BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85123_g1_i1 len=979 path=[957:0-978]

Length=979
                                                                      Score     E

ref|XP_009630729.1|  PREDICTED: ethylene-responsive transcription...    179   1e-49   
emb|CDP04254.1|  unnamed protein product                                173   3e-48   
gb|AFK24441.1|  DREB2                                                   172   7e-48   
ref|XP_011084760.1|  PREDICTED: ethylene-responsive transcription...    153   3e-41   
ref|XP_004237644.1|  PREDICTED: dehydration-responsive element-bi...    147   2e-39   
ref|XP_002267549.1|  PREDICTED: dehydration-responsive element-bi...    137   5e-35   Vitis vinifera
ref|XP_009131668.1|  PREDICTED: dehydration-responsive element-bi...    139   1e-34   
emb|CDY02629.1|  BnaC02g08060D                                          137   3e-34   
ref|XP_009126252.1|  PREDICTED: dehydration-responsive element-bi...    137   5e-34   
ref|XP_006289041.1|  hypothetical protein CARUB_v10002425mg             137   5e-34   
ref|XP_009120973.1|  PREDICTED: dehydration-responsive element-bi...    137   6e-34   
ref|NP_197346.1|  dehydration-responsive element-binding protein 2G     137   6e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26084.1|  hypothetical protein AALP_AA8G200700                    137   7e-34   
emb|CDY58117.1|  BnaA02g35180D                                          136   7e-34   
ref|XP_010454086.1|  PREDICTED: dehydration-responsive element-bi...    137   8e-34   
ref|XP_010420608.1|  PREDICTED: dehydration-responsive element-bi...    136   8e-34   
emb|CDY25420.1|  BnaC09g39350D                                          137   8e-34   
ref|XP_010043317.1|  PREDICTED: dehydration-responsive element-bi...    134   1e-33   
ref|XP_002873895.1|  hypothetical protein ARALYDRAFT_909855             136   1e-33   
ref|XP_007208518.1|  hypothetical protein PRUPE_ppa026176mg             130   2e-33   
emb|CAN66064.1|  hypothetical protein VITISV_032355                     132   2e-33   Vitis vinifera
ref|XP_010492849.1|  PREDICTED: dehydration-responsive element-bi...    135   4e-33   
gb|EYU39769.1|  hypothetical protein MIMGU_mgv1a018752mg                129   6e-33   
ref|XP_006443285.1|  hypothetical protein CICLE_v10022244mg             129   4e-32   
ref|XP_008389032.1|  PREDICTED: dehydration-responsive element-bi...    130   5e-32   
ref|XP_006400393.1|  hypothetical protein EUTSA_v10015907mg             131   8e-32   
ref|XP_008218369.1|  PREDICTED: dehydration-responsive element-bi...    129   1e-31   
emb|CAN60823.1|  hypothetical protein VITISV_037056                     125   6e-31   Vitis vinifera
ref|XP_004302113.1|  PREDICTED: dehydration-responsive element-bi...    125   8e-31   
ref|XP_007160709.1|  hypothetical protein PHAVU_001G010400g             127   9e-31   
ref|XP_010243654.1|  PREDICTED: dehydration-responsive element-bi...    125   1e-30   
ref|XP_010936099.1|  PREDICTED: dehydration-responsive element-bi...    125   1e-30   
ref|XP_002280893.3|  PREDICTED: dehydration-responsive element-bi...    125   2e-30   Vitis vinifera
ref|XP_002510462.1|  Dehydration-responsive element-binding prote...    125   4e-30   Ricinus communis
ref|XP_002522019.1|  hypothetical protein RCOM_0610630                  124   4e-30   Ricinus communis
ref|XP_007030307.1|  Integrase-type DNA-binding superfamily prote...    124   4e-30   
ref|XP_002302006.1|  hypothetical protein POPTR_0002s03090g             125   4e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008388158.1|  PREDICTED: dehydration-responsive element-bi...    125   6e-30   
ref|XP_011048848.1|  PREDICTED: dehydration-responsive element-bi...    125   6e-30   
ref|XP_009391184.1|  PREDICTED: dehydration-responsive element-bi...    123   6e-30   
ref|XP_006435084.1|  hypothetical protein CICLE_v10002280mg             124   8e-30   
ref|XP_011083628.1|  PREDICTED: dehydration-responsive element-bi...    123   8e-30   
gb|KDO84711.1|  hypothetical protein CISIN_1g036655mg                   124   8e-30   
ref|XP_006473580.1|  PREDICTED: dehydration-responsive element-bi...    124   8e-30   
dbj|BAJ53172.1|  JHL18I08.6                                             124   9e-30   
gb|KDP38573.1|  hypothetical protein JCGZ_04498                         124   1e-29   
ref|XP_007136043.1|  hypothetical protein PHAVU_009G013200g             124   1e-29   
ref|XP_002306897.2|  hypothetical protein POPTR_0005s25470g             124   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_009336823.1|  PREDICTED: dehydration-responsive element-bi...    123   1e-29   
ref|XP_003549447.2|  PREDICTED: ethylene-responsive transcription...    124   1e-29   
emb|CDX70820.1|  BnaC03g09040D                                          124   2e-29   
gb|KHN12670.1|  Dehydration-responsive element-binding protein 2D       124   2e-29   
ref|XP_010533259.1|  PREDICTED: dehydration-responsive element-bi...    122   2e-29   
ref|XP_003545264.1|  PREDICTED: ethylene-responsive transcription...    124   2e-29   
ref|XP_007226392.1|  hypothetical protein PRUPE_ppa023248mg             123   2e-29   
gb|KDP23749.1|  hypothetical protein JCGZ_23582                         122   2e-29   
ref|XP_009386363.1|  PREDICTED: dehydration-responsive element-bi...    122   3e-29   
ref|XP_008796422.1|  PREDICTED: dehydration-responsive element-bi...    122   3e-29   
ref|XP_008388157.1|  PREDICTED: dehydration-responsive element-bi...    123   4e-29   
ref|XP_009336842.1|  PREDICTED: dehydration-responsive element-bi...    123   4e-29   
ref|XP_004152768.1|  PREDICTED: dehydration-responsive element-bi...    120   4e-29   
ref|XP_004292958.1|  PREDICTED: dehydration-responsive element-bi...    122   5e-29   
ref|XP_009351419.1|  PREDICTED: dehydration-responsive element-bi...    119   5e-29   
ref|XP_010549641.1|  PREDICTED: dehydration-responsive element-bi...    124   6e-29   
gb|KGN62640.1|  hypothetical protein Csa_2G363010                       121   7e-29   
gb|EYU32882.1|  hypothetical protein MIMGU_mgv1a018624mg                120   8e-29   
ref|XP_007017661.1|  Dehydration-responsive element-binding prote...    121   1e-28   
gb|EPS61812.1|  hypothetical protein M569_12986                         119   1e-28   
gb|KFK41984.1|  hypothetical protein AALP_AA2G197300                    120   1e-28   
ref|XP_010674522.1|  PREDICTED: dehydration-responsive element-bi...    120   2e-28   
ref|XP_008221333.1|  PREDICTED: dehydration-responsive element-bi...    123   2e-28   
ref|XP_010271525.1|  PREDICTED: dehydration-responsive element-bi...    119   2e-28   
ref|XP_004499266.1|  PREDICTED: dehydration-responsive element-bi...    120   2e-28   
ref|XP_006390299.1|  hypothetical protein EUTSA_v10019142mg             119   2e-28   
ref|XP_003527879.1|  PREDICTED: dehydration-responsive element-bi...    120   3e-28   
ref|XP_009104705.1|  PREDICTED: dehydration-responsive element-bi...    119   3e-28   
ref|XP_011029080.1|  PREDICTED: dehydration-responsive element-bi...    119   3e-28   
ref|XP_010940672.1|  PREDICTED: dehydration-responsive element-bi...    119   3e-28   
emb|CDY70626.1|  BnaCnng69090D                                          119   4e-28   
ref|XP_006660398.1|  PREDICTED: dehydration-responsive element-bi...    119   4e-28   
ref|XP_008377237.1|  PREDICTED: dehydration-responsive element-bi...    120   4e-28   
ref|XP_010416439.1|  PREDICTED: dehydration-responsive element-bi...    118   5e-28   
ref|XP_006302829.1|  hypothetical protein CARUB_v10020960mg             118   6e-28   
ref|XP_010428577.1|  PREDICTED: dehydration-responsive element-bi...    118   6e-28   
ref|XP_002887600.1|  hypothetical protein ARALYDRAFT_476698             118   6e-28   
ref|NP_177681.2|  dehydration-responsive element-binding protein 2D     118   6e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471662.1|  PREDICTED: dehydration-responsive element-bi...    118   6e-28   
gb|ABK59671.1|  At1g75490                                               118   6e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444762.1|  PREDICTED: dehydration-responsive element-bi...    118   7e-28   
ref|XP_008347385.1|  PREDICTED: dehydration-responsive element-bi...    119   8e-28   
ref|XP_008789576.1|  PREDICTED: dehydration-responsive element-bi...    117   9e-28   
ref|XP_003523563.1|  PREDICTED: dehydration-responsive element-bi...    119   1e-27   
ref|XP_009106200.1|  PREDICTED: dehydration-responsive element-bi...    117   1e-27   
ref|XP_010922640.1|  PREDICTED: dehydration-responsive element-bi...    120   1e-27   
emb|CDY47519.1|  BnaAnng09170D                                          117   1e-27   
emb|CDY64211.1|  BnaC06g43980D                                          117   2e-27   
ref|XP_003589344.1|  Ethylene-responsive transcription factor ERF071    118   2e-27   
ref|XP_010105262.1|  GTPase obg                                         123   2e-27   
ref|NP_001062535.1|  Os08g0565200                                       117   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008799804.1|  PREDICTED: dehydration-responsive element-bi...    119   3e-27   
ref|XP_008366770.1|  PREDICTED: dehydration-responsive element-bi...    118   3e-27   
gb|EAZ08049.1|  hypothetical protein OsI_30314                          117   3e-27   Oryza sativa Indica Group [Indian rice]
emb|CDP07457.1|  unnamed protein product                                117   4e-27   
ref|XP_010931300.1|  PREDICTED: dehydration-responsive element-bi...    117   4e-27   
ref|XP_004147872.1|  PREDICTED: dehydration-responsive element-bi...    115   4e-27   
ref|XP_003571275.1|  PREDICTED: dehydration-responsive element-bi...    116   5e-27   
ref|NP_181566.2|  putative dehydration-responsive element-binding...    114   5e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAD25670.1|  AP2 domain transcription factor                         114   6e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881716.1|  hypothetical protein ARALYDRAFT_903325             118   7e-27   
ref|XP_008466672.1|  PREDICTED: dehydration-responsive element-bi...    114   8e-27   
ref|XP_010257031.1|  PREDICTED: dehydration-responsive element-bi...    118   8e-27   
ref|XP_010517453.1|  PREDICTED: dehydration-responsive element-bi...    118   9e-27   
ref|XP_010505763.1|  PREDICTED: dehydration-responsive element-bi...    118   9e-27   
ref|XP_010102188.1|  Dehydration-responsive element-binding prote...    114   1e-26   
ref|XP_004293490.1|  PREDICTED: dehydration-responsive element-bi...    114   2e-26   
ref|XP_009128106.1|  PREDICTED: dehydration-responsive element-bi...    114   2e-26   
ref|XP_006353419.1|  PREDICTED: dehydration-responsive element-bi...    116   2e-26   
ref|XP_004238613.1|  PREDICTED: dehydration-responsive element-bi...    115   3e-26   
ref|XP_002520794.1|  Dehydration-responsive element-binding prote...    117   3e-26   Ricinus communis
gb|AAT44958.1|  putative AP2/EREBP transcription factor                 112   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009767687.1|  PREDICTED: dehydration-responsive element-bi...    114   3e-26   
ref|XP_006342227.1|  PREDICTED: dehydration-responsive element-bi...    114   5e-26   
ref|XP_009598034.1|  PREDICTED: dehydration-responsive element-bi...    114   5e-26   
emb|CDY20377.1|  BnaC02g24390D                                          112   5e-26   
ref|XP_009767453.1|  PREDICTED: dehydration-responsive element-bi...    113   6e-26   
ref|XP_008792179.1|  PREDICTED: dehydration-responsive element-bi...    115   6e-26   
gb|KCW67902.1|  hypothetical protein EUGRSUZ_F01607                     113   7e-26   
ref|XP_008664551.1|  PREDICTED: dehydration-responsive element-bi...    115   7e-26   
ref|XP_002968658.1|  hypothetical protein SELMODRAFT_38494              108   8e-26   
ref|XP_006294523.1|  hypothetical protein CARUB_v10023556mg             115   9e-26   
ref|NP_001234689.1|  dehydration responsive element binding protein     114   1e-25   
emb|CBH19549.1|  AP2 domain containing protein                          110   1e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_010064559.1|  PREDICTED: dehydration-responsive element-bi...    113   1e-25   
ref|XP_006294524.1|  hypothetical protein CARUB_v10023556mg             115   1e-25   
ref|XP_002444543.1|  hypothetical protein SORBIDRAFT_07g023575          115   1e-25   Sorghum bicolor [broomcorn]
gb|AEI98833.1|  dehydration responsive element binding protein 1        114   1e-25   
emb|CBH19547.1|  AP2 domain containing protein                          111   1e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_008678419.1|  PREDICTED: dehydration-responsive element-bi...    114   1e-25   
gb|AIZ74387.1|  DREB1                                                   111   2e-25   
ref|XP_010921034.1|  PREDICTED: dehydration-responsive element-bi...    114   2e-25   
emb|CBH19548.1|  AP2 domain containing protein                          111   2e-25   Oryza sativa Indica Group [Indian rice]
emb|CBI19777.3|  unnamed protein product                                111   2e-25   
ref|NP_001042107.1|  Os01g0165000                                       112   2e-25   Oryza sativa Japonica Group [Japonica rice]
sp|A2WL19.2|DRE2A_ORYSI  RecName: Full=Dehydration-responsive ele...    112   2e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_009621512.1|  PREDICTED: dehydration-responsive element-bi...    111   3e-25   
gb|AIY24737.1|  dehydration responsive element binding protein 2a       112   3e-25   
emb|CBH19567.1|  AP2 domain containing protein                          111   3e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_006643786.1|  PREDICTED: dehydration-responsive element-bi...    112   3e-25   
gb|AAL40870.1|  DREB1                                                   112   3e-25   Oryza sativa [red rice]
gb|ADT91190.1|  DREB-like protein                                       112   3e-25   
gb|EAY72665.1|  hypothetical protein OsI_00531                          112   4e-25   Oryza sativa Indica Group [Indian rice]
gb|EAZ10669.1|  hypothetical protein OsJ_00499                          112   4e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AFP89590.1|  putative dehydration responsive element-binding p...    110   5e-25   
ref|XP_010508876.1|  PREDICTED: dehydration-responsive element-bi...    113   5e-25   
ref|XP_010254126.1|  PREDICTED: dehydration-responsive element-bi...    112   5e-25   
gb|ACA79910.1|  DRE-binding protein 2                                   111   7e-25   Sorghum bicolor [broomcorn]
ref|XP_002457289.1|  hypothetical protein SORBIDRAFT_03g004980          111   7e-25   Sorghum bicolor [broomcorn]
gb|ACA79916.1|  DRE-binding protein 2                                   111   7e-25   Sorghum bicolor [broomcorn]
gb|ACA79914.1|  DRE-binding protein 2                                   111   7e-25   Sorghum bicolor [broomcorn]
gb|ABX45045.1|  desiccation responisve element-binding protein          111   7e-25   Sorghum bicolor [broomcorn]
gb|ACA79912.1|  DRE-binding protein 2                                   111   8e-25   Sorghum bicolor [broomcorn]
gb|AAS46285.1|  DREB-like protein 2                                     110   9e-25   Cynodon dactylon
ref|XP_009416308.1|  PREDICTED: dehydration-responsive element-bi...    111   9e-25   
ref|XP_009141887.1|  PREDICTED: dehydration-responsive element-bi...    111   1e-24   
gb|ACX37095.1|  DREB-like protein 1                                     110   1e-24   Zoysia japonica [Japanese lawn grass]
gb|AAS46284.1|  DREB-like protein 1                                     110   1e-24   Cynodon dactylon
gb|ACA79919.1|  DRE-binding protein 2                                   110   1e-24   Sorghum bicolor [broomcorn]
gb|ACV42429.1|  DREB-like protein 1                                     110   1e-24   Zoysia japonica [Japanese lawn grass]
ref|XP_009384927.1|  PREDICTED: dehydration-responsive element-bi...    111   1e-24   
ref|XP_009384928.1|  PREDICTED: dehydration-responsive element-bi...    110   1e-24   
gb|ABP52086.1|  dehydration responsive element binding protein          110   1e-24   Bouteloua dactyloides
gb|KDP44697.1|  hypothetical protein JCGZ_01197                         111   2e-24   
gb|AFV52020.1|  DREB2                                                   109   3e-24   
gb|KEH36215.1|  dehydration-responsive element-binding protein          108   3e-24   
ref|XP_010922641.1|  PREDICTED: dehydration-responsive element-bi...    109   3e-24   
gb|AIU40168.1|  dehydration responsive element binding protein 2        109   3e-24   
gb|AGG20202.1|  DREB2                                                   109   4e-24   
emb|CDY52924.1|  BnaA04g29310D                                          110   4e-24   
gb|ADM73511.1|  dehydration responsive element-binding protein 2        108   4e-24   
ref|XP_006828126.1|  hypothetical protein AMTR_s00023p00044590          110   4e-24   
ref|XP_009402398.1|  PREDICTED: dehydration-responsive element-bi...    110   4e-24   
gb|ACF98541.1|  DRE-binding protein DREB1                               108   5e-24   Phyllostachys edulis [kikko-chiku]
ref|NP_565929.1|  dehydration-responsive element-binding protein 2C     109   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001152469.1|  dehydration-responsive element-binding prote...    108   6e-24   Zea mays [maize]
ref|XP_008799805.1|  PREDICTED: dehydration-responsive element-bi...    108   6e-24   
ref|XP_004968294.1|  PREDICTED: dehydration-responsive element-bi...    108   7e-24   
ref|XP_002973089.1|  hypothetical protein SELMODRAFT_38502              103   9e-24   
gb|ACA79921.1|  DRE-binding protein 2                                   108   1e-23   Sorghum bicolor [broomcorn]
ref|XP_001756620.1|  predicted protein                                  103   1e-23   
gb|ABY19375.1|  DRE-binding protein DREB2                               108   1e-23   Phyllostachys edulis [kikko-chiku]
ref|XP_009406908.1|  PREDICTED: dehydration-responsive element-bi...    108   1e-23   
ref|XP_009406909.1|  PREDICTED: dehydration-responsive element-bi...    108   1e-23   
gb|AEK48227.1|  dehydration-responsive element-binding protein          104   2e-23   
gb|AEI69362.1|  dehydration responsive element binding protein 1001     107   2e-23   
emb|CAG30547.1|  putative DREB2A protein                                106   3e-23   Festuca arundinacea [tall fescue]
emb|CAH10193.1|  dehydration-responsive element binding protein 2...    106   3e-23   Festuca arundinacea [tall fescue]
gb|AFO12481.1|  DRE-binding protein 2                                   106   3e-23   
emb|CAG30548.1|  putative DREB2A protein                                106   3e-23   Festuca arundinacea [tall fescue]
gb|AAR11157.1|  dehydration-responsive element binding protein 2        106   3e-23   Festuca arundinacea [tall fescue]
gb|AAS59530.1|  putative DRE-binding protein DREB2                      106   3e-23   Poa pratensis
ref|XP_003569085.1|  PREDICTED: dehydration-responsive element-bi...    106   4e-23   
gb|AGL08026.1|  dehydration-responsive element-binding protein          103   5e-23   
gb|AEK48229.1|  dehydration-responsive element-binding protein          103   5e-23   
gb|ABA08425.1|  dehydration-responsive element-binding protein          103   5e-23   Triticum aestivum [Canadian hard winter wheat]
gb|AEK48231.1|  dehydration-responsive element-binding protein          103   5e-23   
gb|AFO12472.1|  DRE-binding protein 2                                   105   5e-23   
gb|AGL08024.1|  dehydration-responsive element-binding protein          103   6e-23   
gb|AGL08027.1|  dehydration-responsive element-binding protein          103   6e-23   
gb|AEO78514.1|  dehydration-responsive element-binding protein          103   6e-23   
gb|AFO12478.1|  DRE-binding protein 2                                   105   6e-23   
gb|AEZ68001.1|  dehydration-responsive element-binding protein          103   6e-23   
gb|AFO12474.1|  DRE-binding protein 2                                   105   6e-23   
gb|AAM61256.1|  AP2 domain transcription factor                         107   6e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AEO78515.1|  dehydration-responsive element-binding protein          103   6e-23   
gb|AFO12471.1|  DRE-binding protein 2                                   105   6e-23   
gb|AEO78516.1|  dehydration-responsive element-binding protein          102   6e-23   
gb|AFO12476.1|  DRE-binding protein 2                                   105   6e-23   
gb|AFO12468.1|  DRE-binding protein 2                                   105   7e-23   
gb|AFO12479.1|  DRE-binding protein 2                                   105   7e-23   
gb|AFO12470.1|  DRE-binding protein 2                                   105   7e-23   
gb|AAU29412.1|  dehydration-responsive element-binding protein 2        105   7e-23   Hordeum brevisubulatum
gb|AFO12483.1|  DRE-binding protein 2                                   105   7e-23   
gb|AFO12467.1|  DRE-binding protein 2                                   105   7e-23   
gb|AFO12477.1|  DRE-binding protein 2                                   105   7e-23   
gb|AFH75401.1|  dehydration-responsive element-binding transcript...    105   7e-23   
gb|AIY22669.1|  Dreb-like protein                                       105   7e-23   
gb|AGL08025.1|  dehydration-responsive element-binding protein          102   7e-23   
gb|ABD66654.1|  DRE-binding protein 2                                   105   7e-23   Sorghum bicolor [broomcorn]
gb|AFO12480.1|  DRE-binding protein 2                                   105   7e-23   
gb|AFO12475.1|  DRE-binding protein 2                                   105   8e-23   
gb|AIY22668.1|  Dreb-like protein                                       105   8e-23   
gb|AFO12473.1|  DRE-binding protein 2                                   105   9e-23   
gb|AEZ68005.1|  dehydration-responsive element-binding protein          102   9e-23   
gb|AEV46839.1|  dehydration-responsive element binding protein          105   9e-23   
gb|AIY22663.1|  Dreb-like protein                                       105   9e-23   
gb|AIY22665.1|  Dreb-like protein                                       105   1e-22   
gb|ABA08426.1|  dehydration-responsive element-binding protein          105   1e-22   Triticum aestivum [Canadian hard winter wheat]
gb|AER42620.1|  dehydration responsive element binding protein 1        105   1e-22   
gb|AEZ68003.1|  dehydration-responsive element-binding protein          102   1e-22   
ref|XP_008804145.1|  PREDICTED: dehydration-responsive element-bi...    105   1e-22   
ref|XP_008776283.1|  PREDICTED: dehydration-responsive element-bi...    105   1e-22   
gb|AAY25517.1|  dehydration responsive element binding protein 1        105   1e-22   Hordeum vulgare subsp. vulgare [barley]
emb|CAG30549.1|  putative FaDREB2A                                      104   1e-22   Festuca arundinacea [tall fescue]
gb|AEI98920.1|  AP2/EREBP transcription factor                          105   1e-22   
gb|AEZ68002.1|  dehydration-responsive element-binding protein          102   1e-22   
gb|AAX13289.1|  DREB transcription factor 6                             104   1e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007009970.1|  Dehydration-responsive element-binding prote...    104   1e-22   
ref|XP_008792180.1|  PREDICTED: dehydration-responsive element-bi...    105   1e-22   
gb|AAL01124.1|AF303376_1  AP2-containing protein                        105   1e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010534621.1|  PREDICTED: dehydration-responsive element-bi...    106   1e-22   
emb|CBX87024.1|  DREB2 protein                                          105   1e-22   
gb|AAY44604.1|  dehydration responsive element binding protein W73      105   1e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009803153.1|  PREDICTED: uncharacterized protein LOC104248568    106   2e-22   
emb|CBH19568.1|  AP2 domain containing protein                          103   2e-22   Oryza sativa Indica Group [Indian rice]
gb|AIY22666.1|  Dreb-like protein                                       103   3e-22   
ref|XP_007140202.1|  hypothetical protein PHAVU_008G092800g             106   3e-22   
gb|ABS11171.1|  putative DRE-binding protein DREB2                      103   3e-22   Avena sativa [cultivated oat]
ref|XP_010921035.1|  PREDICTED: dehydration-responsive element-bi...    103   4e-22   
gb|AFO12469.1|  DRE-binding protein 2                                   103   5e-22   
gb|AIY22662.1|  Dreb-like protein                                       103   6e-22   
gb|EMS61906.1|  Dehydration-responsive element-binding protein 2C       101   6e-22   
ref|XP_006411048.1|  hypothetical protein EUTSA_v10017658mg             102   6e-22   
gb|EMT21934.1|  Dehydration-responsive element-binding protein 2G       102   6e-22   
ref|XP_003568655.1|  PREDICTED: dehydration-responsive element-bi...    103   7e-22   
ref|XP_008370188.1|  PREDICTED: uncharacterized protein LOC103433697    105   8e-22   
gb|AFJ14635.1|  dehydration-responsive element-binding protein (D...    105   8e-22   
ref|XP_003568656.1|  PREDICTED: dehydration-responsive element-bi...    103   9e-22   
gb|ACH73204.1|  dehydration responsive element binding protein          103   9e-22   Leymus chinensis
emb|CDX72012.1|  BnaC08g28620D                                          102   9e-22   
gb|ABU68663.1|  AP2 transcriptional activator variant                 98.2    9e-22   Triticum turgidum subsp. durum
ref|XP_009116465.1|  PREDICTED: dehydration-responsive element-bi...    102   9e-22   
gb|AIY22664.1|  Dreb-like protein                                       102   9e-22   
ref|XP_004963449.1|  PREDICTED: dehydration-responsive element-bi...    102   9e-22   
emb|CDY06088.1|  BnaA09g36920D                                          102   1e-21   
gb|AAO27885.1|  dehydration-responsive AP2 domain transcriptional...    103   1e-21   Hordeum vulgare [barley]
gb|ACU15341.1|  unknown                                                 100   1e-21   Glycine max [soybeans]
gb|AFI71304.1|  dehydration responsive element binding protein is...    103   1e-21   
ref|XP_011020328.1|  PREDICTED: dehydration-responsive element-bi...    102   1e-21   
gb|AAO38209.1|  AP2 transcriptional activator DRF1.1                    103   1e-21   Hordeum vulgare [barley]
gb|ADE35085.1|  DREB2A                                                  102   1e-21   
gb|ADD92167.1|  DREB2A                                                  102   2e-21   
gb|ACX94337.1|  dehydration responsive factor 1.3                       102   2e-21   
ref|NP_001267497.1|  uncharacterized protein LOC100500303               104   2e-21   
gb|AIY22667.1|  Dreb-like protein                                       101   2e-21   
ref|XP_009597142.1|  PREDICTED: dehydration-responsive element-bi...    102   2e-21   
ref|XP_002308045.2|  Dehydration responsive element binding prote...    101   3e-21   
ref|XP_010676824.1|  PREDICTED: dehydration-responsive element-bi...    101   3e-21   
ref|XP_010553212.1|  PREDICTED: dehydration-responsive element-bi...    102   3e-21   
gb|ACJ01649.1|  dehydration responsive factor 1 variant 1.3             101   3e-21   
gb|EMT23900.1|  Dehydration-responsive element-binding protein 2A       105   3e-21   
gb|EMS47871.1|  Dehydration-responsive element-binding protein 2A       105   3e-21   
gb|ACX94335.1|  dehydration responsive factor 1.1                       102   3e-21   
gb|KFK36732.1|  hypothetical protein AALP_AA4G162500                    100   3e-21   
gb|ACJ01646.1|  dehydration responsive factor 1 variant 1.3 type b      101   3e-21   
gb|ACO58508.1|  dehydration responsive factor 1                       99.8    3e-21   
gb|ACO35588.1|  dehydration responsive factor 1 variant 3               101   3e-21   
ref|XP_011075213.1|  PREDICTED: dehydration-responsive element-bi...    101   4e-21   
gb|ACJ01645.1|  dehydration responsive factor 1 variant 1.3 type a      101   4e-21   
gb|AFO11002.1|  AP2 transcriptional activator DRF 1.3                   101   4e-21   
gb|AAX13283.1|  DREB transcription factor 4B                            101   4e-21   
gb|AAX13278.1|  DREB transcription factor 3B                            101   4e-21   
gb|ADM93284.1|  DRE-binding transcription factor 1.1                    101   4e-21   
gb|ACO35585.1|  dehydration responsive factor 1 variant 3               101   4e-21   
gb|AFO10996.1|  AP2 transcriptional activator DRF 1.3                   101   4e-21   
ref|XP_010934576.1|  PREDICTED: dehydration-responsive element-bi...  98.2    4e-21   
gb|AFQ00888.1|  AP2 transcriptional activator DRF1.3                    101   4e-21   
gb|ABU97502.1|  AP2 transcriptional activator variant 1                 101   5e-21   
gb|ACJ01643.1|  dehydration responsive factor 1 variant 1.3             101   5e-21   
gb|AES79603.2|  DRE transcription factor                                103   5e-21   
gb|EMS45041.1|  Dehydration-responsive element-binding protein 2B       101   5e-21   
gb|AHG26212.1|  dreb2                                                   101   5e-21   
gb|AEI54698.1|  AP2/EREBP protein                                       100   5e-21   
gb|ABU68665.1|  AP2 transcriptional activator DRF1.1                    101   5e-21   
gb|AAO27884.1|  AP2 domain protein                                      100   6e-21   
gb|ACT78966.1|  dehydration responsive factor 1 variant 1.1 type a      101   6e-21   
gb|ACO35583.1|  dehydration responsive factor 1 variant 1               101   6e-21   
gb|ADM93286.1|  DRE-binding transcription factor 1.3                    101   6e-21   
gb|ADM89078.1|  DREB2 transcription factor alpha isoform                101   6e-21   
gb|AAY83361.2|  AP2 transcriptional activator                           100   6e-21   
gb|AAX13277.1|  DREB transcription factor 3A                            101   6e-21   
gb|ACO35586.1|  dehydration responsive factor 1 variant 1               101   6e-21   
gb|KFK36913.1|  hypothetical protein AALP_AA4G189100                    100   6e-21   
ref|XP_010692919.1|  PREDICTED: dehydration-responsive element-bi...    101   6e-21   
ref|XP_010692920.1|  PREDICTED: dehydration-responsive element-bi...    100   6e-21   
ref|XP_009613454.1|  PREDICTED: dehydration-responsive element-bi...    100   6e-21   
gb|AFO11000.1|  AP2 transcriptional activator DRF 1.1                   101   7e-21   
gb|AAX13282.1|  DREB transcription factor 4A                            101   7e-21   
ref|XP_010524115.1|  PREDICTED: dehydration-responsive element-bi...    100   7e-21   
ref|XP_009804771.1|  PREDICTED: dehydration-responsive element-bi...    100   7e-21   
gb|AFO10994.1|  AP2 transcriptional activator DRF 1.1                   101   7e-21   
gb|AFU35564.1|  DRE-binding protein 2D;1                                102   7e-21   
dbj|BAJ94771.1|  predicted protein                                      100   7e-21   
ref|XP_009402399.1|  PREDICTED: dehydration-responsive element-bi...  99.8    7e-21   
gb|ACT78962.1|  dehydration responsive factor 1 variant 1.1             101   8e-21   
ref|XP_004249756.1|  PREDICTED: dehydration-responsive element-bi...    100   8e-21   
gb|AEI54699.1|  AP2/EREBP protein                                       100   8e-21   
gb|AFO10997.1|  AP2 transcriptional activator DRF 1.1                   100   8e-21   
gb|ADX32484.1|  Dreb2                                                 99.4    8e-21   
gb|AAY83360.2|  AP2 transcriptional activator                           100   9e-21   
ref|XP_009768300.1|  PREDICTED: uncharacterized protein LOC104219331    102   9e-21   
dbj|BAD97369.1|  EREBP/AP2 type transcription factor                    100   9e-21   
ref|NP_191319.1|  dehydration-responsive element-binding protein 2F   99.8    9e-21   
ref|XP_002876426.1|  hypothetical protein ARALYDRAFT_486209           99.8    9e-21   
ref|XP_004148625.1|  PREDICTED: uncharacterized protein LOC101215862    100   1e-20   
gb|AAX13287.1|  DREB transcription factor 5B                            100   1e-20   
ref|XP_003623385.1|  Dehydration responsive element binding protein     102   1e-20   
ref|XP_004136746.1|  PREDICTED: dehydration-responsive element-bi...  97.4    1e-20   
ref|XP_010504692.1|  PREDICTED: dehydration-responsive element-bi...  99.8    1e-20   
ref|XP_010427643.1|  PREDICTED: dehydration-responsive element-bi...  99.8    1e-20   
emb|CDY71905.1|  BnaCnng75020D                                        99.0    1e-20   
gb|KDP26013.1|  hypothetical protein JCGZ_21046                       99.8    1e-20   
gb|ABY66038.1|  DRF1.3                                                  100   1e-20   
ref|XP_008464230.1|  PREDICTED: ethylene-responsive transcription...    100   1e-20   
gb|KFK35005.1|  hypothetical protein AALP_AA5G221900                  99.0    1e-20   
ref|XP_006291644.1|  hypothetical protein CARUB_v10017800mg           99.4    1e-20   
gb|EMT19751.1|  Dehydration-responsive element-binding protein 2A       100   1e-20   
ref|XP_006351409.1|  PREDICTED: dehydration-responsive element-bi...  99.8    1e-20   
ref|XP_010516379.1|  PREDICTED: dehydration-responsive element-bi...  99.4    1e-20   
gb|AAD25951.1|AF085279_24  hypothetical protein                       99.4    1e-20   
gb|EMT22445.1|  Dehydration-responsive element-binding protein 2A     97.4    1e-20   
ref|XP_003625169.1|  Dehydration-responsive element-binding prote...  99.4    1e-20   
gb|AGL07769.1|  AP2/EREBP protein                                     99.4    1e-20   
gb|AAX13286.1|  DREB transcription factor 5A                            100   1e-20   
ref|XP_004161497.1|  PREDICTED: dehydration-responsive element-bi...  97.1    1e-20   
gb|ACO35591.1|  dehydration responsive factor 1 variant 3             99.8    1e-20   
gb|AEC53579.1|  dehydration-responsive element binding protein 2A     99.8    2e-20   
gb|ABY66036.1|  DRF1.1                                                  100   2e-20   
ref|XP_010672841.1|  PREDICTED: dehydration-responsive element-bi...  99.0    2e-20   
gb|EYU18760.1|  hypothetical protein MIMGU_mgv1a011288mg              99.0    2e-20   
ref|XP_011033305.1|  PREDICTED: dehydration-responsive element-bi...  99.0    2e-20   
ref|XP_002323309.1|  Dehydration responsive element binding prote...  99.0    2e-20   
ref|XP_002526723.1|  hypothetical protein RCOM_0089590                99.0    2e-20   
emb|CDP06427.1|  unnamed protein product                                101   2e-20   
ref|XP_004492501.1|  PREDICTED: uncharacterized protein LOC101505842    101   2e-20   
ref|XP_009143395.1|  PREDICTED: dehydration-responsive element-bi...  98.2    2e-20   
gb|AEC53580.1|  dehydration-responsive element binding protein 2C     99.8    2e-20   
ref|XP_004493523.1|  PREDICTED: dehydration-responsive element-bi...  98.6    2e-20   
gb|AFI71292.1|  dehydration responsive element binding protein 2 ...  99.4    2e-20   
gb|ACO35589.1|  dehydration responsive factor 1 variant 1             99.8    2e-20   
ref|XP_007162244.1|  hypothetical protein PHAVU_001G136100g           98.6    2e-20   
gb|ACJ01648.1|  dehydration responsive factor 1 variant 1.3 type b    99.0    2e-20   
ref|XP_006402862.1|  hypothetical protein EUTSA_v10006489mg           98.6    3e-20   
emb|CDY33815.1|  BnaCnng07330D                                        94.4    3e-20   
ref|XP_003553420.1|  PREDICTED: dehydration-responsive element-bi...  98.2    3e-20   
gb|KHN26337.1|  Dehydration-responsive element-binding protein 2F     98.2    3e-20   
gb|ACJ01647.1|  dehydration responsive factor 1 variant 1.3 type a    99.0    3e-20   
emb|CDX93190.1|  BnaC04g47060D                                        97.1    3e-20   
gb|AFI71291.1|  dehydration responsive element binding protein 2 ...  99.0    3e-20   
emb|CDP10066.1|  unnamed protein product                              98.2    4e-20   
ref|XP_010091874.1|  Dehydration-responsive element-binding prote...    101   4e-20   
gb|KHN29762.1|  Dehydration-responsive element-binding protein 2F     95.5    4e-20   
ref|XP_009139025.1|  PREDICTED: dehydration-responsive element-bi...  97.4    5e-20   
gb|KGN59345.1|  hypothetical protein Csa_3G812170                     98.2    5e-20   
gb|AEO78517.1|  dehydration-responsive element-binding protein        93.6    5e-20   
ref|XP_002277662.2|  PREDICTED: dehydration-responsive element-bi...  97.8    5e-20   
ref|XP_007145629.1|  hypothetical protein PHAVU_007G255100g           97.8    5e-20   
ref|XP_007028832.1|  Integrase-type DNA-binding superfamily protein   97.4    5e-20   
emb|CDX88955.1|  BnaA04g02310D                                        97.1    5e-20   
ref|XP_009764492.1|  PREDICTED: dehydration-responsive element-bi...  98.2    6e-20   
ref|XP_009394631.1|  PREDICTED: dehydration-responsive element-bi...  96.7    6e-20   
ref|XP_008443124.1|  PREDICTED: dehydration-responsive element-bi...  97.8    6e-20   
ref|XP_009599185.1|  PREDICTED: uncharacterized protein LOC104094874  99.4    6e-20   
ref|XP_004307569.1|  PREDICTED: dehydration-responsive element-bi...  97.4    6e-20   
gb|AIB05898.1|  AP2-EREBP transcription factor                        97.8    6e-20   
ref|XP_008387280.1|  PREDICTED: dehydration-responsive element-bi...  97.4    6e-20   
ref|XP_008350282.1|  PREDICTED: dehydration-responsive element-bi...  97.4    6e-20   
gb|ACT78969.1|  dehydration responsive factor 1 variant 1.1 type a    98.2    6e-20   
ref|XP_008660493.1|  PREDICTED: dehydration-responsive element-bi...  97.8    6e-20   
ref|XP_008651496.1|  PREDICTED: dehydration-responsive element-bi...  97.8    6e-20   
gb|EAY88744.1|  hypothetical protein OsI_10219                        97.8    7e-20   
gb|EAZ25772.1|  hypothetical protein OsJ_09612                        97.8    7e-20   
sp|Q10R18.1|DRE2E_ORYSJ  RecName: Full=Dehydration-responsive ele...  97.8    7e-20   
ref|XP_002881588.1|  hypothetical protein ARALYDRAFT_482845           96.7    7e-20   
ref|XP_001781003.1|  predicted protein                                92.0    7e-20   
ref|XP_009340780.1|  PREDICTED: dehydration-responsive element-bi...  97.1    8e-20   
gb|ACJ01644.1|  dehydration responsive factor 1 variant 1.3           97.8    8e-20   
emb|CAT00689.1|  AP2 transcription factor                             95.5    9e-20   
ref|NP_181368.1|  dehydration-responsive element-binding protein 2E   96.3    9e-20   
ref|XP_003520524.1|  PREDICTED: dehydration-responsive element-bi...  96.7    9e-20   
gb|KCW49415.1|  hypothetical protein EUGRSUZ_K02952                   94.7    1e-19   
emb|CDY61527.1|  BnaC04g53380D                                        97.1    1e-19   
ref|XP_004985522.1|  PREDICTED: dehydration-responsive element-bi...  97.1    1e-19   
emb|CDY54455.1|  BnaAnng13220D                                        95.9    1e-19   
ref|XP_009373085.1|  PREDICTED: uncharacterized protein LOC103962141  99.0    1e-19   
ref|XP_006850202.1|  hypothetical protein AMTR_s00022p00250320        96.3    1e-19   
ref|XP_007202407.1|  hypothetical protein PRUPE_ppa009616mg           96.7    1e-19   
ref|XP_008240865.1|  PREDICTED: dehydration-responsive element-bi...  96.7    1e-19   
gb|KHN48370.1|  Dehydration-responsive element-binding protein 2F     97.1    1e-19   
ref|XP_010091861.1|  Dehydration-responsive element-binding prote...  96.3    1e-19   
ref|XP_010265763.1|  PREDICTED: dehydration-responsive element-bi...  96.3    1e-19   
ref|XP_003518110.1|  PREDICTED: dehydration-responsive element-bi...  96.7    1e-19   
ref|XP_010257316.1|  PREDICTED: dehydration-responsive element-bi...  96.3    1e-19   
gb|ACT78964.1|  dehydration responsive factor 1 variant 1.1           97.4    2e-19   
gb|AFJ14634.1|  dehydration-responsive element-binding protein (D...  97.8    2e-19   
ref|XP_009612863.1|  PREDICTED: dehydration-responsive element-bi...  97.1    2e-19   
gb|ADJ67432.1|  ethylene response factor 3                            96.7    2e-19   
ref|XP_010940962.1|  PREDICTED: dehydration-responsive element-bi...  96.3    2e-19   
ref|XP_009411347.1|  PREDICTED: dehydration-responsive element-bi...  96.3    2e-19   
ref|XP_010057479.1|  PREDICTED: dehydration-responsive element-bi...  95.9    2e-19   
ref|XP_007026573.1|  Uncharacterized protein TCM_021596               99.0    2e-19   
ref|XP_006575245.1|  PREDICTED: dehydration-responsive element-bi...  94.4    2e-19   
ref|XP_008809802.1|  PREDICTED: dehydration-responsive element-bi...  95.9    2e-19   
ref|XP_006493905.1|  PREDICTED: dehydration-responsive element-bi...  95.9    2e-19   
ref|XP_003535164.2|  PREDICTED: dehydration-responsive element-bi...  96.3    2e-19   
ref|XP_006421446.1|  hypothetical protein CICLE_v10005549mg           95.9    2e-19   
ref|XP_010676822.1|  PREDICTED: dehydration-responsive element-bi...  95.9    3e-19   
ref|XP_008776284.1|  PREDICTED: dehydration-responsive element-bi...  95.1    3e-19   
emb|CDY52095.1|  BnaC04g55440D                                        95.1    3e-19   
gb|KDP22828.1|  hypothetical protein JCGZ_00415                       95.5    4e-19   
gb|AHG26213.1|  dreb2                                                 95.9    5e-19   
emb|CDP13966.1|  unnamed protein product                              95.5    5e-19   
gb|ADX06857.1|  AP2/ERF domain-containing transcription factor        94.7    5e-19   
ref|XP_006355639.1|  PREDICTED: dehydration-responsive element-bi...  95.9    5e-19   
gb|EPS72578.1|  hypothetical protein M569_02179                       93.2    6e-19   
ref|XP_010087025.1|  Dehydration-responsive element-binding prote...  95.1    7e-19   
ref|XP_010534622.1|  PREDICTED: dehydration-responsive element-bi...  95.1    7e-19   
ref|XP_006854296.1|  hypothetical protein AMTR_s00039p00088760        93.6    7e-19   
ref|XP_008676276.1|  PREDICTED: dehydration-responsive element-bi...  90.5    8e-19   
ref|XP_002315132.1|  dehydration responsive element binding prote...  94.0    9e-19   
gb|AFI71303.1|  dehydration responsive element binding protein 3      94.0    1e-18   
dbj|BAO00821.1|  transcription factor                                 94.0    1e-18   
gb|AEI54688.1|  AP2/EREBP protein                                     93.6    1e-18   
ref|XP_008804144.1|  PREDICTED: dehydration-responsive element-bi...  94.0    1e-18   
ref|XP_011004133.1|  PREDICTED: dehydration-responsive element-bi...  93.2    1e-18   
gb|ACR22838.1|  dehydration responsive factor 1                       92.0    2e-18   
ref|XP_002960299.1|  hypothetical protein SELMODRAFT_27203            90.5    2e-18   
gb|ACR22839.1|  dehydration responsive factor 1                       92.0    2e-18   
ref|XP_002273838.1|  PREDICTED: dehydration-responsive element-bi...  94.0    2e-18   
ref|XP_009788693.1|  PREDICTED: dehydration-responsive element-bi...  94.0    2e-18   
gb|ABQ59087.1|  DREB2A                                                92.8    2e-18   
gb|AGG39692.1|  ERF transcription factor ERF1                         94.0    2e-18   
gb|ACR22841.1|  dehydration responsive factor 1                       91.7    2e-18   
gb|ADA59487.1|  DREB2b                                                92.8    2e-18   
ref|NP_001291246.1|  dehydration-responsive element-binding prote...  92.8    2e-18   
gb|ADA59486.1|  DREB2a                                                92.8    2e-18   
gb|ABV03750.1|  DRE-binding protein                                   92.8    2e-18   
ref|XP_011015329.1|  PREDICTED: dehydration-responsive element-bi...  92.8    2e-18   
ref|XP_009594350.1|  PREDICTED: dehydration-responsive element-bi...  93.6    2e-18   
ref|XP_008233818.1|  PREDICTED: dehydration-responsive element-bi...  94.0    2e-18   
ref|XP_007218175.1|  hypothetical protein PRUPE_ppa007606mg           93.6    2e-18   
gb|AAU93685.1|  DREB2A                                                90.9    2e-18   
ref|XP_010517125.1|  PREDICTED: dehydration-responsive element-bi...  92.4    2e-18   
gb|AHZ44784.1|  dehydration-responsive element-binding protein 2A     88.6    2e-18   
ref|XP_002989303.1|  hypothetical protein SELMODRAFT_427925           91.3    2e-18   
gb|ACR22840.1|  dehydration responsive factor 1                       91.7    2e-18   
ref|XP_002980956.1|  hypothetical protein SELMODRAFT_420500           91.3    2e-18   
gb|ACO58507.1|  dehydration responsive factor 1                       91.7    3e-18   
ref|XP_006295384.1|  hypothetical protein CARUB_v10024477mg           92.0    3e-18   
ref|XP_010505457.1|  PREDICTED: dehydration-responsive element-bi...  92.0    3e-18   
ref|NP_001055260.2|  Os05g0346200                                     92.4    3e-18   
gb|AGE97370.1|  ethylene response factor 15                           93.2    3e-18   
gb|AHI45171.1|  DREB group protein                                    93.6    3e-18   
ref|XP_004239956.1|  PREDICTED: dehydration-responsive element-bi...  93.6    4e-18   
ref|XP_002967414.1|  hypothetical protein SELMODRAFT_38483            87.4    4e-18   
emb|CAB93939.1|  AP2-domain DNA-binding protein                       93.2    4e-18   
gb|ADZ15315.1|  DREB2                                                 93.6    4e-18   
gb|AHJ08574.1|  DREB2-like protein                                    92.8    4e-18   
ref|XP_004302563.1|  PREDICTED: uncharacterized protein LOC101313427  94.4    6e-18   
ref|XP_007141729.1|  hypothetical protein PHAVU_008G220400g           92.4    7e-18   
gb|ACR22835.1|  dehydration responsive factor 1                       89.4    8e-18   



>ref|XP_009630729.1| PREDICTED: ethylene-responsive transcription factor CRF3-like 
[Nicotiana tomentosiformis]
Length=326

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 125/177 (71%), Gaps = 23/177 (13%)
 Frame = +2

Query  149  ANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLG  328
             N +P  KKS VGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGAR+WLG
Sbjct  7    TNNSPISKKSTVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARIWLG  66

Query  329  TFNTSLEaarayddaarrLYGPSAKLNLLDDTFsslsssspgstggagFNIGDDHYLsss  508
            TFNTSLEAARAYDDAARRLYG  AKLNL +                  FN G++  + S 
Sbjct  67   TFNTSLEAARAYDDAARRLYGSGAKLNLSES----------EQPSNENFNSGENCIIGS-  115

Query  509  pgssatatsEMSEGKEWYAEECSVLDEASVFRDRDGKYLLWETPAPSLLDEEQNRGW  679
                         G E  + ECSVL+EAS+F+D +GKYL+WE PAPSLLDE+ + G+
Sbjct  116  -----------GNGNE-SSGECSVLEEASIFKDGNGKYLVWENPAPSLLDEQLSTGF  160



>emb|CDP04254.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 143/224 (64%), Gaps = 11/224 (5%)
 Frame = +2

Query  68   MEESSGDSTINVRVPIGKEGGAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTF  247
            M E   +  +NV +P+ K+      K A  +  +KK  VG SRKGCMRGKGGPENA CT+
Sbjct  1    MMERVENEGVNVGIPVDKK----PKKEAAISTSMKKITVGGSRKGCMRGKGGPENAFCTY  56

Query  248  RGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrLYGPSAKLNLLDDTF  427
            RGVRQRTWGKWVAEIREPN GARVWLGTFNTS EAARAYDDAA+RLYG  AKLNL ++  
Sbjct  57   RGVRQRTWGKWVAEIREPNHGARVWLGTFNTSYEAARAYDDAAKRLYGKCAKLNLPEEDQ  116

Query  428  sslsssspgstggagFNIGDDHYLssspgssatatsEMSEGKEWYAEECSVLDEASVFRD  607
                  S      A  N  +  Y +    ++   + E+ + K       SVLDE S+F+D
Sbjct  117  PPSPPGSSSVASAAYSN--NTGYKNGQDLTNEHQSPELEDKK----NGTSVLDEVSIFKD  170

Query  608  RDGKYLLWETPAPSLLDEEQNRGWPEFPKDNNGFHCADGTEINI  739
             +G++   ETPAPSLL EEQ   WPE+P D NGFH ++   I++
Sbjct  171  INGEFAFDETPAPSLLGEEQILNWPEYPFD-NGFHWSNDGGISV  213



>gb|AFK24441.1| DREB2 [Coffea arabica]
Length=229

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 141/215 (66%), Gaps = 11/215 (5%)
 Frame = +2

Query  95   INVRVPIGKEGGAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWG  274
            +NV +P+ K+      K A  +  +KK  VG SRKGCMRGKGGPENA CT+RGVRQRTWG
Sbjct  9    VNVGIPVDKK----PKKEAAISTSMKKITVGGSRKGCMRGKGGPENAFCTYRGVRQRTWG  64

Query  275  KWVAEIREPNRGARVWLGTFNTSLEaarayddaarrLYGPSAKLNLLDDTFsslsssspg  454
            KWVAEIREPN GARVWLGTFNTS EAARAYDDAA+RLYG  AKLNL ++       SS  
Sbjct  65   KWVAEIREPNHGARVWLGTFNTSYEAARAYDDAAKRLYGKCAKLNLPEEDQPPSPPSSSS  124

Query  455  stggagFNIGDDHYLssspgssatatsEMSEGKEWYAEECSVLDEASVFRDRDGKYLLWE  634
                A  N  +  Y +    ++   + E+ + K       SVLDE S+F+D +G++   E
Sbjct  125  VASAAYSN--NTGYKNGQDLTNEHQSPELEDKK----NGTSVLDEVSIFKDINGEFAFDE  178

Query  635  TPAPSLLDEEQNRGWPEFPKDNNGFHCADGTEINI  739
            TPAPSLL EEQ   WPE+P D NGFH ++   I++
Sbjct  179  TPAPSLLGEEQILNWPEYPFD-NGFHWSNDGGISV  212



>ref|XP_011084760.1| PREDICTED: ethylene-responsive transcription factor RAP2-2-like 
[Sesamum indicum]
Length=199

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 118/194 (61%), Gaps = 31/194 (16%)
 Frame = +2

Query  107  VPIGKEGGAVTGKPANTAPPV-KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWV  283
            +PI KE       P+   P   KK  VGRSRKGCMRGKGGPENALCT+RGVRQRTWGKWV
Sbjct  12   LPIAKEPILAPDGPSKPPPASGKKPAVGRSRKGCMRGKGGPENALCTYRGVRQRTWGKWV  71

Query  284  AEIREPNRGARVWLGTFNTSLEaarayddaarrLYGPSAKLNLLDDTFsslsssspgstg  463
            AEIREPNRGARVWLGTFNTSLEAA+AYDDAARRLYG SAKLNL                 
Sbjct  72   AEIREPNRGARVWLGTFNTSLEAAQAYDDAARRLYGSSAKLNLSSGD-------------  118

Query  464  gagFNIGDDHYLssspgssatatsEMSEGKEWYAEECSVLDEASVFRDRDGKYLLWETPA  643
                  G D +      +  +   E      +Y EE SV DEA+          +WET  
Sbjct  119  ------GGDDFSQVPSDNYPSGGGEFVVPDNYYREEKSVFDEANC---------MWET--  161

Query  644  PSLLDEEQNRGWPE  685
            P+LLDE+++  WPE
Sbjct  162  PTLLDEKRSPNWPE  175



>ref|XP_004237644.1| PREDICTED: dehydration-responsive element-binding protein 2G-like 
[Solanum lycopersicum]
Length=161

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 108/163 (66%), Gaps = 36/163 (22%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            V+     RSRKGCMRGKGGPENA CT+RGVRQRTWGKWVAEIREPN GAR+WLGTFNTS+
Sbjct  12   VESKRKSRSRKGCMRGKGGPENASCTYRGVRQRTWGKWVAEIREPNGGARIWLGTFNTSV  71

Query  347  EaarayddaarrLYGPSAKLNLLDDTFsslsssspgstggagFNIGDDHYLssspgssat  526
            EAARAYDDAARRLYG  AKLNL +                   ++G              
Sbjct  72   EAARAYDDAARRLYGSDAKLNLSEQ---------------ESTDVG--------------  102

Query  527  atsEMSEGKEWYAEECSVLDEASVFRDRDGKYLLWETPAPSLL  655
               E  +G      ECSVL+EAS+F+D +GKYL+W+TPAPSLL
Sbjct  103  -IIEDGDG------ECSVLEEASIFKDGNGKYLVWDTPAPSLL  138



>ref|XP_002267549.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Vitis vinifera]
Length=198

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            VK+S +GRSRKGCM+GKGGPENALC++RGVRQRTWGKWVAEIREPNRGAR+WLGTFNTS 
Sbjct  9    VKRSAMGRSRKGCMKGKGGPENALCSYRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSY  68

Query  347  EaarayddaarrLYGPSAKLNLLDDT  424
            EAA AYD AA++LYGPSAKLNL  D+
Sbjct  69   EAAMAYDMAAQKLYGPSAKLNLPHDS  94



>ref|XP_009131668.1| PREDICTED: dehydration-responsive element-binding protein 2G-like 
[Brassica rapa]
Length=291

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  161  PPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNT  340
            PP KK N+GRSRKGCM+GKGGPENA CTFRGVRQRTWGKWVAEIREPNRG R+WLGTFNT
Sbjct  5    PPAKKRNMGRSRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNT  64

Query  341  SLEaarayddaarrLYGPSAKLNLL  415
            S++AA AYD+AA +LYGP A+LNLL
Sbjct  65   SVQAAMAYDEAAMKLYGPEARLNLL  89



>emb|CDY02629.1| BnaC02g08060D [Brassica napus]
Length=288

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  161  PPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNT  340
            PP KK N+GRSRKGCM+GKGGPENA CTFRGVRQRTWGKWVAEIREPN G R+WLGTFNT
Sbjct  6    PPTKKRNMGRSRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNHGTRIWLGTFNT  65

Query  341  SLEaarayddaarrLYGPSAKLNLL  415
            S+EAA AYD+AA++LYG  AKLNLL
Sbjct  66   SVEAAMAYDEAAKKLYGHEAKLNLL  90



>ref|XP_009126252.1| PREDICTED: dehydration-responsive element-binding protein 2G-like 
[Brassica rapa]
Length=288

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  161  PPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNT  340
            PP KK N+GRSRKGCM+GKGGPENA CTFRGVRQRTWGKWVAEIREPN G R+WLGTFNT
Sbjct  6    PPAKKRNMGRSRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNHGTRLWLGTFNT  65

Query  341  SLEaarayddaarrLYGPSAKLNLL  415
            S+EAA AYD+AA++LYG  AKLNLL
Sbjct  66   SVEAAMAYDEAAKKLYGHEAKLNLL  90



>ref|XP_006289041.1| hypothetical protein CARUB_v10002425mg [Capsella rubella]
 gb|EOA21939.1| hypothetical protein CARUB_v10002425mg [Capsella rubella]
Length=303

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  161  PPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNT  340
            PP KK N+GRSRKGCM+GKGGPENA CTFRGVRQRTWGKWVAEIREPNRG R+WLGTFNT
Sbjct  6    PPAKKRNMGRSRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNT  65

Query  341  SLEaarayddaarrLYGPSAKLNLL  415
            S+EAA+AYD+AA++LYG  AKLNLL
Sbjct  66   SVEAAKAYDEAAKKLYGHEAKLNLL  90



>ref|XP_009120973.1| PREDICTED: dehydration-responsive element-binding protein 2G 
[Brassica rapa]
 emb|CDX92610.1| BnaA10g16490D [Brassica napus]
Length=306

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  161  PPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNT  340
            PP KK N+GRSRKGCM+GKGGP+NA CTFRGVRQRTWGKWVAEIREPNRG R+WLGTFNT
Sbjct  6    PPAKKRNMGRSRKGCMKGKGGPQNATCTFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNT  65

Query  341  SLEaarayddaarrLYGPSAKLNLL  415
            S+EAA AYD+AA++LYG  AKLNLL
Sbjct  66   SVEAAMAYDEAAKKLYGHEAKLNLL  90



>ref|NP_197346.1| dehydration-responsive element-binding protein 2G [Arabidopsis 
thaliana]
 sp|P61827.1|DRE2G_ARATH RecName: Full=Dehydration-responsive element-binding protein 
2G; Short=Protein DREB2G [Arabidopsis thaliana]
 gb|AAT44920.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|ABG48430.1| At5g18450 [Arabidopsis thaliana]
 gb|AED92565.1| dehydration-responsive element-binding protein 2G [Arabidopsis 
thaliana]
Length=307

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  161  PPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNT  340
            PP KK N+GRSRKGCM+GKGGPENA CTFRGVRQRTWGKWVAEIREPNRG R+WLGTFNT
Sbjct  6    PPAKKRNMGRSRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNT  65

Query  341  SLEaarayddaarrLYGPSAKLNLL  415
            S+EAA AYD+AA++LYG  AKLNL+
Sbjct  66   SVEAAMAYDEAAKKLYGHEAKLNLV  90



>gb|KFK26084.1| hypothetical protein AALP_AA8G200700 [Arabis alpina]
Length=295

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  161  PPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNT  340
            PP KK N+GRSRKGCM+GKGGPENA CT+RGVRQRTWGKWVAEIREPNRG R+WLGTFNT
Sbjct  6    PPAKKRNMGRSRKGCMKGKGGPENATCTYRGVRQRTWGKWVAEIREPNRGTRLWLGTFNT  65

Query  341  SLEaarayddaarrLYGPSAKLNLL  415
            S+EAA AYD+AA++LYG  AKLNLL
Sbjct  66   SVEAAMAYDEAAKKLYGHEAKLNLL  90



>emb|CDY58117.1| BnaA02g35180D [Brassica napus]
Length=289

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  161  PPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNT  340
            PP KK N+GRSRKGCM+GKGGPENA CTFRGVRQRTWGKWVAEIREPN G R+WLGTFNT
Sbjct  7    PPAKKRNMGRSRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNHGTRLWLGTFNT  66

Query  341  SLEaarayddaarrLYGPSAKLNLL  415
            S+EAA AYD+AA++LYG  AKLNLL
Sbjct  67   SVEAAMAYDEAAKKLYGHEAKLNLL  91



>ref|XP_010454086.1| PREDICTED: dehydration-responsive element-binding protein 2G-like 
[Camelina sativa]
Length=305

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  161  PPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNT  340
            PP KK N+GRSRKGCM+GKGGPENA CTFRGVRQRTWGKWVAEIREPNRG R+WLGTFNT
Sbjct  6    PPAKKRNMGRSRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNT  65

Query  341  SLEaarayddaarrLYGPSAKLNLL  415
            S+EAA AYD+AA++LYG  AKLNLL
Sbjct  66   SVEAAMAYDEAAKKLYGHEAKLNLL  90



>ref|XP_010420608.1| PREDICTED: dehydration-responsive element-binding protein 2G-like 
[Camelina sativa]
Length=300

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  161  PPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNT  340
            PP KK N+GRSRKGCM+GKGGPENA CTFRGVRQRTWGKWVAEIREPNRG R+WLGTFNT
Sbjct  6    PPAKKRNMGRSRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNT  65

Query  341  SLEaarayddaarrLYGPSAKLNLL  415
            S+EAA AYD+AA++LYG  AKLNLL
Sbjct  66   SVEAAMAYDEAAKKLYGHEAKLNLL  90



>emb|CDY25420.1| BnaC09g39350D [Brassica napus]
Length=328

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  161  PPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNT  340
            PP KK N+GRSRKGCM+GKGGP+NA CTFRGVRQRTWGKWVAEIREPNRG R+WLGTFNT
Sbjct  6    PPAKKRNMGRSRKGCMKGKGGPQNATCTFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNT  65

Query  341  SLEaarayddaarrLYGPSAKLNLL  415
            S+EAA AYD+AA++LYG  AKLNLL
Sbjct  66   SVEAAMAYDEAAKKLYGHEAKLNLL  90



>ref|XP_010043317.1| PREDICTED: dehydration-responsive element-binding protein 2E 
[Eucalyptus grandis]
Length=240

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +2

Query  179  NVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaar  358
            ++GRSRKGCMRGKGGPENALCT+RGVRQRTWGKWVAEIREPNRGAR+WLGTFNTSLEAA 
Sbjct  27   SMGRSRKGCMRGKGGPENALCTYRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSLEAAL  86

Query  359  ayddaarrLYGPSAKLNL  412
            AYD AAR+LYGPSA+LNL
Sbjct  87   AYDKAARKLYGPSARLNL  104



>ref|XP_002873895.1| hypothetical protein ARALYDRAFT_909855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50154.1| hypothetical protein ARALYDRAFT_909855 [Arabidopsis lyrata subsp. 
lyrata]
Length=310

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  161  PPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNT  340
            PP KK N+GRSRKGCM+GKGGPENA CTFRGVRQRTWGKWVAEIREPNRG R+WLGTFNT
Sbjct  6    PPAKKRNMGRSRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNT  65

Query  341  SLEaarayddaarrLYGPSAKLNLL  415
            S+EAA AYD+AA++LYG  AKLNL+
Sbjct  66   SVEAAMAYDEAAKKLYGHEAKLNLV  90



>ref|XP_007208518.1| hypothetical protein PRUPE_ppa026176mg, partial [Prunus persica]
 gb|EMJ09717.1| hypothetical protein PRUPE_ppa026176mg, partial [Prunus persica]
Length=110

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +2

Query  176  SNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaa  355
            +++GRSRKGCM+GKGGPENALC+FRGVRQRTWGKWVAEIREPNRGAR+WLGTFNTS EAA
Sbjct  14   ASMGRSRKGCMKGKGGPENALCSFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSTEAA  73

Query  356  rayddaarrLYGPSAKLNLLD  418
             AYD+AAR+LYG SAKLNL D
Sbjct  74   LAYDEAARKLYGSSAKLNLPD  94



>emb|CAN66064.1| hypothetical protein VITISV_032355 [Vitis vinifera]
Length=173

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  VGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaara  361
            +GRSRKGCM+GKGGPENALC++RGVRQRTWGKWVAEIREPNRGAR+WLGTFNTS EAA A
Sbjct  1    MGRSRKGCMKGKGGPENALCSYRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSYEAAMA  60

Query  362  yddaarrLYGPSAKLNLLDDT  424
            YD AA++LYGPSAKLNL  D+
Sbjct  61   YDMAAQKLYGPSAKLNLPHDS  81



>ref|XP_010492849.1| PREDICTED: dehydration-responsive element-binding protein 2G 
[Camelina sativa]
Length=305

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  161  PPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNT  340
            PP KK N+GRSRKGCM+GKGGPENA C FRGVRQRTWGKWVAEIREPNRG R+WLGTFNT
Sbjct  6    PPAKKRNMGRSRKGCMKGKGGPENATCNFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNT  65

Query  341  SLEaarayddaarrLYGPSAKLNLL  415
            S+EAA AYD+AA++LYG  AKLNLL
Sbjct  66   SVEAAMAYDEAAKKLYGHEAKLNLL  90



>gb|EYU39769.1| hypothetical protein MIMGU_mgv1a018752mg, partial [Erythranthe 
guttata]
Length=113

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/78 (91%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +2

Query  179  NVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaar  358
            +V RSRKGCMRGKGGPENALCT+RGVRQRTWG+WVAEIREPNRGARVWLGTF+TSLEAA+
Sbjct  36   SVRRSRKGCMRGKGGPENALCTYRGVRQRTWGRWVAEIREPNRGARVWLGTFSTSLEAAQ  95

Query  359  ayddaarrLYGPSAKLNL  412
            AYDDAARRLYGP AKLNL
Sbjct  96   AYDDAARRLYGPFAKLNL  113



>ref|XP_006443285.1| hypothetical protein CICLE_v10022244mg [Citrus clementina]
 ref|XP_006478977.1| PREDICTED: dehydration-responsive element-binding protein 2G-like 
[Citrus sinensis]
 gb|ESR56525.1| hypothetical protein CICLE_v10022244mg [Citrus clementina]
Length=210

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
             KK N+GRSRKGCM+GKGGPEN LCT++GVRQRTWGKWVAEIREPNRGAR+WLG+FNTSL
Sbjct  15   TKKPNMGRSRKGCMKGKGGPENVLCTYKGVRQRTWGKWVAEIREPNRGARLWLGSFNTSL  74

Query  347  EaarayddaarrLYGPSAKLNL  412
            +AA AYD+AAR+LYG  AKLNL
Sbjct  75   DAALAYDEAARKLYGDYAKLNL  96



>ref|XP_008389032.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Malus domestica]
Length=228

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +2

Query  179  NVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaar  358
            ++GRSRKGCM+GKGGPENALC+FRGVRQRTWGKWVAEIREPNRGAR+WLGTFNTS EAA 
Sbjct  22   SMGRSRKGCMKGKGGPENALCSFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSTEAAL  81

Query  359  ayddaarrLYGPSAKLNLLD  418
            AYD+AAR+LYG SAKLNL D
Sbjct  82   AYDEAARKLYGSSAKLNLPD  101



>ref|XP_006400393.1| hypothetical protein EUTSA_v10015907mg [Eutrema salsugineum]
 gb|ESQ41846.1| hypothetical protein EUTSA_v10015907mg [Eutrema salsugineum]
Length=290

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +2

Query  161  PPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNT  340
            PP KK N+GRSRKGCM+GKGGPENA CTFRGVRQRTWGKWVAEIREPNRG R+WLGTFNT
Sbjct  6    PPTKKRNMGRSRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNT  65

Query  341  SLEaarayddaarrLYGPSAK  403
            S+EAA AYD+AA++LYG  AK
Sbjct  66   SVEAAMAYDEAAKKLYGHEAK  86



>ref|XP_008218369.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Prunus mume]
Length=223

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  179  NVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaar  358
            ++GRSRKGCM+GKGGPENALC FRGVRQRTWGKWVAEIREPNRGAR+WLGTFNTS EAA 
Sbjct  15   SMGRSRKGCMKGKGGPENALCNFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSTEAAL  74

Query  359  ayddaarrLYGPSAKLNLLD  418
            AYD+AAR+LYG SAKLNL D
Sbjct  75   AYDEAARKLYGTSAKLNLPD  94



>emb|CAN60823.1| hypothetical protein VITISV_037056 [Vitis vinifera]
Length=178

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
             KK+    SRKGCMRGKGGPENA+CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  9    AKKTAQASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSY  68

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYGP AKLNL
Sbjct  69   EAAIAYDAAARKLYGPEAKLNL  90



>ref|XP_004302113.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Fragaria vesca subsp. vesca]
Length=180

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  182  VGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaara  361
            +GRSRKGCM+GKGGPENA CTFRGVRQRTWGKWVAEIREP RGAR+WLGTFNTS EAA A
Sbjct  1    MGRSRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPKRGARLWLGTFNTSTEAALA  60

Query  362  yddaarrLYGPSAKLNLLD  418
            YDDAAR+LYG SAKLNL D
Sbjct  61   YDDAARKLYGSSAKLNLPD  79



>ref|XP_007160709.1| hypothetical protein PHAVU_001G010400g [Phaseolus vulgaris]
 gb|ESW32703.1| hypothetical protein PHAVU_001G010400g [Phaseolus vulgaris]
Length=265

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  137  TGKPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGAR  316
            +G   N +  VKK+    SRKGCMRGKGGPENA CTF+GVRQRTWGKWVAEIREPNRGAR
Sbjct  4    SGMGMNASKQVKKAAKASSRKGCMRGKGGPENATCTFKGVRQRTWGKWVAEIREPNRGAR  63

Query  317  VWLGTFNTSLEaarayddaarrLYGPSAKLNL  412
            +WLGTF TSLEAA AYD AAR+LYG  AKLNL
Sbjct  64   LWLGTFETSLEAAMAYDGAARKLYGSDAKLNL  95



>ref|XP_010243654.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Nelumbo nucifera]
Length=204

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            K+S    SRKGCMRGKGGPENALC +RGVRQRTWGKWVAEIREPNRGAR+WLGTFNTSLE
Sbjct  6    KRSPKRNSRKGCMRGKGGPENALCPYRGVRQRTWGKWVAEIREPNRGARIWLGTFNTSLE  65

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYDDAAR+LYG SA+LNL
Sbjct  66   AAVAYDDAARKLYGSSARLNL  86



>ref|XP_010936099.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Elaeis guineensis]
Length=207

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  188  RSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayd  367
            RSRKGCM+GKGGPEN  CTFRGVRQRTWGKWVAEIREPNRGAR+WLGTFNTSLEAA+AYD
Sbjct  22   RSRKGCMKGKGGPENQACTFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSLEAAQAYD  81

Query  368  daarrLYGPSAKLNLLDDTF  427
             AAR LYG  A+LNL D +F
Sbjct  82   AAARSLYGECARLNLPDSSF  101



>ref|XP_002280893.3| PREDICTED: dehydration-responsive element-binding protein 2D 
[Vitis vinifera]
Length=228

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
             KK+    SRKGCMRGKGGPENA+CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  15   AKKTAQASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSY  74

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYGP AKLNL
Sbjct  75   EAAIAYDAAARKLYGPEAKLNL  96



>ref|XP_002510462.1| Dehydration-responsive element-binding protein 2G, putative [Ricinus 
communis]
 gb|EEF52649.1| Dehydration-responsive element-binding protein 2G, putative [Ricinus 
communis]
Length=247

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            +KK     SRKGCMRGKGGPENALCT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  17   LKKPAQASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSH  76

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYGP AKLNL
Sbjct  77   EAAMAYDAAARKLYGPEAKLNL  98



>ref|XP_002522019.1| hypothetical protein RCOM_0610630 [Ricinus communis]
 gb|EEF40423.1| hypothetical protein RCOM_0610630 [Ricinus communis]
Length=215

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            KK  + RSRKGCM+GKGGPENALCT+RGVRQRTWGKWVAEIREPNRG R+WLGTFNTS E
Sbjct  8    KKVTMRRSRKGCMKGKGGPENALCTYRGVRQRTWGKWVAEIREPNRGNRIWLGTFNTSHE  67

Query  350  aarayddaarrLYGPSAKLNL  412
            AA+AYD AA +LYG SA LNL
Sbjct  68   AAKAYDQAAIKLYGSSATLNL  88



>ref|XP_007030307.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOY10809.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=213

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            + S++G+SRKGC RGKGGPENA+CT+RGVRQRTWGKWVAEIREPNRG R+W+GTF+TSL+
Sbjct  18   RPSSLGKSRKGCKRGKGGPENAMCTYRGVRQRTWGKWVAEIREPNRGNRLWIGTFSTSLD  77

Query  350  aarayddaarrLYGPSAKLNL  412
            A  AYD+ AR+LYGPSAKLNL
Sbjct  78   AVLAYDEVARKLYGPSAKLNL  98



>ref|XP_002302006.1| hypothetical protein POPTR_0002s03090g [Populus trichocarpa]
 gb|EEE81279.1| hypothetical protein POPTR_0002s03090g [Populus trichocarpa]
Length=240

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            KK     SRKGCMRGKGGPENALCT++GVRQRTWGKWVAEIREPNRGAR+WLGT++TS E
Sbjct  16   KKPEQASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTYDTSHE  75

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD AAR+LYGP AKLNL
Sbjct  76   AAMAYDAAARKLYGPEAKLNL  96



>ref|XP_008388158.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Malus domestica]
Length=251

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            P K+   G SRKGCM+GKGGPENA+CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF TS
Sbjct  15   PAKRPAQGSSRKGCMKGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFATS  74

Query  344  LEaarayddaarrLYGPSAKLNLLDD  421
             EAA AYD AAR+LYG  AKLNL D 
Sbjct  75   FEAALAYDAAARKLYGSKAKLNLPDQ  100



>ref|XP_011048848.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Populus euphratica]
Length=244

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            KK     SRKGCMRGKGGPENALCT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS E
Sbjct  19   KKPAQASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARIWLGTFDTSHE  78

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD AAR+LYGP AKLNL
Sbjct  79   AATAYDAAARKLYGPEAKLNL  99



>ref|XP_009391184.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Musa acuminata subsp. malaccensis]
Length=195

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  188  RSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayd  367
            RSRKGCM+GKGGPEN  CT+RGVRQRTWGKWVAEIREPNRGAR+WLGTF++SLEAA+AYD
Sbjct  16   RSRKGCMKGKGGPENQACTYRGVRQRTWGKWVAEIREPNRGARLWLGTFSSSLEAAQAYD  75

Query  368  daarrLYGPSAKLNLLDDT  424
            +AAR LYG  A+LNL DD+
Sbjct  76   NAARSLYGDCARLNLSDDS  94



>ref|XP_006435084.1| hypothetical protein CICLE_v10002280mg [Citrus clementina]
 gb|ESR48324.1| hypothetical protein CICLE_v10002280mg [Citrus clementina]
Length=248

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            +KK     SRKGCMRGKGGPENALCT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  15   LKKPAQASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSH  74

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYGP AKLNL
Sbjct  75   EAAMAYDAAARKLYGPDAKLNL  96



>ref|XP_011083628.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Sesamum indicum]
Length=212

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            V+K     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRG+RVWLGTF+TS 
Sbjct  14   VRKPAQASSRKGCMRGKGGPENAACTYKGVRQRTWGKWVAEIREPNRGSRVWLGTFDTSY  73

Query  347  EaarayddaarrLYGPSAKLNL  412
            +AA AYD AAR+LYGP AK+NL
Sbjct  74   DAAVAYDTAARKLYGPDAKVNL  95



>gb|KDO84711.1| hypothetical protein CISIN_1g036655mg [Citrus sinensis]
Length=243

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            +KK     SRKGCMRGKGGPENALCT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  10   LKKPAQASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSH  69

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYGP AKLNL
Sbjct  70   EAAMAYDAAARKLYGPDAKLNL  91



>ref|XP_006473580.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Citrus sinensis]
Length=248

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            +KK     SRKGCMRGKGGPENALCT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  15   LKKPAQASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSH  74

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYGP AKLNL
Sbjct  75   EAAVAYDAAARKLYGPDAKLNL  96



>dbj|BAJ53172.1| JHL18I08.6 [Jatropha curcas]
Length=238

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            ++K     SRKGCMRGKGGPENALCT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  17   LRKPAQASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSH  76

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYGP AKLNL
Sbjct  77   EAAMAYDAAARKLYGPEAKLNL  98



>gb|KDP38573.1| hypothetical protein JCGZ_04498 [Jatropha curcas]
Length=233

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            ++K     SRKGCMRGKGGPENALCT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  12   LRKPAQASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSH  71

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYGP AKLNL
Sbjct  72   EAAMAYDAAARKLYGPEAKLNL  93



>ref|XP_007136043.1| hypothetical protein PHAVU_009G013200g [Phaseolus vulgaris]
 gb|ESW08037.1| hypothetical protein PHAVU_009G013200g [Phaseolus vulgaris]
Length=249

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            VKK+    SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF TS 
Sbjct  14   VKKTAQASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSH  73

Query  347  EaarayddaarrLYGPSAKLNLLDDTF  427
            +AA AYD AAR+LYGP AKLNL D T 
Sbjct  74   DAALAYDAAARKLYGPDAKLNLPDLTV  100



>ref|XP_002306897.2| hypothetical protein POPTR_0005s25470g [Populus trichocarpa]
 gb|ABP64694.1| putative DRE-binding protein 5 [Populus trichocarpa]
 gb|EEE93893.2| hypothetical protein POPTR_0005s25470g [Populus trichocarpa]
Length=244

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            KK     SRKGCMRGKGGPENALCT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS E
Sbjct  19   KKPAQASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHE  78

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD AAR+LYGP AKLNL
Sbjct  79   AATAYDAAARKLYGPEAKLNL  99



>ref|XP_009336823.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Pyrus x bretschneideri]
Length=225

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            P K+   G SRKGCM+GKGGPENA+CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF TS
Sbjct  19   PAKRPVQGSSRKGCMKGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFATS  78

Query  344  LEaarayddaarrLYGPSAKLNLLDD  421
             EAA AYD AAR+LYG  AKLNL D 
Sbjct  79   YEAALAYDAAARKLYGSKAKLNLPDQ  104



>ref|XP_003549447.2| PREDICTED: ethylene-responsive transcription factor CRF4-like 
[Glycine max]
Length=282

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            VKK     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+T+ 
Sbjct  9    VKKPAQASSRKGCMRGKGGPENATCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAR  68

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYGP AKLNL
Sbjct  69   EAALAYDAAARKLYGPDAKLNL  90



>emb|CDX70820.1| BnaC03g09040D [Brassica napus]
Length=280

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  182  VGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaara  361
            +GRSRKGCM+GKGGPENA CTFRGVRQRTWGKWVAEIREPNRG R+WLGTFNTS++AA A
Sbjct  1    MGRSRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNTSVQAAMA  60

Query  362  yddaarrLYGPSAKLN  409
            YD+AA +LYGP A+LN
Sbjct  61   YDEAAMKLYGPEARLN  76



>gb|KHN12670.1| Dehydration-responsive element-binding protein 2D [Glycine soja]
Length=289

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            VKK     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+T+ 
Sbjct  14   VKKPAQASSRKGCMRGKGGPENATCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAR  73

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYGP AKLNL
Sbjct  74   EAALAYDAAARKLYGPDAKLNL  95



>ref|XP_010533259.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Tarenaya hassleriana]
Length=216

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            +K++    SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  9    IKRAVQTSSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSH  68

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYGPSA++NL
Sbjct  69   EAALAYDSAARKLYGPSAQVNL  90



>ref|XP_003545264.1| PREDICTED: ethylene-responsive transcription factor CRF4-like 
[Glycine max]
 gb|KHN20940.1| Dehydration-responsive element-binding protein 2D [Glycine soja]
Length=283

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            VKK     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+T+ 
Sbjct  9    VKKPAQASSRKGCMRGKGGPENAKCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAR  68

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYGP AKLNL
Sbjct  69   EAALAYDAAARKLYGPDAKLNL  90



>ref|XP_007226392.1| hypothetical protein PRUPE_ppa023248mg [Prunus persica]
 gb|EMJ27591.1| hypothetical protein PRUPE_ppa023248mg [Prunus persica]
Length=255

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            VK+     SRKGCMRGKGGPENA+CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  17   VKRPAQASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSH  76

Query  347  EaarayddaarrLYGPSAKLNLLDD  421
            EAA AYD AAR+LYG  AKLNL D 
Sbjct  77   EAASAYDAAARKLYGSQAKLNLPDQ  101



>gb|KDP23749.1| hypothetical protein JCGZ_23582 [Jatropha curcas]
Length=224

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 75/95 (79%), Gaps = 4/95 (4%)
 Frame = +2

Query  143  KPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVW  322
            K AN   P  +    RSRKGCM+GKGGPENALCT+RGVRQRTWGKWVAEIREPNRG R+W
Sbjct  3    KEANEKKPCMR----RSRKGCMKGKGGPENALCTYRGVRQRTWGKWVAEIREPNRGNRIW  58

Query  323  LGTFNTSLEaarayddaarrLYGPSAKLNLLDDTF  427
            LGTFNTS EAARAYD AA +LYG SA LNL    F
Sbjct  59   LGTFNTSDEAARAYDQAALKLYGSSATLNLPQYCF  93



>ref|XP_009386363.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Musa acuminata subsp. malaccensis]
Length=202

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            P K   + RSRKGCM+GKGGPEN  CT+RGVRQRTWGKWVAEIREPNRGAR+WLGTF+T+
Sbjct  8    PRKCCPLRRSRKGCMKGKGGPENQACTYRGVRQRTWGKWVAEIREPNRGARLWLGTFSTA  67

Query  344  LEaarayddaarrLYGPSAKLNLLD  418
            LEAA+AYD+AAR LYG  A+LNL D
Sbjct  68   LEAAQAYDNAARSLYGDCARLNLSD  92



>ref|XP_008796422.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Phoenix dactylifera]
Length=204

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  188  RSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayd  367
            RSRKGCM+GKGGPEN  C FRGVRQRTWGKWVAEIREPNRGAR+WLGTFNTSLEAA+AYD
Sbjct  22   RSRKGCMKGKGGPENQACAFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSLEAAQAYD  81

Query  368  daarrLYGPSAKLNLLDDT  424
             AAR LYG  A+LNL D +
Sbjct  82   AAARSLYGECARLNLPDSS  100



>ref|XP_008388157.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Malus domestica]
Length=279

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
             K+   G SRKGCMRGKGGPENA+CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  30   AKRPAQGSSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSY  89

Query  347  EaarayddaarrLYGPSAKLNLLDD  421
            EAA AYD AAR+LYG  AKLNL D 
Sbjct  90   EAALAYDAAARKLYGSEAKLNLPDQ  114



>ref|XP_009336842.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Pyrus x bretschneideri]
Length=279

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
             K+   G SRKGCMRGKGGPENA+CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  30   AKRPAQGSSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSY  89

Query  347  EaarayddaarrLYGPSAKLNLLDD  421
            EAA AYD AAR+LYG  AKLNL D 
Sbjct  90   EAALAYDAAARKLYGSEAKLNLPDQ  114



>ref|XP_004152768.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cucumis sativus]
 ref|XP_004172094.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cucumis sativus]
Length=164

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            K +    SRKGCMRGKGGPENALCT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS +
Sbjct  10   KNNKKASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHD  69

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD+AARRLYG  AKLNL
Sbjct  70   AALAYDNAARRLYGSDAKLNL  90



>ref|XP_004292958.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Fragaria vesca subsp. vesca]
Length=259

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            +KK     SRKGCMRGKGGPENA+CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  21   MKKPAQASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSS  80

Query  347  EaarayddaarrLYGPSAKLNLLD  418
            EAA AYD AAR+LYG  AKLNL D
Sbjct  81   EAAMAYDAAARKLYGSEAKLNLPD  104



>ref|XP_009351419.1| PREDICTED: dehydration-responsive element-binding protein 2D-like, 
partial [Pyrus x bretschneideri]
Length=123

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 85/118 (72%), Gaps = 15/118 (13%)
 Frame = +2

Query  59   IITMEESSGDSTINVRVPIGKEGGAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPENAL  238
            ++  E + G ST      +G E G ++ +P   +          SRKGCMRGKGGPENA+
Sbjct  1    MLKSEMNGGGST-----SVGVEEGKLSKRPVQAS----------SRKGCMRGKGGPENAM  45

Query  239  CTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrLYGPSAKLNL  412
            CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF++S EAA AYD AAR+LYG  AKLNL
Sbjct  46   CTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDSSHEAALAYDAAARKLYGSGAKLNL  103



>ref|XP_010549641.1| PREDICTED: dehydration-responsive element-binding protein 2G 
[Tarenaya hassleriana]
Length=370

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            KK ++GRSRKGCMRGKGGP+NA C +RGVRQRTWGKWVAEIREPNRG+R+WLGTF+TS E
Sbjct  40   KKPDMGRSRKGCMRGKGGPDNATCRYRGVRQRTWGKWVAEIREPNRGSRLWLGTFDTSFE  99

Query  350  aarayddaarrLYGPSAKLNLL  415
            AA AYD AA++LYG +AKLNL+
Sbjct  100  AAMAYDKAAKKLYGQAAKLNLV  121



>gb|KGN62640.1| hypothetical protein Csa_2G363010 [Cucumis sativus]
Length=212

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            K +    SRKGCMRGKGGPENALCT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS +
Sbjct  10   KNNKKASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHD  69

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD+AARRLYG  AKLNL
Sbjct  70   AALAYDNAARRLYGSDAKLNL  90



>gb|EYU32882.1| hypothetical protein MIMGU_mgv1a018624mg [Erythranthe guttata]
Length=215

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            V+K     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRG+RVWLGTF+TS 
Sbjct  14   VRKLAQASSRKGCMRGKGGPENAACTYKGVRQRTWGKWVAEIREPNRGSRVWLGTFDTSH  73

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYGP AK+NL
Sbjct  74   EAAVAYDAAARKLYGPDAKVNL  95



>ref|XP_007017661.1| Dehydration-responsive element-binding protein 2G, putative [Theobroma 
cacao]
 gb|EOY14886.1| Dehydration-responsive element-binding protein 2G, putative [Theobroma 
cacao]
Length=235

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            +KK     SRKGCMRGKGGPENALCT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  15   IKKPAQASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSH  74

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYG  AKLNL
Sbjct  75   EAATAYDAAARKLYGLDAKLNL  96



>gb|EPS61812.1| hypothetical protein M569_12986, partial [Genlisea aurea]
Length=186

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRG+RVWLGTF+TS E
Sbjct  9    RKPAQASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGSRVWLGTFDTSYE  68

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD AAR+LYGP AK+NL
Sbjct  69   AAIAYDAAARKLYGPEAKVNL  89



>gb|KFK41984.1| hypothetical protein AALP_AA2G197300 [Arabis alpina]
Length=211

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS EAA AYD 
Sbjct  23   SRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDS  82

Query  371  aarrLYGPSAKLNL  412
            AAR+LYGP A LNL
Sbjct  83   AARKLYGPEAHLNL  96



>ref|XP_010674522.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Beta vulgaris subsp. vulgaris]
Length=242

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGPENALCT++GVRQRTWGKWVAEIREPNRGAR+WLGTFNTS EAA AYD 
Sbjct  24   SRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFNTSHEAALAYDA  83

Query  371  aarrLYGPSAKLNL  412
            AAR+LYG  AKLNL
Sbjct  84   AARKLYGSDAKLNL  97



>ref|XP_008221333.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Prunus mume]
Length=352

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            VK+     SRKGCMRGKGGPENA+CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  106  VKRPAQASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSH  165

Query  347  EaarayddaarrLYGPSAKLNLLDD  421
            EAA AYD AAR+LYG  AKLNL D 
Sbjct  166  EAALAYDAAARKLYGSEAKLNLPDQ  190



>ref|XP_010271525.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nelumbo nucifera]
Length=200

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGPENALCT+RGVRQRTWGKWVAEIREPNRGAR+WLGTF+TS +AA AYD 
Sbjct  12   SRKGCMRGKGGPENALCTYRGVRQRTWGKWVAEIREPNRGARLWLGTFDTSRDAAIAYDS  71

Query  371  aarrLYGPSAKLNL  412
            AAR+LYG  AKLNL
Sbjct  72   AARKLYGKFAKLNL  85



>ref|XP_004499266.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cicer arietinum]
Length=249

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            +KK     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF TS 
Sbjct  14   LKKPAQASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSH  73

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYG  AKLNL
Sbjct  74   EAALAYDAAARKLYGSDAKLNL  95



>ref|XP_006390299.1| hypothetical protein EUTSA_v10019142mg [Eutrema salsugineum]
 gb|ESQ27585.1| hypothetical protein EUTSA_v10019142mg [Eutrema salsugineum]
Length=205

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS EAA AYD 
Sbjct  24   SRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDS  83

Query  371  aarrLYGPSAKLNL  412
            AAR+LYGP A LNL
Sbjct  84   AARKLYGPEAHLNL  97



>ref|XP_003527879.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Glycine max]
 gb|KHN22218.1| Dehydration-responsive element-binding protein 2D [Glycine soja]
Length=249

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            VKK     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF TS 
Sbjct  14   VKKPAQASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSH  73

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYG  AKLNL
Sbjct  74   EAALAYDAAARKLYGSDAKLNL  95



>ref|XP_009104705.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Brassica rapa]
 emb|CDX68128.1| BnaA07g21680D [Brassica napus]
Length=204

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF TS EAA AYD 
Sbjct  24   SRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSREAALAYDS  83

Query  371  aarrLYGPSAKLNL  412
            AAR+LYGP A LNL
Sbjct  84   AARKLYGPEAHLNL  97



>ref|XP_011029080.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Populus euphratica]
Length=212

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            KK     SRKGCMRGKGGPENALCT++GVRQRTWGKWVAEIREPN GAR+WLGT++TS E
Sbjct  19   KKPAQASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNCGARLWLGTYDTSHE  78

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD AAR+LYGP AKLNL
Sbjct  79   AAMAYDAAARKLYGPEAKLNL  99



>ref|XP_010940672.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Elaeis guineensis]
Length=226

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  188  RSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayd  367
            RSRKGCM+GKGGPEN  C FRGVRQRTWGKWVAEIREPNRGAR+WLGTFNTSLEAA+AYD
Sbjct  42   RSRKGCMKGKGGPENQACAFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSLEAAQAYD  101

Query  368  daarrLYGPSAKLNL  412
             AAR LYG  A+LNL
Sbjct  102  AAARGLYGDCARLNL  116



>emb|CDY70626.1| BnaCnng69090D [Brassica napus]
Length=204

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF TS EAA AYD 
Sbjct  24   SRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSREAALAYDS  83

Query  371  aarrLYGPSAKLNL  412
            AAR+LYGP A LNL
Sbjct  84   AARKLYGPDAHLNL  97



>ref|XP_006660398.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Oryza brachyantha]
Length=235

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +2

Query  188  RSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayd  367
            RSRKGCM+GKGGPEN  C FRGVRQRTWGKWVAEIREPNRGAR+WLGTFNT+L+AARAYD
Sbjct  26   RSRKGCMKGKGGPENQRCPFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTALDAARAYD  85

Query  368  daarrLYGPSAKLNLL  415
             AAR LYG  A+LNLL
Sbjct  86   SAARALYGDCARLNLL  101



>ref|XP_008377237.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Malus domestica]
Length=258

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +2

Query  125  GGAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPN  304
            GG  T        P K      SRKGCMRGKGGPENA+CT++GVRQRTWGKWVAEIREPN
Sbjct  3    GGGSTSVXVEERKPSKWPAQASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPN  62

Query  305  RGARVWLGTFNTSLEaarayddaarrLYGPSAKLNL  412
            RGAR+WLGTF+TS EAA AYD AAR+LYG  AKLNL
Sbjct  63   RGARLWLGTFDTSDEAALAYDVAARKLYGSVAKLNL  98



>ref|XP_010416439.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Camelina sativa]
Length=206

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGP+NA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS EAA AYD 
Sbjct  24   SRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDS  83

Query  371  aarrLYGPSAKLNL  412
            AAR+LYGP A LNL
Sbjct  84   AARKLYGPEAHLNL  97



>ref|XP_006302829.1| hypothetical protein CARUB_v10020960mg [Capsella rubella]
 gb|EOA35727.1| hypothetical protein CARUB_v10020960mg [Capsella rubella]
Length=205

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGP+NA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS EAA AYD 
Sbjct  24   SRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDS  83

Query  371  aarrLYGPSAKLNL  412
            AAR+LYGP A LNL
Sbjct  84   AARKLYGPEAHLNL  97



>ref|XP_010428577.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Camelina sativa]
Length=205

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGP+NA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS EAA AYD 
Sbjct  24   SRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDS  83

Query  371  aarrLYGPSAKLNL  412
            AAR+LYGP A LNL
Sbjct  84   AARKLYGPEAHLNL  97



>ref|XP_002887600.1| hypothetical protein ARALYDRAFT_476698 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63859.1| hypothetical protein ARALYDRAFT_476698 [Arabidopsis lyrata subsp. 
lyrata]
Length=196

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGP+NA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS EAA AYD 
Sbjct  15   SRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDS  74

Query  371  aarrLYGPSAKLNL  412
            AAR+LYGP A LNL
Sbjct  75   AARKLYGPEAHLNL  88



>ref|NP_177681.2| dehydration-responsive element-binding protein 2D [Arabidopsis 
thaliana]
 sp|Q9LQZ2.1|DRE2D_ARATH RecName: Full=Dehydration-responsive element-binding protein 
2D; Short=Protein DREB2D [Arabidopsis thaliana]
 gb|AAF87124.1|AC006434_20 F10A5.29 [Arabidopsis thaliana]
 dbj|BAD43665.1| transcription factor DREB2A like protein [Arabidopsis thaliana]
 gb|AEE35725.1| dehydration-responsive element-binding protein 2D [Arabidopsis 
thaliana]
Length=206

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGP+NA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS EAA AYD 
Sbjct  24   SRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDS  83

Query  371  aarrLYGPSAKLNL  412
            AAR+LYGP A LNL
Sbjct  84   AARKLYGPEAHLNL  97



>ref|XP_010471662.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Camelina sativa]
Length=205

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGP+NA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS EAA AYD 
Sbjct  24   SRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDS  83

Query  371  aarrLYGPSAKLNL  412
            AAR+LYGP A LNL
Sbjct  84   AARKLYGPEAHLNL  97



>gb|ABK59671.1| At1g75490 [Arabidopsis thaliana]
Length=197

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGP+NA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS EAA AYD 
Sbjct  15   SRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDS  74

Query  371  aarrLYGPSAKLNL  412
            AAR+LYGP A LNL
Sbjct  75   AARKLYGPEAHLNL  88



>ref|XP_008444762.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Cucumis melo]
Length=211

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            K +    SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS +
Sbjct  10   KNNKKASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSYD  69

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD+AARRLYG  AKLNL
Sbjct  70   AALAYDNAARRLYGSDAKLNL  90



>ref|XP_008347385.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Malus domestica]
Length=258

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +2

Query  125  GGAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPN  304
            GG  T        P K      SRKGCMRGKGGPENA+CT++GVRQRTWGKWVAEIREPN
Sbjct  3    GGGSTSVGVEERKPSKWPAQASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPN  62

Query  305  RGARVWLGTFNTSLEaarayddaarrLYGPSAKLNL  412
            RGAR+WLGTF+TS EAA AYD AAR+LYG  AKLNL
Sbjct  63   RGARLWLGTFDTSDEAALAYDVAARKLYGSVAKLNL  98



>ref|XP_008789576.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Phoenix dactylifera]
Length=199

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  188  RSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayd  367
            RSRKGCM+GKGGPEN  C FRGVRQR+WGKWVAEIREPNRG R+WLGTFNTSLEAA+AYD
Sbjct  16   RSRKGCMKGKGGPENQGCAFRGVRQRSWGKWVAEIREPNRGTRIWLGTFNTSLEAAQAYD  75

Query  368  daarrLYGPSAKLNLLDDT  424
             AAR LYG  A+LNL D +
Sbjct  76   AAARGLYGDCARLNLPDSS  94



>ref|XP_003523563.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Glycine max]
 gb|KHN45888.1| Dehydration-responsive element-binding protein 2D [Glycine soja]
Length=245

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            +KK     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF TS 
Sbjct  14   LKKPAQASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSH  73

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYG  AKLNL
Sbjct  74   EAALAYDAAARKLYGSDAKLNL  95



>ref|XP_009106200.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Brassica rapa]
Length=206

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGP+NA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS EAA AYD 
Sbjct  24   SRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDS  83

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR+LYGP A LNL  ++
Sbjct  84   AARKLYGPEAHLNLPQES  101



>ref|XP_010922640.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Elaeis guineensis]
Length=328

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            V++     SRKGCMRGKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG+R+WLGTFNT+L
Sbjct  44   VRRVPAKGSRKGCMRGKGGPENSHCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFNTAL  103

Query  347  EaarayddaarrLYGPSAKLNL  412
            +AA AYD+AAR +YGP A+LNL
Sbjct  104  DAAMAYDEAARAMYGPCARLNL  125



>emb|CDY47519.1| BnaAnng09170D [Brassica napus]
Length=206

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGP+NA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS EAA AYD 
Sbjct  24   SRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDS  83

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR+LYGP A LNL  ++
Sbjct  84   AARKLYGPEAHLNLPQES  101



>emb|CDY64211.1| BnaC06g43980D [Brassica napus]
Length=206

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGP+NA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS EAA AYD 
Sbjct  24   SRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDS  83

Query  371  aarrLYGPSAKLNL  412
            AAR+LYGP A LN+
Sbjct  84   AARKLYGPEAHLNI  97



>ref|XP_003589344.1| Ethylene-responsive transcription factor ERF071 [Medicago truncatula]
 gb|AES59595.1| AP2 domain class transcription factor [Medicago truncatula]
Length=271

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            +K+     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF TS 
Sbjct  14   LKRPAQASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSH  73

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AAR+LYG  AKLNL
Sbjct  74   EAALAYDAAARKLYGSDAKLNL  95



>ref|XP_010105262.1| GTPase obg [Morus notabilis]
 gb|AHJ25990.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXC04197.1| GTPase obg [Morus notabilis]
Length=782

 Score =   123 bits (309),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            VKK     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS 
Sbjct  535  VKKPAQASSRKGCMRGKGGPENATCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSH  594

Query  347  EaarayddaarrLYGPSAKLNLLD  418
            EAA AYD AAR+LYG  AKLNL D
Sbjct  595  EAAMAYDAAARKLYGSDAKLNLPD  618



>ref|NP_001062535.1| Os08g0565200 [Oryza sativa Japonica Group]
 sp|Q84ZA1.1|DRE2C_ORYSJ RecName: Full=Dehydration-responsive element-binding protein 
2C; Short=OsDREB2C [Oryza sativa Japonica Group]
 dbj|BAC56005.1| AP2-domain DNA-binding protein-like [Oryza sativa Japonica Group]
 gb|AAQ19033.1| Ap22 [Oryza sativa]
 dbj|BAD10326.1| AP2-domain DNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF24449.1| Os08g0565200 [Oryza sativa Japonica Group]
 gb|EAZ08054.1| hypothetical protein OsI_30319 [Oryza sativa Indica Group]
Length=230

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  188  RSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayd  367
            RSRKGCM+GKGGPEN  C FRGVRQRTWGKWVAEIREPNRGAR+WLGTFNT+L+AARAYD
Sbjct  36   RSRKGCMKGKGGPENQRCPFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTALDAARAYD  95

Query  368  daarrLYGPSAKLN  409
             AAR LYG  A+LN
Sbjct  96   SAARALYGDCARLN  109



>ref|XP_008799804.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
isoform X1 [Phoenix dactylifera]
Length=319

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCM+GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG+R+WLGTFNT+L+AA AYD+
Sbjct  52   SRKGCMQGKGGPENSHCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFNTALDAAMAYDE  111

Query  371  aarrLYGPSAKLNL  412
            AAR +YGP A+LNL
Sbjct  112  AARAMYGPCARLNL  125



>ref|XP_008366770.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Malus domestica]
Length=270

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +2

Query  122  EGGAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREP  301
            +G +  G P     P K    G SRKGCMRGKGGPENA+CT++GVRQR WGKWVAEIREP
Sbjct  8    DGSSSVGVPEKK--PAKLPAQGSSRKGCMRGKGGPENAMCTYKGVRQRMWGKWVAEIREP  65

Query  302  NRGARVWLGTFNTSLEaarayddaarrLYGPSAKLNLLD  418
            NRG R+WLGT++TS EAA AYD AAR+LYG  A+LNL D
Sbjct  66   NRGPRLWLGTYDTSYEAALAYDAAARKLYGSEAQLNLPD  104



>gb|EAZ08049.1| hypothetical protein OsI_30314 [Oryza sativa Indica Group]
Length=231

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  188  RSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayd  367
            RSRKGCM+GKGGPEN  C FRGVRQRTWGKWVAEIREPNRGAR+WLGTFNT+L+AARAYD
Sbjct  36   RSRKGCMKGKGGPENQRCPFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTALDAARAYD  95

Query  368  daarrLYGPSAKLN  409
             AAR LYG  A+LN
Sbjct  96   SAARALYGDCARLN  109



>emb|CDP07457.1| unnamed protein product [Coffea canephora]
Length=257

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            P KK     SRKGCMRGKGGPENA C ++GVRQRTWGKWVAEIREPNRG+R+WLGTF+TS
Sbjct  13   PGKKPAQASSRKGCMRGKGGPENASCAYKGVRQRTWGKWVAEIREPNRGSRLWLGTFDTS  72

Query  344  LEaarayddaarrLYGPSAKLNL  412
             EAA AYD AAR+LYG +AKLNL
Sbjct  73   HEAAIAYDAAARKLYGTAAKLNL  95



>ref|XP_010931300.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Elaeis guineensis]
Length=281

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGPEN+ C +RGVRQRTWGKWVAEIR+PNRG+R+WLGTFNT+LEAA AYD 
Sbjct  52   SRKGCMRGKGGPENSHCNYRGVRQRTWGKWVAEIRKPNRGSRLWLGTFNTALEAALAYDK  111

Query  371  aarrLYGPSAKLNL  412
            AAR +YGP A+LNL
Sbjct  112  AARAMYGPHARLNL  125



>ref|XP_004147872.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cucumis sativus]
 ref|XP_004167757.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cucumis sativus]
 gb|KGN60003.1| hypothetical protein Csa_3G865380 [Cucumis sativus]
Length=184

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGP+NA CTF+GVRQRTWGKWVAEIREPNRGAR+WLGTF+T+ EAA AYD 
Sbjct  16   SRKGCMRGKGGPDNAACTFKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAHEAALAYDA  75

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR+LYG  AKLNL   T
Sbjct  76   AARKLYGSEAKLNLPQTT  93



>ref|XP_003571275.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Brachypodium distachyon]
Length=213

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  188  RSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayd  367
            RSRKGCM+GKGGPEN  C FRGVRQRTWGKWVAEIREPNRGAR+WLGTF+T+L+AARAYD
Sbjct  22   RSRKGCMKGKGGPENQRCPFRGVRQRTWGKWVAEIREPNRGARLWLGTFSTALDAARAYD  81

Query  368  daarrLYGPSAKLNLLDDT  424
             AA+ LYG  A+LNL   T
Sbjct  82   SAAKALYGDCARLNLAGGT  100



>ref|NP_181566.2| putative dehydration-responsive element-binding protein 2H [Arabidopsis 
thaliana]
 sp|Q9SIZ0.3|DRE2H_ARATH RecName: Full=Putative dehydration-responsive element-binding 
protein 2H; Short=Protein DREB2H [Arabidopsis thaliana]
 gb|AEC09817.1| putative dehydration-responsive element-binding protein 2H [Arabidopsis 
thaliana]
Length=157

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 81/114 (71%), Gaps = 16/114 (14%)
 Frame = +2

Query  71   EESSGDSTINVRVPIGKEGGAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFR  250
            E++  DS I+        GG    KP   APP       RSRKGCM+GKGGPEN +C + 
Sbjct  25   EQTEADSCID--------GGG--SKPIRKAPP------KRSRKGCMKGKGGPENGICDYT  68

Query  251  GVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrLYGPSAKLNL  412
            GVRQRTWGKWVAEIREP RGA++WLGTF++S EAA AYD+A++ +YG SA+LNL
Sbjct  69   GVRQRTWGKWVAEIREPGRGAKLWLGTFSSSYEAALAYDEASKAIYGQSARLNL  122



>gb|AAD25670.1| AP2 domain transcription factor [Arabidopsis thaliana]
Length=177

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 81/114 (71%), Gaps = 16/114 (14%)
 Frame = +2

Query  71   EESSGDSTINVRVPIGKEGGAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFR  250
            E++  DS I+        GG    KP   APP       RSRKGCM+GKGGPEN +C + 
Sbjct  25   EQTEADSCID--------GGG--SKPIRKAPP------KRSRKGCMKGKGGPENGICDYT  68

Query  251  GVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrLYGPSAKLNL  412
            GVRQRTWGKWVAEIREP RGA++WLGTF++S EAA AYD+A++ +YG SA+LNL
Sbjct  69   GVRQRTWGKWVAEIREPGRGAKLWLGTFSSSYEAALAYDEASKAIYGQSARLNL  122



>ref|XP_002881716.1| hypothetical protein ARALYDRAFT_903325 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57975.1| hypothetical protein ARALYDRAFT_903325 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 16/114 (14%)
 Frame = +2

Query  71   EESSGDSTINVRVPIGKEGGAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFR  250
            E++  DS I+  VP          KP    PP        SRKGCM+GKGGPEN +C +R
Sbjct  41   EQTEADSCIDGGVP----------KPVRNPPPKG------SRKGCMKGKGGPENGICDYR  84

Query  251  GVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrLYGPSAKLNL  412
            GVRQRTWGKWVAEIREP RGAR+WLGTF++S EAA AYD+AA+ +YG SA+LNL
Sbjct  85   GVRQRTWGKWVAEIREPGRGARLWLGTFSSSYEAALAYDEAAKAIYGQSARLNL  138



>ref|XP_008466672.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cucumis melo]
Length=184

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGP+NA CTF+GVRQRTWGKWVAEIREPNRGAR+WLGTF+T+ EAA AYD 
Sbjct  16   SRKGCMRGKGGPDNASCTFKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAHEAALAYDA  75

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR+LYG  AKLNL   T
Sbjct  76   AARKLYGSEAKLNLPQTT  93



>ref|XP_010257031.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Nelumbo nucifera]
Length=362

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            ++K     S+KGCMRGKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG+R+WLGTF T+L
Sbjct  46   IRKVPAKGSKKGCMRGKGGPENSRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFATAL  105

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAARAYD+AAR +YGP A+LNL
Sbjct  106  EAARAYDEAARAMYGPCARLNL  127



>ref|XP_010517453.1| PREDICTED: dehydration-responsive element-binding protein 2C 
[Camelina sativa]
Length=342

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            P++K+ V  SRKGCMRGKGGPEN  C +RGVRQRTWGKWVAEIREP +G R+WLGTF+TS
Sbjct  47   PIRKAPVKGSRKGCMRGKGGPENGNCEYRGVRQRTWGKWVAEIREPGKGGRLWLGTFSTS  106

Query  344  LEaarayddaarrLYGPSAKLNLLDDT  424
             EAA AYD+AA+ +YG SA+LNL D T
Sbjct  107  HEAALAYDEAAKAMYGHSARLNLPDFT  133



>ref|XP_010505763.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Camelina sativa]
Length=340

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            P++K+    SRKGCMRGKGGPEN  C +RGVRQRTWGKWVAEIREP +G R+WLGTF+TS
Sbjct  48   PIRKAPTKGSRKGCMRGKGGPENGNCEYRGVRQRTWGKWVAEIREPGKGGRLWLGTFSTS  107

Query  344  LEaarayddaarrLYGPSAKLNL  412
            LEAA AYD+AA+ +YG SA+LNL
Sbjct  108  LEAALAYDEAAKAMYGYSARLNL  130



>ref|XP_010102188.1| Dehydration-responsive element-binding protein 2G [Morus notabilis]
 gb|AHJ25979.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB93131.1| Dehydration-responsive element-binding protein 2G [Morus notabilis]
Length=199

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  188  RSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayd  367
            RSRK  M+GKGGPENA CTF GVRQRTWGKWVAEIREPNRGAR+WLGTFNTS EAA AYD
Sbjct  23   RSRKRRMKGKGGPENAECTFIGVRQRTWGKWVAEIREPNRGARLWLGTFNTSTEAALAYD  82

Query  368  daarrLYGPSAKLNLLD  418
            DAA +LYG SAKLNL D
Sbjct  83   DAATKLYGTSAKLNLPD  99



>ref|XP_004293490.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Fragaria vesca subsp. vesca]
Length=198

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            P +K     SRKGCM+GKGGPEN+ C +RGVRQRTWGKWVAEIR PNRG+R+WLGTF T+
Sbjct  40   PTRKVPAKGSRKGCMKGKGGPENSRCNYRGVRQRTWGKWVAEIRSPNRGSRLWLGTFPTA  99

Query  344  LEaarayddaarrLYGPSAKLNLLDDTF  427
            +EAA AYD AAR +YG +A+LN    TF
Sbjct  100  IEAALAYDKAARAMYGSAARLNFPKVTF  127



>ref|XP_009128106.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Brassica rapa]
 emb|CDY39036.1| BnaA02g17250D [Brassica napus]
Length=198

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGP+NA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+T+ EAA AYD 
Sbjct  15   SRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAREAALAYDS  74

Query  371  aarrLYGPSAKLNL  412
            AAR+LYG  A LNL
Sbjct  75   AARKLYGSEAHLNL  88



>ref|XP_006353419.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Solanum tuberosum]
Length=320

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            PV+K     S+KGCMRGKGGPEN+ C +RGVRQR WGKWVAEIREP RG+R+WLGTF T+
Sbjct  56   PVRKVPAKGSKKGCMRGKGGPENSRCKYRGVRQRIWGKWVAEIREPKRGSRLWLGTFGTA  115

Query  344  LEaarayddaarrLYGPSAKLNL  412
            +EAA AYD+AAR +YGP A+LNL
Sbjct  116  IEAALAYDEAARAMYGPCARLNL  138



>ref|XP_004238613.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Solanum lycopersicum]
Length=248

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            KK     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+ S +
Sbjct  6    KKLIPATSRKGCMRGKGGPENANCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDNSYD  65

Query  350  aarayddaarrLYGPSAKLNL  412
            AA  YD AA +LYG  AKLNL
Sbjct  66   AAVVYDAAALKLYGAEAKLNL  86



>ref|XP_002520794.1| Dehydration-responsive element-binding protein 2C, putative [Ricinus 
communis]
 gb|EEF41503.1| Dehydration-responsive element-binding protein 2C, putative [Ricinus 
communis]
Length=386

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            PV+K+    SRKGCM+GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLGTF T+
Sbjct  55   PVRKTPAKGSRKGCMKGKGGPENSECNYRGVRQRTWGKWVAEIREPNRGPRLWLGTFPTA  114

Query  344  LEaarayddaarrLYGPSAKLNL  412
             EAA AYD+AA+ +YG SA+LN 
Sbjct  115  YEAAVAYDEAAKAMYGSSARLNF  137



>gb|AAT44958.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
Length=157

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 80/114 (70%), Gaps = 16/114 (14%)
 Frame = +2

Query  71   EESSGDSTINVRVPIGKEGGAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFR  250
            E++  DS I+        GG    KP   APP       RSRKGCM+GKGGPEN +C + 
Sbjct  25   EQTEADSCID--------GGG--SKPIRKAPP------KRSRKGCMKGKGGPENGICDYT  68

Query  251  GVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrLYGPSAKLNL  412
            GVRQRTWGKWVAEIREP RGA++WLGT ++S EAA AYD+A++ +YG SA+LNL
Sbjct  69   GVRQRTWGKWVAEIREPGRGAKLWLGTISSSYEAALAYDEASKAIYGQSARLNL  122



>ref|XP_009767687.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana sylvestris]
Length=249

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
             KK     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF  S 
Sbjct  11   TKKITQATSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFENSY  70

Query  347  EaarayddaarrLYGPSAKLNL  412
            +AA AYD AAR+LYG  AKLNL
Sbjct  71   DAAVAYDAAARKLYGADAKLNL  92



>ref|XP_006342227.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Solanum tuberosum]
Length=262

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            KK     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+ S +
Sbjct  6    KKLIPATSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDNSYD  65

Query  350  aarayddaarrLYGPSAKLNL  412
            AA  YD AA +LYG  AKLNL
Sbjct  66   AAVVYDAAALKLYGAEAKLNL  86



>ref|XP_009598034.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana tomentosiformis]
Length=251

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
             KK     SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF  S 
Sbjct  11   TKKITQATSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFENSY  70

Query  347  EaarayddaarrLYGPSAKLNL  412
            +AA AYD AAR+LYG  AKLNL
Sbjct  71   DAAVAYDAAARKLYGADAKLNL  92



>emb|CDY20377.1| BnaC02g24390D [Brassica napus]
Length=198

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SR+GCMRGKGGP+NA CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+T+ EAA AYD 
Sbjct  15   SRRGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAREAALAYDS  74

Query  371  aarrLYGPSAKLNL  412
            AAR+LYG  A LNL
Sbjct  75   AARKLYGSEAHLNL  88



>ref|XP_009767453.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana sylvestris]
 ref|XP_009767454.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana sylvestris]
 ref|XP_009767455.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana sylvestris]
 ref|XP_009767456.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana sylvestris]
 ref|XP_009767457.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana sylvestris]
 ref|XP_009767458.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana sylvestris]
Length=208

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRG R+WLGTF TS +AA AYD 
Sbjct  18   SRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGPRLWLGTFETSHDAAMAYDA  77

Query  371  aarrLYGPSAKLNL  412
             A +LYG +AKLN 
Sbjct  78   VAHKLYGDNAKLNF  91



>ref|XP_008792179.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Phoenix dactylifera]
Length=328

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCMRGKGGPEN+ C +RGVRQRTWGKWVAEIR+PN G+R+WLGTFNT+LEAA AYD+
Sbjct  52   SRKGCMRGKGGPENSHCNYRGVRQRTWGKWVAEIRKPNGGSRLWLGTFNTALEAALAYDE  111

Query  371  aarrLYGPSAKLNL  412
            AAR +YGP A+LNL
Sbjct  112  AARAMYGPRARLNL  125



>gb|KCW67902.1| hypothetical protein EUGRSUZ_F01607, partial [Eucalyptus grandis]
Length=232

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K     SRKGCMRGKGGPENA C+++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS +
Sbjct  13   RKPAQASSRKGCMRGKGGPENASCSYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHD  72

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD AAR+LYG  AKLNL
Sbjct  73   AAVAYDAAARKLYGLEAKLNL  93



>ref|XP_008664551.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Zea mays]
 tpg|DAA48537.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
Length=359

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  188  RSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayd  367
            RSRKGCM+GKGGP+N  C FRGVRQRTWGKWVAEIREPNRGAR+WLGTF ++LEAARAYD
Sbjct  66   RSRKGCMKGKGGPDNQQCPFRGVRQRTWGKWVAEIREPNRGARLWLGTFGSALEAARAYD  125

Query  368  daarrLYGPSAKLNL  412
             AAR LYG  A+LNL
Sbjct  126  AAARTLYGDCARLNL  140



>ref|XP_002968658.1| hypothetical protein SELMODRAFT_38494, partial [Selaginella moellendorffii]
 ref|XP_002989907.1| hypothetical protein SELMODRAFT_38495, partial [Selaginella moellendorffii]
 gb|EFJ08920.1| hypothetical protein SELMODRAFT_38495, partial [Selaginella moellendorffii]
 gb|EFJ29774.1| hypothetical protein SELMODRAFT_38494, partial [Selaginella moellendorffii]
Length=81

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  173  KSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEa  352
            +  + RSRKGCM+GKGGPENA C +RGVRQR WGKWVAEIREPN GAR+WLGTF+T++EA
Sbjct  1    RPQLKRSRKGCMKGKGGPENAACQYRGVRQRVWGKWVAEIREPNCGARIWLGTFDTAVEA  60

Query  353  arayddaarrLYGPSAKLNL  412
            ARAYD AA + +G +A+LNL
Sbjct  61   ARAYDQAALKYFGENARLNL  80



>ref|XP_006294523.1| hypothetical protein CARUB_v10023556mg [Capsella rubella]
 gb|EOA27421.1| hypothetical protein CARUB_v10023556mg [Capsella rubella]
Length=334

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            P++K+    S+KGCMRGKGGPEN +C +RGVRQR WGKWVAEIREP RG R+WLGTF++S
Sbjct  45   PIRKAPAKGSKKGCMRGKGGPENGICGYRGVRQRIWGKWVAEIREPGRGNRLWLGTFSSS  104

Query  344  LEaarayddaarrLYGPSAKLNLLDDT  424
             EAA AYD+AAR +YG SA+LNL D T
Sbjct  105  HEAALAYDEAARAMYGQSARLNLPDYT  131



>ref|NP_001234689.1| dehydration responsive element binding protein [Solanum lycopersicum]
 gb|AAN77051.1| dehydration responsive element binding protein [Solanum lycopersicum]
Length=300

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            PV+K     S+KGCMRGKGGPEN  C +RGVRQR WGKWVAEIREP RG+R+WLGTF T+
Sbjct  55   PVRKVPAKGSKKGCMRGKGGPENWRCKYRGVRQRIWGKWVAEIREPKRGSRLWLGTFGTA  114

Query  344  LEaarayddaarrLYGPSAKLNL  412
            +EAA AYDDAAR +YGP A+LNL
Sbjct  115  IEAALAYDDAARAMYGPCARLNL  137



>emb|CBH19549.1| AP2 domain containing protein [Oryza sativa Indica Group]
Length=154

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LE
Sbjct  58   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALE  117

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AAR +YGP+A++N  D++
Sbjct  118  AAHAYDEAARAMYGPTARVNFADNS  142



>ref|XP_010064559.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Eucalyptus grandis]
Length=235

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K     SRKGCMRGKGGPENA C+++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS +
Sbjct  13   RKPAQASSRKGCMRGKGGPENASCSYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHD  72

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD AAR+LYG  AKLNL
Sbjct  73   AAVAYDAAARKLYGLEAKLNL  93



>ref|XP_006294524.1| hypothetical protein CARUB_v10023556mg [Capsella rubella]
 gb|EOA27422.1| hypothetical protein CARUB_v10023556mg [Capsella rubella]
Length=345

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            P++K+    S+KGCMRGKGGPEN +C +RGVRQR WGKWVAEIREP RG R+WLGTF++S
Sbjct  56   PIRKAPAKGSKKGCMRGKGGPENGICGYRGVRQRIWGKWVAEIREPGRGNRLWLGTFSSS  115

Query  344  LEaarayddaarrLYGPSAKLNLLDDT  424
             EAA AYD+AAR +YG SA+LNL D T
Sbjct  116  HEAALAYDEAARAMYGQSARLNLPDYT  142



>ref|XP_002444543.1| hypothetical protein SORBIDRAFT_07g023575 [Sorghum bicolor]
 gb|EES14038.1| hypothetical protein SORBIDRAFT_07g023575 [Sorghum bicolor]
Length=388

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  188  RSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayd  367
            RSRKGCM+GKGGP+N  C +RGVRQRTWGKWVAEIREPNRGAR+WLGTF ++LEAARAYD
Sbjct  70   RSRKGCMKGKGGPDNQQCPYRGVRQRTWGKWVAEIREPNRGARLWLGTFGSALEAARAYD  129

Query  368  daarrLYGPSAKLNL  412
            +AAR+LYG  A+LNL
Sbjct  130  NAARQLYGDCARLNL  144



>gb|AEI98833.1| dehydration responsive element binding protein 1 [Solanum tuberosum]
Length=319

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            PV K     S+KGCMRGKGGPEN+ C +RGVRQR WGKWVAEIREP RG+R+WLGTF T+
Sbjct  56   PVCKVPAKGSKKGCMRGKGGPENSRCKYRGVRQRIWGKWVAEIREPKRGSRLWLGTFGTA  115

Query  344  LEaarayddaarrLYGPSAKLNL  412
            +EAA AYD+AAR +YGP A+LNL
Sbjct  116  IEAALAYDEAARAMYGPCARLNL  138



>emb|CBH19547.1| AP2 domain containing protein [Oryza sativa Indica Group]
Length=168

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LE
Sbjct  58   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALE  117

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AAR +YGP+A++N  D++
Sbjct  118  AAHAYDEAARAMYGPTARVNFADNS  142



>ref|XP_008678419.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Zea mays]
 gb|AFW61647.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05166.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=352

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  188  RSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayd  367
            RSRKGCM+GKGGP+N  C FRGVRQRTWGKWVAEIREPNRGAR+WLGTF ++LEAARAYD
Sbjct  59   RSRKGCMKGKGGPDNQQCPFRGVRQRTWGKWVAEIREPNRGARLWLGTFGSALEAARAYD  118

Query  368  daarrLYGPSAKLNL  412
             AAR LYG  A+LNL
Sbjct  119  AAARALYGDCARLNL  133



>gb|AIZ74387.1| DREB1 [Sophora moorcroftiana]
Length=199

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  59   IITMEESSGDSTINVRVPIGK--EGGAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPEN  232
            ++   +S GD + ++   + K  E  A      +   P++K     SRKGCM+GKGGPEN
Sbjct  1    MLAKAQSKGDGSKSLAKILAKWKEYNAQLDSSNDADKPIRKVPAKGSRKGCMKGKGGPEN  60

Query  233  ALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrLYGPSAKLNL  412
            + C +RGVRQRTWGKWVAEIREPNRG+R+WLGTF T++ AA AYD+AAR +YG  A+LN 
Sbjct  61   SRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAIGAALAYDEAARAMYGTCARLNF  120



>ref|XP_010921034.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Elaeis guineensis]
Length=313

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCM+GKGGP+N  C +RGVRQRTWGKWVAEIREPNRG+R+WLGTF T+LEAA AYD+
Sbjct  50   SRKGCMKGKGGPDNPQCKYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTALEAALAYDE  109

Query  371  aarrLYGPSAKLNL  412
            AAR +YGP A+LNL
Sbjct  110  AARAMYGPYARLNL  123



>emb|CBH19548.1| AP2 domain containing protein [Oryza sativa Indica Group]
Length=204

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LE
Sbjct  58   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALE  117

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AAR +YGP+A++N  D++
Sbjct  118  AAHAYDEAARAMYGPTARVNFADNS  142



>emb|CBI19777.3| unnamed protein product [Vitis vinifera]
Length=201

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  206  MRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrL  385
            MRGKGGPENA+CT++GVRQRTWGKWVAEIREPNRGAR+WLGTF+TS EAA AYD AAR+L
Sbjct  1    MRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSYEAAIAYDAAARKL  60

Query  386  YGPSAKLNL  412
            YGP AKLNL
Sbjct  61   YGPEAKLNL  69



>ref|NP_001042107.1| Os01g0165000 [Oryza sativa Japonica Group]
 sp|Q0JQF7.1|DRE2A_ORYSJ RecName: Full=Dehydration-responsive element-binding protein 
2A; Short=OsDREB2A [Oryza sativa Japonica Group]
 gb|AAN02487.2|AF300971_1 DRE binding protein 2 [Oryza sativa]
 dbj|BAF04021.1| Os01g0165000 [Oryza sativa Japonica Group]
Length=274

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LE
Sbjct  51   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALE  110

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AAR +YGP+A++N  D++
Sbjct  111  AAHAYDEAARAMYGPTARVNFADNS  135



>sp|A2WL19.2|DRE2A_ORYSI RecName: Full=Dehydration-responsive element-binding protein 
2A; Short=Protein DREB2A [Oryza sativa Indica Group]
Length=274

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LE
Sbjct  51   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALE  110

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AAR +YGP+A++N  D++
Sbjct  111  AAHAYDEAARAMYGPTARVNFADNS  135



>ref|XP_009621512.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana tomentosiformis]
Length=216

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            + K +   SRKGCMRGKGGPENA CT++GVRQRTWGKWVAEIREPNRG R+WLGTF TS 
Sbjct  10   IMKISQAASRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGPRLWLGTFETSH  69

Query  347  EaarayddaarrLYGPSAKLNL  412
            +AA AYD  AR+LYG +AKLN 
Sbjct  70   DAAVAYDAVARKLYGDNAKLNF  91



>gb|AIY24737.1| dehydration responsive element binding protein 2a [Oryza coarctata]
Length=282

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LE
Sbjct  58   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALE  117

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AAR +YGP+A++N  D++
Sbjct  118  AAHAYDEAARAMYGPTARVNFADNS  142



>emb|CBH19567.1| AP2 domain containing protein [Oryza sativa Indica Group]
Length=236

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LE
Sbjct  58   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALE  117

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AAR +YGP+A++N  D++
Sbjct  118  AAHAYDEAARAMYGPTARVNFADNS  142



>ref|XP_006643786.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Oryza brachyantha]
Length=274

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LE
Sbjct  51   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALE  110

Query  350  aarayddaarrLYGPSAKLNLLDD  421
            AA AYD+AAR +YGP+A++N  D+
Sbjct  111  AAHAYDEAARAMYGPTARVNFADN  134



>gb|AAL40870.1| DREB1 [Oryza sativa]
Length=281

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LE
Sbjct  58   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALE  117

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AAR +YGP+A++N  D++
Sbjct  118  AAHAYDEAARAMYGPTARVNFADNS  142



>gb|ADT91190.1| DREB-like protein [Oryza sativa Indica Group]
 gb|AFB77198.1| dehydration responsive element binding protein 2a [Oryza sativa 
Indica Group]
Length=281

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LE
Sbjct  58   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALE  117

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AAR +YGP+A++N  D++
Sbjct  118  AAHAYDEAARAMYGPTARVNFADNS  142



>gb|EAY72665.1| hypothetical protein OsI_00531 [Oryza sativa Indica Group]
Length=284

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LE
Sbjct  61   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALE  120

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AAR +YGP+A++N  D++
Sbjct  121  AAHAYDEAARAMYGPTARVNFADNS  145



>gb|EAZ10669.1| hypothetical protein OsJ_00499 [Oryza sativa Japonica Group]
Length=284

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LE
Sbjct  61   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALE  120

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AAR +YGP+A++N  D++
Sbjct  121  AAHAYDEAARAMYGPTARVNFADNS  145



>gb|AFP89590.1| putative dehydration responsive element-binding protein [Sophora 
davidii]
Length=199

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 82/120 (68%), Gaps = 2/120 (2%)
 Frame = +2

Query  59   IITMEESSGDSTINVRVPIGK--EGGAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPEN  232
            ++   +S GD + ++   + K  E  A      +   P++K     SRKGCM+GKGGPEN
Sbjct  1    MLAKAQSKGDGSKSLAKILAKWKEYNAQLDSSNDADKPIRKVPAKGSRKGCMKGKGGPEN  60

Query  233  ALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrLYGPSAKLNL  412
            + C +RGVRQRTWGKWVAEIREPNRG R+WLGTF T++ AA AYD+AAR +YG  A+LN 
Sbjct  61   SRCNYRGVRQRTWGKWVAEIREPNRGNRLWLGTFPTAIGAALAYDEAARAMYGTCARLNF  120



>ref|XP_010508876.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
isoform X1 [Camelina sativa]
 ref|XP_010508877.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
isoform X2 [Camelina sativa]
Length=343

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            ++K+    SRKGCMRGKGGPEN  C +RGVRQRTWGKWVAEIREP +G R+WLGTF+TS 
Sbjct  48   IRKAPTQGSRKGCMRGKGGPENRYCEYRGVRQRTWGKWVAEIREPGKGGRLWLGTFSTSH  107

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD+AA+ +YG SA+LNL
Sbjct  108  EAALAYDEAAKAMYGHSARLNL  129



>ref|XP_010254126.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Nelumbo nucifera]
Length=306

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    SRKGCMRGKGGPEN  C +RGVRQRTWGKWVAEIREPNRG+R+WLGTF+T+LE
Sbjct  47   RKAPAKGSRKGCMRGKGGPENLRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFSTALE  106

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD AA+ +YG  A+LN 
Sbjct  107  AALAYDKAAKAMYGRYARLNF  127



>gb|ACA79910.1| DRE-binding protein 2 [Sorghum bicolor]
 gb|ACA79920.1| DRE-binding protein 2 [Sorghum bicolor]
Length=262

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAA AYD+
Sbjct  65   SKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTAVEAAHAYDE  124

Query  371  aarrLYGPSAKLNLLDDT  424
            AA+ +YGP A++N  D++
Sbjct  125  AAKAMYGPKARVNFSDNS  142



>ref|XP_002457289.1| hypothetical protein SORBIDRAFT_03g004980 [Sorghum bicolor]
 gb|EES02409.1| hypothetical protein SORBIDRAFT_03g004980 [Sorghum bicolor]
Length=262

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAA AYD+
Sbjct  65   SKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTAVEAAHAYDE  124

Query  371  aarrLYGPSAKLNLLDDT  424
            AA+ +YGP A++N  D++
Sbjct  125  AAKAMYGPKARVNFSDNS  142



>gb|ACA79916.1| DRE-binding protein 2 [Sorghum bicolor]
Length=262

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAA AYD+
Sbjct  65   SKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTAVEAAHAYDE  124

Query  371  aarrLYGPSAKLNLLDDT  424
            AA+ +YGP A++N  D++
Sbjct  125  AAKAMYGPKARVNFSDNS  142



>gb|ACA79914.1| DRE-binding protein 2 [Sorghum bicolor]
Length=262

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAA AYD+
Sbjct  65   SKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTAVEAAHAYDE  124

Query  371  aarrLYGPSAKLNLLDDT  424
            AA+ +YGP A++N  D++
Sbjct  125  AAKAMYGPKARVNFSDNS  142



>gb|ABX45045.1| desiccation responisve element-binding protein [Sorghum bicolor]
 gb|ACA79911.1| DRE-binding protein 2 [Sorghum bicolor]
 gb|ACA79913.1| DRE-binding protein 2 [Sorghum bicolor]
 gb|ACA79915.1| DRE-binding protein 2 [Sorghum bicolor]
 gb|ACA79917.1| DRE-binding protein 2 [Sorghum bicolor]
 gb|ACA79918.1| DRE-binding protein 2 [Sorghum bicolor]
 gb|ACA79922.1| DRE-binding protein 2 [Sorghum bicolor]
Length=262

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAA AYD+
Sbjct  65   SKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTAVEAAHAYDE  124

Query  371  aarrLYGPSAKLNLLDDT  424
            AA+ +YGP A++N  D++
Sbjct  125  AAKAMYGPKARVNFSDNS  142



>gb|ACA79912.1| DRE-binding protein 2 [Sorghum bicolor]
Length=262

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAA AYD+
Sbjct  65   SKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTAVEAAHAYDE  124

Query  371  aarrLYGPSAKLNLLDDT  424
            AA+ +YGP A++N  D++
Sbjct  125  AAKAMYGPKARVNFSDNS  142



>gb|AAS46285.1| DREB-like protein 2 [Cynodon dactylon]
Length=250

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LEAA AYD+
Sbjct  56   SKKGCMAGKGGPENGNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTALEAAHAYDE  115

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YGP+A++N  + +
Sbjct  116  AARAMYGPTARVNFSESS  133



>ref|XP_009416308.1| PREDICTED: dehydration-responsive element-binding protein 2B 
[Musa acuminata subsp. malaccensis]
Length=297

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            V+++    SRKGCMRGKGGPEN  C +RGVRQRTWGKWVAEIREPNRG+R+WLGTF T++
Sbjct  7    VRRAPAKGSRKGCMRGKGGPENPKCRYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAV  66

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYDDAAR +YG  A++NL
Sbjct  67   EAALAYDDAARAMYGTMARVNL  88



>ref|XP_009141887.1| PREDICTED: dehydration-responsive element-binding protein 2C 
[Brassica rapa]
Length=274

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 73/97 (75%), Gaps = 6/97 (6%)
 Frame = +2

Query  128  GAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNR  307
            G +  KP   APP        SRKGCM+GKGGPEN +  +RGVRQRTWGKWVAEIR+P R
Sbjct  42   GCLKPKPIRKAPPKG------SRKGCMKGKGGPENGIWNYRGVRQRTWGKWVAEIRQPCR  95

Query  308  GARVWLGTFNTSLEaarayddaarrLYGPSAKLNLLD  418
            GAR+WLGTF +S EAA AYD+AA+ +YG SA+LNL D
Sbjct  96   GARLWLGTFPSSYEAALAYDEAAKAMYGESARLNLPD  132



>gb|ACX37095.1| DREB-like protein 1 [Zoysia japonica]
 gb|ACX37096.1| DREB-like protein 1 [Zoysia japonica]
Length=257

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LEAA AYD+
Sbjct  61   SKKGCMAGKGGPENRACAYRGVRQRTWGKWVAEIREPNRGKRLWLGSFPTALEAAHAYDE  120

Query  371  aarrLYGPSAKLNL  412
            AAR +YGP A++N 
Sbjct  121  AARAMYGPRARVNF  134



>gb|AAS46284.1| DREB-like protein 1 [Cynodon dactylon]
Length=250

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LEAA AYD+
Sbjct  56   SKKGCMAGKGGPENGNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALEAAHAYDE  115

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YGP+A++N  + +
Sbjct  116  AARAMYGPTARVNFSESS  133



>gb|ACA79919.1| DRE-binding protein 2 [Sorghum bicolor]
Length=262

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAA AYD+
Sbjct  65   SKKGCMTGKGGPENINCVYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTAVEAAHAYDE  124

Query  371  aarrLYGPSAKLNLLDDT  424
            AA+ +YGP A++N  D++
Sbjct  125  AAKAMYGPKARVNFSDNS  142



>gb|ACV42429.1| DREB-like protein 1 [Zoysia japonica]
 gb|ACX37094.1| DREB-like protein 1 [Zoysia japonica]
 gb|ACX45475.1| DREB-like protein 1 [Zoysia japonica]
 gb|ACX45476.1| DREB-like protein 1 [Zoysia japonica]
Length=257

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LEAA AYD+
Sbjct  61   SKKGCMAGKGGPENRACAYRGVRQRTWGKWVAEIREPNRGKRLWLGSFPTALEAAHAYDE  120

Query  371  aarrLYGPSAKLNL  412
            AAR +YGP A++N 
Sbjct  121  AARAMYGPRARVNF  134



>ref|XP_009384927.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=317

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  80   SGDSTINVRVPIGKEGGAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFRGVR  259
            +G  T+   +   KE G       +   P++K     S+KGCMRGKGGPEN  C +RGVR
Sbjct  16   NGSHTVAETIARWKEHGCQLDCSMDGEKPIRKPPARGSKKGCMRGKGGPENPSCRYRGVR  75

Query  260  QRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrLYGPSAKLNL  412
            QRTWGKWVAEIREPNRG R+WLGTF T+ EAA AYDDAAR +YG  A++NL
Sbjct  76   QRTWGKWVAEIREPNRGGRLWLGTFPTATEAALAYDDAARAMYGSLARVNL  126



>ref|XP_009384928.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009384929.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=279

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            P++K     S+KGCMRGKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLGTF T+
Sbjct  6    PIRKPPARGSKKGCMRGKGGPENPSCRYRGVRQRTWGKWVAEIREPNRGGRLWLGTFPTA  65

Query  344  LEaarayddaarrLYGPSAKLNL  412
             EAA AYDDAAR +YG  A++NL
Sbjct  66   TEAALAYDDAARAMYGSLARVNL  88



>gb|ABP52086.1| dehydration responsive element binding protein [Buchloe dactyloides]
Length=254

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGP+N  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LEAA AYD+
Sbjct  60   SKKGCMAGKGGPDNGNCVYRGVRQRTWGKWVAEIREPNRGKRLWLGSFPTALEAAHAYDE  119

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YGP+A++N  + +
Sbjct  120  AARAMYGPTARVNFAESS  137



>gb|KDP44697.1| hypothetical protein JCGZ_01197 [Jatropha curcas]
Length=374

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = +2

Query  86   DSTINVRVPIGK--EGGAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFRGVR  259
            DST +V   I K  E         N   PV+K     SRKGCMRGKGGP+N+ C +RGVR
Sbjct  22   DSTCSVAETIQKWKEYNEFLDSCPNGDKPVRKIPAKGSRKGCMRGKGGPDNSRCNYRGVR  81

Query  260  QRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrLYGPSAKLNL  412
            QRTWGKWVAEIREPNRG R+WLGTF T+ +AA AYD+AA+ +YG  A+LN 
Sbjct  82   QRTWGKWVAEIREPNRGPRLWLGTFPTAYDAALAYDEAAKAMYGNLARLNF  132



>gb|AFV52020.1| DREB2 [Saccharum officinarum]
Length=262

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAA AYD+
Sbjct  65   SKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTAVEAAHAYDE  124

Query  371  aarrLYGPSAKLNLLDDT  424
            AA+ +YGP A++N  +++
Sbjct  125  AAKAMYGPKARVNFSENS  142



>gb|KEH36215.1| dehydration-responsive element-binding protein [Medicago truncatula]
Length=227

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            +KK     SRKGCM+GKGGPEN  C ++GVRQRTWGKWVAEIREPNRG+R+WLGTF TSL
Sbjct  13   LKKPQQAISRKGCMKGKGGPENPSCPYKGVRQRTWGKWVAEIREPNRGSRLWLGTFETSL  72

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD AA +LYG  AKLNL
Sbjct  73   EAALAYDAAALKLYGSRAKLNL  94



>ref|XP_010922641.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
isoform X2 [Elaeis guineensis]
Length=272

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  206  MRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrL  385
            MRGKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG+R+WLGTFNT+L+AA AYD+AAR +
Sbjct  1    MRGKGGPENSHCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFNTALDAAMAYDEAARAM  60

Query  386  YGPSAKLNL  412
            YGP A+LNL
Sbjct  61   YGPCARLNL  69



>gb|AIU40168.1| dehydration responsive element binding protein 2 [Saccharum arundinaceum]
Length=262

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAA AYD+
Sbjct  65   SKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTAVEAAHAYDE  124

Query  371  aarrLYGPSAKLNLLDDT  424
            AA+ +YGP A++N  +++
Sbjct  125  AAKAMYGPKARVNFSENS  142



>gb|AGG20202.1| DREB2 [Hemarthria compressa]
Length=264

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAA AYD+
Sbjct  67   SKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTAVEAAHAYDE  126

Query  371  aarrLYGPSAKLNLLDDT  424
            AA+ +YGP A++N  +++
Sbjct  127  AAKAMYGPRARVNFSENS  144



>emb|CDY52924.1| BnaA04g29310D [Brassica napus]
Length=336

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 73/97 (75%), Gaps = 6/97 (6%)
 Frame = +2

Query  128  GAVTGKPANTAPPVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNR  307
            G +  KP   APP        SRKGCM+GKGGPEN +  +RGVRQRTWGKWVAEIR+P R
Sbjct  104  GCLKPKPIRKAPPKG------SRKGCMKGKGGPENGIWNYRGVRQRTWGKWVAEIRQPCR  157

Query  308  GARVWLGTFNTSLEaarayddaarrLYGPSAKLNLLD  418
            GAR+WLGTF +S EAA AYD+AA+ +YG +A+LNL D
Sbjct  158  GARLWLGTFPSSYEAALAYDEAAKAMYGEAARLNLPD  194



>gb|ADM73511.1| dehydration responsive element-binding protein 2 [Setaria italica]
Length=234

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  32   RKAPAKGSKKGCMAGKGGPENGNCPYRGVRQRTWGKWVAEIREPNRGKRLWLGSFPTAVE  91

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AA+ +YGP A++N  +++
Sbjct  92   AAHAYDEAAKAMYGPKARVNFPENS  116



>ref|XP_006828126.1| hypothetical protein AMTR_s00023p00044590 [Amborella trichopoda]
 gb|ERM95542.1| hypothetical protein AMTR_s00023p00044590 [Amborella trichopoda]
Length=382

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            V+K     S+KGCMRGKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLGTF T+L
Sbjct  42   VRKVPAKGSKKGCMRGKGGPENSRCNYRGVRQRTWGKWVAEIREPNRGNRLWLGTFPTAL  101

Query  347  EaarayddaarrLYGPSAKLNLLDDT  424
             AA AYD+AAR +YG  A+LNL D T
Sbjct  102  AAALAYDEAARAMYGSCARLNLPDTT  127



>ref|XP_009402398.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=326

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            ++K     S+KGCMRGKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLGTF T++
Sbjct  48   IRKPPAKGSKKGCMRGKGGPENRSCRYRGVRQRTWGKWVAEIREPNRGNRLWLGTFPTAV  107

Query  347  EaarayddaarrLYGPSAKLNL  412
            +AA AYDDAAR +YG SA++NL
Sbjct  108  QAALAYDDAARAMYGTSARINL  129



>gb|ACF98541.1| DRE-binding protein DREB1 [Phyllostachys edulis]
Length=226

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S++GCM GKGGPEN++C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LE
Sbjct  34   RKAPAKGSKRGCMAGKGGPENSICDYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALE  93

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AAR +YG +A++N  +++
Sbjct  94   AAHAYDEAARAVYGSAARVNFSENS  118



>ref|NP_565929.1| dehydration-responsive element-binding protein 2C [Arabidopsis 
thaliana]
 sp|Q8LFR2.2|DRE2C_ARATH RecName: Full=Dehydration-responsive element-binding protein 
2C; Short=Protein DREB2C [Arabidopsis thaliana]
 gb|AAD25669.2| AP2 domain transcription factor [Arabidopsis thaliana]
 gb|ABH04612.1| At2g40340 [Arabidopsis thaliana]
 gb|AEC09816.1| dehydration-responsive element-binding protein 2C [Arabidopsis 
thaliana]
Length=341

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCM+GKGGPEN +C +RGVRQR WGKWVAEIREP+ GAR+WLGTF++S EAA AYD+
Sbjct  54   SRKGCMKGKGGPENGICDYRGVRQRRWGKWVAEIREPDGGARLWLGTFSSSYEAALAYDE  113

Query  371  aarrLYGPSAKLNL  412
            AA+ +YG SA+LNL
Sbjct  114  AAKAIYGQSARLNL  127



>ref|NP_001152469.1| dehydration-responsive element-binding protein 2A [Zea mays]
 gb|ACG47772.1| dehydration-responsive element-binding protein 2A [Zea mays]
Length=260

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  56   RKAPAKGSKKGCMMGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTAVE  115

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AA+ +YGP A++N  + +
Sbjct  116  AAHAYDEAAKAMYGPKARVNFSESS  140



>ref|XP_008799805.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008799806.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
isoform X2 [Phoenix dactylifera]
Length=263

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  206  MRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrL  385
            M+GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG+R+WLGTFNT+L+AA AYD+AAR +
Sbjct  1    MQGKGGPENSHCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFNTALDAAMAYDEAARAM  60

Query  386  YGPSAKLNL  412
            YGP A+LNL
Sbjct  61   YGPCARLNL  69



>ref|XP_004968294.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Setaria italica]
Length=259

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  57   RKAPAKGSKKGCMAGKGGPENGNCPYRGVRQRTWGKWVAEIREPNRGKRLWLGSFPTAVE  116

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AA AYD+AA+ +YGP A++N  +++
Sbjct  117  AAHAYDEAAKAMYGPKARVNFPENS  141



>ref|XP_002973089.1| hypothetical protein SELMODRAFT_38502, partial [Selaginella moellendorffii]
 ref|XP_002976779.1| hypothetical protein SELMODRAFT_105485, partial [Selaginella 
moellendorffii]
 gb|EFJ22448.1| hypothetical protein SELMODRAFT_105485, partial [Selaginella 
moellendorffii]
 gb|EFJ25463.1| hypothetical protein SELMODRAFT_38502, partial [Selaginella moellendorffii]
Length=75

 Score =   103 bits (256),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KG MRGKGGPENA CT+RGVRQRTWGKWVAEIREP + +R+WLG+F T+ EAARAYD+
Sbjct  1    SKKGSMRGKGGPENASCTYRGVRQRTWGKWVAEIREPKKRSRLWLGSFATADEAARAYDE  60

Query  371  aarrLYGPSAKLNL  412
            AA+RLYGP A LNL
Sbjct  61   AAKRLYGPEAHLNL  74



>gb|ACA79921.1| DRE-binding protein 2 [Sorghum bicolor]
Length=262

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTW KWVAEIREPNRG R+WLG+F T++EAA AYD+
Sbjct  65   SKKGCMTGKGGPENVNCVYRGVRQRTWVKWVAEIREPNRGRRLWLGSFPTAVEAAHAYDE  124

Query  371  aarrLYGPSAKLNLLDDT  424
            AA+ +YGP A++N  D++
Sbjct  125  AAKAMYGPKARVNFSDNS  142



>ref|XP_001756620.1| predicted protein [Physcomitrella patens]
 gb|EDQ78574.1| predicted protein [Physcomitrella patens]
Length=85

 Score =   103 bits (256),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 53/73 (73%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S++GCM+GKGGPENALCT+RGVRQ+TWG WVAEIR+PNRG R+WLGT++T+  AA AY+ 
Sbjct  11   SKRGCMKGKGGPENALCTYRGVRQQTWGMWVAEIRKPNRGLRLWLGTYSTAEIAALAYNS  70

Query  371  aarrLYGPSAKLN  409
            AAR LYGP+A LN
Sbjct  71   AARILYGPNALLN  83



>gb|ABY19375.1| DRE-binding protein DREB2 [Phyllostachys edulis]
 gb|ABY19376.1| DRE-binding protein DREB2 [Phyllostachys edulis]
Length=277

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T+LEAA AYD+
Sbjct  58   SKKGCMAGKGGPENSNCDYRGVRQRTWGKWVAEIREPNRGKRLWLGSFPTALEAAHAYDE  117

Query  371  aarrLYGPSAKLNL  412
            AAR +YG +A++N 
Sbjct  118  AARAMYGSAARVNF  131



>ref|XP_009406908.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=326

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            V++     S+KGCMRGKGGPEN  C +RGVRQRTWGKWVAEIREPNRG+R+WLGTF T+ 
Sbjct  49   VRRPPAKGSKKGCMRGKGGPENPNCRYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAF  108

Query  347  EaarayddaarrLYGPSAKLNL  412
            +AA AYDDAAR +YG  A+LNL
Sbjct  109  QAALAYDDAARAMYGTMARLNL  130



>ref|XP_009406909.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009406910.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=318

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
            V++     S+KGCMRGKGGPEN  C +RGVRQRTWGKWVAEIREPNRG+R+WLGTF T+ 
Sbjct  41   VRRPPAKGSKKGCMRGKGGPENPNCRYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAF  100

Query  347  EaarayddaarrLYGPSAKLNL  412
            +AA AYDDAAR +YG  A+LNL
Sbjct  101  QAALAYDDAARAMYGTMARLNL  122



>gb|AEK48227.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
 gb|AEK48228.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=153

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  35   RKAQAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  94

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AARAYDDAAR +YG  A++N  + +
Sbjct  95   AARAYDDAARAMYGAKARVNFSEQS  119



>gb|AEI69362.1| dehydration responsive element binding protein 1001 [Sorghum 
bicolor]
Length=262

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN  C +RGVRQRTWGK VAEIREPNRG R+WLG+F T++EAA AYD+
Sbjct  65   SKKGCMTGKGGPENVNCVYRGVRQRTWGKXVAEIREPNRGRRLWLGSFPTAVEAAHAYDE  124

Query  371  aarrLYGPSAKLNLLDDT  424
            AA+ +YGP A++N  D++
Sbjct  125  AAKAMYGPKARVNFSDNS  142



>emb|CAG30547.1| putative DREB2A protein [Festuca arundinacea]
Length=264

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  38   RKAPAKGSKKGCMAGKGGPENSNCKYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  97

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD+AAR +YG +A++N 
Sbjct  98   AAHAYDEAARAMYGATARVNF  118



>emb|CAH10193.1| dehydration-responsive element binding protein 2 isoform 2 [Festuca 
arundinacea]
Length=264

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
             +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++
Sbjct  37   ARKAPAKGSKKGCMAGKGGPENSNCKYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAV  96

Query  347  EaarayddaarrLYGPSAKLNL  412
            EAA AYD+AAR +YG +A++N 
Sbjct  97   EAAHAYDEAARAMYGATARVNF  118



>gb|AFO12481.1| DRE-binding protein 2 [Leymus qinghaicus]
Length=264

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  45   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  104

Query  371  aarrLYGPSAKLNL  412
            AAR +YG +A++N+
Sbjct  105  AARAMYGATARVNI  118



>emb|CAG30548.1| putative DREB2A protein [Festuca arundinacea]
Length=254

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAA AYD+
Sbjct  45   SKKGCMAGKGGPENSNCEYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAAHAYDE  104

Query  371  aarrLYGPSAKLNL  412
            AAR +YG +A++N 
Sbjct  105  AARAMYGATARVNF  118



>gb|AAR11157.1| dehydration-responsive element binding protein 2 [Festuca arundinacea]
Length=263

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  167  VKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSL  346
             +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++
Sbjct  37   ARKAPAKGSKKGCMAGKGGPENSNCKYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAV  96

Query  347  EaarayddaarrLYGPSAKLNLLDDTF  427
            EAA AYD+AAR +YG +A++N  + + 
Sbjct  97   EAAHAYDEAARAMYGATARVNFSERSL  123



>gb|AAS59530.1| putative DRE-binding protein DREB2 [Poa pratensis]
Length=264

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  38   RKAPAKGSKKGCMAGKGGPENSNCKYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  97

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD+AAR +YG +A++N 
Sbjct  98   AAHAYDEAARAMYGATARVNF  118



>ref|XP_003569085.1| PREDICTED: dehydration-responsive element-binding protein 2A 
[Brachypodium distachyon]
Length=279

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  53   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGKRLWLGSFPTAVE  112

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD+AAR +YG  A++N 
Sbjct  113  AAHAYDEAARAMYGAKARVNF  133



>gb|AGL08026.1| dehydration-responsive element-binding protein, partial [Aegilops 
tauschii]
Length=153

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  42   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  101

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  102  AARAMYGAKARVNFSEQS  119



>gb|AEK48229.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
 gb|AEK48230.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=152

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  41   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  100

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  101  AARAMYGAKARVNFSEQS  118



>gb|ABA08425.1| dehydration-responsive element-binding protein [Triticum aestivum]
Length=176

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  42   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  101

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  102  AARAMYGAKARVNFSEQS  119



>gb|AEK48231.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=150

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  32   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  91

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AARAYDDAAR +YG  A++N  + +
Sbjct  92   AARAYDDAARAMYGAKARVNFSEQS  116



>gb|AFO12472.1| DRE-binding protein 2 [Leymus crassiusculus]
 gb|AFO12482.1| DRE-binding protein 2 [Leymus tianschanicus]
Length=264

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  45   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  104

Query  371  aarrLYGPSAKLNL  412
            AAR +YG +A++N 
Sbjct  105  AARAMYGATARVNF  118



>gb|AGL08024.1| dehydration-responsive element-binding protein, partial [Triticum 
dicoccoides]
Length=154

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  43   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  102

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  103  AARAMYGAKARVNFSEQS  120



>gb|AGL08027.1| dehydration-responsive element-binding protein, partial [Aegilops 
peregrina]
Length=150

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  42   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  101

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  102  AARAMYGAKARVNFSEQS  119



>gb|AEO78514.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=149

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  41   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  100

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  101  AARAMYGAKARVNFSEQS  118



>gb|AFO12478.1| DRE-binding protein 2 [Leymus racemosus]
Length=264

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  45   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  104

Query  371  aarrLYGPSAKLNL  412
            AAR +YG +A++N 
Sbjct  105  AARAMYGTTARVNF  118



>gb|AEZ68001.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=157

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  46   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  105

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  106  AARAMYGAKARVNFSEQS  123



>gb|AFO12474.1| DRE-binding protein 2 [Leymus mollis]
Length=264

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  38   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  97

Query  350  aarayddaarrLYGPSAKLNL  412
            AARAYDDAAR +YG +A++N 
Sbjct  98   AARAYDDAARAMYGATARVNF  118



>gb|AAM61256.1| AP2 domain transcription factor [Arabidopsis thaliana]
Length=341

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCM+GKGGPEN +C +R VRQR WGKWVAEIREP+ GAR+WLGTF++S EAA AYD+
Sbjct  54   SRKGCMKGKGGPENGICDYREVRQRRWGKWVAEIREPDGGARLWLGTFSSSYEAALAYDE  113

Query  371  aarrLYGPSAKLNL  412
            AA+ +YG SA+LNL
Sbjct  114  AAKAIYGQSARLNL  127



>gb|AEO78515.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=152

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  41   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  100

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  101  AARAMYGAKARVNFSEQS  118



>gb|AFO12471.1| DRE-binding protein 2 [Leymus chinensis]
Length=264

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  38   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  97

Query  350  aarayddaarrLYGPSAKLNL  412
            AARAYDDAAR +YG +A++N 
Sbjct  98   AARAYDDAARAMYGATARVNF  118



>gb|AEO78516.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=144

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  42   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  101

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  102  AARAMYGAKARVNFSEQS  119



>gb|AFO12476.1| DRE-binding protein 2 [Leymus paboanus]
Length=264

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  38   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  97

Query  350  aarayddaarrLYGPSAKLNL  412
            AARAYDDAAR +YG +A++N 
Sbjct  98   AARAYDDAARAMYGTTARVNF  118



>gb|AFO12468.1| DRE-binding protein 2 [Leymus alaicus subsp. karataviensis]
Length=264

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  45   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  104

Query  371  aarrLYGPSAKLNL  412
            AAR +YG +A++N 
Sbjct  105  AARAMYGATARVNF  118



>gb|AFO12479.1| DRE-binding protein 2 [Leymus secalinus]
Length=264

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  45   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  104

Query  371  aarrLYGPSAKLNL  412
            AAR +YG +A++N 
Sbjct  105  AARAMYGATARVNF  118



>gb|AFO12470.1| DRE-binding protein 2 [Leymus arenarius]
Length=264

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  45   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  104

Query  371  aarrLYGPSAKLNL  412
            AAR +YG +A++N 
Sbjct  105  AARAMYGATARVNF  118



>gb|AAU29412.1| dehydration-responsive element-binding protein 2 [Hordeum brevisubulatum]
Length=264

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  38   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  97

Query  350  aarayddaarrLYGPSAKLNL  412
            AARAYDDAAR +YG +A++N 
Sbjct  98   AARAYDDAARAMYGATARVNF  118



>gb|AFO12483.1| DRE-binding protein 2 [Leymus triticoides]
Length=264

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  38   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  97

Query  350  aarayddaarrLYGPSAKLNL  412
            AARAYDDAAR +YG +A++N 
Sbjct  98   AARAYDDAARAMYGATARVNF  118



>gb|AFO12467.1| DRE-binding protein 2 [Leymus akmolinensis]
Length=264

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  45   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  104

Query  371  aarrLYGPSAKLNL  412
            AAR +YG +A++N 
Sbjct  105  AARAMYGATARVNF  118



>gb|AFO12477.1| DRE-binding protein 2 [Leymus qinghaicus]
Length=264

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM G+GGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  38   RKAPAKGSKKGCMAGEGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  97

Query  350  aarayddaarrLYGPSAKLNL  412
            AAR YDDAAR +YG +A++N 
Sbjct  98   AARTYDDAARAMYGATARVNF  118



>gb|AFH75401.1| dehydration-responsive element-binding transcription factor 2 
[Hordeum brevisubulatum subsp. violaceum]
Length=264

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  38   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  97

Query  350  aarayddaarrLYGPSAKLNL  412
            AARAYDDAAR +YG +A++N 
Sbjct  98   AARAYDDAARAMYGATARVNF  118



>gb|AIY22669.1| Dreb-like protein, partial [Dasypyrum villosum]
Length=261

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  42   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  101

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  102  AARAMYGAKARVNFSEQS  119



>gb|AGL08025.1| dehydration-responsive element-binding protein, partial [Aegilops 
speltoides]
Length=144

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  31   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  90

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AARAYDDAAR +YG  A++N  + +
Sbjct  91   AARAYDDAARAMYGAKARVNFSEQS  115



>gb|ABD66654.1| DRE-binding protein 2 [Sorghum bicolor]
Length=262

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN    +RGVRQRTWGKWVAEIREPNRG R+WLG+F  ++EAA AYD+
Sbjct  65   SKKGCMTGKGGPENVNSMYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPNAVEAAHAYDE  124

Query  371  aarrLYGPSAKLNLLDDT  424
            AA+ +YGP A++N  D++
Sbjct  125  AAKAMYGPKARVNFSDNS  142



>gb|AFO12480.1| DRE-binding protein 2 [Leymus secalinus subsp. secalinus]
Length=264

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  45   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  104

Query  371  aarrLYGPSAKLNL  412
            AAR +YG +A++N 
Sbjct  105  AARAMYGTTARVNF  118



>gb|AFO12475.1| DRE-binding protein 2 [Leymus multicaulis]
Length=264

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  38   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  97

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AARAYDDAAR +YG  A++N  + +
Sbjct  98   AARAYDDAARAMYGAKARVNFSEQS  122



>gb|AIY22668.1| Dreb-like protein, partial [Elymus spicatus]
Length=261

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  35   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  94

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AARAYDDAAR +YG  A++N  + +
Sbjct  95   AARAYDDAARAMYGAKARVNFSEQS  119



>gb|AFO12473.1| DRE-binding protein 2 [Leymus karelinii]
Length=264

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  38   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  97

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AARAYDDAAR +YG  A++N  + +
Sbjct  98   AARAYDDAARAMYGAKARVNFSEQS  122



>gb|AEZ68005.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=157

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  40   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  99

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AARAYDDAAR +YG  A++N  + +
Sbjct  100  AARAYDDAARAMYGAKARVNFSEQS  124



>gb|AEV46839.1| dehydration-responsive element binding protein [Leymus chinensis]
Length=278

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  59   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  118

Query  371  aarrLYGPSAKLNL  412
            AAR +YG +A++N 
Sbjct  119  AARAMYGATARVNF  132



>gb|AIY22663.1| Dreb-like protein, partial [Thinopyrum bessarabicum]
Length=261

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  42   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  101

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  102  AARAMYGAKARVNFSEQS  119



>gb|AIY22665.1| Dreb-like protein, partial [Thinopyrum ponticum]
Length=260

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  35   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  94

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AARAYDDAAR +YG  A++N  + +
Sbjct  95   AARAYDDAARAMYGAKARVNFSEQS  119



>gb|ABA08426.1| dehydration-responsive element-binding protein [Triticum aestivum]
Length=261

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  42   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  101

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  102  AARAMYGAKARVNFSEQS  119



>gb|AER42620.1| dehydration responsive element binding protein 1 [Hordeum brevisubulatum]
Length=278

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  52   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  111

Query  350  aarayddaarrLYGPSAKLNL  412
            AARAYDDAAR +YG +A++N 
Sbjct  112  AARAYDDAARAMYGATARVNF  132



>gb|AEZ68003.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
 gb|AEZ68004.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=160

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  49   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  108

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  109  AARAMYGAKARVNFSEQS  126



>ref|XP_008804145.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X2 [Phoenix dactylifera]
Length=266

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  206  MRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrL  385
            M+GKGGP+NA C +RGVRQRTWGKWVAEIREPNRG+R+WLGTF T+LEAA AYD+AA+ +
Sbjct  1    MKGKGGPDNAHCKYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTALEAALAYDEAAKAM  60

Query  386  YGPSAKLNL  412
            YGP A+LNL
Sbjct  61   YGPYARLNL  69



>ref|XP_008776283.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Phoenix dactylifera]
Length=326

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            SRKGCM GKGGP+N  C +RGVRQRTWGKWVAEIREP+RG+R+WLGTF T++EAA AYD+
Sbjct  52   SRKGCMEGKGGPDNPHCKYRGVRQRTWGKWVAEIREPSRGSRLWLGTFPTAVEAALAYDE  111

Query  371  aarrLYGPSAKLNL  412
            AAR +YG  A+LNL
Sbjct  112  AARAMYGSYARLNL  125



>gb|AAY25517.1| dehydration responsive element binding protein 1 [Hordeum vulgare 
subsp. vulgare]
 dbj|BAK07539.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AEI54696.1| AP2/EREBP-like protein [Hordeum vulgare subsp. vulgare]
 gb|AEI54697.1| AP2/EREBP-like protein [Hordeum vulgare subsp. vulgare]
 gb|AHY82615.1| dehydration responsive element binding protein 1 [Hordeum vulgare 
subsp. vulgare]
Length=278

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  52   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  111

Query  350  aarayddaarrLYGPSAKLNL  412
            AARAYDDAAR +YG +A++N 
Sbjct  112  AARAYDDAARAMYGATARVNF  132



>emb|CAG30549.1| putative FaDREB2A [Festuca arundinacea]
 emb|CAH10192.1| dehydration-responsive element binding protein 2 isoform 1 [Festuca 
arundinacea]
Length=254

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIR+PNRG R+WLG+F T++EAA AYD+
Sbjct  45   SKKGCMAGKGGPENSNCKYRGVRQRTWGKWVAEIRKPNRGNRLWLGSFPTAVEAAHAYDE  104

Query  371  aarrLYGPSAKLNL  412
            AAR +YG +A++N 
Sbjct  105  AARAMYGATARVNF  118



>gb|AEI98920.1| AP2/EREBP transcription factor [Lophopyrum elongatum]
Length=278

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++E
Sbjct  52   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  111

Query  350  aarayddaarrLYGPSAKLNLLDDT  424
            AARAYDDAAR +YG  A++N  + +
Sbjct  112  AARAYDDAARAMYGAKARVNFSEQS  136



>gb|AEZ68002.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=158

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  49   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  108

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  109  AARAMYGAKARVNFSEQS  126



>gb|AAX13289.1| DREB transcription factor 6 [Triticum aestivum]
 emb|CDM81490.1| unnamed protein product [Triticum aestivum]
Length=254

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  59   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  118

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  119  AARAMYGAKARVNFSEQS  136



>ref|XP_007009970.1| Dehydration-responsive element-binding protein 2C [Theobroma 
cacao]
 gb|EOY18780.1| Dehydration-responsive element-binding protein 2C [Theobroma 
cacao]
Length=248

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  KKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLE  349
            +K+    S+KGCMRGKGGP+N  C +RGVRQRTWGKWVAEIR PNRG R+WLGTF T+ E
Sbjct  48   RKAPAKGSKKGCMRGKGGPQNQSCNYRGVRQRTWGKWVAEIRAPNRGKRLWLGTFPTAYE  107

Query  350  aarayddaarrLYGPSAKLNL  412
            AA AYD+AAR +YG +A LN+
Sbjct  108  AALAYDEAARMMYGENAILNM  128



>ref|XP_008792180.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X2 [Phoenix dactylifera]
Length=272

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  206  MRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaarayddaarrL  385
            MRGKGGPEN+ C +RGVRQRTWGKWVAEIR+PN G+R+WLGTFNT+LEAA AYD+AAR +
Sbjct  1    MRGKGGPENSHCNYRGVRQRTWGKWVAEIRKPNGGSRLWLGTFNTALEAALAYDEAARAM  60

Query  386  YGPSAKLNL  412
            YGP A+LNL
Sbjct  61   YGPRARLNL  69



>gb|AAL01124.1|AF303376_1 AP2-containing protein [Triticum aestivum]
 gb|AAY44605.1| dehydration responsive element binding protein W50 [Triticum 
aestivum]
 gb|ABA08424.1| dehydration-responsive element-binding protein [Triticum aestivum]
Length=278

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTSLEaaraydd  370
            S+KGCM GKGGPEN+ C +RGVRQRTWGKWVAEIREPNRG R+WLG+F T++EAARAYDD
Sbjct  59   SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVEAARAYDD  118

Query  371  aarrLYGPSAKLNLLDDT  424
            AAR +YG  A++N  + +
Sbjct  119  AARAMYGAKARVNFSEQS  136



>ref|XP_010534621.1| PREDICTED: dehydration-responsive element-binding protein 2C 
isoform X1 [Tarenaya hassleriana]
Length=417

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  164  PVKKSNVGRSRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARVWLGTFNTS  343
            P ++++   S+KGCM GKGGPEN  C +RGVRQRTWGKWVAEIREPN+G R+WLGTF  +
Sbjct  46   PGQRAHAKGSKKGCMTGKGGPENFDCDYRGVRQRTWGKWVAEIREPNKGTRLWLGTFPNA  105

Query  344  LEaarayddaarrLYGPSAKLNL  412
             EAA AYD+AAR +YG SA+LNL
Sbjct  106  YEAALAYDNAARAMYGQSARLNL  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2145275583018