAF  381

Query  1173  GPGITLEGILTRNL  1214
             GPGIT EGIL R+L
Sbjct  382   GPGITFEGILLRSL  395



>gb|AAY96741.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   496 bits (1276),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 249/375 (66%), Positives = 302/375 (81%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K++L  LCKTTTVKTRY V+
Sbjct  21    ANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKERLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             + EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    TREILAKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM +E K++ +A   +WGL LA
Sbjct  319   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  378   FGPGITFEGLLIRSL  392



>gb|AAY96721.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   495 bits (1275),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 249/375 (66%), Positives = 302/375 (81%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             + EIL KYPE+  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    TREILAKYPEITTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM +E K++ +A   +WGL LA
Sbjct  319   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  378   FGPGITFEGLLIRSL  392



>ref|XP_003516799.1| PREDICTED: chalcone synthase-like [Glycine max]
 gb|KHN22950.1| Chalcone synthase 9 [Glycine soja]
Length=388

 Score =   495 bits (1275),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 250/374 (67%), Positives = 294/374 (79%), Gaps = 7/374 (2%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+A+GKAFP Q++ QE LV+GY ++T C+D  +K+KL RLCK TTVKTRY VMS
Sbjct  22    TPGKATILAIGKAFPSQIIPQECLVEGYIRDTKCEDAYIKEKLERLCKNTTVKTRYTVMS  81

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL KYPELA EG PT++Q+L+I N AV +MA +AS  CIK+WGR   +ITH+VYVSSS
Sbjct  82    KEILDKYPELATEGSPTIRQKLEIANPAVVEMATKASLCCIKEWGRPAQDITHIVYVSSS  141

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDLYLA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSET
Sbjct  142   EIRLPGGDLYLANELGLRSDVSRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  201

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGA A++IG+NPV   E P  EL  A+Q F+ DT  +
Sbjct  202   TILGFRPPNKARPYDLVGAALFGDGAAAVIIGANPVMGQESPFMELSYAVQKFLLDTHNV  261

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+L+EEGI+FKL R+LPQ IEDNI+EFC KLM     S   DFN LFWAVHPGGPAIL
Sbjct  262   IDGRLSEEGINFKLGRDLPQKIEDNIEEFCRKLM---AKSSAKDFNDLFWAVHPGGPAIL  318

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAF  1172
             NRLE  L+LS +KL  SR+AL DYGN SSNTI YV+EYM E  K + E    +WGL LAF
Sbjct  319   NRLESTLKLSNDKLECSRKALMDYGNVSSNTIFYVMEYMREYLKEDGE----EWGLGLAF  374

Query  1173  GPGITLEGILTRNL  1214
             GPGIT EGIL R+L
Sbjct  375   GPGITFEGILLRSL  388



>gb|AAZ81861.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   495 bits (1275),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 250/375 (67%), Positives = 300/375 (80%), Gaps = 2/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+P KA+++ALGKAFP Q+V QE LV+G+ ++T C+D  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANPRKATLLALGKAFPSQVVPQENLVEGFLRDTKCEDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  E  PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    SREILDKYPELTTESSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++I ++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIRADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDESMEFNDMFWAVHPGGPAI  319

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KLEL  EKL +SRRAL DYGN SSNTI+YV+EYM EE K++ +A   +WGL LA
Sbjct  320   LNRLETKLELEKEKLESSRRALVDYGNVSSNTIMYVMEYMREELKKKGDAA-QEWGLGLA  378

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  379   FGPGITFEGLLIRSL  393



>gb|AGO05924.1| anther-specific protein [Capsicum annuum]
Length=396

 Score =   495 bits (1275),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 245/374 (66%), Positives = 298/374 (80%), Gaps = 1/374 (0%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+A+GKAFP QLV Q+ LV+GY ++TNC D  +K+KL RLCKTTTVKTRY VMS
Sbjct  24    TPGKATILAMGKAFPSQLVPQDCLVEGYMRDTNCQDMAIKEKLERLCKTTTVKTRYTVMS  83

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL KYPELA+EG PT+ QRL+I N AV +MA +AS  CIK+WGRS  EITH+VYVSSS
Sbjct  84    KEILDKYPELAVEGTPTINQRLEIANPAVVEMAKQASLACIKEWGRSTDEITHIVYVSSS  143

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDL+LA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSET
Sbjct  144   EIRLPGGDLHLATELGLRSDIGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  203

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGAGA+++G+ P+   E P  EL+ A+Q F+P T+ +
Sbjct  204   TILGFRPPNNARPYDLVGAALFGDGAGAVIVGTEPIVGTESPFMELNFALQQFLPGTKNV  263

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+LTEEGI+FKL R+LP+ I+DNI+EFC KL+       +  +N LFWAVHPGGPAIL
Sbjct  264   IDGRLTEEGINFKLGRDLPEKIQDNIEEFCKKLIEKGDQLKETKYNDLFWAVHPGGPAIL  323

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAF  1172
             +RLE+ L+L   KL  SRRAL DYGN SSNTI YV+EYM +E + + +  + +WGL LAF
Sbjct  324   DRLERTLKLQSGKLDCSRRALMDYGNVSSNTIFYVIEYMRQELQNKKDGGE-EWGLALAF  382

Query  1173  GPGITLEGILTRNL  1214
             GPGIT EGIL R+L
Sbjct  383   GPGITFEGILLRSL  396



>gb|AAZ81862.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ81865.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ81866.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   495 bits (1274),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 250/375 (67%), Positives = 302/375 (81%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++A GKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANAGKATLLAPGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             + EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    TREILAKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM +E K++ +A   +WGL LA
Sbjct  319   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNL  1214
             FGPGITLEG+L R+L
Sbjct  378   FGPGITLEGLLIRSL  392



>gb|AAY96729.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96742.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96743.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   495 bits (1274),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 249/375 (66%), Positives = 302/375 (81%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             + EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    TREILAKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +I+G+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM +E K++ +A   +WGL LA
Sbjct  319   LNRLEAKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  378   FGPGITFEGLLIRSL  392



>gb|AAY96717.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96718.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96726.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96730.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96731.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96732.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96735.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96736.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96739.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96744.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96747.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   495 bits (1274),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 249/375 (66%), Positives = 302/375 (81%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             + EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    TREILAKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +I+G+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM +E K++ +A   +WGL LA
Sbjct  319   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  378   FGPGITFEGLLIRSL  392



>ref|XP_003607498.1| Chalcone synthase [Medicago truncatula]
 gb|AES89695.1| chalcone synthase family protein, putative [Medicago truncatula]
Length=389

 Score =   494 bits (1273),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 245/373 (66%), Positives = 300/373 (80%), Gaps = 6/373 (2%)
 Frame = +3

Query  96    PGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSE  275
             PGKA+I+ALGKAFP Q++ QE LV+GY ++T C+D  +K+KLTRLCK TTVKTRY VMS+
Sbjct  23    PGKATILALGKAFPSQVLPQECLVEGYIRDTKCEDDYVKEKLTRLCKNTTVKTRYTVMSK  82

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EIL +YPEL IEG PT++Q+L+I N AV +MA  AS  CI++WGRSP EITH+VYVSSSE
Sbjct  83    EILDEYPELFIEGTPTIRQKLEIANPAVVEMATRASKACIEEWGRSPEEITHIVYVSSSE  142

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
              RLPGGDLYLA  LGL+ D  RVMLYF GC GGV+GLRVAKDIAENNPGSRVL+ TSETT
Sbjct  143   IRLPGGDLYLANELGLKSDVNRVMLYFLGCYGGVSGLRVAKDIAENNPGSRVLLTTSETT  202

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
             I+GF+PP+  RPYDLVG ALFGDGA A +IG+NP+   ERP  EL+ A+Q F+P+T+ +I
Sbjct  203   ILGFRPPNKARPYDLVGAALFGDGAAAAIIGTNPLPNQERPFMELNYAVQQFLPNTQNVI  262

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG++TEEGI+FKL R+LPQ IEDNI+EFC KLM  +G     +FN++FWAVHPGGPAILN
Sbjct  263   DGRITEEGINFKLGRDLPQKIEDNIEEFCKKLMAKSGVK---EFNEMFWAVHPGGPAILN  319

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAFG  1175
             +LE  L+LS +KL  SR+AL ++GN SSNTI YV+EYM +  K +   E   WGL LAFG
Sbjct  320   KLENTLKLSGDKLECSRKALMNFGNVSSNTIFYVMEYMRDYLKNDGTEE---WGLGLAFG  376

Query  1176  PGITLEGILTRNL  1214
             PGIT EG+L R+L
Sbjct  377   PGITFEGVLLRSL  389



>gb|AAY96719.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   494 bits (1273),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 249/375 (66%), Positives = 302/375 (81%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             + EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    TREILAKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQD  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +I+G+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM +E K++ +A   +WGL LA
Sbjct  319   LNRLEAKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  378   FGPGITFEGLLIRSL  392



>gb|AAY96725.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   494 bits (1272),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 249/375 (66%), Positives = 302/375 (81%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             + EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    TREILAKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +I+G+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDGSM-EFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM +E K++ +A   +WGL LA
Sbjct  319   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  378   FGPGITFEGLLIRSL  392



>gb|AAY96728.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   493 bits (1270),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 248/375 (66%), Positives = 302/375 (81%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ G+A+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANAGRATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             + EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +IT++VYVSS
Sbjct  81    TREILAKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITYIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM +E K++ +A   +WGL LA
Sbjct  319   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  378   FGPGITFEGLLIRSL  392



>gb|AAY96746.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   493 bits (1268),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 249/375 (66%), Positives = 301/375 (80%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++A GKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANAGKATLLAPGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             + EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    TREILAKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ T E
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTPE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM +E K++ +A   +WGL LA
Sbjct  319   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNL  1214
             FGPGITLEG+L R+L
Sbjct  378   FGPGITLEGLLIRSL  392



>gb|AAY96745.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   493 bits (1268),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 248/375 (66%), Positives = 301/375 (80%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             + EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    TREILAKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +I+G+LT EGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIEGRLTAEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM +E K++ +A   +WGL LA
Sbjct  319   LNRLEAKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  378   FGPGITFEGLLIRSL  392



>ref|XP_004492184.1| PREDICTED: chalcone synthase-like [Cicer arietinum]
Length=389

 Score =   493 bits (1268),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 252/384 (66%), Positives = 297/384 (77%), Gaps = 10/384 (3%)
 Frame = +3

Query  75    QGGKKAS----PGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTT  242
             Q G +A     PGKA+I+ALGKAFP Q++ QE LV+GY ++T C D  +K+KL RLCK T
Sbjct  12    QNGARARRAPVPGKATILALGKAFPSQVLPQECLVEGYIRDTKCADSSIKEKLERLCKNT  71

Query  243   TVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTE  422
             TVKTRY VMS+EIL KYPELAIEG PT++Q+L+I N AV +MA  AS  CIK+WGR   E
Sbjct  72    TVKTRYTVMSKEILDKYPELAIEGTPTIRQKLEIANPAVVEMATRASKACIKEWGRPVEE  131

Query  423   ITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPG  602
             ITH+VYVSSSE RLPGGDLYLA  LGL+ D  RVMLYF GC GGV GLRVAKDIAENNPG
Sbjct  132   ITHMVYVSSSEIRLPGGDLYLANELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPG  191

Query  603   SRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAI  782
             SRVL+ TSETTI+GF+PP+  RPYDLVG ALFGDGA A +IG+NP+   E P  EL+ A+
Sbjct  192   SRVLLTTSETTILGFRPPNISRPYDLVGAALFGDGAAAAIIGTNPLLNHESPFIELNYAV  251

Query  783   QHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFW  962
             Q F+PDT+ +IDG+++EEGI+FKL R+LPQ IEDNI+EFC KLM         DFN+LFW
Sbjct  252   QKFLPDTQNVIDGRISEEGINFKLGRDLPQKIEDNIEEFCNKLM---AKCDVKDFNELFW  308

Query  963   AVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAE  1142
             AVHPGGPAILN+LE  L+LS +KL  SR+AL DYGN SSNTI YV+EYM E  K +   E
Sbjct  309   AVHPGGPAILNKLETILKLSGDKLECSRKALMDYGNVSSNTIFYVMEYMREYLKEDGREE  368

Query  1143  DSDWGLILAFGPGITLEGILTRNL  1214
                WGL LAFGPGIT EGIL R+L
Sbjct  369   ---WGLGLAFGPGITFEGILLRSL  389



>gb|AAY96748.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   490 bits (1261),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 247/375 (66%), Positives = 300/375 (80%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             + EIL KYPEL  EG PT+KQRL+I N AV +MA+EA   CIK+WGR   +ITH+VYVSS
Sbjct  81    TREILAKYPELTTEGSPTIKQRLEIANEAVVEMALEAGLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+ P+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRQPNKARPYDLVGAALFGDGAAAVIIGADP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +I+G+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAG-DESMEFNDMFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM +E K++ +A   +WGL LA
Sbjct  319   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAA-QEWGLGLA  377

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  378   FGPGITFEGLLIRSL  392



>ref|XP_009401221.1| PREDICTED: chalcone synthase [Musa acuminata subsp. malaccensis]
Length=361

 Score =   489 bits (1258),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 243/359 (68%), Positives = 298/359 (83%), Gaps = 4/359 (1%)
 Frame = +3

Query  150   MQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVK  329
             MQ+ LVDGYF+NTNC DP LK+KLTRLCKTTTVKTRY+VM +EIL+ +PELA +G PT++
Sbjct  1     MQDLLVDGYFRNTNCTDPDLKKKLTRLCKTTTVKTRYLVMCDEILENHPELARDGQPTLR  60

Query  330   QRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRP  509
             QRL+I + AVT+MAIEAS +C+K WGR    ITHLVYVSSSEAR P GDL+LA+ L L P
Sbjct  61    QRLEISHEAVTEMAIEASRSCVKAWGRPFAAITHLVYVSSSEARFPSGDLHLARALRLNP  120

Query  510   DTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETTIIGFKPPSADRPYDLVGV  689
             D  RVM+ F+GCSGGVAGLRVAKDIAENNPGSRVL+ATSETTI+GF+PP+  RPYDLVG 
Sbjct  121   DVSRVMISFAGCSGGVAGLRVAKDIAENNPGSRVLLATSETTIVGFRPPNPHRPYDLVGA  180

Query  690   ALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELP  869
             ALFGDGAGA+V+G++P+   E P+FEL +AIQ ++PDT+K I G+LTEEGISF L RELP
Sbjct  181   ALFGDGAGAVVLGTDPIPGTETPMFELSSAIQQYLPDTDKTIQGELTEEGISFLLGRELP  240

Query  870   QIIEDNIDEFCAKLMR--VAGYSHKDDFNKLFWAVHPGGPAILNRlekklelspeklsas  1043
              +IED+++ FC KL    + G SH  ++N +FWA+HPGGPAILN++E +L L P+KL+AS
Sbjct  241   LVIEDHVEAFCKKLAMEGLRGESHDVNYNDMFWAMHPGGPAILNKVESRLRLCPDKLNAS  300

Query  1044  RRALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
             R+AL D+GNASSNTI+YVLE ++EE  KK+ES   D +WGLILAFGPGIT EGIL RNL
Sbjct  301   RQALRDFGNASSNTIIYVLENIIEESRKKKESGESDCEWGLILAFGPGITFEGILARNL  359



>ref|XP_007140778.1| hypothetical protein PHAVU_008G141200g [Phaseolus vulgaris]
 gb|ESW12772.1| hypothetical protein PHAVU_008G141200g [Phaseolus vulgaris]
Length=391

 Score =   489 bits (1258),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 247/374 (66%), Positives = 294/374 (79%), Gaps = 7/374 (2%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+A+GKAFP Q++ QE LV+GY ++T C D  +K+KL RLCK TTVKTRY VMS
Sbjct  25    TPGKATILAIGKAFPSQIIPQECLVEGYIRDTKCVDAYIKEKLERLCKNTTVKTRYTVMS  84

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL KYPELA EG PT+KQ+L+I N AV +MA +AS  CIK+WGR   +ITH+VYVSSS
Sbjct  85    KEILDKYPELATEGSPTIKQKLEIANPAVVEMATKASLCCIKEWGRPAEDITHIVYVSSS  144

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDLYLA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVLV TSET
Sbjct  145   EIRLPGGDLYLANELGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLVTTSET  204

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGA A+++G+NP+   E P  EL  A+Q F+PDT  +
Sbjct  205   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPMVGQESPFMELSYAVQKFLPDTHSV  264

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+L+EEGI+FKL R+LPQ IE+NI++FC KLM     S   +FN LFWAVHPGGPAIL
Sbjct  265   IDGRLSEEGINFKLGRDLPQKIEENIEDFCRKLM---AKSSVKEFNDLFWAVHPGGPAIL  321

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAF  1172
             N+LE  L+LS +KL  SR+AL DYGN SSNTI YV+EYM E  K + E    +WGL LAF
Sbjct  322   NKLESSLKLSTDKLECSRKALMDYGNVSSNTIFYVMEYMREYLKDDGE----EWGLGLAF  377

Query  1173  GPGITLEGILTRNL  1214
             GPGIT EGIL R+L
Sbjct  378   GPGITFEGILLRSL  391



>ref|XP_010258840.1| PREDICTED: chalcone synthase-like [Nelumbo nucifera]
Length=401

 Score =   489 bits (1259),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 247/373 (66%), Positives = 293/373 (79%), Gaps = 6/373 (2%)
 Frame = +3

Query  96    PGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSE  275
             PGKA+++ALGKAFP QL+ QE LV+GYF++T CDD  +K+KL RLCK TTVKTRY VMS+
Sbjct  33    PGKATVLALGKAFPSQLIPQECLVEGYFRDTKCDDSAIKEKLERLCKNTTVKTRYTVMSK  92

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSSSE
Sbjct  93    EILDKYPELTTEGSPTIKQRLEIANPAVLEMALEASLACIKEWGRPVGDITHIVYVSSSE  152

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
              RLPGGDLYLA GLGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSETT
Sbjct  153   IRLPGGDLYLASGLGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  212

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
             I+G++PP+  RPYDLVG ALFGDGA A++IG++P+ ++E P  EL+ A+Q F+P T  II
Sbjct  213   ILGYRPPNMARPYDLVGAALFGDGAAALIIGTDPISQIESPFMELNFAVQQFLPGTHNII  272

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG+L+EEGI+FKL R+LPQ IEDNI+ FC  LM  A      +FN LFWAVHPGGPAILN
Sbjct  273   DGRLSEEGINFKLGRDLPQKIEDNIESFCRMLMEKANLK---EFNDLFWAVHPGGPAILN  329

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAFG  1175
             RLE  L L  +KL  SRRAL DYGN SSNTI YV++YM   ++        +WGL+LAFG
Sbjct  330   RLESCLSLKADKLQCSRRALMDYGNVSSNTIFYVMDYM---REELKGGGGEEWGLVLAFG  386

Query  1176  PGITLEGILTRNL  1214
             PGIT EGIL R+L
Sbjct  387   PGITFEGILVRSL  399



>ref|XP_006837297.1| hypothetical protein AMTR_s00111p00033190 [Amborella trichopoda]
 gb|ERN00151.1| hypothetical protein AMTR_s00111p00033190 [Amborella trichopoda]
Length=383

 Score =   488 bits (1255),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 243/371 (65%), Positives = 292/371 (79%), Gaps = 6/371 (2%)
 Frame = +3

Query  102   KASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEEI  281
             +A+I+A+GKAFP Q++ QE LV+ YF+NTNC DPV+++KL RLCK TTVKTRY V+S+EI
Sbjct  18    EATILAVGKAFPEQVIPQECLVEAYFRNTNCQDPVIREKLERLCKNTTVKTRYTVISKEI  77

Query  282   LKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSEAR  461
             L KYPEL  EG PT+ QRLDI N AV +MA++AS +CI  WG+  ++ITHLVYVSSSE R
Sbjct  78    LDKYPELTTEGSPTITQRLDIANHAVLEMALQASLSCISDWGKPVSQITHLVYVSSSEIR  137

Query  462   LPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETTII  641
              PGGDLYLA  LGL+ D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ T+ETTI+
Sbjct  138   FPGGDLYLAANLGLKTDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTAETTIL  197

Query  642   GFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKIIDG  821
             G++PP+  RPYDLVG ALFGDGA A+++GS P  E E+P  ELH A+Q F+P T+ II+G
Sbjct  198   GYRPPNLARPYDLVGAALFGDGAAAVIVGSGPFSEGEKPFMELHNAVQEFLPGTQGIIEG  257

Query  822   QLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILNRl  1001
             +LTEEGI+FKL R+LPQ IE +ID FC  LM+ A  +   +FN LFWAVHPGGPAILN+L
Sbjct  258   RLTEEGINFKLGRDLPQKIEGHIDIFCKNLMKNANLT---EFNDLFWAVHPGGPAILNKL  314

Query  1002  ekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAFGPG  1181
             E  L L+PEKL  SR+AL DYGN SSNTI YVL+YM EE K +   E   WGL+LAFGPG
Sbjct  315   ESNLRLNPEKLKCSRKALMDYGNVSSNTIFYVLDYMREEAKEDGGEE---WGLVLAFGPG  371

Query  1182  ITLEGILTRNL  1214
             IT EGIL R L
Sbjct  372   ITFEGILVRRL  382



>emb|CAN83038.1| hypothetical protein VITISV_034337 [Vitis vinifera]
Length=359

 Score =   484 bits (1247),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 245/365 (67%), Positives = 289/365 (79%), Gaps = 6/365 (2%)
 Frame = +3

Query  120   LGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEEILKKYPE  299
             +GKAFP QL+ QE LV+GYF++T C D  +K+KL RLCKTTTVKTRY VMS+EIL+KYPE
Sbjct  1     MGKAFPSQLIPQECLVEGYFRDTKCQDLAIKEKLERLCKTTTVKTRYTVMSKEILEKYPE  60

Query  300   LAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSEARLPGGDL  479
             LA EG PT+KQ+L+I N AV QMA+EAS  CI++WGR   +ITH+VYVSSSE RLPGGDL
Sbjct  61    LATEGSPTIKQKLEIANPAVLQMAMEASLACIEEWGRPVGDITHIVYVSSSEIRLPGGDL  120

Query  480   YLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETTIIGFKPPS  659
             YLA  LGLR D  R+MLYF GC GGV GLRVAKDIAENNPGSRVL+ TSETTI+GF+PP+
Sbjct  121   YLASQLGLRSDVGRIMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPN  180

Query  660   ADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKIIDGQLTEEG  839
              +RPYDLVG ALFGDGA A+++G++P+   E P  EL+ A+Q F+P T  +IDG+L+EEG
Sbjct  181   KERPYDLVGAALFGDGAAAVIVGTDPIPGKECPFMELNHAVQQFLPGTHNVIDGRLSEEG  240

Query  840   ISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILNRlekklel  1019
             I+FKL R+LP  IE+NI+EFC KLM  AG     +FN LFWAVHPGGPAILNRLE  L+L
Sbjct  241   INFKLGRDLPAKIEENIEEFCKKLMEKAGLV---EFNDLFWAVHPGGPAILNRLESTLKL  297

Query  1020  speklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAFGPGITLEGI  1199
               EKL  SRRAL DYGN SSNTI YV+EYM E  KR+   E   WGL LAFGPGIT EGI
Sbjct  298   RSEKLECSRRALMDYGNVSSNTIFYVMEYMREALKRKGGEE---WGLALAFGPGITFEGI  354

Query  1200  LTRNL  1214
             L R+L
Sbjct  355   LIRSL  359



>ref|XP_010501268.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like [Camelina sativa]
Length=1119

 Score =   508 bits (1309),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 257/400 (64%), Positives = 312/400 (78%), Gaps = 3/400 (1%)
 Frame = +3

Query  21    NLFVKRLRESMGFGDAVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDD  200
             N  +  +  S   G   L   + A+PGKA+++ALGKAFP Q+V QE LV+G+ ++T CDD
Sbjct  722   NFHLHEMSNSRMNGVEKLSTRRVANPGKATVLALGKAFPSQVVPQENLVEGFLRDTKCDD  781

Query  201   PVLKQKLTRLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEA  380
               +K+KL  LCKTTTVKTRY V+S EIL KYPEL  EG PT+KQRL+I N AV +MA+EA
Sbjct  782   AFIKEKLEHLCKTTTVKTRYTVLSREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEA  841

Query  381   SWTCIKKWGRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVA  560
             S  CIK+WGR   +ITH+VYVSSSE RLPGGDLYL+  LGLR D  RVMLYF GC GGV 
Sbjct  842   SLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVT  901

Query  561   GLRVAKDIAENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPV  740
             GLRVAKDIAENNPGSRVL+ TSETTI+GF+PP+  RPYDLVG ALFGDGA A++IG+NP 
Sbjct  902   GLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGANP-  960

Query  741   QELERPLFELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRV  920
             +E E P  ELH A+Q F+P T+ +IDG+L+EEGI+FKL R+LPQ IE+NI+EFC KLM  
Sbjct  961   KECEAPFMELHYAVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEENIEEFCKKLMGK  1020

Query  921   AGYSHKDDFNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVL  1100
             AG     +FN +FWAVHPGGPAILNRLE KL+L  EKL +SRRAL +YGN SSNTI+YV+
Sbjct  1021  AG-DESMEFNDMFWAVHPGGPAILNRLETKLKLEREKLESSRRALVNYGNVSSNTILYVM  1079

Query  1101  EYMLEEKKRESEAEDSDWGLILAFGPGITLEGILTRNLTA  1220
             EYM +E K++ EA   +WGL LAFGPGIT EG+L R+LT+
Sbjct  1080  EYMRDELKKKGEAA-QEWGLGLAFGPGITFEGLLIRSLTS  1118



>ref|XP_011094451.1| PREDICTED: LOW QUALITY PROTEIN: chalcone synthase [Sesamum indicum]
Length=383

 Score =   484 bits (1245),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 245/378 (65%), Positives = 294/378 (78%), Gaps = 17/378 (4%)
 Frame = +3

Query  81    GKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRY  260
             G+ A+PGKA+I+A+GKAFP+QLV Q+FLV+GY ++T CDD  +K+KL RLCKTTTVKTRY
Sbjct  23    GRVATPGKATILAIGKAFPNQLVPQDFLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRY  82

Query  261   VVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVY  440
              VMS+EIL +YPELA EG PT+KQRL+I N AV +MA EAS  C+K+W R P+ ITH+VY
Sbjct  83    TVMSKEILDQYPELATEGSPTIKQRLEIANPAVLKMAKEASLACLKEWNRPPSHITHIVY  142

Query  441   VSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVA  620
             VSSSE RLPGGDLYLA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ 
Sbjct  143   VSSSEIRLPGGDLYLAAELGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLT  202

Query  621   TSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPD  800
             TSETTI+GF+PP+  RPYDLVG ALFGDGA ++               EL+ A+Q F+P+
Sbjct  203   TSETTILGFRPPNKARPYDLVGAALFGDGAASVX------------FLELNFAVQQFLPE  250

Query  801   TEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGG  980
             T  +IDG+L+EEGI FKL R+LPQ IE+NI++FC KLM  AG     ++N+LFWAVHPGG
Sbjct  251   TSNVIDGRLSEEGIYFKLGRDLPQKIEENIEDFCKKLMVKAGLK---EYNELFWAVHPGG  307

Query  981   PAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGL  1160
             PAILNRLE  L L  +KL  SRRAL D+GN SSNTI YV+EYM EE +++   E  +WGL
Sbjct  308   PAILNRLESNLGLDSQKLDCSRRALMDFGNVSSNTIFYVMEYMREELRKKENGE--EWGL  365

Query  1161  ILAFGPGITLEGILTRNL  1214
              LAFGPGIT EGIL R+L
Sbjct  366   ALAFGPGITFEGILLRSL  383



>gb|EYU31920.1| hypothetical protein MIMGU_mgv1a007619mg [Erythranthe guttata]
Length=401

 Score =   484 bits (1247),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 256/382 (67%), Positives = 297/382 (78%), Gaps = 11/382 (3%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+A+GKAFP QLV Q+ LV+G+ ++T C D V+K+KL RLCKTTTVKTRY VMS
Sbjct  23    TPGKATILAIGKAFPSQLVPQDCLVEGFIRDTKCHDLVIKEKLERLCKTTTVKTRYTVMS  82

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
              EIL++YPELA EG PT+KQRLDI N AV +MA EAS TC+K+WGR  ++ITHLVYVSSS
Sbjct  83    REILEQYPELATEGTPTIKQRLDIANPAVLKMATEASLTCLKEWGRPASDITHLVYVSSS  142

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDL LA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ATSET
Sbjct  143   EIRLPGGDLLLASELGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLATSET  202

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGA A+VIG+ PV  LE P  EL+ A+Q F+P T ++
Sbjct  203   TILGFRPPNKSRPYDLVGAALFGDGAAAVVIGAEPVPGLESPFLELNFAVQQFLPGTSEV  262

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+L+EEGI FKL R+LPQ IEDNI EFC KLM  AG    +D+N+LFWAVHPGGPAIL
Sbjct  263   IDGRLSEEGIYFKLGRDLPQKIEDNIKEFCDKLMAKAGV---EDYNELFWAVHPGGPAIL  319

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYM--------LEEKKRESEAEDS  1148
             NRLE KL L  EKL  SRRAL DYGN SSNT++YV+EYM              E      
Sbjct  320   NRLEGKLGLGKEKLDCSRRALMDYGNVSSNTVLYVMEYMREEMKKKKAAAAAAEDGGGGE  379

Query  1149  DWGLILAFGPGITLEGILTRNL  1214
             +WGL LAFGPGIT EGIL R+L
Sbjct  380   EWGLALAFGPGITFEGILLRSL  401



>emb|CAA74847.1| anther-specific protein [Nicotiana sylvestris]
 emb|CAA74846.1| anther-specific protein [Nicotiana sylvestris]
Length=363

 Score =   483 bits (1242),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 245/365 (67%), Positives = 286/365 (78%), Gaps = 2/365 (1%)
 Frame = +3

Query  120   LGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEEILKKYPE  299
             +GKAFP QLV Q+ LV+GY ++TNC D  +K+KL RLCKTTTVKTRY VMS+EIL KYPE
Sbjct  1     MGKAFPAQLVPQDCLVEGYIRDTNCQDLAIKEKLERLCKTTTVKTRYTVMSKEILDKYPE  60

Query  300   LAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSEARLPGGDL  479
             LA EG PT+KQRL+I N AV +MA +AS  CIK+WGRS  EITH+VYVSSSE RLPGGDL
Sbjct  61    LATEGTPTIKQRLEIANPAVVEMAKQASQACIKEWGRSAEEITHIVYVSSSEIRLPGGDL  120

Query  480   YLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETTIIGFKPPS  659
             YLA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSETTI+GF+PP+
Sbjct  121   YLATELGLRNDIGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPN  180

Query  660   ADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKIIDGQLTEEG  839
               RPYDLVG ALFGDGA A++IG+ P+   E P  EL+ A Q F+P T  +IDG+LTEEG
Sbjct  181   KARPYDLVGAALFGDGAAAVIIGTEPIMGKESPFMELNFATQQFLPGTNNVIDGRLTEEG  240

Query  840   ISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILNRlekklel  1019
             I+FKL R+LP+ I+DNI+EFC K++  A    +  +N LFWAVHPGGPAILNRLE  L+L
Sbjct  241   INFKLGRDLPEKIQDNIEEFCKKIIAKADL-REAKYNDLFWAVHPGGPAILNRLENTLKL  299

Query  1020  speklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAFGPGITLEGI  1199
               EKL  SRRAL DYGN SSNTI YV+EYM EE K +    + +WGL LAFGPGIT EGI
Sbjct  300   QSEKLDCSRRALMDYGNVSSNTIFYVMEYMREELKNKKNGGE-EWGLALAFGPGITFEGI  358

Query  1200  LTRNL  1214
             L R+L
Sbjct  359   LLRSL  363



>gb|AAZ81869.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   483 bits (1243),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 251/375 (67%), Positives = 300/375 (80%), Gaps = 2/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+P KA+++ALGKAFP Q+V QE LV+G+ ++T CDD  +K+KL  LCKTTTVKTRY V+
Sbjct  21    ANPRKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVL  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S EIL KYPEL  EG PT+KQRL+I N AV +MA+EAS  CIK+WGR   +ITH+VYVSS
Sbjct  81    SREILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TTI+GF+PP+  RPYDLVG ALFGDGA A++IG+ P +E E P  ELH A+Q F+P T+ 
Sbjct  201   TTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAAP-RECEAPFMELHYAVQQFLPGTQN  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+LTEEGI+FKL R+LPQ IE+NI+EFC KLM  AG     +FN +FWAVHPGGPAI
Sbjct  260   VIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDESMEFNDMFWAVHPGGPAI  319

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             LNRLE KL+L  EKL +SRRAL DYGN SSNTI+YV+EYM EE K++ +A   +W L LA
Sbjct  320   LNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREELKKKGDAA-QEWRLGLA  378

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG+L R+L
Sbjct  379   FGPGITFEGLLIRSL  393



>ref|XP_004229766.1| PREDICTED: chalcone synthase 6-4 [Solanum lycopersicum]
Length=394

 Score =   483 bits (1242),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 242/374 (65%), Positives = 298/374 (80%), Gaps = 1/374 (0%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+A+GKA P QLV Q+ LV+GY ++TNC D  +K+KL RLCKTTTVKTRY VMS
Sbjct  20    TPGKATILAIGKALPPQLVPQDCLVEGYMRDTNCKDLRIKEKLERLCKTTTVKTRYTVMS  79

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL+KYPELA EG PT+ QRL+I N AV +MA EAS  CIK+WGRS  EI+H+VYVSSS
Sbjct  80    KEILEKYPELATEGTPTINQRLEIANEAVVEMAKEASLACIKEWGRSVDEISHIVYVSSS  139

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDL+L+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSET
Sbjct  140   EIRLPGGDLHLSTELGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  199

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGA A++IG+ P+   E P  EL+ A+Q F+P T+ +
Sbjct  200   TILGFRPPNNARPYDLVGAALFGDGAAAVIIGTEPIIGTESPFIELNFAMQQFLPGTKNV  259

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+LT+EGI+FKL R+LP+ I++NI+EFC KL+         ++N LFWAVHPGGPAIL
Sbjct  260   IDGRLTDEGINFKLGRDLPEKIQENIEEFCKKLIAKRDELQGSNYNDLFWAVHPGGPAIL  319

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAF  1172
             +RLEK ++L  EKL+ SR+AL D+GN SSNTI YV+E M EE K + +A + +WGL LAF
Sbjct  320   DRLEKTMKLQNEKLNCSRKALMDFGNVSSNTIFYVIENMREEMKNKKDAGE-EWGLALAF  378

Query  1173  GPGITLEGILTRNL  1214
             GPGIT EGIL R+L
Sbjct  379   GPGITFEGILLRSL  392



>ref|XP_011042452.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Populus euphratica]
Length=1216

 Score =   507 bits (1306),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 257/378 (68%), Positives = 301/378 (80%), Gaps = 6/378 (2%)
 Frame = +3

Query  81    GKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRY  260
             G+  +PGKA+I+A GKAFP QLV QE LV+GY ++T CDD  +K+KL RLCK+TTVKTRY
Sbjct  845   GRAPTPGKATILATGKAFPSQLVPQECLVEGYMRDTKCDDASIKEKLERLCKSTTVKTRY  904

Query  261   VVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVY  440
              VMS+EIL+KYPELA EG PT+KQRL+I N AV +MA++AS  CI +WG S  +ITH+VY
Sbjct  905   TVMSKEILEKYPELATEGSPTIKQRLEIANPAVVEMALKASIACINEWGGSVKDITHVVY  964

Query  441   VSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVA  620
             VSSSE RLPGGDLYLA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSR+L+ 
Sbjct  965   VSSSEIRLPGGDLYLASQLGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRILLT  1024

Query  621   TSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPD  800
             TSETTI+GF+PP+  RPYDLVG ALFGDGA A++IG++PV   E P  EL  A+Q F+P 
Sbjct  1025  TSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADPVIGKESPFMELSYAVQQFLPG  1084

Query  801   TEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGG  980
             T+ +IDG+L+EEGI+FKL R+LPQ IEDNI+EFC KLM  AG +   +FN LFWAVHPGG
Sbjct  1085  TQNVIDGRLSEEGINFKLGRDLPQKIEDNIEEFCRKLMSKAGLT---EFNDLFWAVHPGG  1141

Query  981   PAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGL  1160
             PAILNRLE  L+L+ EKL  SRRAL +YGN SSNTIVYVLEYM EE KR    E   WGL
Sbjct  1142  PAILNRLESNLKLNTEKLECSRRALINYGNVSSNTIVYVLEYMKEELKRGGGEE---WGL  1198

Query  1161  ILAFGPGITLEGILTRNL  1214
              LAFGPGIT EGIL R+L
Sbjct  1199  ALAFGPGITFEGILLRSL  1216



>ref|XP_006347928.1| PREDICTED: octaketide synthase 3-like [Solanum tuberosum]
Length=396

 Score =   479 bits (1233),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 241/372 (65%), Positives = 295/372 (79%), Gaps = 1/372 (0%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEE  278
             GKA+I+A+GKA P QLV Q+ LV+GY ++TNC D  +K+KL RLCKTTTVKTRY VMS+E
Sbjct  26    GKATILAMGKALPPQLVPQDCLVEGYMRDTNCKDLRIKEKLERLCKTTTVKTRYTVMSKE  85

Query  279   ILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSEA  458
             IL+KYPELA EG PT+ QRL+I N AV +MA EAS  CIK+WGR+  EITH+VYVSSSE 
Sbjct  86    ILEKYPELATEGTPTINQRLEIANPAVVEMAKEASLACIKEWGRTVDEITHIVYVSSSEI  145

Query  459   RLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETTI  638
             RLPGGDL+L+  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSETTI
Sbjct  146   RLPGGDLHLSTELGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  205

Query  639   IGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKIID  818
             +GF+PP+  RPYDLVG ALFGDGA A++IG+ P+   E P  EL+ A+Q F+P T+ +ID
Sbjct  206   LGFRPPNNARPYDLVGAALFGDGAAAVIIGTEPIVGTESPFIELNFAMQQFLPGTKNVID  265

Query  819   GQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILNR  998
             G+LT+EGI+FKL R+LP+ I+DNI+EFC KL+         ++N LFWAVHPGGPAIL+R
Sbjct  266   GRLTDEGINFKLGRDLPEKIQDNIEEFCKKLIAKNDELKGSNYNDLFWAVHPGGPAILDR  325

Query  999   lekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAFGP  1178
             LEK ++L  EKL+ SR+AL D+GN SSNTI YV+E M EE K + +  + +WGL LAFGP
Sbjct  326   LEKTMKLQNEKLNCSRKALMDFGNVSSNTIFYVMENMREELKNKKDGGE-EWGLALAFGP  384

Query  1179  GITLEGILTRNL  1214
             GIT EGIL R+L
Sbjct  385   GITFEGILLRSL  396



>gb|ADF43043.1| chalcone synthase 2 protein [Brassica rapa subsp. rapa]
Length=392

 Score =   478 bits (1231),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 248/378 (66%), Positives = 293/378 (78%), Gaps = 9/378 (2%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP  +V QE LV+ Y +   CDDP +K+KL  LCKTTTVKTRY VM
Sbjct  21    ANQGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDPSIKEKLQHLCKTTTVKTRYTVM  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S E +KKYPELA EG PT+KQRL+I N AV QMA EAS  CIK+WGR   +ITHLVYVSS
Sbjct  81    SSETMKKYPELATEGSPTIKQRLEIANEAVVQMAYEASLACIKEWGRGVEDITHLVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGL  + QRVM YF GC GGV+G+RVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEFRLPGGDLYLSAQLGLSNEVQRVMFYFLGCYGGVSGMRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             T ++GF+PP+  RPYDLVG ALFGDGA A++IG++P  E E P  ELH A+Q F+P T+ 
Sbjct  201   TMVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPT-ESESPFMELHYALQQFLPGTQG  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+L+EEGISFKL RELPQ IEDNI+EFC KL+  AG S   + N LFWAVHPGGPAI
Sbjct  260   VIDGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKAG-SGSLELNDLFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYM---LEEKKRESEAEDSDWGL  1160
             LN LE KL+L PEKL  SR+AL DYGNASSNTI Y+++ +   LE+K R  E    +WGL
Sbjct  319   LNGLETKLKLKPEKLECSRQALVDYGNASSNTIFYIMDKVRGELEKKGRGGE----EWGL  374

Query  1161  ILAFGPGITLEGILTRNL  1214
              LAFGPGIT EG L R+L
Sbjct  375   GLAFGPGITFEGFLMRSL  392



>emb|CDX83215.1| BnaA03g22910D [Brassica napus]
Length=392

 Score =   478 bits (1231),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 247/378 (65%), Positives = 293/378 (78%), Gaps = 9/378 (2%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP  +V QE LV+ Y +   CDDP +K+KL  LCKTTTVKTRY VM
Sbjct  21    ANQGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDPSIKEKLQHLCKTTTVKTRYTVM  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S E ++KYPELA EG PT+KQRL+I N AV QMA EAS  CIK+WGR   +ITHLVYVSS
Sbjct  81    SSETMQKYPELATEGTPTIKQRLEIANDAVVQMAYEASLACIKEWGRGVEDITHLVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGL  + QRVM YF GC GGV+G+RVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEFRLPGGDLYLSAQLGLSNEVQRVMFYFLGCYGGVSGMRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             T ++GF+PP+  RPYDLVG ALFGDGA A++IG++P  E E P  ELH A+Q F+P T+ 
Sbjct  201   TMVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPT-ESESPFMELHYALQQFLPGTQG  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+L+EEGISFKL RELPQ IEDNI+EFC KL+  AG S   + N LFWAVHPGGPAI
Sbjct  260   VIDGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKAG-SGSLELNDLFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYM---LEEKKRESEAEDSDWGL  1160
             LN LE KL+L PEKL  SR+AL DYGNASSNTI Y+++ +   LE+K R  E    +WGL
Sbjct  319   LNGLETKLKLKPEKLECSRQALVDYGNASSNTIFYIMDKVRDELEKKGRSGE----EWGL  374

Query  1161  ILAFGPGITLEGILTRNL  1214
              LAFGPGIT EG L R+L
Sbjct  375   GLAFGPGITFEGFLMRSL  392



>emb|CDY21499.1| BnaC03g26980D [Brassica napus]
Length=392

 Score =   478 bits (1229),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 247/378 (65%), Positives = 293/378 (78%), Gaps = 9/378 (2%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP  +V QE LV+ Y +   CDDP +K+KL  LCKTTTVKTRY VM
Sbjct  21    ANQGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDPSIKEKLQHLCKTTTVKTRYTVM  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S E ++KYPELA EG PT+KQRL+I N AV QMA EAS  CIK+WGR   +ITHLVYVSS
Sbjct  81    SSETMQKYPELATEGTPTIKQRLEIANDAVVQMAYEASLACIKEWGRGVEDITHLVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGL  + QRVM YF GC GGV+G+RVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEFRLPGGDLYLSAQLGLSNEVQRVMFYFLGCYGGVSGMRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             T ++GF+PP+  RPYDLVG ALFGDGA A++IG++P  E E P  ELH A+Q F+P T+ 
Sbjct  201   TMVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPT-ESESPFMELHYALQQFLPGTQG  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+L+EEGISFKL RELPQ IEDNI+EFC KL+  AG S   + N LFWAVHPGGPAI
Sbjct  260   VIDGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKAG-SGSLELNDLFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYM---LEEKKRESEAEDSDWGL  1160
             LN LE KL+L PEKL  SR+AL DYGNASSNTI Y+++ +   LE+K R  E    +WGL
Sbjct  319   LNGLETKLKLKPEKLECSRQALVDYGNASSNTIFYIMDKVRGELEKKGRGGE----EWGL  374

Query  1161  ILAFGPGITLEGILTRNL  1214
              LAFGPGIT EG L R+L
Sbjct  375   GLAFGPGITFEGFLMRSL  392



>ref|XP_009133969.1| PREDICTED: chalcone synthase [Brassica rapa]
Length=392

 Score =   477 bits (1228),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 247/378 (65%), Positives = 293/378 (78%), Gaps = 9/378 (2%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP  +V QE LV+ Y +   CDDP +K+KL  LCKTTTVKTRY VM
Sbjct  21    ANQGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDPSIKEKLQHLCKTTTVKTRYTVM  80

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S E ++KYPELA EG PT+KQRL+I N AV QMA EAS  CIK+WGR   +ITHLVYVSS
Sbjct  81    SSETMQKYPELATEGSPTIKQRLEIANEAVVQMAYEASLACIKEWGRGVEDITHLVYVSS  140

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGL  + QRVM YF GC GGV+G+RVAKDIAENNPGSRVL+ TSE
Sbjct  141   SEFRLPGGDLYLSAQLGLSNEVQRVMFYFLGCYGGVSGMRVAKDIAENNPGSRVLLTTSE  200

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             T ++GF+PP+  RPYDLVG ALFGDGA A++IG++P  E E P  ELH A+Q F+P T+ 
Sbjct  201   TMVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPT-ESESPFMELHYALQQFLPGTQG  259

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+L+EEGISFKL RELPQ IEDNI+EFC KL+  AG S   + N LFWAVHPGGPAI
Sbjct  260   VIDGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKAG-SGSLELNDLFWAVHPGGPAI  318

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYM---LEEKKRESEAEDSDWGL  1160
             LN LE KL+L PEKL  SR+AL DYGNASSNTI Y+++ +   LE+K R  E    +WGL
Sbjct  319   LNGLETKLKLKPEKLECSRQALVDYGNASSNTIFYIMDKVRGELEKKGRGGE----EWGL  374

Query  1161  ILAFGPGITLEGILTRNL  1214
              LAFGPGIT EG L R+L
Sbjct  375   GLAFGPGITFEGFLMRSL  392



>gb|ACY74337.1| putative chalcone synthase [Artemisia annua]
Length=378

 Score =   474 bits (1221),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 248/374 (66%), Positives = 296/374 (79%), Gaps = 5/374 (1%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+++ALGKAFP QL+ Q+ LV+G+F++TNC D  +K+KL RLCKTTTVKTRY VMS
Sbjct  9     TPGKATVLALGKAFPSQLIPQDCLVEGFFRDTNCADSAMKEKLARLCKTTTVKTRYTVMS  68

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL KYPELA EG  T+ QRL I N AVT+MA EAS  C K+WGR   +ITH+VYVSSS
Sbjct  69    KEILDKYPELAREGSATISQRLTIANEAVTEMAKEASLACFKQWGRPAEDITHVVYVSSS  128

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDL+LA  LGLR D  RVMLYF GC GGV GLR+AKDIAENNPGSRVL+ TSET
Sbjct  129   EIRLPGGDLFLASELGLRNDVNRVMLYFLGCYGGVTGLRIAKDIAENNPGSRVLLTTSET  188

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGA A +IG++P+   E P  EL  A+Q F+P T+ +
Sbjct  189   TILGFRPPNKSRPYDLVGAALFGDGAAAAIIGADPING-ESPFMELSYAVQQFLPGTQNV  247

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+LTEEGI+FKL R+LPQ I+DNI+ FC KLM  AG    +DFN LFWAVHPGGPAIL
Sbjct  248   IDGRLTEEGINFKLGRDLPQKIDDNIEAFCKKLMEKAG--KLEDFNDLFWAVHPGGPAIL  305

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAF  1172
             NRLE  L+L  EKL  SRRAL D+GN SSNTI+YV+EYM +E   + ++E  +WGL LAF
Sbjct  306   NRLEATLKLKGEKLDCSRRALTDFGNVSSNTIIYVMEYMRDELMNKEKSE--EWGLALAF  363

Query  1173  GPGITLEGILTRNL  1214
             GPGIT EGIL R+L
Sbjct  364   GPGITFEGILLRSL  377



>ref|XP_006854881.1| hypothetical protein AMTR_s00182p00053650 [Amborella trichopoda]
 gb|ERN16348.1| hypothetical protein AMTR_s00182p00053650 [Amborella trichopoda]
Length=317

 Score =   472 bits (1215),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 240/319 (75%), Positives = 279/319 (87%), Gaps = 4/319 (1%)
 Frame = +3

Query  267   MSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVS  446
             MS+EILKKYPELA+EGLPT+ QRL I N AVT+MAIEAS  CIK WGR  ++ITHLVYVS
Sbjct  1     MSDEILKKYPELALEGLPTISQRLSISNEAVTEMAIEASKACIKNWGRPVSDITHLVYVS  60

Query  447   SSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATS  626
             SSEARLPGGD+YLA+G+GL P+  RVMLYF GCSGGVAGLRVAKDIAENNPGSRVL+AT+
Sbjct  61    SSEARLPGGDIYLARGIGLNPEANRVMLYFMGCSGGVAGLRVAKDIAENNPGSRVLLATT  120

Query  627   ETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTE  806
             ETTIIGFKPPSA RPYDLVG ALFGDGAGAM++G+NP+ E E+PLFELHTAIQHF+P TE
Sbjct  121   ETTIIGFKPPSASRPYDLVGAALFGDGAGAMILGTNPI-EGEKPLFELHTAIQHFLPGTE  179

Query  807   KIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPA  986
             KIIDG+LTEEGI+FK+ER+LPQIIED I+ FC KLM+  G   ++ +N++FWAVHPGGPA
Sbjct  180   KIIDGRLTEEGINFKIERDLPQIIEDYIEAFCLKLMQKVGLG-EEGYNEMFWAVHPGGPA  238

Query  987   ILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE--KKRESEAEDSDWGL  1160
             ILNRLEK+L L+PEKL ASRRAL DYGN SSNTIVYVLE+M+EE  K R++   +++WGL
Sbjct  239   ILNRLEKRLNLTPEKLVASRRALMDYGNVSSNTIVYVLEFMMEESLKMRDTGERENEWGL  298

Query  1161  ILAFGPGITLEGILTRNLT  1217
             ILAFGPGIT EGIL R+L 
Sbjct  299   ILAFGPGITFEGILARSLV  317



>ref|XP_002875049.1| hypothetical protein ARALYDRAFT_490563 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51308.1| hypothetical protein ARALYDRAFT_490563 [Arabidopsis lyrata subsp. 
lyrata]
Length=385

 Score =   474 bits (1221),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 243/375 (65%), Positives = 294/375 (78%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A  GKA+++ALGKAFP  +V QE LV+ Y +   CDD  +K KL  LCK+TTVKTRY VM
Sbjct  14    AYQGKATLLALGKAFPSNVVSQENLVEDYLREIKCDDLSIKDKLQHLCKSTTVKTRYTVM  73

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S E L+KYPELA EG PT+KQRL+I N AV QMA EAS  CIK+WGR+  +ITHLVYVSS
Sbjct  74    SRETLQKYPELATEGSPTIKQRLEIANEAVVQMAYEASLVCIKEWGRTVEDITHLVYVSS  133

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR + QRVMLYF GC GG++GLRVAKDIAENNPGSRVL+ TSE
Sbjct  134   SEFRLPGGDLYLSTQLGLRNEVQRVMLYFLGCYGGLSGLRVAKDIAENNPGSRVLLTTSE  193

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TT++GF+PP+  RPYDLVG ALFGDGA A++IG++P +E E P  ELH A+Q F+P T+ 
Sbjct  194   TTVLGFRPPNKARPYDLVGAALFGDGAAALIIGADP-RESESPFMELHCALQQFLPQTQG  252

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+L+EEGISFKL R+LPQ IEDN++EFC KL+  AG S   + N LFWAVHPGGPAI
Sbjct  253   VIDGRLSEEGISFKLGRDLPQKIEDNVEEFCKKLVAKAG-SGSLELNDLFWAVHPGGPAI  311

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             L+ LE KL+L PEKL  SRRAL DYGN SSNTI Y+++ + +E +++   E  +WGL LA
Sbjct  312   LSGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMDKVRDELEKKG-TEGEEWGLGLA  370

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG L R+L
Sbjct  371   FGPGITFEGFLMRSL  385



>ref|XP_006290098.1| hypothetical protein CARUB_v10003743mg [Capsella rubella]
 gb|EOA22996.1| hypothetical protein CARUB_v10003743mg [Capsella rubella]
Length=394

 Score =   474 bits (1219),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 244/378 (65%), Positives = 293/378 (78%), Gaps = 3/378 (1%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             + A+ GKA+++ALGKAFP  +V QE LV+ Y +  NCDD  ++ KL  LCKTTTVKTRY 
Sbjct  19    RTANQGKATVLALGKAFPSNVVSQENLVEEYLREINCDDLSIRDKLQHLCKTTTVKTRYT  78

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMS E L KYPELA EG PT+KQRL+I N AV QMA EAS  CIK+WGR+  +ITHLVYV
Sbjct  79    VMSRETLHKYPELATEGSPTIKQRLEIANEAVVQMAYEASLVCIKEWGRAVQDITHLVYV  138

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSE RLPGGDLYL+  LGL  + QRVMLYF GC GGV+GLRVAKDIAENNPGSRVL+ T
Sbjct  139   SSSEFRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGVSGLRVAKDIAENNPGSRVLLTT  198

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETT++GF+PP+  RPYDLVG ALFGDGA A++IG++P  E E P  ELH A+Q F+P T
Sbjct  199   SETTVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPT-ESESPFVELHCAMQQFLPGT  257

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGY-SHKDDFNKLFWAVHPGG  980
               +IDG+L+EEGISFKL R+LPQ IEDN++EFC KL+  AG  S   + N LFWAVHPGG
Sbjct  258   HGVIDGRLSEEGISFKLGRDLPQKIEDNVEEFCKKLVAEAGSGSGSLELNDLFWAVHPGG  317

Query  981   PAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGL  1160
             PAIL+ LE KL+L PEKL  SRRAL DYGN SSNTI Y++E + +E +++    + +WGL
Sbjct  318   PAILSGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMEKVRDELEKKGTGGE-EWGL  376

Query  1161  ILAFGPGITLEGILTRNL  1214
              LAFGPGIT EG L R+L
Sbjct  377   GLAFGPGITFEGFLMRSL  394



>ref|XP_010456329.1| PREDICTED: chalcone synthase-like isoform X1 [Camelina sativa]
Length=394

 Score =   471 bits (1211),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 246/394 (62%), Positives = 297/394 (75%), Gaps = 6/394 (2%)
 Frame = +3

Query  36    RLRESMGFGDAVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQ  215
             RL + M  G +     + A+ GKA+++ALGKAFP  +V QE LV+ Y +   CDD  +K 
Sbjct  6     RLEKRMEIGKSTR---RAATQGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDLSIKD  62

Query  216   KLTRLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCI  395
             KL  LCKTTTVKTRY VMS E L KYPELA EG PT+ QRL+I N AV QMA EAS  CI
Sbjct  63    KLQHLCKTTTVKTRYTVMSRETLHKYPELATEGSPTINQRLEIANEAVVQMAYEASLVCI  122

Query  396   KKWGRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVA  575
             K WGR+  +ITHL+YVSSSE RLPGGDLYL+  LGL  + QRVMLYF GC GG++GLRVA
Sbjct  123   KDWGRAVEDITHLLYVSSSEFRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGLSGLRVA  182

Query  576   KDIAENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELER  755
             KDIAENNPGSRVL+ TSETT++GF+PP+  RPYDLVG ALFGDGA A++IG++P  E E 
Sbjct  183   KDIAENNPGSRVLLTTSETTVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPT-ESES  241

Query  756   PLFELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGY-S  932
             P  ELH A+Q F+P T+ +IDG+L+EEGISFKL R+LPQ IE+N++EFC KL+  AG  S
Sbjct  242   PFMELHYALQQFLPGTQGVIDGRLSEEGISFKLGRDLPQKIEENVEEFCKKLVAKAGSGS  301

Query  933   HKDDFNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYML  1112
                D N LFWAVHPGGPAIL+ LE KL+L PEKL  SRRAL DYGN SSNTI Y++E + 
Sbjct  302   GLLDLNDLFWAVHPGGPAILSGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMEKVR  361

Query  1113  EEKKRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
             +E +++   E  +WGL LAFGPGIT EG L R+L
Sbjct  362   DELEKKG-TEGEEWGLGLAFGPGITFEGFLMRSL  394



>ref|XP_004142644.1| PREDICTED: chalcone synthase J-like [Cucumis sativus]
 ref|XP_004168964.1| PREDICTED: chalcone synthase J-like [Cucumis sativus]
 gb|KGN54531.1| hypothetical protein Csa_4G358690 [Cucumis sativus]
Length=389

 Score =   469 bits (1208),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 248/374 (66%), Positives = 292/374 (78%), Gaps = 6/374 (2%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PG A+I+ALGKAFP QLV QE LV+GY ++T C D  +K+KL RLCKTTTV+TRY VM 
Sbjct  22    TPGTATILALGKAFPSQLVPQECLVEGYIRDTKCIDATIKEKLERLCKTTTVRTRYTVMC  81

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL KYPEL  EG PT++QRL+I NSAV +MA EAS  CIK+WGRS  +ITH+VYVSSS
Sbjct  82    KEILDKYPELVTEGSPTIRQRLEIANSAVVEMATEASKACIKEWGRSVEDITHIVYVSSS  141

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDLY+A  LGL+ D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSET
Sbjct  142   EIRLPGGDLYIANQLGLKNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  201

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGA A++IG++PV   E P  EL+ AIQ F+PDT+ +
Sbjct  202   TILGFRPPNNARPYDLVGAALFGDGAAAVIIGADPVLGQESPFMELNCAIQQFLPDTQNV  261

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             I+G+L+EEGISFKL R+LPQ I+DNI+ FC KLM      +   FN LFWAVHPGGPAIL
Sbjct  262   INGKLSEEGISFKLGRDLPQRIDDNIEGFCRKLMEKRNLVN---FNDLFWAVHPGGPAIL  318

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAF  1172
             N+LE  L L  EKL  SR+AL DYGN SSNTI YV+E M E  KRE   +  +WGL LAF
Sbjct  319   NKLENTLRLKSEKLECSRKALMDYGNVSSNTIFYVIENMRENLKRE---DGEEWGLALAF  375

Query  1173  GPGITLEGILTRNL  1214
             GPGIT EGIL R+L
Sbjct  376   GPGITFEGILIRSL  389



>gb|AAM63363.1| putative chalcone synthase [Arabidopsis thaliana]
Length=385

 Score =   469 bits (1206),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 241/375 (64%), Positives = 289/375 (77%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A  GKA+++ALGKA P  +V QE LV+ Y +   CDD  +K KL  LCK+TTVKTRY VM
Sbjct  14    AYQGKATVLALGKALPSNVVSQENLVEEYLREIKCDDLSIKDKLQHLCKSTTVKTRYTVM  73

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S E L KYPELA EG PT+KQRL+I N AV QMA EAS  CIK+WGR+  +ITHLVYVSS
Sbjct  74    SRETLHKYPELATEGSPTIKQRLEIANDAVVQMAYEASLVCIKEWGRAVEDITHLVYVSS  133

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGL  + QRVMLYF GC GG++GLRVAKDIAENNPGSRVL+ TSE
Sbjct  134   SEFRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGLSGLRVAKDIAENNPGSRVLLTTSE  193

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TT++GF+PP   RPYDLVG ALFGDGA A++IG++P  E E P  ELH A+Q F+P T+ 
Sbjct  194   TTVLGFRPPKKARPYDLVGAALFGDGAAALIIGADPT-ESESPFMELHCAMQQFLPQTQG  252

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+L+EEGI+FKL R+LPQ IEDN++EFC KL+  AG S   + N LFWAVHPGGPAI
Sbjct  253   VIDGRLSEEGITFKLGRDLPQKIEDNVEEFCKKLVAKAG-SGALELNDLFWAVHPGGPAI  311

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             L+ LE KL+L PEKL  SRRAL DYGN SSNTI Y+++ + +E +++   E  +WGL LA
Sbjct  312   LSGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMDKVRDELEKKG-TEGEEWGLGLA  370

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG L RNL
Sbjct  371   FGPGITFEGFLMRNL  385



>ref|XP_010456330.1| PREDICTED: chalcone synthase-like isoform X2 [Camelina sativa]
Length=384

 Score =   469 bits (1206),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 242/378 (64%), Positives = 291/378 (77%), Gaps = 3/378 (1%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             + A+ GKA+++ALGKAFP  +V QE LV+ Y +   CDD  +K KL  LCKTTTVKTRY 
Sbjct  9     RAANQGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDLSIKDKLQHLCKTTTVKTRYT  68

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMS E L KYPELA EG PT+ QRL+I N AV QMA EAS  CIK WGR+  +ITHL+YV
Sbjct  69    VMSRETLHKYPELATEGSPTINQRLEIANEAVVQMAYEASLVCIKDWGRAVEDITHLLYV  128

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSE RLPGGDLYL+  LGL  + QRVMLYF GC GG++GLRVAKDIAENNPGSRVL+ T
Sbjct  129   SSSEFRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGLSGLRVAKDIAENNPGSRVLLTT  188

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SETT++GF+PP+  RPYDLVG ALFGDGA A++IG++P  E E P  ELH A+Q F+P T
Sbjct  189   SETTVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPT-ESESPFMELHYALQQFLPGT  247

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGY-SHKDDFNKLFWAVHPGG  980
             + +IDG+L+EEGISFKL R+LPQ IE+N++EFC KL+  AG  S   D N LFWAVHPGG
Sbjct  248   QGVIDGRLSEEGISFKLGRDLPQKIEENVEEFCKKLVAKAGSGSGLLDLNDLFWAVHPGG  307

Query  981   PAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGL  1160
             PAIL+ LE KL+L PEKL  SRRAL DYGN SSNTI Y++E + +E +++   E  +WGL
Sbjct  308   PAILSGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMEKVRDELEKKG-TEGEEWGL  366

Query  1161  ILAFGPGITLEGILTRNL  1214
              LAFGPGIT EG L R+L
Sbjct  367   GLAFGPGITFEGFLMRSL  384



>ref|XP_004308525.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=1128

 Score =   493 bits (1268),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 252/405 (62%), Positives = 306/405 (76%), Gaps = 13/405 (3%)
 Frame = +3

Query  24    LFVKRLRESMGFGDAVLQGGKKAS--------PGKASIMALGKAFPHQLVMQEFLVDGYF  179
             LF   L     F  + +QG +  S        PGKA+++ALGKAFP Q++ Q+ LV+GY 
Sbjct  729   LFTAHLGMDERFQMSKVQGNRNGSAKQLHVPTPGKATVLALGKAFPSQIIPQDCLVEGYI  788

Query  180   KNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAV  359
             ++T C D  +K+KL RLCKTTTVKTRY VMS+EIL KYPELA EG  T++QRL+I N AV
Sbjct  789   RDTKCADVAIKEKLERLCKTTTVKTRYTVMSKEILDKYPELATEGTTTIRQRLEITNPAV  848

Query  360   TQMAIEASWTCIKKWGRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFS  539
              +MA EAS  CIK+WGR   +ITH+VYVSSSE RLPGGDLYLA  LGLR D  RVMLYF 
Sbjct  849   VEMAFEASLACIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLASKLGLRNDVGRVMLYFL  908

Query  540   GCSGGVAGLRVAKDIAENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAM  719
             GC GGV GLRVAKDIAENNPGSRVL+ TSETTI+GF+PP+  RPYDLVG ALFGDGA A+
Sbjct  909   GCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAV  968

Query  720   VIGSNPVQELERPLFELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEF  899
             ++GSNPV   E P  EL+ A+Q F+PDT  +IDG+L+EEGI+FKL R+LPQ I++NI+ F
Sbjct  969   IVGSNPVWGQESPFMELNYAVQQFLPDTHNVIDGRLSEEGINFKLGRDLPQKIDENIEVF  1028

Query  900   CAKLMRVAGYSHKDDFNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASS  1079
             C KLM  A      DFN+LFWAVHPGGPAILN+LE  L+L+ +KL  SR+AL DYGN SS
Sbjct  1029  CKKLMAKANLK---DFNELFWAVHPGGPAILNKLEGTLKLTSDKLECSRQALMDYGNVSS  1085

Query  1080  NTIVYVLEYMLEEKKRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
             NTI YV+E M +E +++  +E  +WGL LAFGPGIT EGIL R+L
Sbjct  1086  NTIFYVMEKMRDELRKKEGSE--EWGLALAFGPGITFEGILLRSL  1128



>ref|XP_008444217.1| PREDICTED: chalcone synthase [Cucumis melo]
Length=389

 Score =   468 bits (1205),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 247/374 (66%), Positives = 293/374 (78%), Gaps = 6/374 (2%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PG A+I+ALGKAFP QLV QE LV+GY ++T C D  +K+KL RLCKTTTV+TRY VM 
Sbjct  22    TPGTATILALGKAFPSQLVPQECLVEGYIRDTKCIDTTIKEKLERLCKTTTVRTRYTVMC  81

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL KYPEL  EG PT++QRL+I NSAV +MA EAS  CIK+WGRS  +ITH+VYVSSS
Sbjct  82    KEILDKYPELVTEGSPTIRQRLEIANSAVVEMATEASKACIKEWGRSVEDITHIVYVSSS  141

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDLY+A  LGL+ D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSET
Sbjct  142   EIRLPGGDLYIANQLGLKNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  201

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGA A++IG++P+   E P  EL+ AIQ F+PDT+ +
Sbjct  202   TILGFRPPNNARPYDLVGAALFGDGAAAVIIGADPMLGQESPFMELNYAIQQFLPDTQNV  261

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             I+G+L+EEGISFKL R+LPQ I+DNI+ FC KLM+        +FN LFWAVHPGGPAIL
Sbjct  262   INGKLSEEGISFKLGRDLPQRIDDNIEGFCRKLMKKRNLM---NFNDLFWAVHPGGPAIL  318

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAF  1172
             N+LE  L L  EKL  SR+AL DYGN SSNTI YV+E M E  KRE   +  +WGL LAF
Sbjct  319   NKLENTLRLKSEKLECSRKALMDYGNVSSNTIFYVIENMRENLKRE---DGEEWGLALAF  375

Query  1173  GPGITLEGILTRNL  1214
             GPGIT EGIL R+L
Sbjct  376   GPGITFEGILIRSL  389



>ref|XP_008232397.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Prunus mume]
Length=1150

 Score =   491 bits (1265),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 250/374 (67%), Positives = 297/374 (79%), Gaps = 3/374 (1%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+++ALGKAFP QL+ Q+ LV+GY ++T C D  +K+KL RLCKTTTVKTRY VMS
Sbjct  780   TPGKATVLALGKAFPSQLIPQDCLVEGYIRDTKCVDVAIKEKLERLCKTTTVKTRYTVMS  839

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL KYPELA EG  T++QRL+I N AV QMA+EAS +CIK+WGR   +ITH+VYVSSS
Sbjct  840   KEILDKYPELATEGSATIRQRLEIANPAVVQMALEASLSCIKEWGRPVEDITHIVYVSSS  899

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDLYLA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSET
Sbjct  900   EIRLPGGDLYLASKLGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  959

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGA A+++GS P    E P  EL+ A+Q F+PDT  +
Sbjct  960   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGSKPKPGQETPFMELNYAVQQFLPDTHNV  1019

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+L+EEGI+FKL R+LPQ I++NI+EFC KLM  A      DFN+LFWAVHPGGPAIL
Sbjct  1020  IDGRLSEEGINFKLGRDLPQKIDENIEEFCKKLMAKASLK---DFNELFWAVHPGGPAIL  1076

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAF  1172
             N+LE  L+L  +KL  SRRAL DYGN SSNTI YV+E M EE K++ E E  +WGL LAF
Sbjct  1077  NKLESTLKLGSDKLECSRRALMDYGNVSSNTIFYVMENMREELKKKKEEEREEWGLALAF  1136

Query  1173  GPGITLEGILTRNL  1214
             GPGIT EGIL R+L
Sbjct  1137  GPGITFEGILMRSL  1150



>ref|NP_191915.1| Chalcone and stilbene synthase family protein [Arabidopsis thaliana]
 gb|AAC19299.1| similar to plant chalcone and stilbene synthases [Arabidopsis 
thaliana]
 emb|CAB80762.1| putative chalcone synthase [Arabidopsis thaliana]
 gb|AAN72004.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37822.1| At4g00040 [Arabidopsis thaliana]
 gb|AEE81817.1| Chalcone and stilbene synthase family protein [Arabidopsis thaliana]
Length=385

 Score =   466 bits (1199),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 239/375 (64%), Positives = 290/375 (77%), Gaps = 3/375 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A  GKA+++ALGKA P  +V QE LV+ Y +   CD+  +K KL  LCK+TTVKTRY VM
Sbjct  14    AYQGKATVLALGKALPSNVVSQENLVEEYLREIKCDNLSIKDKLQHLCKSTTVKTRYTVM  73

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S E L KYPELA EG PT+KQRL+I N AV QMA EAS  CIK+WGR+  +ITHLVYVSS
Sbjct  74    SRETLHKYPELATEGSPTIKQRLEIANDAVVQMAYEASLVCIKEWGRAVEDITHLVYVSS  133

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGL  + QRVMLYF GC GG++GLRVAKDIAENNPGSRVL+ TSE
Sbjct  134   SEFRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGLSGLRVAKDIAENNPGSRVLLTTSE  193

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             TT++GF+PP+  RPY+LVG ALFGDGA A++IG++P  E E P  ELH A+Q F+P T+ 
Sbjct  194   TTVLGFRPPNKARPYNLVGAALFGDGAAALIIGADPT-ESESPFMELHCAMQQFLPQTQG  252

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
             +IDG+L+EEGI+FKL R+LPQ IEDN++EFC KL+  AG S   + N LFWAVHPGGPAI
Sbjct  253   VIDGRLSEEGITFKLGRDLPQKIEDNVEEFCKKLVAKAG-SGALELNDLFWAVHPGGPAI  311

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILA  1169
             L+ LE KL+L PEKL  SRRAL DYGN SSNTI Y+++ + +E +++   E  +WGL LA
Sbjct  312   LSGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMDKVRDELEKKG-TEGEEWGLGLA  370

Query  1170  FGPGITLEGILTRNL  1214
             FGPGIT EG L RNL
Sbjct  371   FGPGITFEGFLMRNL  385



>gb|EMT21347.1| hypothetical protein F775_52323 [Aegilops tauschii]
Length=401

 Score =   466 bits (1198),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 243/392 (62%), Positives = 296/392 (76%), Gaps = 38/392 (10%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+I+ALG AFP QLVMQ+++V+G+ +NTNC+DP LK+KL RLCKTTTVKTRYVVMS
Sbjct  27    NPGKATILALGHAFPQQLVMQDYVVEGFMRNTNCNDPELKEKLARLCKTTTVKTRYVVMS  86

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EILK YPELA EG PT+KQRLDI N AVTQMA EAS  C+K   R              
Sbjct  87    DEILKSYPELAQEGWPTMKQRLDISNKAVTQMATEASLACVKASRRV-------------  133

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
                     L+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATSET
Sbjct  134   --------LHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSET  185

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             T+ GF+PPS DRPYDLVGVALFGDGAGA V+G++P   LERPLFELH+A+Q F+PDTEK 
Sbjct  186   TVAGFRPPSPDRPYDLVGVALFGDGAGAAVVGTDPT-PLERPLFELHSALQRFLPDTEKT  244

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMR---VAGYSHKDD---FNKLFWAVHP  974
             IDG+LTEEGI F+L RELP IIE +++ FC KL++    A  +  D+   ++K+FWAVHP
Sbjct  245   IDGRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDNMLTYDKMFWAVHP  304

Query  975   GGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESE------  1136
             GGPAIL ++E +L L   KL ASR AL D+GNASSNTIVYVLE M+EE ++ +E      
Sbjct  305   GGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESRQRAEAPEPEP  364

Query  1137  ----AEDSDWGLILAFGPGITLEGILTRNLTA  1220
                  ++ +WGLILAFGPGIT EGIL RNL A
Sbjct  365   EPEGGQECEWGLILAFGPGITFEGILARNLQA  396



>ref|XP_007219350.1| hypothetical protein PRUPE_ppa019432mg, partial [Prunus persica]
 gb|EMJ20549.1| hypothetical protein PRUPE_ppa019432mg, partial [Prunus persica]
Length=362

 Score =   464 bits (1193),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 231/341 (68%), Positives = 273/341 (80%), Gaps = 3/341 (1%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+++ALGKAFP QL+ Q+ LV+GY ++T C D  +K+KL RLCKTTTVKTRY VMS
Sbjct  25    TPGKATVLALGKAFPSQLIPQDCLVEGYIRDTKCVDVAIKEKLERLCKTTTVKTRYTVMS  84

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL KYPELA EG  T++QRL+I N AV QMA+EAS +CIK+WGR   +ITH+VYVSSS
Sbjct  85    KEILDKYPELATEGSATIRQRLEIANPAVVQMALEASLSCIKEWGRPVEDITHVVYVSSS  144

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDLYLA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSET
Sbjct  145   EIRLPGGDLYLASELGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  204

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PPS  RPYDLVG ALFGDGA A+++GSNP    E P  EL+ A+Q F+PDT  +
Sbjct  205   TILGFRPPSKARPYDLVGAALFGDGAAAVIVGSNPKPGQETPFMELNYAVQQFLPDTHNV  264

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+L+EEGI+FKL R+LPQ I++NI+EFC KLM  A      DFN+LFWAVHPGGPAIL
Sbjct  265   IDGRLSEEGINFKLGRDLPQKIDENIEEFCKKLMAKASLK---DFNELFWAVHPGGPAIL  321

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLE  1115
             N+LE  L+L  +KL  SRRAL DYGN SSNTI YV+E M E
Sbjct  322   NKLESTLKLGSDKLECSRRALMDYGNVSSNTIFYVMENMRE  362



>ref|XP_006396202.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
 gb|ESQ37655.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
Length=395

 Score =   464 bits (1195),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 239/376 (64%), Positives = 288/376 (77%), Gaps = 3/376 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP  +V QE LV+ Y +   CDD  +K KL  LCKTTTVKTRY VM
Sbjct  22    ANQGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDLSIKHKLQHLCKTTTVKTRYTVM  81

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S E L KYPELA EG PT+KQRL+I N AV QMA EAS  CIK+WGR   +ITHL+YVSS
Sbjct  82    SRETLHKYPELATEGSPTIKQRLEIANEAVVQMAYEASLACIKEWGRPVEDITHLIYVSS  141

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR + QRVMLYF GC GGV GLR+AKDIAENN GSRVL+ TSE
Sbjct  142   SEFRLPGGDLYLSAQLGLRHEVQRVMLYFLGCYGGVTGLRLAKDIAENNRGSRVLLTTSE  201

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             T ++GF+PP+  RPYDLVG ALFGDGA A++IG++P  E E P  ELH A+Q F+P T+ 
Sbjct  202   TMVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPT-ESESPFIELHCAMQKFLPGTQG  260

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGY-SHKDDFNKLFWAVHPGGPA  986
             +IDG+L+EEGISFKL R+LPQ IEDN+++FC KL+  AG  S   + N LFWAVHPGGPA
Sbjct  261   VIDGRLSEEGISFKLARDLPQRIEDNVEDFCKKLVAEAGSGSGSLELNDLFWAVHPGGPA  320

Query  987   ILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLIL  1166
             ILN LE KL+L P KL  SR+AL DYGNASSNTI Y+++ + +E  ++    + +WGL L
Sbjct  321   ILNGLETKLKLKPGKLECSRQALMDYGNASSNTIFYIMDKVRDELGKKGRGGE-EWGLGL  379

Query  1167  AFGPGITLEGILTRNL  1214
             AFGPGIT EG L R+L
Sbjct  380   AFGPGITFEGFLMRSL  395



>ref|XP_002511627.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF50296.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=1163

 Score =   484 bits (1247),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 253/374 (68%), Positives = 300/374 (80%), Gaps = 6/374 (2%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+++A+GKAFP QL+ Q+ LV+GY ++T C+D  +K+KL RLCKTTTVKTRY VMS
Sbjct  796   TPGKATVLAVGKAFPSQLIPQDCLVEGYIRDTKCEDVSIKEKLERLCKTTTVKTRYTVMS  855

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL+KYPE+AIEG  T+KQRLDI N AV +MA EAS  CIK+WGR   +ITH+VYVSSS
Sbjct  856   KEILEKYPEIAIEGSTTIKQRLDIANPAVVEMAKEASLACIKEWGRPVEDITHIVYVSSS  915

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDLYLA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSET
Sbjct  916   EIRLPGGDLYLASQLGLRNDVCRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  975

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGA A +IG++PV   E P  EL+ A+Q F+P T+ +
Sbjct  976   TILGFRPPNKARPYDLVGAALFGDGAAAAIIGADPVLSSESPFMELNYAVQQFLPGTQHV  1035

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+L+EEGI+FKL R+LPQ IEDNI+EFC KLM  AG +   +FN LFWAVHPGGPAIL
Sbjct  1036  IDGRLSEEGINFKLGRDLPQKIEDNIEEFCKKLMSKAGLT---EFNDLFWAVHPGGPAIL  1092

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAF  1172
             NRLE  L+L+ EKL  SR+AL DYGN SSNT+ YV+EYM EE KR+   E   WGL LAF
Sbjct  1093  NRLESTLKLNAEKLECSRKALMDYGNVSSNTVFYVIEYMREELKRKGSEE---WGLALAF  1149

Query  1173  GPGITLEGILTRNL  1214
             GPGIT EGIL R+L
Sbjct  1150  GPGITFEGILLRSL  1163



>ref|XP_006396200.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
 gb|ESQ37653.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
Length=538

 Score =   465 bits (1196),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 239/376 (64%), Positives = 288/376 (77%), Gaps = 3/376 (1%)
 Frame = +3

Query  90    ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
             A+ GKA+++ALGKAFP  +V QE LV+ Y +   CDD  +K KL  LCKTTTVKTRY VM
Sbjct  165   ANQGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDLSIKHKLQHLCKTTTVKTRYTVM  224

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             S E L KYPELA EG PT+KQRL+I N AV QMA EAS  CIK+WGR   +ITHL+YVSS
Sbjct  225   SRETLHKYPELATEGSPTIKQRLEIANEAVVQMAYEASLACIKEWGRPVEDITHLIYVSS  284

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             SE RLPGGDLYL+  LGLR + QRVMLYF GC GGV GLR+AKDIAENN GSRVL+ TSE
Sbjct  285   SEFRLPGGDLYLSAQLGLRHEVQRVMLYFLGCYGGVTGLRLAKDIAENNRGSRVLLTTSE  344

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
             T ++GF+PP+  RPYDLVG ALFGDGA A++IG++P  E E P  ELH A+Q F+P T+ 
Sbjct  345   TMVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPT-ESESPFIELHCAMQKFLPGTQG  403

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGY-SHKDDFNKLFWAVHPGGPA  986
             +IDG+L+EEGISFKL R+LPQ IEDN+++FC KL+  AG  S   + N LFWAVHPGGPA
Sbjct  404   VIDGRLSEEGISFKLARDLPQRIEDNVEDFCKKLVAEAGSGSGSLELNDLFWAVHPGGPA  463

Query  987   ILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLIL  1166
             ILN LE KL+L P KL  SR+AL DYGNASSNTI Y+++ + +E  ++    + +WGL L
Sbjct  464   ILNGLETKLKLKPGKLECSRQALMDYGNASSNTIFYIMDKVRDELGKKGRGGE-EWGLGL  522

Query  1167  AFGPGITLEGILTRNL  1214
             AFGPGIT EG L R+L
Sbjct  523   AFGPGITFEGFLMRSL  538



>ref|XP_010053966.1| PREDICTED: chalcone synthase-like [Eucalyptus grandis]
 gb|KCW78344.1| hypothetical protein EUGRSUZ_D02515 [Eucalyptus grandis]
Length=393

 Score =   456 bits (1174),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 245/380 (64%), Positives = 294/380 (77%), Gaps = 7/380 (2%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             +  +PGKA+I+A+GKAFP Q++ QE LV+G+ ++T C+D  +K+KL RLCKTTTVKTRY 
Sbjct  19    RSPTPGKATILAIGKAFPSQVIPQECLVEGFIRDTKCEDASIKEKLERLCKTTTVKTRYT  78

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMS+EIL KYPEL  EG PT+ QRL+I N AVT+MA++AS +CIK+WGR P  ITHLVYV
Sbjct  79    VMSKEILDKYPELVREGSPTLNQRLEIANPAVTEMALQASLSCIKQWGRPPGHITHLVYV  138

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSE RLPGGDL+LA  LGLR D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ T
Sbjct  139   SSSELRLPGGDLHLATRLGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTT  198

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQ-ELERPLFELHTAIQHFVPD  800
             SETTI+GF+PP+  RPYDLVG ALFGDGA A +IG++P+    E P  EL  A Q F+P 
Sbjct  199   SETTILGFRPPNKARPYDLVGAALFGDGAAAAIIGADPLLCHGESPFMELRHAAQRFLPG  258

Query  801   TEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGG  980
             T  +IDG+L++EGI FKL R+LPQ IE NI+EFC  LM  AG S  + FN +FWAVHPGG
Sbjct  259   THDVIDGRLSDEGIYFKLGRDLPQKIEANIEEFCKGLMATAGLS--EGFNDVFWAVHPGG  316

Query  981   PAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE-KKRESEAEDSDWG  1157
             PAI+N+LE  L+L  +KL  SR+AL DYGN SSNTI YV+E M +E  KRE   E   WG
Sbjct  317   PAIMNKLESTLKLRSDKLECSRKALMDYGNVSSNTIFYVIENMRDELMKREGGEE---WG  373

Query  1158  LILAFGPGITLEGILTRNLT  1217
             L LAFGPGIT EGIL R+L+
Sbjct  374   LALAFGPGITFEGILVRSLS  393



>gb|EPS63204.1| hypothetical protein M569_11580, partial [Genlisea aurea]
Length=373

 Score =   448 bits (1153),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 243/374 (65%), Positives = 300/374 (80%), Gaps = 4/374 (1%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             + GKA+++A+GKAFP Q+V Q+ LV+G+ ++TNC D ++K KL RLCKTTTV+TRY VMS
Sbjct  4     TAGKATVLAMGKAFPSQVVPQDCLVEGFIRDTNCHDSIIKDKLQRLCKTTTVRTRYTVMS  63

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL ++PELA+EG PT+KQRL I N+AV QMA EAS +C+++WGR  ++ITH+VYV+SS
Sbjct  64    KEILDEFPELAMEGSPTIKQRLQIANTAVVQMAKEASLSCLREWGRPASDITHVVYVTSS  123

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGGDL+LA  LGL P   RVMLYF GC GGV GLRVAKDIAENNPGSRVLVATSET
Sbjct  124   EIRLPGGDLHLAAELGLNPHVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLVATSET  183

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+GF+PP+  RPYDLVG ALFGDGA A V+G++PV+  E P  EL+ A+Q F+P T  +
Sbjct  184   TILGFRPPNRSRPYDLVGAALFGDGAAAAVVGADPVEGRESPFLELNAAMQKFLPGTSDV  243

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+L+EEGI FKL R+LPQ IEDNI+ FC +LM  AG S   ++N LFWAVHPGGPAIL
Sbjct  244   IDGRLSEEGIYFKLGRDLPQRIEDNIECFCRELMSAAGLS---EYNDLFWAVHPGGPAIL  300

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAF  1172
             N LE++L+L   KL  SRRAL D+GN SSNTI YV+EYM +E K + EA + +WGL LAF
Sbjct  301   NGLERRLKLDKAKLDCSRRALMDFGNVSSNTIFYVMEYMRKEMKEKGEAAE-EWGLGLAF  359

Query  1173  GPGITLEGILTRNL  1214
             GPGIT EGIL RN+
Sbjct  360   GPGITFEGILLRNV  373



>ref|XP_010934708.1| PREDICTED: chalcone synthase-like [Elaeis guineensis]
Length=331

 Score =   442 bits (1136),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 224/336 (67%), Positives = 266/336 (79%), Gaps = 6/336 (2%)
 Frame = +3

Query  207   LKQKLTRLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASW  386
             +K+KL RLCK TTVK R+ VMS+EIL KYPELA EG PT+KQ+LDI N+AV +MA+EAS 
Sbjct  1     MKEKLERLCKNTTVKRRFTVMSKEILDKYPELATEGSPTIKQKLDIANAAVVEMAVEASR  60

Query  387   TCIKKWGRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGL  566
              C+ +W R   +ITH++YVSSSE RLPGGDLYLA  LGLR +  RVMLYF GC GGV GL
Sbjct  61    ACMAEWKRPAGDITHIIYVSSSEIRLPGGDLYLANHLGLRSNVGRVMLYFLGCYGGVTGL  120

Query  567   RVAKDIAENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQE  746
             RVAKDIAENNPGSR+L+ATSETTI+GF+PP+  RPYDLVG ALFGDGA A+VIG++P+  
Sbjct  121   RVAKDIAENNPGSRILLATSETTILGFRPPNMARPYDLVGAALFGDGAAAVVIGADPIDG  180

Query  747   LERPLFELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAG  926
             +E P  EL  A+Q F+P T  IIDG+++EEGI+FKL R+LPQ+IE +I+ FC  LM  AG
Sbjct  181   VETPFMELDYAVQQFLPGTHNIIDGRISEEGINFKLGRDLPQMIEGHIEGFCRMLMAKAG  240

Query  927   YSHKDDFNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEY  1106
                  DFN+LFWAVHPGGPAILNRLE  L L PEKL  SRRAL DYGNASSNT+ YV++Y
Sbjct  241   LQ---DFNELFWAVHPGGPAILNRLESSLRLRPEKLQCSRRALMDYGNASSNTVFYVMDY  297

Query  1107  MLEEKKRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
             M EE +RE   E   WGL+LAFGPGIT EGIL R+L
Sbjct  298   MREELRREGGDE---WGLVLAFGPGITFEGILVRSL  330



>ref|XP_001781520.1| predicted protein [Physcomitrella patens]
 gb|EDQ53700.1| predicted protein [Physcomitrella patens]
Length=418

 Score =   438 bits (1126),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 224/384 (58%), Positives = 284/384 (74%), Gaps = 8/384 (2%)
 Frame = +3

Query  78    GGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTR  257
             G ++ +PGK +IMA+G+A P      + L D Y +  N  DPVL+ KL RLC+TTTVKTR
Sbjct  37    GHRQVTPGKTTIMAIGRAVPANTTFNDGLADHYIQEFNLQDPVLQAKLRRLCETTTVKTR  96

Query  258   YVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLV  437
             Y+V+++EIL ++PE  ++G  TV QRL I   AVTQ+  EA+   IK+WGR  +EITHLV
Sbjct  97    YLVVNKEILDEHPEFLVDGAATVSQRLAITGEAVTQLGHEAATAAIKEWGRPASEITHLV  156

Query  438   YVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLV  617
             YVSSSE RLPGGDLYLA+ LGLR D  RVMLY  GC GG +G+RVAKD+AENNPGSRVL+
Sbjct  157   YVSSSEIRLPGGDLYLAQLLGLRSDVNRVMLYMLGCYGGASGIRVAKDLAENNPGSRVLL  216

Query  618   ATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVP  797
              TSE T+IG+K  S DRPYDLVG ALFGDGA AM++G +P+  LER  FEL  A Q F+P
Sbjct  217   ITSECTLIGYKSLSPDRPYDLVGAALFGDGAAAMIMGKDPIPVLERAFFELDWAGQSFIP  276

Query  798   DTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPG  977
              T K IDG+L+EEGISFKL RELP++IE NI  FC  +++ AG      +N +FWAVHPG
Sbjct  277   GTNKTIDGRLSEEGISFKLGRELPKLIESNIQGFCDPILKRAG---GLKYNDIFWAVHPG  333

Query  978   GPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDS---  1148
             GPAILN ++K+L+L+PEKL  +R+ L DYGN SS+T +YVL+YM  +  +  EA D+   
Sbjct  334   GPAILNAVQKQLDLAPEKLQTARQVLRDYGNISSSTCIYVLDYMRHQSLKLKEANDNVNT  393

Query  1149  --DWGLILAFGPGITLEGILTRNL  1214
               +WGL+LAFGPG+T+EG L RNL
Sbjct  394   EPEWGLLLAFGPGVTIEGALLRNL  417



>ref|XP_003574084.1| PREDICTED: chalcone synthase-like [Brachypodium distachyon]
Length=386

 Score =   436 bits (1122),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 226/386 (59%), Positives = 281/386 (73%), Gaps = 6/386 (2%)
 Frame = +3

Query  51    MGFGDAVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRL  230
             +G GD + + G   S GKA ++ALGK  P  +  Q+ LV+ Y ++T CDDP  + KL RL
Sbjct  4     LGLGD-IGRSGNGRSHGKAKLLALGKGLPEHVQPQDKLVETYLQDTRCDDPATRAKLERL  62

Query  231   CKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGR  410
             CKTTTVKTRY VMS+E+L ++PEL  EG PT+  RLDICN+AV ++   A+   + +WGR
Sbjct  63    CKTTTVKTRYTVMSKELLDEHPELKTEGTPTLTPRLDICNAAVLELGAAAAHAALGEWGR  122

Query  411   SPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAE  590
                EITHLVY+SSSE RLPGGDL+LA  LGL P+T R  L F GCSGG A LR AKDIAE
Sbjct  123   PAVEITHLVYISSSELRLPGGDLFLATRLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAE  182

Query  591   NNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFEL  770
             NNPGSRVLV  +ETT++GF+PPS DRPYDLVG ALFGDGA A +IG++P+   E P  EL
Sbjct  183   NNPGSRVLVIAAETTVLGFRPPSPDRPYDLVGAALFGDGASAAIIGASPITAEENPFLEL  242

Query  771   HTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFN  950
               + Q F+P T+K+IDG++TEEGI+FKL R+LP+ IE  I+ FC  LM   G     +FN
Sbjct  243   EFSTQEFLPGTDKVIDGKITEEGINFKLGRDLPEKIESRIEGFCRILMDKVGIK---EFN  299

Query  951   KLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE  1130
              +FWAVHPGGPAILNRLE  L+L P+KL  SR+AL +YGN SSNT+ YVLEY+ +  K+ 
Sbjct  300   DVFWAVHPGGPAILNRLEICLQLDPDKLKISRKALMNYGNVSSNTVFYVLEYLRDGLKKG  359

Query  1131  SEAEDSDWGLILAFGPGITLEGILTR  1208
                E  +WGLILAFGPGIT EG+L R
Sbjct  360   MIRE--EWGLILAFGPGITFEGMLVR  383



>ref|XP_008775196.1| PREDICTED: chalcone synthase-like [Phoenix dactylifera]
Length=331

 Score =   434 bits (1116),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 223/336 (66%), Positives = 265/336 (79%), Gaps = 6/336 (2%)
 Frame = +3

Query  207   LKQKLTRLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASW  386
             +K+KL RLCK TTVK R+ VMS+EIL+KYPELA EG PT+KQRLDI N+AV +MA+EAS 
Sbjct  1     MKEKLERLCKNTTVKRRFTVMSKEILEKYPELATEGSPTIKQRLDIANAAVLEMAVEASR  60

Query  387   TCIKKWGRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGL  566
              C+ +W R+  +ITH+VYVSSSE RLPGGDLYLA  LGLR +  RVMLYF GC GGVAGL
Sbjct  61    ACMAEWKRAAGDITHIVYVSSSEIRLPGGDLYLADQLGLRSNVGRVMLYFLGCYGGVAGL  120

Query  567   RVAKDIAENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQE  746
             RVAKDIAENNPGSRVL+ TSETTI+GF+PP+  RPYDLVG ALFGDGA A+VIG++PV+ 
Sbjct  121   RVAKDIAENNPGSRVLLTTSETTILGFRPPNMARPYDLVGAALFGDGAAAVVIGADPVEG  180

Query  747   LERPLFELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAG  926
              E P  EL  A+Q F+P T  IIDG+++EEGISFKL R+LPQ+IE +I+ FC  LM  AG
Sbjct  181   TETPFMELDYAVQQFLPGTHNIIDGRISEEGISFKLGRDLPQMIEGHIEGFCRMLMANAG  240

Query  927   YSHKDDFNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEY  1106
                  DFN+LFWAVHPGGPAILNRLE  L L PEKL  SRRAL DYGNASSNT+ YV++Y
Sbjct  241   L---QDFNELFWAVHPGGPAILNRLESSLGLRPEKLQCSRRALMDYGNASSNTVFYVMDY  297

Query  1107  MLEEKKRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
             +   ++        +WGL+LAFGPGIT EGIL R+L
Sbjct  298   V---REELRREGGEEWGLVLAFGPGITFEGILVRSL  330



>ref|XP_010661353.1| PREDICTED: chalcone synthase isoform X1 [Vitis vinifera]
Length=409

 Score =   434 bits (1116),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 222/327 (68%), Positives = 259/327 (79%), Gaps = 6/327 (2%)
 Frame = +3

Query  234   KTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRS  413
             KTTTVKTRY VMS+EIL+KYPELA EG PT+KQ+L+I N AV QMA+EAS  CI++WGR 
Sbjct  89    KTTTVKTRYTVMSKEILEKYPELATEGSPTIKQKLEIANPAVLQMAMEASLACIEEWGRP  148

Query  414   PTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAEN  593
               +ITH+VYVSSSE RLPGGDLYLA  LGLR D  R+MLYF GC GGV GLRVAKDIAEN
Sbjct  149   VGDITHIVYVSSSEIRLPGGDLYLASQLGLRSDVGRIMLYFLGCYGGVTGLRVAKDIAEN  208

Query  594   NPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELH  773
             NPGSRVL+ TSETTI+GF+PP+ +RPYDLVG ALFGDGA A+++G++P+   E P  EL+
Sbjct  209   NPGSRVLLTTSETTILGFRPPNKERPYDLVGAALFGDGAAAVIVGTDPIPGKECPFMELN  268

Query  774   TAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNK  953
              A+Q F+P T  +IDG+L+EEGI+FKL R+LP  IE+NI+EFC KLM  AG     +FN 
Sbjct  269   HAVQQFLPGTHNVIDGRLSEEGINFKLGRDLPAKIEENIEEFCKKLMEKAGLV---EFND  325

Query  954   LFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRES  1133
             LFWAVHPGGPAILNRLE  L+L  EKL  SRRAL DYGN SSNTI YV+EYM E  KR+ 
Sbjct  326   LFWAVHPGGPAILNRLESTLKLRSEKLECSRRALMDYGNVSSNTIFYVMEYMREALKRKG  385

Query  1134  EAEDSDWGLILAFGPGITLEGILTRNL  1214
               E   WGL LAFGPGIT EGIL R+L
Sbjct  386   GEE---WGLALAFGPGITFEGILIRSL  409



>ref|NP_001064891.1| Os10g0484800 [Oryza sativa Japonica Group]
 gb|AAL59036.1|AC087182_19 anther-specific protein YY2 [Oryza sativa Japonica Group]
 dbj|BAA23618.1| YY2 protein [Oryza sativa]
 gb|AAP54339.1| Chalcone and stilbene synthases, N-terminal domain containing 
protein, expressed [Oryza sativa Japonica Group]
 dbj|BAC78574.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF26805.1| Os10g0484800 [Oryza sativa Japonica Group]
 gb|EAZ16469.1| hypothetical protein OsJ_31939 [Oryza sativa Japonica Group]
 dbj|BAG97274.1| unnamed protein product [Oryza sativa Japonica Group]
Length=389

 Score =   428 bits (1100),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 230/391 (59%), Positives = 287/391 (73%), Gaps = 7/391 (2%)
 Frame = +3

Query  51    MGFGDAVLQGGKKA--SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLT  224
             +GFGDA    G ++  S GKA ++ALGK  P Q++ QE +V+ Y ++T CDDP  + KL 
Sbjct  4     LGFGDARSGNGSRSQCSRGKAMLLALGKGLPEQVLPQEKVVETYLQDTICDDPATRAKLE  63

Query  225   RLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKW  404
             RLCKTTTV+TRY VMS+E+L ++PEL  EG PT+  RLDICN+AV ++   A+   + +W
Sbjct  64    RLCKTTTVRTRYTVMSKELLDEHPELRTEGTPTLTPRLDICNAAVLELGATAARAALGEW  123

Query  405   GRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDI  584
             GR   +ITHLVY+SSSE RLPGGDL+LA  LGL P+T R  L F GCSGG A LR AKDI
Sbjct  124   GRPAADITHLVYISSSELRLPGGDLFLATRLGLHPNTVRTSLLFLGCSGGAAALRTAKDI  183

Query  585   AENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLF  764
             AENNPGSRVLV  +ETT++GF+PPS DRPYDLVG ALFGDGA A +IG+ P+   E P  
Sbjct  184   AENNPGSRVLVVAAETTVLGFRPPSPDRPYDLVGAALFGDGASAAIIGAGPIAAEESPFL  243

Query  765   ELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDD  944
             EL  + Q F+P T+K+IDG++TEEGI+FKL R+LP+ IE+ I+ FC  LM   G     +
Sbjct  244   ELQFSTQEFLPGTDKVIDGKITEEGINFKLGRDLPEKIENRIEGFCRTLMDRVGIK---E  300

Query  945   FNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK  1124
             FN +FWAVHPGGPAILNRLE  LEL PEKL  SR+AL +YGN SSNT+ YVLEY+ +E K
Sbjct  301   FNDVFWAVHPGGPAILNRLEVCLELQPEKLKISRKALMNYGNVSSNTVFYVLEYLRDELK  360

Query  1125  RESEAEDSDWGLILAFGPGITLEGILTRNLT  1217
             +    E  +WGLILAFGPGIT EG+L R + 
Sbjct  361   KGMIRE--EWGLILAFGPGITFEGMLVRGIN  389



>ref|NP_001150611.1| chalcone synthase G [Zea mays]
 gb|ACG39754.1| chalcone synthase G [Zea mays]
 tpg|DAA49571.1| TPA: chalcone synthase G [Zea mays]
Length=385

 Score =   428 bits (1100),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 220/387 (57%), Positives = 281/387 (73%), Gaps = 10/387 (3%)
 Frame = +3

Query  54    GFGDAVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLC  233
             G G     G  ++S  KA ++ALGK+FP Q++ QE +V+ Y + ++CDDP  + KL RL 
Sbjct  3     GSGSTGANGKSQSSRAKAMLLALGKSFPDQVLPQEKVVESYLQESSCDDPATRAKLQRL-  61

Query  234   KTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRS  413
                 +KTRY VMS+E+L K+PEL +EG PT+  RLDICN+AV  +   A+   + +WGR 
Sbjct  62    ----LKTRYTVMSKELLDKHPELKMEGTPTLTPRLDICNAAVIDLGAAAARAALDEWGRP  117

Query  414   PTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAEN  593
               +ITHL+Y+SSS+ RLPGGDL+LA  LGL P+T R  L F GCSGG A LR AKDIAEN
Sbjct  118   AADITHLIYISSSDLRLPGGDLHLAARLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAEN  177

Query  594   NPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELH  773
             NPGSRVLV  +ETT++GF+PPS DRPYDLVG ALFGDGA A++IG+ P+   E P  EL 
Sbjct  178   NPGSRVLVTAAETTVLGFRPPSYDRPYDLVGAALFGDGASAVIIGAGPMTPAENPFLELE  237

Query  774   TAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNK  953
              + Q F+P T+K+IDG+++EEGI+FKL R+LP+ IE  I+ FC  LM   G     DFN 
Sbjct  238   FSTQEFLPGTDKVIDGKISEEGINFKLGRDLPEKIESRIEGFCRTLMNKVGIK---DFND  294

Query  954   LFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRES  1133
             +FWAVHPGGPAILNRLE  L+L PEKL  SR+AL +YGN SSNTI YVLEY+ +E K+ +
Sbjct  295   IFWAVHPGGPAILNRLEFCLKLQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDELKKGA  354

Query  1134  EAEDSDWGLILAFGPGITLEGILTRNL  1214
              +E  +WGLILAFGPGIT EG+L R +
Sbjct  355   ISE--EWGLILAFGPGITFEGLLVRGV  379



>gb|EAY78973.1| hypothetical protein OsI_34081 [Oryza sativa Indica Group]
Length=389

 Score =   427 bits (1098),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 230/391 (59%), Positives = 286/391 (73%), Gaps = 7/391 (2%)
 Frame = +3

Query  51    MGFGDAVLQGGKKA--SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLT  224
             +GFGDA    G ++  S GKA ++ALGK  P Q++ QE +V+ Y ++T CDDP  + KL 
Sbjct  4     LGFGDARSGNGSRSQCSRGKAMLLALGKGLPEQVLPQEKVVETYLQDTICDDPATRAKLE  63

Query  225   RLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKW  404
             RLCKTTTV+TRY VMS+E+L ++PEL  EG PT+  RLDICN+AV ++   A+   + +W
Sbjct  64    RLCKTTTVRTRYTVMSKELLDEHPELRTEGTPTLTPRLDICNAAVLELGATAARAALGEW  123

Query  405   GRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDI  584
             GR   +ITHLVY+SSSE RLPGGDL+LA  LGL P+T R  L F GCSGG A LR AKDI
Sbjct  124   GRPAADITHLVYISSSELRLPGGDLFLATRLGLHPNTVRTSLLFLGCSGGAAALRTAKDI  183

Query  585   AENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLF  764
             AENNPGSRVLV  +ETT++GF+PPS DRPYDLVG ALFGDGA A +IG+ P+   E P  
Sbjct  184   AENNPGSRVLVVAAETTVLGFRPPSPDRPYDLVGAALFGDGASAAIIGAGPIAAEESPFL  243

Query  765   ELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDD  944
             EL  + Q F+P T+K+IDG++TEEGI+FKL R+LP+ IE  I+ FC  LM   G     +
Sbjct  244   ELQFSTQEFLPGTDKVIDGKITEEGINFKLGRDLPEKIESRIEGFCRTLMDRVGIK---E  300

Query  945   FNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK  1124
             FN +FWAVHPGGPAILNRLE  LEL PEKL  SR+AL +YGN SSNT+ YVLEY+ +E K
Sbjct  301   FNDVFWAVHPGGPAILNRLEVCLELQPEKLKISRKALMNYGNVSSNTVFYVLEYLRDELK  360

Query  1125  RESEAEDSDWGLILAFGPGITLEGILTRNLT  1217
             +    E  +WGLILAFGPGIT EG+L R + 
Sbjct  361   KGMIRE--EWGLILAFGPGITFEGMLVRGIN  389



>ref|XP_008678397.1| PREDICTED: chalcone synthase G isoform X1 [Zea mays]
 gb|ACF85939.1| unknown [Zea mays]
 tpg|DAA49572.1| TPA: hypothetical protein ZEAMMB73_179866 [Zea mays]
Length=390

 Score =   425 bits (1093),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 225/387 (58%), Positives = 285/387 (74%), Gaps = 5/387 (1%)
 Frame = +3

Query  54    GFGDAVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLC  233
             G G     G  ++S  KA ++ALGK+FP Q++ QE +V+ Y + ++CDDP  + KL RLC
Sbjct  3     GSGSTGANGKSQSSRAKAMLLALGKSFPDQVLPQEKVVESYLQESSCDDPATRAKLQRLC  62

Query  234   KTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRS  413
              TTTVKTRY VMS+E+L K+PEL +EG PT+  RLDICN+AV  +   A+   + +WGR 
Sbjct  63    TTTTVKTRYTVMSKELLDKHPELKMEGTPTLTPRLDICNAAVIDLGAAAARAALDEWGRP  122

Query  414   PTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAEN  593
               +ITHL+Y+SSS+ RLPGGDL+LA  LGL P+T R  L F GCSGG A LR AKDIAEN
Sbjct  123   AADITHLIYISSSDLRLPGGDLHLAARLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAEN  182

Query  594   NPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELH  773
             NPGSRVLV  +ETT++GF+PPS DRPYDLVG ALFGDGA A++IG+ P+   E P  EL 
Sbjct  183   NPGSRVLVTAAETTVLGFRPPSYDRPYDLVGAALFGDGASAVIIGAGPMTPAENPFLELE  242

Query  774   TAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNK  953
              + Q F+P T+K+IDG+++EEGI+FKL R+LP+ IE  I+ FC  LM   G     DFN 
Sbjct  243   FSTQEFLPGTDKVIDGKISEEGINFKLGRDLPEKIESRIEGFCRTLMNKVGIK---DFND  299

Query  954   LFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRES  1133
             +FWAVHPGGPAILNRLE  L+L PEKL  SR+AL +YGN SSNTI YVLEY+ +E K+ +
Sbjct  300   IFWAVHPGGPAILNRLEFCLKLQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDELKKGA  359

Query  1134  EAEDSDWGLILAFGPGITLEGILTRNL  1214
              +E  +WGLILAFGPGIT EG+L R +
Sbjct  360   ISE--EWGLILAFGPGITFEGLLVRGV  384



>gb|ACN35784.1| unknown [Zea mays]
Length=339

 Score =   422 bits (1086),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 217/332 (65%), Positives = 261/332 (79%), Gaps = 15/332 (5%)
 Frame = +3

Query  267   MSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVS  446
             MS+EILK YPELA EGLPT+ QRLDI N+AVTQMA EAS +C++ WG + + ITHLVYVS
Sbjct  1     MSDEILKNYPELAQEGLPTMNQRLDISNAAVTQMATEASLSCVRSWGGALSSITHLVYVS  60

Query  447   SSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATS  626
             SSEAR PGGDL+LA+ LGL PD +RVML F+GCSGGVAGLRVAK +AE+ PG+RVL+ATS
Sbjct  61    SSEARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATS  120

Query  627   ETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTE  806
             ETTI+GF+PPS DRPYDLVGVALFGDGAGA VIG++P    ERPLFELH+A+Q F+PDTE
Sbjct  121   ETTIVGFRPPSPDRPYDLVGVALFGDGAGAAVIGTDPAPA-ERPLFELHSALQRFLPDTE  179

Query  807   KIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDD--------FNKLFW  962
             + I+G+LTEEGI F+L RELP IIE ++++FC KLM+        D        +  +FW
Sbjct  180   RTIEGRLTEEGIKFQLGRELPHIIEAHVEDFCQKLMKERQSGEDADGGGPEPMSYGDMFW  239

Query  963   AVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKR-----  1127
             AVHPGGPAIL ++E +L L  +KL ASR AL D+GNASSNTIVYVLE M+E+ +R     
Sbjct  240   AVHPGGPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMVEDTRRRRLLA  299

Query  1128  -ESEAEDSDWGLILAFGPGITLEGILTRNLTA  1220
              +   ED +WGLILAFGPGIT EGIL RNL A
Sbjct  300   ADDGGEDCEWGLILAFGPGITFEGILARNLQA  331



>gb|EAZ39507.1| hypothetical protein OsJ_23944 [Oryza sativa Japonica Group]
Length=410

 Score =   424 bits (1091),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 235/405 (58%), Positives = 282/405 (70%), Gaps = 49/405 (12%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLC-------------  233
             +PGKA+I+ALG AFP QLVMQ+++VDG+ +NTNCDDP LK+KLTRLC             
Sbjct  20    NPGKATILALGHAFPQQLVMQDYVVDGFMRNTNCDDPELKEKLTRLCTVPDPNLIICSYK  79

Query  234   -----------KTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEA  380
                        KTTTVKTRYVVMSEEILK YPELA EG PT+KQRLDI N AVTQMA EA
Sbjct  80    YIYSTIIELACKTTTVKTRYVVMSEEILKSYPELAQEGQPTMKQRLDISNKAVTQMATEA  139

Query  381   SWTCIKKWGRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVA  560
             S  C++ WG + +EITHLVYVSSSEAR PGGDL+LA+ LGL PD +RVML F+GCSGGVA
Sbjct  140   SLACVRSWGGALSEITHLVYVSSSEARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVA  199

Query  561   GLRVAKDIAENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPV  740
             GLRVAK +AE+ P       +S +                          GA V+G++P 
Sbjct  200   GLRVAKGLAESCPAPTAPTTSSASPSSATA-------------------PGAAVVGADPT  240

Query  741   QELERPLFELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRV  920
               +ERPLFELH+A+Q F+PDT+K IDG+LTEEGI F+L RELP IIE N++ FC KLM+ 
Sbjct  241   -PVERPLFELHSALQRFLPDTDKTIDGRLTEEGIKFQLGRELPHIIEANVEAFCQKLMQE  299

Query  921   -AGYSHKDDFNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYV  1097
                 + K  +  +FWAVHPGGPAIL ++E +L L   KL ASR AL D+GNASSNTIVYV
Sbjct  300   HPQAADKLTYGDMFWAVHPGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYV  359

Query  1098  LEYMLEEKKR----ESEAEDSDWGLILAFGPGITLEGILTRNLTA  1220
             LE M+EE ++     +E ED +WGLILAFGPGIT EGIL RNL A
Sbjct  360   LENMVEETRQRREEAAEEEDCEWGLILAFGPGITFEGILARNLQA  404



>emb|CAA62921.1| chalcone synthase-like [Oryza sativa Japonica Group]
Length=389

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 225/391 (58%), Positives = 281/391 (72%), Gaps = 7/391 (2%)
 Frame = +3

Query  51    MGFGDAVLQGGKKA--SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLT  224
             +GFGDA    G ++  S GKA ++ALGK  P Q++ QE +V+ Y ++T C+DP  + KL 
Sbjct  4     LGFGDARSGNGSRSQCSRGKAMLLALGKGLPEQVLPQEKVVETYLQDTICNDPATRAKLE  63

Query  225   RLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKW  404
             RLCKTTTV+TRY VMS+E+L ++PEL  EG PT+  RLDICN+AV ++   A+   + +W
Sbjct  64    RLCKTTTVRTRYTVMSKELLDEHPELRTEGTPTLTPRLDICNAAVLELGATAARAALGEW  123

Query  405   GRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDI  584
             GR   +ITHLVY+SSSE RLPGGDL+LA  LGL P+T R  L F GCSGG A  R AKDI
Sbjct  124   GRPAVDITHLVYISSSELRLPGGDLFLATRLGLHPNTVRTSLLFLGCSGGAAAFRTAKDI  183

Query  585   AENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLF  764
             AENNPGSRVLV  +ETT++GF+PPS DRPYDLVG ALFGDGA A +IG+ P+   E P  
Sbjct  184   AENNPGSRVLVVAAETTVLGFRPPSPDRPYDLVGAALFGDGASAAIIGAGPIAAEESPFL  243

Query  765   ELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDD  944
             EL  + Q F+P T+K+IDG++TEEGI+FKL R+LP+ IE  I+ FC  LM   G     +
Sbjct  244   ELQFSTQEFLPGTDKVIDGKITEEGINFKLGRDLPEKIESRIEGFCRTLMDRVGIK---E  300

Query  945   FNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKK  1124
             FN +FWAVHPGGPAILNRLE   EL  EKL  SR+AL +YGN  SNT+ YVLEY+  E K
Sbjct  301   FNDVFWAVHPGGPAILNRLEVCFELQREKLKISRKALMNYGNVRSNTVFYVLEYLRAELK  360

Query  1125  RESEAEDSDWGLILAFGPGITLEGILTRNLT  1217
             +    E  +WGLILAFGPGIT EG+L R + 
Sbjct  361   KGMIRE--EWGLILAFGPGITFEGMLVRGIN  389



>ref|XP_004982809.1| PREDICTED: stilbene synthase 4-like [Setaria italica]
Length=387

 Score =   421 bits (1083),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 226/389 (58%), Positives = 286/389 (74%), Gaps = 10/389 (3%)
 Frame = +3

Query  66    AVLQGG-----KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRL  230
             +V+ GG     ++ S GKA ++ALGK  P Q++ QE +V+ Y +++ CDDP  + KL RL
Sbjct  4     SVVSGGANGKSQQGSRGKAMLLALGKGLPGQVLPQEKVVESYLQDSTCDDPATRAKLERL  63

Query  231   CKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGR  410
             CKTTTV+TRY VM++E+L ++PEL  EG+PT+  RLDICNSAV  +   A+   +  WGR
Sbjct  64    CKTTTVRTRYTVMTKELLDEHPELKTEGIPTLTPRLDICNSAVIDLGAAAARAALDDWGR  123

Query  411   SPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAE  590
                +ITHLVY+SSSE RLPGGDL+LA  LGL P+T R  L F GCSGG A LR AKDIAE
Sbjct  124   PAADITHLVYISSSELRLPGGDLHLAARLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAE  183

Query  591   NNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFEL  770
             NNPGSRVLV  +ETT++GF+PPS DRPYDLVG ALFGDGA A+++G+ P+   E P  EL
Sbjct  184   NNPGSRVLVTAAETTVLGFRPPSYDRPYDLVGAALFGDGASAVIVGAGPMTPAENPFLEL  243

Query  771   HTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFN  950
               + Q F+P T+K+IDG+++EEGI+FKL R+LP+ IE  I+ FC  LM   G     DFN
Sbjct  244   EFSTQEFLPGTDKVIDGKISEEGINFKLGRDLPEKIESRIEGFCRNLMDQVGIK---DFN  300

Query  951   KLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE  1130
              +FWAVHPGGPAILNRLE  LEL PEKL  SR+AL +YGN SSNTI YVLEY+ +E K+ 
Sbjct  301   DVFWAVHPGGPAILNRLEFCLELQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDELKKG  360

Query  1131  SEAEDSDWGLILAFGPGITLEGILTRNLT  1217
             + +E  +WGLILAFGPGIT EG+L R + 
Sbjct  361   AISE--EWGLILAFGPGITFEGLLVRGVN  387



>ref|XP_002467058.1| hypothetical protein SORBIDRAFT_01g018950 [Sorghum bicolor]
 gb|EER94056.1| hypothetical protein SORBIDRAFT_01g018950 [Sorghum bicolor]
Length=387

 Score =   421 bits (1081),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 223/377 (59%), Positives = 282/377 (75%), Gaps = 5/377 (1%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             +++S GKA ++ALGK FP Q++ QE +V+ Y ++++CDDP  + KL RLC TTTV+TRY 
Sbjct  10    QQSSRGKAMLLALGKGFPDQVLPQEKVVESYLQDSSCDDPATRAKLERLCTTTTVRTRYT  69

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMS+E+L K+PEL +EG PT+  RLDICN+AV  +   A+   +  WGR   +ITHL+Y+
Sbjct  70    VMSKELLDKHPELKMEGTPTLTPRLDICNAAVIDLGAAAARAALDDWGRPAADITHLIYI  129

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSE RLPGGD++LA  LGL P+T R  L F GCSGG A LR AKDIAENNPGSRVLV  
Sbjct  130   SSSELRLPGGDVHLAARLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVTA  189

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             +ETT++GF+PPS DRPYDLVG ALFGDGA A++IG+ P+   E P  EL  + Q F+P T
Sbjct  190   AETTVLGFRPPSYDRPYDLVGAALFGDGASAVIIGAGPMAPAEDPFLELEFSTQEFLPGT  249

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             +K+IDG++ EEGI+FKL R+LP+ IE  I+ FC  LM   G     DFN +FWAVHPGGP
Sbjct  250   DKVIDGKIAEEGINFKLGRDLPEKIESRIEGFCRTLMNQVGIK---DFNDVFWAVHPGGP  306

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLI  1163
             AILNRLE  LEL PEKL  SR+AL +YGN SSNTI YVLEY+ +E K+ + +E  +WGLI
Sbjct  307   AILNRLEFCLELQPEKLKISRKALKNYGNVSSNTIFYVLEYLRDELKKGAISE--EWGLI  364

Query  1164  LAFGPGITLEGILTRNL  1214
             LAFGPGIT EG+L R +
Sbjct  365   LAFGPGITFEGLLVRGV  381



>ref|XP_006661875.1| PREDICTED: stilbene synthase 4-like [Oryza brachyantha]
Length=392

 Score =   421 bits (1081),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 223/381 (59%), Positives = 279/381 (73%), Gaps = 5/381 (1%)
 Frame = +3

Query  75    QGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKT  254
              G    S GKA ++ALGK  P Q++ QE +V+ Y ++++CDDP  + KL RLCKTTTV+T
Sbjct  15    NGKSHCSGGKAMLLALGKGLPEQVLPQEKVVETYLQDSSCDDPATRAKLERLCKTTTVRT  74

Query  255   RYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHL  434
             RY VMS+E+L ++PEL  EG PT+  RLDICN+AV ++   A+   + +WGR   +ITHL
Sbjct  75    RYTVMSKELLDEHPELKTEGTPTLTPRLDICNAAVLELGATAARAALGEWGRPAADITHL  134

Query  435   VYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVL  614
             VY+SSSE RLPGGDL+LA  LGL P+T R  L F GCSGG A LR AKDIAENNPGSRVL
Sbjct  135   VYISSSELRLPGGDLFLAARLGLHPNTIRTSLLFLGCSGGAAALRTAKDIAENNPGSRVL  194

Query  615   VATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFV  794
             V  +ETT++GF+PPS DRPYDLVG ALFGDGA A++IG+ P+   E P  EL  + Q F+
Sbjct  195   VIAAETTVLGFRPPSPDRPYDLVGAALFGDGASAVIIGAGPITAEENPFLELQFSRQEFL  254

Query  795   PDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHP  974
             P TEK+IDG+++EEGI+FKL R+LP+ IE  I+ FC  LM   G     +FN +FWAVHP
Sbjct  255   PGTEKVIDGKISEEGINFKLGRDLPEKIESRIEGFCRTLMDRVGIK---EFNDVFWAVHP  311

Query  975   GGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDW  1154
             GGPAILNRLE  LEL  EKL  SR+AL +YGN SSNT+ YVLEY+ +E K+    E  +W
Sbjct  312   GGPAILNRLELCLELQTEKLKISRKALMNYGNVSSNTVFYVLEYLRDELKKGVIRE--EW  369

Query  1155  GLILAFGPGITLEGILTRNLT  1217
             GLILAFGPGIT EG+L R + 
Sbjct  370   GLILAFGPGITFEGMLVRGVN  390



>ref|NP_001131211.1| uncharacterized protein LOC100192519 [Zea mays]
 gb|ACF79526.1| unknown [Zea mays]
Length=390

 Score =   420 bits (1079),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 223/385 (58%), Positives = 280/385 (73%), Gaps = 5/385 (1%)
 Frame = +3

Query  60    GDAVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKT  239
             G     G  + S GKA ++ALGK FP Q++ QE +   Y + ++CDDP  + KL RLC T
Sbjct  5     GSTDANGKSQGSRGKAMLLALGKGFPDQVLPQEKVAASYLQESSCDDPDTRAKLERLCTT  64

Query  240   TTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPT  419
             TTV+TRY VMS+E+L K+PEL +EG PT+  RLD+CN+AV  +   A+   + +WGR   
Sbjct  65    TTVRTRYTVMSKELLDKHPELKMEGTPTLTPRLDVCNAAVIDLGAAAARAALHEWGRPAA  124

Query  420   EITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNP  599
             +ITHL+Y+SSSE RLPGGDL+LA  LGL P+T R  L F GCSGG A LR AKDIAENNP
Sbjct  125   DITHLIYISSSELRLPGGDLHLAARLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAENNP  184

Query  600   GSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTA  779
             GSRVLV  +ETT++GF+PPS DRPYDLVG ALFGDGA A++IG+ P+   E P  EL  +
Sbjct  185   GSRVLVTAAETTVLGFRPPSYDRPYDLVGAALFGDGASAVIIGAGPMAPAENPFLELQFS  244

Query  780   IQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLF  959
              Q F+P T+K+IDG ++EEGI+FKL R+LP+ IE  I+ FC  LM   G     DFN +F
Sbjct  245   TQEFLPGTDKVIDGNISEEGINFKLGRDLPEKIESRIEGFCRTLMNQVGIK---DFNDVF  301

Query  960   WAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEA  1139
             WAVHPGGPAILNRLE  L+L PEKL  SR+AL +YGN SSNTI YVLEY+ +E K+ + +
Sbjct  302   WAVHPGGPAILNRLEICLQLQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDELKKGTIS  361

Query  1140  EDSDWGLILAFGPGITLEGILTRNL  1214
             E  DWGLILAFGPGIT EG+L + +
Sbjct  362   E--DWGLILAFGPGITFEGLLVQGV  384



>ref|XP_002985571.1| hypothetical protein SELMODRAFT_122361 [Selaginella moellendorffii]
 ref|XP_002987004.1| hypothetical protein SELMODRAFT_235157 [Selaginella moellendorffii]
 gb|EFJ11847.1| hypothetical protein SELMODRAFT_235157 [Selaginella moellendorffii]
 gb|EFJ13445.1| hypothetical protein SELMODRAFT_122361 [Selaginella moellendorffii]
Length=393

 Score =   420 bits (1079),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 217/381 (57%), Positives = 288/381 (76%), Gaps = 4/381 (1%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYV  263
             + A PGKA+++A GKA P  +V QE+LVDGYF++T  ++  LK+KL RLCKTTTVKTRYV
Sbjct  15    RAARPGKATLLAFGKALPDTVVKQEYLVDGYFRDTKVENAALKEKLQRLCKTTTVKTRYV  74

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
             VMS+EIL+ +PE    G P+++QRL+I   AVT+M + A+   + +WGR  ++ITHLVYV
Sbjct  75    VMSKEILENHPEFYTPGTPSIRQRLEIAGEAVTKMGVAAATQALAEWGRPISDITHLVYV  134

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             SSSE R PGGDLYL+K LGL  D  RVMLY  GC GG  GLRV+KD+AENNPGSR+L+  
Sbjct  135   SSSEVRFPGGDLYLSKHLGLSSDISRVMLYMLGCCGGAGGLRVSKDLAENNPGSRILLVI  194

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             S+TT+IG++PP+  RPYDLVG ALFGDGA A+VIG++P+   E P +EL TA Q FVP +
Sbjct  195   SDTTLIGWRPPNPQRPYDLVGAALFGDGASAVVIGADPLPS-ENPCYELVTASQCFVPGS  253

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKD--DFNKLFWAVHPG  977
             EK IDG+LTE+GI F L RELPQ+IE  ++ F   L++ +G       D+++LFWA+HPG
Sbjct  254   EKTIDGRLTEDGIIFSLGRELPQMIESEVEGFIQGLLKRSGRVEAGGVDYDRLFWAIHPG  313

Query  978   GPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWG  1157
             GPAILN  EKKL+L+ +KL  SR+ L+DYGN + +TI+YVL+YM  +    ++  D +WG
Sbjct  314   GPAILNACEKKLQLAGDKLKCSRQVLSDYGNINGSTIIYVLDYM-RQVNAAADKPDPEWG  372

Query  1158  LILAFGPGITLEGILTRNLTA  1220
             +ILAFGPG+T+EG++ RNL A
Sbjct  373   VILAFGPGVTMEGMVARNLVA  393



>gb|EMS57002.1| Stilbene synthase 4 [Triticum urartu]
Length=390

 Score =   419 bits (1076),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 221/373 (59%), Positives = 280/373 (75%), Gaps = 5/373 (1%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEE  278
             GKA ++ALGK  P Q++ QE LV+ Y ++T+CDDP  + KL RLCKTTTV+TRY VMS+E
Sbjct  23    GKAKLLALGKGLPEQVLPQEKLVETYLQDTSCDDPATRAKLERLCKTTTVRTRYTVMSKE  82

Query  279   ILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSEA  458
             +L ++PEL  EG PT+  RLDICN+AV ++   A+   + +WGR   +ITHLVY+SSSE 
Sbjct  83    LLDEHPELKTEGTPTLTPRLDICNAAVLELGAAAARAALGEWGRPAADITHLVYISSSEL  142

Query  459   RLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETTI  638
             RLPGGDL+LA  LGL P+T R  L F GCSGG A LR AKDIAENNPGSRVLV  +ETT+
Sbjct  143   RLPGGDLFLATRLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVIAAETTV  202

Query  639   IGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKIID  818
             +GF+PPS DRPYDLVG ALFGDGA A +IG++P++  E P  EL  + Q F+P T+K+ID
Sbjct  203   LGFRPPSPDRPYDLVGAALFGDGASAAIIGASPIKAEEDPFLELEFSTQEFLPGTDKVID  262

Query  819   GQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILNR  998
             G+++EEGI+FKL R+LP+ IE  I+ FC  LM   G     +FN +FWAVHPGGPAILNR
Sbjct  263   GKISEEGINFKLGRDLPEKIESRIEGFCRILMDKVGIK---EFNDVFWAVHPGGPAILNR  319

Query  999   lekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAFGP  1178
             LE  L+L P+KL  SR+AL +YGN SSNT+ YVLEY+ +E K+ +  E  +WGLILAFGP
Sbjct  320   LEVCLQLEPDKLKISRKALMNYGNVSSNTVFYVLEYLRDELKKGAIRE--EWGLILAFGP  377

Query  1179  GITLEGILTRNLT  1217
             GIT EG+L R + 
Sbjct  378   GITFEGLLVRGIN  390



>gb|AFW68541.1| hypothetical protein ZEAMMB73_283153 [Zea mays]
Length=421

 Score =   420 bits (1079),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 224/385 (58%), Positives = 280/385 (73%), Gaps = 5/385 (1%)
 Frame = +3

Query  60    GDAVLQGGKKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKT  239
             G     G  + S GKA ++ALGK FP Q++ QE +   Y + ++CDDP  + KL RLC T
Sbjct  36    GSTDANGKSQGSRGKAMLLALGKGFPDQVLPQEKVAASYLQESSCDDPDTRAKLERLCTT  95

Query  240   TTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPT  419
             TTV+TRY VMS+E+L K+PEL +EG PT+  RLDICN+AV  +   A+   + +WGR   
Sbjct  96    TTVRTRYTVMSKELLDKHPELKMEGTPTLTPRLDICNAAVIDLGAAAARAALHEWGRPAA  155

Query  420   EITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNP  599
             +ITHL+Y+SSSE RLPGGDL+LA  LGL P+T R  L F GCSGG A LR AKDIAENNP
Sbjct  156   DITHLIYISSSELRLPGGDLHLAARLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAENNP  215

Query  600   GSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTA  779
             GSRVLV  +ETT++GF+PPS DRPYDLVG ALFGDGA A++IG+ P+   E P  EL  +
Sbjct  216   GSRVLVTAAETTVLGFRPPSYDRPYDLVGAALFGDGASAVIIGAGPMAPAENPFLELQFS  275

Query  780   IQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLF  959
              Q F+P T+K+IDG ++EEGI+FKL R+LP+ IE  I+ FC  LM   G     DFN +F
Sbjct  276   TQEFLPGTDKVIDGNISEEGINFKLGRDLPEKIESRIEGFCRTLMNQVGIK---DFNDVF  332

Query  960   WAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEA  1139
             WAVHPGGPAILNRLE  L+L PEKL  SR+AL +YGN SSNTI YVLEY+ +E K+ + +
Sbjct  333   WAVHPGGPAILNRLEICLQLQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDELKKGTIS  392

Query  1140  EDSDWGLILAFGPGITLEGILTRNL  1214
             E  DWGLILAFGPGIT EG+L + +
Sbjct  393   E--DWGLILAFGPGITFEGLLVQGV  415



>gb|ACB38748.1| chalcone synthase-like protein [Triticum aestivum]
 gb|EMT16036.1| Stilbene synthase 4 [Aegilops tauschii]
Length=390

 Score =   418 bits (1074),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 222/372 (60%), Positives = 279/372 (75%), Gaps = 5/372 (1%)
 Frame = +3

Query  102   KASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMSEEI  281
             KA ++ALGK  P Q++ QE LV+ Y ++T+CDDP  + KL RLCKTTTV+TRY VMS+E+
Sbjct  24    KAKLLALGKGLPEQVLPQEKLVETYLQDTSCDDPATRAKLERLCKTTTVRTRYTVMSKEL  83

Query  282   LKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSEAR  461
             L +YPEL  EG PT+  RLDICN+AV ++   A+   + +WGR   +ITHLVY+SSSE R
Sbjct  84    LDEYPELKTEGSPTLTPRLDICNAAVLELGAAAARAALGEWGRPAADITHLVYISSSELR  143

Query  462   LPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETTII  641
             LPGGDL+LA  LGL P+T R  L F GCSGG A LR AKDIAENNPGSRVLV  +ETT++
Sbjct  144   LPGGDLFLATRLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVIAAETTVL  203

Query  642   GFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKIIDG  821
             GF+PPS DRPYDLVG ALFGDGA A +IG++P++  E P  EL  + Q F+P T+K+IDG
Sbjct  204   GFRPPSPDRPYDLVGAALFGDGASAAIIGASPIKAEEDPFLELEFSTQEFLPGTDKVIDG  263

Query  822   QLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILNRl  1001
             +++EEGI+FKL R+LP+ IE  I+ FC  LM   G     +FN +FWAVHPGGPAILNRL
Sbjct  264   KISEEGINFKLGRDLPEKIESRIEGFCRILMDKVGIK---EFNDVFWAVHPGGPAILNRL  320

Query  1002  ekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLILAFGPG  1181
             E  LEL P+KL  SR+AL +YGN SSNT+ YVLEY+ +E K+ +  E  +WGLILAFGPG
Sbjct  321   EVCLELEPDKLKISRKALMNYGNVSSNTVFYVLEYLRDELKKGAIRE--EWGLILAFGPG  378

Query  1182  ITLEGILTRNLT  1217
             IT EG+L R + 
Sbjct  379   ITFEGMLVRGIN  390



>ref|XP_006396201.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
 gb|ESQ37654.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
Length=359

 Score =   413 bits (1061),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 216/336 (64%), Positives = 258/336 (77%), Gaps = 3/336 (1%)
 Frame = +3

Query  210   KQKLTRLCKTTTVKTRYVVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWT  389
             K  +  L KTTTVKTRY VMS E L KYPELA EG PT+KQRL+I N AV QMA EAS  
Sbjct  26    KATVLALGKTTTVKTRYTVMSRETLHKYPELATEGSPTIKQRLEIANEAVVQMAYEASLA  85

Query  390   CIKKWGRSPTEITHLVYVSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLR  569
             CIK+WGR   +ITHL+YVSSSE RLPGGDLYL+  LGLR + QRVMLYF GC GGV GLR
Sbjct  86    CIKEWGRPVEDITHLIYVSSSEFRLPGGDLYLSAQLGLRHEVQRVMLYFLGCYGGVTGLR  145

Query  570   VAKDIAENNPGSRVLVATSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQEL  749
             +AKDIAENN GSRVL+ TSET ++GF+PP+  RPYDLVG ALFGDGA A++IG++P  E 
Sbjct  146   LAKDIAENNRGSRVLLTTSETMVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPT-ES  204

Query  750   ERPLFELHTAIQHFVPDTEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGY  929
             E P  ELH A+Q F+P T+ +IDG+L+EEGISFKL R+LPQ IEDN+++FC KL+  AG 
Sbjct  205   ESPFIELHCAMQKFLPGTQGVIDGRLSEEGISFKLARDLPQRIEDNVEDFCKKLVAEAGS  264

Query  930   -SHKDDFNKLFWAVHPGGPAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEY  1106
              S   + N LFWAVHPGGPAILN LE KL+L P KL  SR+AL DYGNASSNTI Y+++ 
Sbjct  265   GSGSLELNDLFWAVHPGGPAILNGLETKLKLKPGKLECSRQALMDYGNASSNTIFYIMDK  324

Query  1107  MLEEKKRESEAEDSDWGLILAFGPGITLEGILTRNL  1214
             + +E  ++    + +WGL LAFGPGIT EG L R+L
Sbjct  325   VRDELGKKGRGGE-EWGLGLAFGPGITFEGFLMRSL  359



>dbj|BAG32254.1| chalcone synthase [Raphanus sativus]
Length=360

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 229/292 (78%), Gaps = 2/292 (1%)
 Frame = +3

Query  90   ASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVM  269
            A+ GKA+++ALGKAFP  +V QE LV+ Y +   CDDP +K+KL  LCKTTTVKTRY VM
Sbjct  21   ANKGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDPSIKEKLQHLCKTTTVKTRYTVM  80

Query  270  SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
            S E ++KYPELA EG PT+KQRL+I N AV QMA EAS  CIK+WGR+  +ITHLVYVSS
Sbjct  81   SSETMQKYPELATEGSPTIKQRLEIANEAVVQMAYEASLACIKEWGRTVEDITHLVYVSS  140

Query  450  SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
            SE RLPGGDLYL+  LGL  + QRV+ YF GC GGV+G+RVAKDIAENNPGSRVL+ TSE
Sbjct  141  SEFRLPGGDLYLSAQLGLSNEVQRVLFYFLGCYGGVSGMRVAKDIAENNPGSRVLLTTSE  200

Query  630  TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
            T ++GF+PP+  RPYDLVG ALFGDGA A++IG++P  E E P  ELH A+Q F+P T  
Sbjct  201  TMVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPT-ESESPFMELHYALQQFLPGTHG  259

Query  810  IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWA  965
            +IDG+L+EEGISFKL RELPQ IEDNI+EFC KL+  AG S   + N LFWA
Sbjct  260  VIDGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKAG-SGSLELNDLFWA  310



>ref|XP_008344150.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g02060, chloroplastic [Malus domestica]
Length=1210

 Score =   414 bits (1064),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 226/377 (60%), Positives = 279/377 (74%), Gaps = 4/377 (1%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPVLKQKLTRLCKTTTVKTRYVVMS  272
             +PGKA+++ALGKAFP Q +  + LV+GY  +  C+D  +K+KL  LCKTTT+KT Y VMS
Sbjct  835   TPGKATVLALGKAFPSQRIPXDCLVEGYIXDMKCEDVPIKEKLELLCKTTTLKTGYTVMS  894

Query  273   EEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSS  452
             +EIL KYPELA EG  T+KQRL I N  V +MA+EAS  CIK+WGR   +I H+VYVSS 
Sbjct  895   KEILDKYPELATEGTATIKQRLXIANPXVVEMALEASLACIKEWGRPVEDIIHIVYVSSX  954

Query  453   EARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSET  632
             E RLPGG+L L+  LGLR D  RVMLYF G  GGV GLR++KDIAEN PGS VL+ TSET
Sbjct  955   EIRLPGGBLXLSSKLGLRNDVGRVMLYFLGFYGGVTGLRISKDIAENYPGSXVLLTTSET  1014

Query  633   TIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKI  812
             TI+G  PP+   PYDLVG ALFGDGA A++IGSNP+   E P  EL+ A+Q F+ +T  +
Sbjct  1015  TILGXWPPNKACPYDLVGAALFGDGAAAVIIGSNPIAGQESPFMELNYAVQQFLXETHNV  1074

Query  813   IDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAIL  992
             IDG+L EEGI+FKL R+LPQ I++NI+ FC KL+ VA  +   DFN+LFWAVHPGGPAIL
Sbjct  1075  IDGRLFEEGINFKLGRDLPQKIDZNIEVFCKKLV-VAANAELRDFNELFWAVHPGGPAIL  1133

Query  993   NRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEE---KKRESEAEDSDWGLI  1163
             N+LE  L+ S +KL +SRRAL DYGN SSNTI YV+E M EE   K ++    + +  L 
Sbjct  1134  NKLESTLKRSSDKLESSRRALXDYGNVSSNTIFYVMENMREELXLKLKKXXXREEECXLA  1193

Query  1164  LAFGPGITLEGILTRNL  1214
             LAFGPGIT EGIL R+L
Sbjct  1194  LAFGPGITFEGILLRSL  1210



>ref|XP_010466554.1| PREDICTED: chalcone synthase-like [Camelina sativa]
Length=277

 Score =   306 bits (783),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 167/257 (65%), Positives = 202/257 (79%), Gaps = 3/257 (1%)
 Frame = +3

Query  447   SSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATS  626
             + E RLPGGDLYL+  LGL  + QRVMLYF GC GG++GLRVAKDIAENNPGSRVL+ TS
Sbjct  23    ACEFRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGLSGLRVAKDIAENNPGSRVLLTTS  82

Query  627   ETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTE  806
             ETT++GF+PP+  RPYDLVG ALFGDGA A++IG++P  E E P  ELH A+Q F+P T+
Sbjct  83    ETTVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPT-ESESPFMELHCALQQFLPGTQ  141

Query  807   KIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGY-SHKDDFNKLFWAVHPGGP  983
              +IDG+L+EEGISFKL R+LPQ IEDN++EFC KL+  AG  S   DFN LFWAVHPGGP
Sbjct  142   GVIDGRLSEEGISFKLGRDLPQKIEDNVEEFCKKLVAKAGSGSGLLDFNDLFWAVHPGGP  201

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDSDWGLI  1163
             AIL+ +E KL+L PEKL  SRRAL DYGN SSNTI Y++E + EE +++   E  +WGL 
Sbjct  202   AILSGIETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMEKVKEELEKKG-TEGEEWGLG  260

Query  1164  LAFGPGITLEGILTRNL  1214
             LAFGPGIT EG L R+L
Sbjct  261   LAFGPGITFEGFLMRSL  277



>gb|ABI94386.1| chalcone synthase-like polyketide synthase [Huperzia serrata]
Length=399

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 244/377 (65%), Gaps = 7/377 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+I+A+G + P  +  Q    D +F  TNC+D   LK+K  R+C  + +K R+  +++
Sbjct  25    GPATILAIGTSNPTNIFEQSTYPDFFFDVTNCNDKTELKKKFQRICDKSGIKKRHFHLTD  84

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EIL+K P +      ++  R DI    V ++A EA+ + IK+WG+  ++ITHLV+ ++S 
Sbjct  85    EILRKNPSICKFKEASLDPRQDIAVLEVPKLAKEAAISAIKQWGQPKSKITHLVFATTSG  144

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  LAK LGLRP  +RVMLY  GC  G   LRVAKD+AENN G+RVLVA SE T
Sbjct  145   VDMPGADFQLAKLLGLRPTVKRVMLYQQGCYAGATVLRVAKDLAENNKGARVLVACSEVT  204

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A+++GS+PV + E+PLFE+H A +  +PD++  I
Sbjct  205   AVTFRAPSETHLDGLVGSALFGDGAAALIVGSDPVPQEEKPLFEIHWAGEAVLPDSDGAI  264

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             +G L E G+ F L +++P +I  NID+  A+ +    Y H   +N +FWAVHPGGPAIL+
Sbjct  265   NGHLREAGLIFHLLKDVPGLISKNIDKVLAEPLE---YVHFPSYNDMFWAVHPGGPAILD  321

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYML---EEKKRESEAEDSDWGLIL  1166
             ++E KL LS +K+ ASR  LA YGN SS ++++VL+ +    EE    +  E  +WG ++
Sbjct  322   QIEAKLGLSTDKMQASRDVLASYGNMSSASVLFVLDQIRKNSEELHLPTTGEGFEWGFVI  381

Query  1167  AFGPGITLEGILTRNLT  1217
              FGPG+T+E +L R++ 
Sbjct  382   GFGPGLTVETLLLRSIN  398



>gb|AHY39238.1| stilbenecarboxylate synthase 2 [Plagiochasma appendiculatum]
Length=411

 Score =   307 bits (786),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 164/376 (44%), Positives = 238/376 (63%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDD-PVLKQKLTRLCKTTTVKTRYVVMSE  275
             G A+++A+GKA PH +  Q    D +F  T C+D P LK K  R+C  + +K R+  + +
Sbjct  31    GPATVLAMGKAVPHNVFEQATYPDFFFNITKCNDKPTLKAKFQRICDKSGIKKRHFYLDQ  90

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             +IL+  P +      ++  R +I  + V ++A EA+   IK+WGR  +EITH+V  ++S 
Sbjct  91    KILESSPSMCTYMETSLNCRQEIAIAQVPKLAKEAAQVAIKEWGRPKSEITHIVMATTSG  150

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG +L  AK LGLRP+ +RVM+Y  GC  G   LRVAKD+AENN G+RVL   SE T
Sbjct  151   VNMPGAELATAKLLGLRPNVRRVMMYQQGCFAGATVLRVAKDLAENNAGARVLAICSEVT  210

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ P       LVG ALFGDGA A+++G++P  E+ERP+FE+H A +  +P+++  I
Sbjct  211   AVTFRAPCETHIDGLVGSALFGDGAAAVIVGADPRPEIERPMFEMHWAGEMVLPESDGAI  270

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG LTE G+ F L +++P +I  NI  F      + G S    +N LFWAVHPGGPAIL+
Sbjct  271   DGHLTEAGLVFHLLKDVPGLITKNIGGFLKDTKNLVGAS---TWNDLFWAVHPGGPAILD  327

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLE---EKKRESEAEDSDWGLIL  1166
             ++E KLEL   K  ASR  LADYGN SS ++++VL+ + E   E  + +  E S+WG ++
Sbjct  328   QVEAKLELEKNKFQASRDILADYGNMSSASVLFVLDRVRERSLESNKYTFGEGSEWGFLI  387

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E +L R L
Sbjct  388   GFGPGLTVETLLLRAL  403



>gb|AIV42295.1| chalcone synthase [Plagiochasma appendiculatum]
Length=411

 Score =   306 bits (785),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 164/376 (44%), Positives = 238/376 (63%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDD-PVLKQKLTRLCKTTTVKTRYVVMSE  275
             G A+++A+GKA PH +  Q    D +F  T C+D P LK K  R+C  + +K R+  + +
Sbjct  31    GPATVLAMGKAVPHNVFEQATYPDFFFNITKCNDKPTLKAKFQRICDKSGIKKRHFYLDQ  90

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             +IL+  P +      ++  R +I  + V ++A EA+   IK+WGR  +EITH+V  ++S 
Sbjct  91    KILESNPSMCTYMETSLNCRQEIAIAHVPKLAKEAAQVAIKEWGRPKSEITHIVMATTSG  150

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG +L  AK LGLRP+ +RVM+Y  GC  G   LRVAKD+AENN G+RVL   SE T
Sbjct  151   VNMPGAELATAKLLGLRPNVRRVMMYQQGCFAGATVLRVAKDLAENNAGARVLAICSEVT  210

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ P       LVG ALFGDGA A+++G++P  E+ERP+FE+H A +  +P+++  I
Sbjct  211   AVTFRAPCETHIDGLVGSALFGDGAAAVIVGADPRPEIERPMFEMHWAGEMVLPESDGAI  270

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG LTE G+ F L +++P +I  NI  F      + G S    +N LFWAVHPGGPAIL+
Sbjct  271   DGHLTEAGLVFHLLKDVPGLITKNIGGFLKDTKNLVGAS---TWNDLFWAVHPGGPAILD  327

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLE---EKKRESEAEDSDWGLIL  1166
             ++E KLEL   K  ASR  LADYGN SS ++++VL+ + E   E  + +  E S+WG ++
Sbjct  328   QVEAKLELEKNKFQASRDILADYGNMSSASVLFVLDRVRERSLESNKYTFGEGSEWGFLI  387

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E +L R L
Sbjct  388   GFGPGLTVETLLLRAL  403



>pdb|3AWJ|A Chain A, Crystal Structure Of The Huperzia Serrata Polyketide 
Synthase 1 Complexed With Coa-Sh
 pdb|3AWJ|B Chain B, Crystal Structure Of The Huperzia Serrata Polyketide 
Synthase 1 Complexed With Coa-Sh
 pdb|3AWK|A Chain A, Crystal Structure Of The Polyketide Synthase 1 From 
Huperzia Serrata
Length=402

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 165/377 (44%), Positives = 243/377 (64%), Gaps = 7/377 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+I+A+G + P  +  Q    D +F  TNC+D   LK+K  R+C  + +K R+  +++
Sbjct  28    GPATILAIGTSNPTNIFEQSTYPDFFFDVTNCNDKTELKKKFQRICDKSGIKKRHFHLTD  87

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EIL+K P +      ++  R DI    V ++A EA+ + IK+WG+  ++ITHLV+ ++S 
Sbjct  88    EILRKNPSICKFKEASLDPRQDIAVLEVPKLAKEAAISAIKQWGQPKSKITHLVFATTSG  147

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  LAK LGLRP  +RVMLY  G   G   LRVAKD+AENN G+RVLVA SE T
Sbjct  148   VDMPGADFQLAKLLGLRPTVKRVMLYQQGXYAGATVLRVAKDLAENNKGARVLVACSEVT  207

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A+++GS+PV + E+PLFE+H A +  +PD++  I
Sbjct  208   AVTFRAPSETHLDGLVGSALFGDGAAALIVGSDPVPQEEKPLFEIHWAGEAVLPDSDGAI  267

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             +G L E G+ F L +++P +I  NID+  A+ +    Y H   +N +FWAVHPGGPAIL+
Sbjct  268   NGHLREAGLIFHLLKDVPGLISKNIDKVLAEPLE---YVHFPSYNDMFWAVHPGGPAILD  324

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYML---EEKKRESEAEDSDWGLIL  1166
             ++E KL LS +K+ ASR  LA YGN SS ++++VL+ +    EE    +  E  +WG ++
Sbjct  325   QIEAKLGLSTDKMQASRDVLASYGNMSSASVLFVLDQIRKNSEELHLPTTGEGFEWGFVI  384

Query  1167  AFGPGITLEGILTRNLT  1217
              FGPG+T+E +L R++ 
Sbjct  385   GFGPGLTVETLLLRSIN  401



>gb|AAK49457.1| chalcone synthase [Nicotiana tabacum]
Length=389

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 163/380 (43%), Positives = 244/380 (64%), Gaps = 7/380 (2%)
 Frame = +3

Query  87    KASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYV  263
             + + G A++MA+G A P   V Q    D YF+ TN +  V LK+K  R+C+ + +K RY+
Sbjct  11    QCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKKRYM  70

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
              ++EEILK+ P +     P++  R DI    V ++  EA+   IK+WG+  ++ITHLV+ 
Sbjct  71    HLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFC  130

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             ++S   +PG D  L K LGLRP  +R M+Y  GC  G   LR+AKD+AENN G+RVLV  
Sbjct  131   TTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVLVVC  190

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SE T + F+ P+      LVG ALFGDGA A++IGS+P+ E+ERPLFEL +A Q  +PD+
Sbjct  191   SEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELVSAAQTLLPDS  250

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             E  IDG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGP
Sbjct  251   EGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGIS---DWNSLFWIAHPGGP  307

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDW  1154
             AIL+++E KL L  EKL A+R+ L++YGN SS  ++++L+ M +   +E   +  E  +W
Sbjct  308   AILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1155  GLILAFGPGITLEGILTRNL  1214
             G++  FGPG+T+E ++  ++
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_009619773.1| PREDICTED: chalcone synthase 1B [Nicotiana tomentosiformis]
 gb|ACS12836.1| chalcone synthase [Nicotiana tomentosiformis]
Length=389

 Score =   302 bits (774),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 163/380 (43%), Positives = 243/380 (64%), Gaps = 7/380 (2%)
 Frame = +3

Query  87    KASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYV  263
             + + G A++MA+G A P   V Q    D YF+ TN +  V LK+K  R+C+ + +K RY+
Sbjct  11    QCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKKRYM  70

Query  264   VMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYV  443
              ++EEILK  P +     P++  R DI    V ++  EA+   IK+WG+  ++ITHLV+ 
Sbjct  71    HLTEEILKDNPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFC  130

Query  444   SSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVAT  623
             ++S   +PG D  L K LGLRP  +R M+Y  GC  G   LR+AKD+AENN G+RVLV  
Sbjct  131   TTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVLVVC  190

Query  624   SETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDT  803
             SE T + F+ P+      LVG ALFGDGA A++IGS+P+ E+ERPLFEL +A Q  +PD+
Sbjct  191   SEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELVSAAQTLLPDS  250

Query  804   EKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGP  983
             E  IDG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGP
Sbjct  251   EGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGIS---DWNSLFWIAHPGGP  307

Query  984   AILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDW  1154
             AIL+++E KL L  EKL A+R+ L++YGN SS  ++++L+ M +   +E   +  E  +W
Sbjct  308   AILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1155  GLILAFGPGITLEGILTRNL  1214
             G++  FGPG+T+E ++  ++
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AAW30010.1| stilbenecarboxylate synthase 2 [Marchantia polymorpha]
Length=392

 Score =   302 bits (773),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 163/376 (43%), Positives = 238/376 (63%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDD-PVLKQKLTRLCKTTTVKTRYVVMSE  275
             G A+++A+GKA P  +  Q    D +F  TN +D P LK K  R+C  + +K R+  + +
Sbjct  12    GPATVLAMGKAVPANVFEQATYPDFFFNITNSNDKPALKAKFQRICDKSGIKKRHFYLDQ  71

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             +IL+  P +      ++  R +I  + V ++A EAS   IK+WGR  +EITH+V  ++S 
Sbjct  72    KILESNPAMCTYMETSLNCRQEIAVAQVPKLAKEASMNAIKEWGRPKSEITHIVMATTSG  131

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG +L  AK LGLRP+ +RVM+Y  GC  G   LRVAKD+AENN G+RVL   SE T
Sbjct  132   VNMPGAELATAKLLGLRPNVRRVMMYQQGCFAGATVLRVAKDLAENNAGARVLAICSEVT  191

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A+++GS+P   +ERP++E+H A +  +P+++  I
Sbjct  192   AVTFRAPSETHIDGLVGSALFGDGAAAVIVGSDPRPGIERPIYEMHWAGEMVLPESDGAI  251

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG LTE G+ F L +++P +I  NI  F      + G S    +N+LFWAVHPGGPAIL+
Sbjct  252   DGHLTEAGLVFHLLKDVPGLITKNIGGFLKDTKNLVGAS---SWNELFWAVHPGGPAILD  308

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLE---EKKRESEAEDSDWGLIL  1166
             ++E KLEL   K  ASR  L+DYGN SS ++++VL+ + E   E  + +  E S+WG ++
Sbjct  309   QVEAKLELEKGKFQASRDILSDYGNMSSASVLFVLDRVRERSLESNKSTFGEGSEWGFLI  368

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E +L R L
Sbjct  369   GFGPGLTVETLLLRAL  384



>ref|XP_009616637.1| PREDICTED: chalcone synthase 2 [Nicotiana tomentosiformis]
Length=389

 Score =   301 bits (772),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 163/378 (43%), Positives = 242/378 (64%), Gaps = 7/378 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+IMA+G A P   V Q    D YF+ TN +    LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATIMAIGTATPSNCVDQSTYPDYYFRVTNSEHMTELKEKFKRMCDKSMIKKRYMHLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R DI    + ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      +VG ALFGDGA A++IGS+PV  +ERPLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSMVGQALFGDGAAAIIIGSDPVPGVERPLFELVSAAQTLLPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N +FW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLMEAFQPLGLS---DWNSIFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E  L L PEKL A+R+ L+DYGN SS  ++++L+ M +   +E   +  E  DWG++ 
Sbjct  312   QVELTLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKTSAKEGFGTTGEGLDWGVLF  371

Query  1167  AFGPGITLEGILTRNLTA  1220
              FGPG+T+E ++  +++A
Sbjct  372   GFGPGLTVETVVLHSVSA  389



>gb|AIM54369.1| chalcone synthase [Dracaena cambodiana]
Length=390

 Score =   301 bits (772),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 164/376 (44%), Positives = 240/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+I+A+G A P   V Q    D YF+ TN +D V LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPAAILAIGTANPSNCVEQSTYADYYFRVTNSEDKVELKEKFKRMCDKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKQNPNVCAYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPCVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
             ++ F+ PS      LVG ALFGDGA AM+IGS+P+  +E P+FE+ +A Q   PD+E  I
Sbjct  195   VVTFRGPSDTHLDSLVGQALFGDGAAAMIIGSDPIDTIEHPIFEIVSAAQTLCPDSECAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             +G L E G++F L  ++P II  NI++      +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   EGHLREVGLTFHLLTDVPGIISKNIEKCLDDAFKPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L PEKL A+R+ L++YGN SS  ++++L+ M ++   E   + AE   WG++ 
Sbjct  312   QVEAKLSLKPEKLRATRQVLSEYGNMSSACVLFILDEMRKKSAEEGKGTTAEGLKWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E +  R++
Sbjct  372   GFGPGLTVETVALRSV  387



>gb|AFU52909.1| chalcone synthase [Hypericum sampsonii]
Length=390

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/376 (43%), Positives = 241/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +    LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKKRYMYLNE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             E+LK+ P +     P++  R DI    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ P+      LVG ALFGDGA A++IGS+P+ E+E+PLFEL +A Q  +PD+E  I
Sbjct  195   AVTFRGPTDTHLDSLVGQALFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTILPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  N+++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L PEKL A+R  L++YGN SS  ++++L+ M  + K +   +  E  +WG++ 
Sbjct  312   QVEAKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLKTTGEGIEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  +L
Sbjct  372   GFGPGLTVETVVLHSL  387



>gb|ABB89213.1| chalcone synthase [Sorbus aucuparia]
Length=391

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 163/376 (43%), Positives = 243/376 (65%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +  V LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A++IG++PV E+E+PLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVTEVEKPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPVGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLE---EKKRESEAEDSDWGLIL  1166
             ++E KL L PEKL A+R+ L+DYGN SS  ++++L+ +     EK  ++  E  +WG++ 
Sbjct  312   QVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>ref|NP_001275296.1| chalcone synthase 2 [Solanum tuberosum]
 sp|Q43188.1|CHS2_SOLTU RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Solanum tuberosum]
 gb|AAB05239.1| chalcone synthase 2 [Solanum tuberosum]
Length=389

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 241/377 (64%), Gaps = 7/377 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+IMA+G A P   V Q    D YF+ TN +    LK+K  R+C  + +  RY+ ++E
Sbjct  15    GPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMINKRYMHLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R DI    V ++  EA+   IK+WG+  ++ITH+V+ ++S 
Sbjct  75    EILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHVVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   +R+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F  PS      +VG ALFGDGA AM+IGS+P+ E+ERPLFEL +A Q  +PD+E  I
Sbjct  195   AVTFSGPSDTHLDSMVGQALFGDGAAAMIIGSDPLPEVERPLFELVSAAQTLLPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N +FW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGIS---DWNSIFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L PEKL A+R+ L+DYGN SS  ++++L+ M +   +E   +  E  DWG++ 
Sbjct  312   QVELKLGLKPEKLQATRQVLSDYGNMSSACVLFILDEMRKASSKEGLSTTGEGLDWGVLF  371

Query  1167  AFGPGITLEGILTRNLT  1217
              FGPG+T+E ++  +++
Sbjct  372   GFGPGLTVETVVLHSVS  388



>gb|AFL47798.1| chalcone synthase [Capsicum annuum]
Length=402

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/382 (42%), Positives = 245/382 (64%), Gaps = 7/382 (2%)
 Frame = +3

Query  84    KKASPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRY  260
             ++ + G A+IMA+G A P   V Q    D YF+ TN +    LK+K  R+C  + +K RY
Sbjct  10    EQRAKGPATIMAIGTATPSNCVDQATYPDYYFRITNSEHMTELKEKFQRMCDKSMIKKRY  69

Query  261   VVMSEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVY  440
             + ++EEILK+ P +     P++  R DI    + ++  EA+   IK+WG+  ++ITHLV+
Sbjct  70    MHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAKKAIKEWGQPKSKITHLVF  129

Query  441   VSSSEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVA  620
              ++S   +PG D  L K LGLRP  +R+M+Y  GC  G   +R+AKD+AENN G+RVLV 
Sbjct  130   CTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVLVV  189

Query  621   TSETTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPD  800
              SE T + F+ PS      +VG ALFGDGA A+++GS+P+ E+ERPLFEL +A Q  +PD
Sbjct  190   CSEITAVTFRGPSDTHLDSMVGQALFGDGAAALIVGSDPLPEVERPLFELVSAAQTLLPD  249

Query  801   TEKIIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGG  980
             +E  IDG L E G++F L +++P +I  NI++   +  +  G S   D+N +FW  HPGG
Sbjct  250   SEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGIS---DWNSIFWIAHPGG  306

Query  981   PAILNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSD  1151
             PAIL+++E KL L  EKL A+R+ L+DYGN SS  ++++L+ M +   +E   +  E  D
Sbjct  307   PAILDQVELKLGLKLEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLNTTGEGLD  366

Query  1152  WGLILAFGPGITLEGILTRNLT  1217
             WG++  FGPG+T+E ++  +++
Sbjct  367   WGVLFGFGPGLTVETVVLHSVS  388



>gb|AFM36768.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/376 (43%), Positives = 240/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+I+A+G A P   + Q    D YF+ TN +  V LKQK  R+C+ + +K RY+ ++E
Sbjct  15    GPATILAIGTANPQNCIEQSTYPDYYFRVTNSEHMVELKQKFKRMCEKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P L     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKQNPNLCAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ P+      LVG ALFGDGA AM+IG++PV+ +ERP+F+L +A Q   PD+E  I
Sbjct  195   AVTFRGPTDTHLDSLVGQALFGDGAAAMIIGADPVENVERPIFKLVSAAQTLCPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P II  NI+       +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGIISKNIERCLDDAFKPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E+KL+L  EK+ A+R  L++YGN SS  +V++L+ M +    +   +  E  +WG++ 
Sbjct  312   QVEEKLKLKEEKMRATREVLSEYGNMSSACVVFILDEMRKRSAAQGKGTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>gb|AGM46641.1| chalcone synthase protein, partial [Apium graveolens]
Length=384

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 165/383 (43%), Positives = 244/383 (64%), Gaps = 17/383 (4%)
 Frame = +3

Query  93    SPGKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVM  269
             +PG A+++A+G A P   V Q    D YF+ TN +    LK+K  R+C+ + +K RY+ +
Sbjct  9     APGPATVLAIGTATPSNCVDQAAYPDYYFRITNSEHMTELKEKFKRMCEKSMIKKRYMHL  68

Query  270   SEEILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSS  449
             +EEILK+ P +     P++  R DI    V ++  EA+   IK+WG+  ++ITHLV+ ++
Sbjct  69    TEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAEKAIKEWGQPKSKITHLVFCTT  128

Query  450   SEARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSE  629
             S   +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE
Sbjct  129   SGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE  188

Query  630   TTIIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEK  809
              T + F+ P+      LVG ALFGDGA A+++GS+PV E+ERPLFEL +A Q  +PD+E 
Sbjct  189   ITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPVPEVERPLFELVSAAQTILPDSEG  248

Query  810   IIDGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAI  989
              IDG L E G++F L +++P +I  NI++   +  +  G S   D+N +FW  HPGGPAI
Sbjct  249   AIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGIS---DWNSIFWIAHPGGPAI  305

Query  990   LNRlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRESEAEDS-------  1148
             L+++E KL L PEKL A+   L+DYGN SS  ++++L+ M     R++ AED        
Sbjct  306   LDQVEAKLGLKPEKLRATSHVLSDYGNMSSACVLFILDEM-----RKTSAEDGLATTGEG  360

Query  1149  -DWGLILAFGPGITLEGILTRNL  1214
              DWG++  FGPG+T+E ++  ++
Sbjct  361   LDWGVLFGFGPGLTVETVVLHSV  383



>gb|AGI02994.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/377 (43%), Positives = 243/377 (64%), Gaps = 7/377 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +    LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P++     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A+++GS+P+ E+E+PLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++  A+  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L  EKL A+R  L++YGN SS  ++++L+ M +E   +   +  E  +WG++ 
Sbjct  312   QVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKESAADGLKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNLT  1217
              FGPG+T+E ++  +L+
Sbjct  372   GFGPGLTVETVVLHSLS  388



>ref|XP_009376347.1| PREDICTED: polyketide synthase 5 [Pyrus x bretschneideri]
Length=391

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/376 (43%), Positives = 243/376 (65%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G + P   V Q    D YF+ TN +  V LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A++IG++PV E+E+PLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLE---EKKRESEAEDSDWGLIL  1166
             ++E KL L PEKL A+RR L+DYGN SS  ++++L+ +     EK  ++  E  +WG++ 
Sbjct  312   QVEAKLALKPEKLEATRRVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>gb|ABM63466.1| aromatic polyketide synthase [Hypericum hookerianum]
Length=390

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/376 (43%), Positives = 242/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +    LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKKRYMYLNE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             E+LK+ P +     P++  R DI    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ P+      LVG ALFGDGA A++IGS+P+ E+E+PLFEL +A Q  +PD+E  I
Sbjct  195   AVTFRGPTDTHLDSLVGQALFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTILPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  N+++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L PEKL A+R  L++YGN SS  ++++L+ M  + K++   +  E  +WG++ 
Sbjct  312   QVEAKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKQDGLKTTGEGIEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>gb|ACS12837.1| chalcone synthase [Nicotiana alata]
Length=389

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/376 (43%), Positives = 240/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +    LK+K  R+C+ + +K RY+ ++E
Sbjct  15    GPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKRYMHLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R DI    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ P+      LVG ALFGDGA A++IGS+P+ E+ERPLFEL +A Q  +PD+E  I
Sbjct  195   AVTFRGPNDTHLDSLVGQALFGDGAAAIIIGSDPIPEVERPLFELVSAAQTLLPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L  EKL A+R  L++YGN SS  ++++L+ M +   +E   +  E  +WG++ 
Sbjct  312   QVELKLGLKQEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>ref|XP_008380609.1| PREDICTED: polyketide synthase 5 [Malus domestica]
 gb|AAX16492.1| chalcone synthase [Malus domestica]
 gb|ACJ54530.1| chalcone synthase [Malus domestica]
Length=391

 Score =   300 bits (768),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 163/376 (43%), Positives = 243/376 (65%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +  V LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A++IG++PV E+E+PLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLE---EKKRESEAEDSDWGLIL  1166
             ++E KL L PEKL A+R+ L+DYGN SS  ++++L+ +     EK  ++  E  +WG++ 
Sbjct  312   QVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>dbj|BAB92996.1| chalcone synthase [Malus domestica]
 gb|ACJ54532.1| chalcone synthase [Malus domestica]
Length=391

 Score =   300 bits (768),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 163/376 (43%), Positives = 243/376 (65%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +  V LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAAIKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A++IG++PV E+E+PLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLE---EKKRESEAEDSDWGLIL  1166
             ++E KL L PEKL A+R+ L+DYGN SS  ++++L+ +     EK  ++  E  +WG++ 
Sbjct  312   QVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>gb|AFH68066.1| chalcone synthase [Pyrus pyrifolia]
Length=389

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 163/378 (43%), Positives = 244/378 (65%), Gaps = 7/378 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G + P   V Q    D YF+ TN +  V LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPSVCEYMAPSIDARQDMVVVKVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A++IG++PV E+E+PLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLE---EKKRESEAEDSDWGLIL  1166
             ++E KL L PEKL A+R+ L+DYGN SS  ++++L+ +     EK  ++  E  +WG++ 
Sbjct  312   QVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNLTA  1220
              FGPG+T+E ++  ++ A
Sbjct  372   GFGPGLTVETVVLHSVGA  389



>gb|AFM36767.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 159/376 (42%), Positives = 239/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+I+A+G A P   + Q    D YF+ TN +  V LKQK  R+C+ + +K RY+ ++E
Sbjct  15    GPATILAIGTANPQNCIEQSTYPDYYFRVTNSEHMVELKQKFKRMCEKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EIL++ P L     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILEQNPNLCAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ P+      LVG ALFGDGA AM+IG++PV+ +ERP+F+L +A Q   PD+E  I
Sbjct  195   AVTFRGPTDTHLDSLVGQALFGDGAAAMIIGADPVENVERPIFKLVSAAQTLCPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P II  NI+       +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREAGLTFHLLKDVPGIISKNIERCLNDAFKPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E+KL+L   K+ A+R  L++YGN SS  +V++L+ M +    +   +  E  +WG++ 
Sbjct  312   QVEEKLKLKEGKMRATREVLSEYGNMSSACVVFILDEMRKRSAAQGKGTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>sp|Q9FUB7.1|CHSY_HYPAN RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Hypericum androsaemum]
 gb|AAG30295.1|AF315345_1 chalcone synthase [Hypericum androsaemum]
Length=390

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 160/376 (43%), Positives = 241/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +    LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKKRYMYLNE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             E+LK+ P +     P++  R DI    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ P+      LVG ALFGDGA A++IGS+P+ E+E+PLFEL +A Q  +PD+E  I
Sbjct  195   AVTFRGPTDTHLDSLVGQALFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTILPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  N+++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L PEKL A+R  L++YGN SS  ++++L+ M  + K +   +  E  +WG++ 
Sbjct  312   QVEAKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLKTTGEGIEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>ref|XP_008358057.1| PREDICTED: polyketide synthase 5 [Malus domestica]
 gb|AAY45748.1| chalcone synthase [Malus domestica]
 gb|ACJ54533.1| chalcone synthase [Malus domestica]
 gb|ACN25139.1| chalcone sythase [Malus hybrid cultivar]
Length=389

 Score =   299 bits (765),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 164/378 (43%), Positives = 244/378 (65%), Gaps = 7/378 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+++A+G A P   V Q    D YF+ TN +    LK+K  R+C  + +KTRY+ ++E
Sbjct  15    GPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKTRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A++IGS+PV E+E+PLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLE---EKKRESEAEDSDWGLIL  1166
             ++E KL L PEKL A+R+ L+DYGN SS  ++++L+ +     EK  ++  E  +WG++ 
Sbjct  312   QVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNLTA  1220
              FGPG+T+E ++  ++ A
Sbjct  372   GFGPGLTVETVVLHSVGA  389



>gb|AFC37242.1| chalcone synthase 1 [Camellia chekiangoleosa]
Length=389

 Score =   299 bits (765),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 160/377 (42%), Positives = 243/377 (64%), Gaps = 7/377 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +    LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P++     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A+++GS+P+ E+E+PLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEIEKPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++  A+  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L  EKL A+R  L++YGN SS  ++++L+ M ++   +   +  E  +WG++ 
Sbjct  312   QVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNLT  1217
              FGPG+T+E ++  +L+
Sbjct  372   GFGPGLTVETVVLHSLS  388



>gb|AIY22756.1| chalcone synthase [Iochroma cyaneum]
Length=389

 Score =   299 bits (765),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 242/377 (64%), Gaps = 7/377 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+IMA+G A P   V Q    D YF+ TN +    LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMHLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R DI    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   +R+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      +VG ALFGDGA A++IGS+P+  +ERPLFEL +A Q  +PD+E  I
Sbjct  195   AVTFRGPSDTHLDSMVGQALFGDGAAAIIIGSDPLPGVERPLFELVSAAQTLLPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N +FW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGIS---DWNSVFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L PEKL A+R+ L+DYGN SS  ++++L+ M +   +E   +  E  DWG++ 
Sbjct  312   QVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLSTTGEGLDWGVLF  371

Query  1167  AFGPGITLEGILTRNLT  1217
              FGPG+T+E ++  +++
Sbjct  372   GFGPGLTVETVVLHSVS  388



>gb|AFM36766.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   299 bits (765),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 161/371 (43%), Positives = 237/371 (64%), Gaps = 7/371 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+I+A+G A P   + Q    D YF+ TN +  V LKQK  R+C+ + +K RY+ ++E
Sbjct  15    GPATILAIGTANPPNCIEQSTYPDYYFRVTNSEHMVELKQKFKRMCEKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P L     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKQNPNLCAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ P+      LVG ALFGDGA AM+IG++PV+ +ERP+F+L +A Q   PD+E  I
Sbjct  195   AVTFRGPTDTHLDSLVGQALFGDGAAAMIIGADPVENVERPIFKLVSAAQTLCPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P II  NI+       +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREAGLTFHLLKDVPGIISKNIERCLDDAFKPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E+KL+L  EK+ A+R  L++YGN SS  +V++L+ M +    +   +  E  +WG++ 
Sbjct  312   QVEEKLKLKEEKMRATREVLSEYGNMSSACVVFILDEMRKRSAAQGKGTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGI  1199
              FGPG+T+E +
Sbjct  372   GFGPGLTVETV  382



>gb|AEO96985.1| chalcone synthase [Gossypium hirsutum]
Length=389

 Score =   299 bits (765),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 159/378 (42%), Positives = 246/378 (65%), Gaps = 7/378 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+++A+G + P   V Q    D YF+ TN +    LK+K  R+C+ + +K RY+ ++E
Sbjct  15    GPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPNVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LRVAKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A+++G++P+ E+E+P+FEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPLSEIEKPMFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++  A+  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L PEKL A+R  L++YGN SS  ++++L+ M ++ K +   +  E  +WG++ 
Sbjct  312   QVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSKEDGLGTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNLTA  1220
              FGPG+T+E ++  +++A
Sbjct  372   GFGPGLTVETVVLHSISA  389



>sp|P08894.1|CHSA_PETHY RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A [Petunia x hybrida]
 emb|CAA27718.1| unnamed protein product [Petunia x hybrida]
Length=389

 Score =   299 bits (765),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 163/376 (43%), Positives = 241/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +    LK+K  R+C+ + +K RY+ ++E
Sbjct  15    GPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIKKRYMHLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R DI    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ P+      LVG ALFGDGAGA++IGS+P+  +ERPLFEL +A Q  +PD+   I
Sbjct  195   AVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLLPDSHGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L PEKL A+R  L+DYGN SS  ++++L+ M +   +E   +  E  +WG++ 
Sbjct  312   QVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>gb|AGL50915.1| chalcone synthase [Pyrus communis]
Length=389

 Score =   299 bits (765),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 164/378 (43%), Positives = 243/378 (64%), Gaps = 7/378 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++ A+G A P   V Q    D YF+ TN +    LK+K  R+C  + +KTRY+ ++E
Sbjct  15    GPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKTRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A++IGS+PV E+E+PLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLE---EKKRESEAEDSDWGLIL  1166
             ++E KL L PEKL A+R+ L+DYGN SS  ++++L+ +     EK  ++  E  +WG++ 
Sbjct  312   QVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNLTA  1220
              FGPG+T+E ++  ++ A
Sbjct  372   GFGPGLTVETVVLHSVGA  389



>sp|P48386.1|CHS1_CAMSI RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Camellia sinensis]
 dbj|BAA05640.1| chalcone synthase [Camellia sinensis]
 gb|AGI02992.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   299 bits (765),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 160/377 (42%), Positives = 243/377 (64%), Gaps = 7/377 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +    LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P++     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A+++GS+P+ E+E+PLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++  A+  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L  EKL A+R  L++YGN SS  ++++L+ M ++   +   +  E  +WG++ 
Sbjct  312   QVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNLT  1217
              FGPG+T+E ++  +L+
Sbjct  372   GFGPGLTVETVVLHSLS  388



>dbj|BAM17286.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   299 bits (765),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 163/376 (43%), Positives = 241/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +    LK+K  R+C+ + +K RY+ ++E
Sbjct  15    GPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKRYMHLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R DI    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ P+      LVG ALFGDGAGA++IGS+P+  +ERPLFEL +A Q  +PD+   I
Sbjct  195   AVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLLPDSHGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L PEKL A+R  L+DYGN SS  ++++L+ M +   +E   +  E  +WG++ 
Sbjct  312   QVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>gb|AGZ15299.1| chalcone synthase [Pyrus x bretschneideri]
 gb|AGZ15300.1| chalcone synthase [Pyrus x bretschneideri]
Length=389

 Score =   299 bits (765),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 163/378 (43%), Positives = 244/378 (65%), Gaps = 7/378 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+++A+G + P   V Q    D YF+ TN +    LK+K  R+C  + +KTRY+ ++E
Sbjct  15    GPATVLAIGTSTPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKTRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A++IGS+PV E+E+PLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLE---EKKRESEAEDSDWGLIL  1166
             ++E KL L PEKL A+R+ L+DYGN SS  ++++L+ +     EK  ++  E  +WG++ 
Sbjct  312   QVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNLTA  1220
              FGPG+T+E ++  ++ A
Sbjct  372   GFGPGLTVETVVLHSVAA  389



>ref|NP_001234036.1| chalcone synthase 2 [Solanum lycopersicum]
 sp|P23419.2|CHS2_SOLLC RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Solanum lycopersicum]
 emb|CAA38981.1| chalcone synthase [Solanum lycopersicum]
 gb|AEK99072.1| chalcone synthase [Solanum lycopersicum]
Length=389

 Score =   299 bits (765),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 162/377 (43%), Positives = 241/377 (64%), Gaps = 7/377 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+IMA+G A P   V Q    D YF+ TN +    LK+K  R+C  + +  RY+ ++E
Sbjct  15    GPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMINKRYMHLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R DI    V ++  EA+   IK+WG+  ++ITH+V+ ++S 
Sbjct  75    EILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHVVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   +R+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      +VG ALFGD A AM+IGS+P+ E+ERPLFEL +A Q  +PD+E  I
Sbjct  195   AVTFRGPSDTHLDSMVGQALFGDRAAAMIIGSDPLPEVERPLFELVSAAQTLLPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N +FW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGIS---DWNSIFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L PEKL A+R+ L+DYGN SS  ++++L+ M +   +E   +  E  DWG++ 
Sbjct  312   QVELKLSLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASSKEGLSTTGEGLDWGVLF  371

Query  1167  AFGPGITLEGILTRNLT  1217
              FGPG+T+E ++  +++
Sbjct  372   GFGPGLTVETVVLHSVS  388



>dbj|BAI66465.1| chalcone synthase [Camellia japonica]
 gb|ADZ28512.1| chalcone synthase [Camellia nitidissima]
Length=389

 Score =   298 bits (764),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 160/377 (42%), Positives = 243/377 (64%), Gaps = 7/377 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +    LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P++     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A+++GS+P+ E+E+PLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++  A+  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L  EKL A+R  L++YGN SS  ++++L+ M ++   +   +  E  +WG++ 
Sbjct  312   QVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNLT  1217
              FGPG+T+E ++  +L+
Sbjct  372   GFGPGLTVETVVLHSLS  388



>gb|AFQ92052.1| chalcone synthase [Pyrus pyrifolia]
 gb|AGL81345.1| chalcone synthase [Pyrus communis]
Length=391

 Score =   298 bits (764),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 162/376 (43%), Positives = 243/376 (65%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G + P   V Q    D YF+ TN +  V LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A++IG++PV E+E+PLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLE---EKKRESEAEDSDWGLIL  1166
             ++E KL L PEKL A+R+ L+DYGN SS  ++++L+ +     EK  ++  E  +WG++ 
Sbjct  312   QVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>gb|AAN04188.1| Putative chalcone synthase [Oryza sativa Japonica Group]
 gb|AAP52307.1| Chalcone synthase 8, putative [Oryza sativa Japonica Group]
 gb|EAZ15421.1| hypothetical protein OsJ_30835 [Oryza sativa Japonica Group]
Length=399

 Score =   299 bits (765),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 167/382 (44%), Positives = 243/382 (64%), Gaps = 6/382 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+I+A+G A P  +V Q+   D YF  T  +    LK K+ R+CK + ++ RY+ + E
Sbjct  22    GPATIIAIGTANPANIVPQDNFADYYFGLTKSEHLTELKDKMKRICKKSGIEKRYIHLDE  81

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EI++ +PE+  +  P+++ R++I  + V ++A  A+   I KWGR  T+ITHL++ + S 
Sbjct  82    EIIRAHPEIIDKHQPSLEARVEIAAAEVPKLAESAARKAIAKWGRPATDITHLIFSTYSG  141

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
              R P  DL LA  LGLRP   R +L   GCSGG   L++AK++AENN G+RVLVA SE T
Sbjct  142   CRAPSADLQLASLLGLRPSVSRTILSLHGCSGGGRALQLAKELAENNRGARVLVALSELT  201

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
             ++ F  P   +   +VG  LFGDGAGA+++G+ P  + E PLFE+  A Q  +P TE  +
Sbjct  202   LVCFSTPDESK---IVGHGLFGDGAGAIIVGAGPFSDGECPLFEMVAASQTMIPGTEHAL  258

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
               Q T  GI F L  ++P +I+DNI +   +  +  GY+   D+N LFWAVHPGG AIL+
Sbjct  259   GMQATSTGIDFHLSVQVPMLIKDNIQQSLLESFQSVGYT-DPDWNNLFWAVHPGGRAILD  317

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEK-KRESEAEDSDWGLILAF  1172
              +E KL+L P KL+ASR+ L ++GN S  TI +VL+ +   + K E E++  +WG++LAF
Sbjct  318   NIEGKLQLQPWKLAASRQVLREFGNMSGATIAFVLDELCHRREKDEDESQQHEWGVMLAF  377

Query  1173  GPGITLEGILTRNLTA*SLKQT  1238
             GPGIT+E I+ RN  A  LKQ 
Sbjct  378   GPGITIETIVMRNPLARGLKQN  399



>gb|AFL72079.1| chalcone synthase [Agastache rugosa]
Length=391

 Score =   298 bits (764),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 161/376 (43%), Positives = 239/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+++A+G A P   V Q    D YF+ TN +    LK+K  R+C+ + +K RY+ ++E
Sbjct  15    GPATVLAIGTAVPTNCVDQSTYPDYYFRITNSEHKTDLKEKFVRMCEKSMIKKRYMHLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             E LK+ P +     P++  R DI    V ++  EA+   IK+WG+S ++ITHLV+ ++S 
Sbjct  75    EYLKENPNITAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQSKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A+++GS+PV  +ERPLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSESHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +     G S   D+N +FW  HPGGPAILN
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFAPLGIS---DWNSVFWIAHPGGPAILN  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L PEKL ++R  L++YGN SS  ++++L+ M +   +E   +  E  DWG++ 
Sbjct  312   QVEAKLGLKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSSAKEGLSTTGEGLDWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>sp|Q01286.1|CHS1_PEA RecName: Full=Chalcone synthase 1; AltName: Full=Naregenin-chalcone 
synthase 1 [Pisum sativum]
 emb|CAA44933.1| naregenin-chalcone synthase [Pisum sativum]
 dbj|BAA01512.1| chalcone synthase [Pisum sativum]
Length=389

 Score =   298 bits (764),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 159/376 (42%), Positives = 241/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDP-VLKQKLTRLCKTTTVKTRYVVMSE  275
             G A+I+A+G A P   V Q    D YFK TN +   VLK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTVLKEKFQRMCDKSMIKRRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P L     P++  R D+    V ++  EA+   IK+WG+  ++ITHL++ ++S 
Sbjct  75    EILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A+++GS+PV E+E+P+FE+    Q   PD+E  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E+G++F L +++P I+  NID+   +  +  G S   D+N +FW  HPGGPAIL+
Sbjct  255   DGHLREQGLTFHLLKDVPGIVSKNIDKALVEAFKPLGIS---DYNSIFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E+KL L PEK+ A+R  L++YGN SS  ++++L+ M ++  ++   +  E  +WG++ 
Sbjct  312   QVEQKLGLKPEKMRATREVLSEYGNMSSACVLFILDQMRKKSTQDGLNTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTIETVVLHSV  387



>gb|AFE56210.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/377 (42%), Positives = 242/377 (64%), Gaps = 7/377 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +    LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P++     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A+++GS+P+ E+E+PLFEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++  A+  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L  EKL A+R  L++YGN SS  ++++L+ M +    +   +  E  +WG++ 
Sbjct  312   QVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKRSAADGLKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNLT  1217
              FGPG+T+E ++  +L+
Sbjct  372   GFGPGLTVETVVLHSLS  388



>sp|Q43163.1|CHSB_SOLTU RecName: Full=Chalcone synthase 1B; AltName: Full=Naringenin-chalcone 
synthase 1B [Solanum tuberosum]
 gb|AAB67735.1| chalcone synthase 1b [Solanum tuberosum]
Length=389

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/376 (43%), Positives = 240/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+I+A+G + P   V Q    D YF+ TN +    LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRYMHLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R DI    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  LAK LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGA A+++GS+P+  +ERPLFEL +A Q  VPD+E  I
Sbjct  195   AVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELVSAAQTLVPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L  EKL A+R  L++YGN SS  ++++L+ M +   +E   +  E  +WG++ 
Sbjct  312   QVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEMRKASTKEGLGTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>gb|AGW24283.1| chalcone synthase [Melastoma malabathricum]
Length=391

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 159/376 (42%), Positives = 243/376 (65%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+I+A+G A P   V Q    D YF+ TN +    LK+K  R+C  + +K RY+ ++E
Sbjct  15    GPATILAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFQRMCDKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPSVCAYEAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ PS      LVG ALFGDGAGA++IGS+P+  +E+P+FEL +A Q  +PD++  I
Sbjct  195   AVTFRGPSESHLDSLVGQALFGDGAGAIIIGSDPIPGVEKPMFELVSAAQTILPDSDGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  N+++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNVEKSLVEAFQPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKR---ESEAEDSDWGLIL  1166
             ++E+KL L PEK+ A+R+ L+DYGN SS  ++++L+ M    K+   ++  E  +WG++ 
Sbjct  312   QVEEKLGLKPEKMRATRQVLSDYGNMSSACVLFILDEMRRSSKQNGFKTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSI  387



>gb|AEN04070.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/376 (43%), Positives = 239/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+I+A+G A P   + Q    D YF+ TN +  V LKQK  R+C+ + +K RY+ ++E
Sbjct  15    GPATILAIGTANPQNCIEQSTYPDYYFRVTNSEHMVELKQKFKRMCEKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P L     P++  R D+    V ++   A+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKQNPNLCAYMAPSLDARQDMVVVEVPRLGKAAAVKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ P+      LVG ALFGDGA AM+IG++PV+ +ERP+F+L +A Q   PD+E  I
Sbjct  195   AVTFRGPTDTHLDSLVGQALFGDGAAAMIIGADPVENVERPIFKLVSAAQTLCPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P II  NI+       +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGIISKNIERCLDDAFKPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E+KL+L  EK+ A+R  L++YGN SS  +V++L+ M +    +   +  E  +WG++ 
Sbjct  312   QVEEKLKLKEEKMRATREVLSEYGNMSSACVVFILDEMRKRSAAQGKGTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>gb|ABN80439.1| chalcone synthase [Nicotiana benthamiana]
Length=389

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 161/376 (43%), Positives = 240/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A++MA+G A P   V Q    D YF+ TN +    LK+K  R+C+ + +K RY+ ++E
Sbjct  15    GPATVMAIGTATPFNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKRYMHLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P +     P++  R DI    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ P+      LVG ALFGDGA A++IGS+P+ E+ERPLF+L +A Q  +PD+E  I
Sbjct  195   AVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFQLVSAAQTLLPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P +I  NI++   +  +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E KL L+ EKL A+R  L +YGN SS  ++++L+ M +   +E   +  E  +WG++ 
Sbjct  312   QVELKLGLNQEKLKATRNVLTNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



>gb|AFM36769.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 160/376 (43%), Positives = 240/376 (64%), Gaps = 7/376 (2%)
 Frame = +3

Query  99    GKASIMALGKAFPHQLVMQEFLVDGYFKNTNCDDPV-LKQKLTRLCKTTTVKTRYVVMSE  275
             G A+I+A+G A P   + Q    D YF+ TN +  V L+QK  R+C+ + +K RY+ ++E
Sbjct  15    GPATILAIGTANPPNCIEQSTYPDYYFRVTNSEHMVELEQKFKRMCEKSMIKKRYMYLTE  74

Query  276   EILKKYPELAIEGLPTVKQRLDICNSAVTQMAIEASWTCIKKWGRSPTEITHLVYVSSSE  455
             EILK+ P L     P++  R D+    V ++  EA+   IK+WG+  ++ITHLV+ ++S 
Sbjct  75    EILKQNPNLCAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLVFCTTSG  134

Query  456   ARLPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLVATSETT  635
               +PG D  L K LGLRP  +R+M+Y  GC  G   LR+AKD+AENN G+RVLV  SE T
Sbjct  135   VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEIT  194

Query  636   IIGFKPPSADRPYDLVGVALFGDGAGAMVIGSNPVQELERPLFELHTAIQHFVPDTEKII  815
              + F+ P+      LVG ALFGDGA AM+IG++PV+ +ERP+F+L +A Q   PD+E  I
Sbjct  195   AVTFRGPTDTHLDSLVGQALFGDGAAAMIIGADPVENVERPIFKLVSAAQTLCPDSEGAI  254

Query  816   DGQLTEEGISFKLERELPQIIEDNIDEFCAKLMRVAGYSHKDDFNKLFWAVHPGGPAILN  995
             DG L E G++F L +++P II  NI+       +  G S   D+N LFW  HPGGPAIL+
Sbjct  255   DGHLREAGLTFHLLKDVPGIISKNIERCLDDAFKPLGIS---DWNSLFWIAHPGGPAILD  311

Query  996   RlekklelspeklsasRRALADYGNASSNTIVYVLEYMLEEKKRE---SEAEDSDWGLIL  1166
             ++E+KL+L  EK+ A+R  L++YGN SS  +V++L+ M +    +   +  E  +WG++ 
Sbjct  312   QVEEKLKLKEEKMRATREVLSEYGNMSSACVVFILDEMRKRSAAQGKGATGEGLEWGVLF  371

Query  1167  AFGPGITLEGILTRNL  1214
              FGPG+T+E ++  ++
Sbjct  372   GFGPGLTVETVVLHSV  387



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3875747767884