BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85118_g1_i1 len=1054 path=[1032:0-1053]

Length=1054
                                                                      Score     E

ref|XP_009791297.1|  PREDICTED: uncharacterized protein LOC104238596    111   3e-26   
ref|XP_006339039.1|  PREDICTED: uncharacterized protein LOC102598663    110   4e-26   
ref|XP_007207580.1|  hypothetical protein PRUPE_ppa018485mg             110   4e-26   
ref|XP_009613439.1|  PREDICTED: uncharacterized protein LOC104106573    110   6e-26   
ref|XP_008241603.1|  PREDICTED: uncharacterized protein LOC103340015    110   6e-26   
ref|XP_009609527.1|  PREDICTED: uncharacterized protein LOC104103...    106   2e-24   
ref|XP_010037878.1|  PREDICTED: uncharacterized protein LOC104426502    105   2e-24   
ref|XP_009803697.1|  PREDICTED: uncharacterized protein LOC104249026    105   2e-24   
gb|KDO37054.1|  hypothetical protein CISIN_1g034494mg                   105   3e-24   
gb|KHG20981.1|  Argininosuccinate lyase                                 105   4e-24   
gb|KCW49658.1|  hypothetical protein EUGRSUZ_K03172                     105   7e-24   
ref|XP_006429003.1|  hypothetical protein CICLE_v10013206mg             103   1e-23   
ref|XP_004249525.1|  PREDICTED: MATH and LRR domain-containing pr...    102   3e-23   
ref|XP_008369842.1|  PREDICTED: uncharacterized protein LOC103433368    102   4e-23   
ref|XP_009341600.1|  PREDICTED: uncharacterized protein LOC103933636    102   6e-23   
ref|XP_006345666.1|  PREDICTED: uncharacterized protein LOC102590633    101   1e-22   
ref|XP_009377113.1|  PREDICTED: uncharacterized protein LOC103965762    100   2e-22   
ref|XP_004246743.1|  PREDICTED: uncharacterized protein LOC101246275    100   2e-22   
gb|EYU41673.1|  hypothetical protein MIMGU_mgv1a017010mg              99.4    4e-22   
ref|XP_006436116.1|  hypothetical protein CICLE_v10033177mg           98.6    7e-22   
ref|XP_007027122.1|  Plant protein 1589 of Uncharacterized protei...  98.6    7e-22   
ref|XP_002282451.1|  PREDICTED: uncharacterized protein LOC100244913  99.0    7e-22   Vitis vinifera
ref|XP_008359705.1|  PREDICTED: uncharacterized protein LOC103423410  98.6    9e-22   
ref|XP_002523034.1|  conserved hypothetical protein                   98.6    9e-22   Ricinus communis
ref|XP_004302796.1|  PREDICTED: uncharacterized protein LOC101310...  98.6    1e-21   
ref|XP_002533662.1|  conserved hypothetical protein                   97.8    1e-21   Ricinus communis
gb|KHG20463.1|  hypothetical protein F383_06911                       97.4    2e-21   
gb|ACJ86173.1|  unknown                                               97.4    2e-21   Medicago truncatula
ref|XP_004168103.1|  PREDICTED: uncharacterized LOC101208991          97.4    2e-21   
ref|XP_004493904.1|  PREDICTED: uncharacterized protein LOC101501264  97.1    2e-21   
ref|XP_011019249.1|  PREDICTED: uncharacterized protein LOC105122044  96.7    3e-21   
ref|XP_008463517.1|  PREDICTED: uncharacterized protein LOC103501658  96.7    3e-21   
ref|XP_010096673.1|  hypothetical protein L484_025422                 96.7    4e-21   
ref|XP_007009555.1|  Plant protein 1589 of Uncharacterized protei...  96.7    4e-21   
gb|AFK45002.1|  unknown                                               96.3    5e-21   
ref|XP_004150990.1|  PREDICTED: uncharacterized protein LOC101208991  95.9    6e-21   
ref|XP_002308479.1|  hypothetical protein POPTR_0006s23000g           95.1    9e-21   Populus trichocarpa [western balsam poplar]
emb|CDP00027.1|  unnamed protein product                              94.4    3e-20   
ref|XP_011027103.1|  PREDICTED: uncharacterized protein LOC105127482  93.6    4e-20   
ref|XP_011077432.1|  PREDICTED: uncharacterized protein LOC105161438  94.0    5e-20   
ref|XP_007139279.1|  hypothetical protein PHAVU_008G015900g           93.6    5e-20   
ref|XP_006378740.1|  hypothetical protein POPTR_0010s21830g           93.2    6e-20   
ref|XP_009374695.1|  PREDICTED: uncharacterized protein LOC103963586  93.6    7e-20   
gb|KHG22424.1|  Argininosuccinate lyase                               92.8    7e-20   
ref|XP_010669812.1|  PREDICTED: uncharacterized protein LOC104886...  92.8    8e-20   
ref|XP_006361434.1|  PREDICTED: uncharacterized protein LOC102592404  92.8    1e-19   
ref|XP_002278074.1|  PREDICTED: uncharacterized protein LOC100256772  92.4    1e-19   Vitis vinifera
ref|XP_007219284.1|  hypothetical protein PRUPE_ppa018490mg           92.4    1e-19   
ref|XP_004142092.1|  PREDICTED: uncharacterized protein LOC101219487  92.0    2e-19   
ref|XP_007009551.1|  Plant protein 1589 of Uncharacterized protei...  92.0    2e-19   
ref|XP_009357652.1|  PREDICTED: uncharacterized protein LOC103948365  91.7    2e-19   
ref|XP_010253343.1|  PREDICTED: uncharacterized protein LOC104594647  91.3    3e-19   
emb|CDP06660.1|  unnamed protein product                              91.3    3e-19   
ref|XP_002282487.1|  PREDICTED: uncharacterized protein LOC100267224  91.3    3e-19   Vitis vinifera
ref|XP_010260038.1|  PREDICTED: uncharacterized protein LOC104599...  90.9    3e-19   
ref|XP_008371124.1|  PREDICTED: uncharacterized protein LOC103434533  90.9    3e-19   
ref|XP_007220496.1|  hypothetical protein PRUPE_ppa013960mg           90.9    3e-19   
ref|XP_004497310.1|  PREDICTED: uncharacterized protein LOC101495981  90.9    4e-19   
ref|XP_010922425.1|  PREDICTED: uncharacterized protein LOC105045741  90.9    4e-19   
ref|XP_008233551.1|  PREDICTED: uncharacterized protein LOC103332586  90.9    4e-19   
ref|XP_003554334.1|  PREDICTED: uncharacterized protein LOC100785268  90.9    4e-19   
ref|XP_011094802.1|  PREDICTED: uncharacterized protein LOC105174...  90.5    4e-19   
ref|XP_010529096.1|  PREDICTED: uncharacterized protein LOC104806077  90.9    5e-19   
ref|XP_009778459.1|  PREDICTED: uncharacterized protein LOC104227819  90.5    5e-19   
ref|XP_008461625.1|  PREDICTED: uncharacterized protein LOC103500185  90.5    6e-19   
ref|XP_004147706.1|  PREDICTED: uncharacterized protein LOC101203417  90.1    8e-19   
ref|XP_003521351.1|  PREDICTED: uncharacterized protein LOC100808933  90.1    8e-19   
ref|XP_003551816.1|  PREDICTED: uncharacterized protein LOC100797035  90.1    8e-19   
ref|XP_009622864.1|  PREDICTED: uncharacterized protein LOC104114190  89.7    9e-19   
ref|XP_010253307.1|  PREDICTED: uncharacterized protein LOC104594625  89.7    1e-18   
ref|XP_010097379.1|  hypothetical protein L484_008902                 90.5    1e-18   
ref|XP_010067359.1|  PREDICTED: uncharacterized protein LOC104454261  90.1    1e-18   
ref|XP_010908879.1|  PREDICTED: uncharacterized protein LOC105035139  89.7    1e-18   
ref|XP_003520029.1|  PREDICTED: uncharacterized protein LOC100795...  89.7    1e-18   
ref|XP_010067216.1|  PREDICTED: uncharacterized protein LOC104454150  89.7    1e-18   
ref|XP_008776339.1|  PREDICTED: uncharacterized protein LOC103696468  89.4    1e-18   
gb|KDP35579.1|  hypothetical protein JCGZ_09017                       89.0    1e-18   
ref|XP_003542470.1|  PREDICTED: uncharacterized protein LOC100811683  89.4    1e-18   
ref|XP_010260055.1|  PREDICTED: uncharacterized protein LOC104599279  89.0    2e-18   
ref|XP_004307462.1|  PREDICTED: uncharacterized protein LOC101296040  89.0    2e-18   
gb|KHG18162.1|  hypothetical protein F383_05478                       89.4    2e-18   
ref|XP_010067931.1|  PREDICTED: uncharacterized protein LOC104454716  88.2    2e-18   
gb|KCW65481.1|  hypothetical protein EUGRSUZ_G028901                  87.8    2e-18   
ref|XP_009116221.1|  PREDICTED: uncharacterized protein LOC103841436  88.6    3e-18   
ref|XP_002265038.1|  PREDICTED: uncharacterized protein LOC100245098  88.6    3e-18   Vitis vinifera
ref|XP_006574868.1|  PREDICTED: uncharacterized protein LOC100795...  89.0    3e-18   
ref|XP_010669811.1|  PREDICTED: uncharacterized protein LOC104886...  88.2    4e-18   
gb|KEH17753.1|  hypothetical protein MTR_0001s0190                    88.6    4e-18   
ref|XP_006574869.1|  PREDICTED: uncharacterized protein LOC100795...  88.6    4e-18   
ref|XP_008362697.1|  PREDICTED: uncharacterized protein LOC103426379  88.2    4e-18   
ref|XP_007162681.1|  hypothetical protein PHAVU_001G171100g           87.8    5e-18   
ref|XP_003555622.1|  PREDICTED: uncharacterized protein LOC100800093  87.8    5e-18   
emb|CDY02930.1|  BnaC04g25560D                                        87.8    5e-18   
ref|XP_009419267.1|  PREDICTED: uncharacterized protein LOC103999...  87.8    6e-18   
ref|XP_010543332.1|  PREDICTED: uncharacterized protein LOC104816293  87.4    6e-18   
ref|XP_009139191.1|  PREDICTED: uncharacterized protein LOC103863183  87.4    8e-18   
ref|XP_009609528.1|  PREDICTED: uncharacterized protein LOC104103...  87.0    9e-18   
ref|XP_009804271.1|  PREDICTED: uncharacterized protein LOC104249...  87.0    1e-17   
ref|NP_191084.1|  uncharacterized protein                             86.7    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288973.1|  hypothetical protein CARUB_v10002347mg           86.7    1e-17   
ref|XP_009388635.1|  PREDICTED: uncharacterized protein LOC103975403  86.7    1e-17   
ref|XP_010516084.1|  PREDICTED: uncharacterized protein LOC104791810  86.7    1e-17   
ref|XP_010427285.1|  PREDICTED: uncharacterized protein LOC104712150  86.3    2e-17   
ref|NP_568103.3|  uncharacterized protein                             85.9    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009622570.1|  PREDICTED: uncharacterized protein LOC104113949  86.3    3e-17   
ref|XP_003621784.1|  Plant-specific domain TIGR01589 family protein   85.9    3e-17   
ref|XP_002870980.1|  hypothetical protein ARALYDRAFT_487036           85.5    4e-17   
gb|ACJ85968.1|  unknown                                               85.1    6e-17   Medicago truncatula
emb|CDX80829.1|  BnaC03g00830D                                        84.3    7e-17   
gb|AAM62863.1|  unknown                                               84.3    9e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292115.1|  hypothetical protein CARUB_v10018311mg           84.3    9e-17   
ref|NP_001055765.1|  Os05g0462000                                     84.3    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EAY98332.1|  hypothetical protein OsI_20242                        84.3    1e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_010423844.1|  PREDICTED: uncharacterized protein LOC104708886  84.3    1e-16   
ref|XP_009122767.1|  PREDICTED: uncharacterized protein LOC103847438  84.0    1e-16   
emb|CDY11219.1|  BnaA03g00550D                                        84.0    1e-16   
ref|XP_009416123.1|  PREDICTED: uncharacterized protein LOC103996829  84.0    1e-16   
ref|XP_006398715.1|  hypothetical protein EUTSA_v10015145mg           83.6    2e-16   
ref|XP_009130713.1|  PREDICTED: uncharacterized protein LOC103855476  84.3    2e-16   
ref|XP_010490719.1|  PREDICTED: uncharacterized protein LOC104768427  83.6    2e-16   
gb|EYU38477.1|  hypothetical protein MIMGU_mgv1a021970mg              83.6    2e-16   
ref|XP_010452102.1|  PREDICTED: uncharacterized protein LOC104734268  83.2    2e-16   
gb|KDO67780.1|  hypothetical protein CISIN_1g0344022mg                82.0    3e-16   
gb|KFK34760.1|  hypothetical protein AALP_AA5G190000                  83.2    3e-16   
ref|XP_006589753.1|  PREDICTED: uncharacterized protein LOC102662475  82.8    4e-16   
ref|XP_006654519.1|  PREDICTED: uncharacterized protein LOC102715759  82.4    5e-16   
gb|KHN37320.1|  hypothetical protein glysoja_013535                   82.8    5e-16   
ref|XP_002441225.1|  hypothetical protein SORBIDRAFT_09g022720        81.6    1e-15   Sorghum bicolor [broomcorn]
ref|XP_003568285.1|  PREDICTED: uncharacterized protein LOC100835403  81.3    1e-15   
gb|EPS60536.1|  hypothetical protein M569_14268                       80.5    2e-15   
ref|XP_008649715.1|  PREDICTED: uncharacterized protein LOC103630439  80.9    2e-15   
ref|XP_007142706.1|  hypothetical protein PHAVU_007G010000g           82.8    2e-15   
ref|XP_009420078.1|  PREDICTED: uncharacterized protein LOC103999903  80.5    2e-15   
ref|XP_009804272.1|  PREDICTED: uncharacterized protein LOC104249...  80.5    3e-15   
gb|EMT33812.1|  hypothetical protein F775_28626                       81.6    3e-15   
ref|XP_008447483.1|  PREDICTED: uncharacterized protein LOC103489916  79.3    5e-15   
ref|XP_009397500.1|  PREDICTED: uncharacterized protein LOC103982326  79.7    6e-15   
ref|XP_006345928.1|  PREDICTED: uncharacterized protein LOC102600...  79.3    8e-15   
ref|XP_009143317.1|  PREDICTED: uncharacterized protein LOC103867041  79.0    1e-14   
ref|XP_004302795.1|  PREDICTED: uncharacterized protein LOC101310...  80.1    1e-14   
gb|EPS58057.1|  hypothetical protein M569_16760                       78.6    1e-14   
ref|XP_010260037.1|  PREDICTED: uncharacterized protein LOC104599...  80.1    1e-14   
ref|XP_004961827.1|  PREDICTED: uncharacterized protein LOC101776577  78.2    2e-14   
ref|XP_011094801.1|  PREDICTED: uncharacterized protein LOC105174...  78.6    2e-14   
ref|XP_008788054.1|  PREDICTED: uncharacterized protein LOC103705925  77.8    2e-14   
ref|XP_006646464.1|  PREDICTED: uncharacterized protein LOC102710086  77.8    2e-14   
gb|KHN20281.1|  hypothetical protein glysoja_023844                   76.3    8e-14   
gb|EMT28184.1|  hypothetical protein F775_19095                       76.6    8e-14   
ref|XP_003558209.1|  PREDICTED: uncharacterized protein LOC100821340  76.3    9e-14   
ref|XP_007144475.1|  hypothetical protein PHAVU_007G159200g           77.0    9e-14   
gb|EMS54926.1|  hypothetical protein TRIUR3_13829                     76.3    1e-13   
ref|XP_006844259.1|  hypothetical protein AMTR_s00145p00032450        75.9    1e-13   
ref|XP_010315066.1|  PREDICTED: uncharacterized protein LOC104645376  74.7    1e-13   
ref|XP_006301364.1|  hypothetical protein CARUB_v10021775mg           75.5    2e-13   
ref|NP_001049737.1|  Os03g0280400                                     74.7    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|NP_974722.1|  uncharacterized protein                             74.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649869.1|  PREDICTED: uncharacterized protein LOC102720412  74.7    2e-13   
ref|XP_002533007.1|  conserved hypothetical protein                   73.9    4e-13   Ricinus communis
ref|NP_189541.1|  uncharacterized protein                             74.3    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004970506.1|  PREDICTED: uncharacterized protein LOC101783...  76.3    5e-13   
emb|CDY20432.1|  BnaC04g06120D                                        73.9    5e-13   
emb|CDY72004.1|  BnaCnng75530D                                        72.4    1e-12   
gb|ABK21648.1|  unknown                                               72.8    1e-12   Picea sitchensis
dbj|BAJ92977.1|  predicted protein                                    73.2    2e-12   
ref|XP_009419268.1|  PREDICTED: uncharacterized protein LOC103999...  72.4    2e-12   
ref|XP_006345929.1|  PREDICTED: uncharacterized protein LOC102600...  72.8    2e-12   
ref|XP_007009559.1|  Plant protein 1589 of Uncharacterized protei...  71.6    3e-12   
ref|XP_004984769.1|  PREDICTED: uncharacterized protein LOC101775534  71.6    3e-12   
ref|XP_010507116.1|  PREDICTED: uncharacterized protein LOC104783692  71.6    4e-12   
ref|NP_001148858.1|  plant-specific domain TIGR01589 family protein   71.2    4e-12   Zea mays [maize]
ref|NP_001044739.1|  Os01g0837600                                     72.0    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002468074.1|  hypothetical protein SORBIDRAFT_01g039100        70.9    6e-12   Sorghum bicolor [broomcorn]
emb|CDY53585.1|  BnaA05g34580D                                        69.7    1e-11   
ref|XP_002877149.1|  hypothetical protein ARALYDRAFT_905187           70.1    1e-11   
gb|EMS54935.1|  hypothetical protein TRIUR3_28104                     69.3    3e-11   
gb|EMT02558.1|  hypothetical protein F775_03104                       68.6    6e-11   
emb|CDM84877.1|  unnamed protein product                              68.6    6e-11   
ref|NP_001150934.1|  LOC100284567                                     67.8    1e-10   Zea mays [maize]
ref|XP_008678773.1|  PREDICTED: LOC100284567 isoform X1               67.4    1e-10   
ref|XP_002456605.1|  hypothetical protein SORBIDRAFT_03g039210        68.9    2e-10   Sorghum bicolor [broomcorn]
ref|XP_010029145.1|  PREDICTED: uncharacterized protein LOC104419238  67.4    2e-10   
ref|XP_008657081.1|  PREDICTED: uncharacterized protein LOC103636...  67.4    2e-10   
ref|XP_006292922.1|  hypothetical protein CARUB_v10019189mg           66.2    3e-10   
ref|NP_001143287.1|  uncharacterized protein LOC100275821             68.2    4e-10   Zea mays [maize]
ref|XP_002521440.1|  conserved hypothetical protein                   66.6    4e-10   Ricinus communis
tpg|DAA56931.1|  TPA: hypothetical protein ZEAMMB73_134028            68.2    4e-10   
ref|XP_007031530.1|  Plant protein 1589 of Uncharacterized protei...  66.2    4e-10   
ref|XP_010029143.1|  PREDICTED: uncharacterized protein LOC104419236  66.2    6e-10   
tpg|DAA56932.1|  TPA: hypothetical protein ZEAMMB73_134028            68.2    6e-10   
ref|XP_010096676.1|  hypothetical protein L484_025425                 66.2    1e-09   
ref|XP_010041988.1|  PREDICTED: uncharacterized protein LOC104430...  65.1    2e-09   
ref|XP_009409534.1|  PREDICTED: uncharacterized protein LOC103991724  63.5    3e-09   
ref|XP_010319543.1|  PREDICTED: uncharacterized protein LOC104646787  62.4    4e-09   
ref|XP_008444348.1|  PREDICTED: uncharacterized protein LOC103487...  63.5    5e-09   
ref|XP_010321370.1|  PREDICTED: uncharacterized protein LOC101266...  63.5    5e-09   
ref|XP_004143067.1|  PREDICTED: uncharacterized protein LOC101211262  63.2    5e-09   
ref|XP_004174137.1|  PREDICTED: uncharacterized LOC101211262          63.5    5e-09   
ref|XP_002312687.1|  hypothetical protein POPTR_0008s19340g           63.5    6e-09   Populus trichocarpa [western balsam poplar]
ref|XP_003564568.1|  PREDICTED: uncharacterized protein LOC100836...  63.2    7e-09   
ref|XP_010248515.1|  PREDICTED: uncharacterized protein LOC104591411  62.8    7e-09   
ref|XP_011034121.1|  PREDICTED: uncharacterized protein LOC105132360  62.4    8e-09   
ref|XP_010321372.1|  PREDICTED: uncharacterized protein LOC101266...  62.4    8e-09   
gb|KHG17414.1|  hypothetical protein F383_00341                       62.0    9e-09   
ref|XP_008657080.1|  PREDICTED: uncharacterized protein LOC103636...  62.8    9e-09   
ref|XP_010321371.1|  PREDICTED: uncharacterized protein LOC101266...  62.0    1e-08   
gb|KHN02407.1|  hypothetical protein glysoja_002431                   61.2    1e-08   
ref|XP_010533945.1|  PREDICTED: uncharacterized protein LOC104809...  62.0    2e-08   
ref|XP_010533943.1|  PREDICTED: uncharacterized protein LOC104809...  62.0    2e-08   
ref|XP_002525392.1|  conserved hypothetical protein                   61.2    4e-08   Ricinus communis
ref|XP_008444347.1|  PREDICTED: uncharacterized protein LOC103487...  60.8    5e-08   
ref|XP_009144424.1|  PREDICTED: uncharacterized protein LOC103868...  60.8    5e-08   
ref|XP_010682527.1|  PREDICTED: uncharacterized protein LOC104897364  60.1    8e-08   
emb|CDP13183.1|  unnamed protein product                              59.7    9e-08   
gb|EMS52401.1|  hypothetical protein TRIUR3_18607                     62.0    9e-08   
ref|XP_002315690.1|  hypothetical protein POPTR_0010s05210g           59.7    9e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011045292.1|  PREDICTED: uncharacterized protein LOC105140247  59.7    9e-08   
ref|XP_010041989.1|  PREDICTED: uncharacterized protein LOC104430...  59.3    9e-08   
ref|XP_006438332.1|  hypothetical protein CICLE_v10033163mg           59.3    1e-07   
ref|XP_009144423.1|  PREDICTED: uncharacterized protein LOC103868...  59.7    1e-07   
gb|KDP26613.1|  hypothetical protein JCGZ_17771                       59.7    1e-07   
ref|XP_007153749.1|  hypothetical protein PHAVU_003G061900g           59.3    1e-07   
gb|KDO82359.1|  hypothetical protein CISIN_1g034241mg                 59.3    1e-07   
ref|XP_008672574.1|  PREDICTED: uncharacterized protein LOC100275...  60.5    1e-07   
gb|KDP46441.1|  hypothetical protein JCGZ_10281                       58.5    2e-07   
ref|XP_008444349.1|  PREDICTED: uncharacterized protein LOC103487...  58.9    2e-07   
emb|CDY20964.1|  BnaA08g25610D                                        62.0    3e-07   
ref|XP_003552028.1|  PREDICTED: uncharacterized protein LOC100784875  58.5    3e-07   
emb|CDY20609.1|  BnaC08g14490D                                        61.6    3e-07   
ref|NP_001238177.1|  uncharacterized protein LOC100306139             58.2    3e-07   
ref|XP_010251198.1|  PREDICTED: uncharacterized protein LOC104593...  58.2    3e-07   
gb|KHN26895.1|  hypothetical protein glysoja_035534                   58.2    3e-07   
emb|CDX93395.1|  BnaA06g06530D                                        58.2    4e-07   
ref|XP_008340067.1|  PREDICTED: uncharacterized protein LOC103403035  57.4    6e-07   
emb|CBI28559.3|  unnamed protein product                              57.4    6e-07   
gb|KDO82358.1|  hypothetical protein CISIN_1g034241mg                 57.4    7e-07   
ref|XP_004509574.1|  PREDICTED: uncharacterized protein LOC101509029  57.4    7e-07   
ref|XP_006438331.1|  hypothetical protein CICLE_v10033163mg           57.4    7e-07   
ref|XP_010651547.1|  PREDICTED: uncharacterized protein LOC104879...  57.0    8e-07   
ref|NP_001117263.1|  uncharacterized protein                          57.0    9e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417439.1|  hypothetical protein EUTSA_v10009171mg           57.0    9e-07   
ref|XP_010044610.1|  PREDICTED: uncharacterized protein LOC104433...  57.0    1e-06   
ref|XP_010044609.1|  PREDICTED: uncharacterized protein LOC104433...  57.0    1e-06   
ref|XP_010044608.1|  PREDICTED: uncharacterized protein LOC104433...  57.0    1e-06   
ref|XP_007226033.1|  hypothetical protein PRUPE_ppa013869mg           56.2    1e-06   
ref|XP_008389679.1|  PREDICTED: uncharacterized protein LOC103451994  56.2    2e-06   
gb|ABK28322.1|  unknown                                               56.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010251197.1|  PREDICTED: uncharacterized protein LOC104593...  56.2    2e-06   
gb|EPS59396.1|  hypothetical protein M569_15415                       55.8    2e-06   
ref|XP_010232537.1|  PREDICTED: uncharacterized protein LOC100836...  56.2    2e-06   
ref|NP_001077507.1|  uncharacterized protein                          55.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011086590.1|  PREDICTED: uncharacterized protein LOC105168272  55.8    3e-06   
gb|EYU22507.1|  hypothetical protein MIMGU_mgv1a019504mg              55.5    3e-06   
ref|XP_009148409.1|  PREDICTED: uncharacterized protein LOC103871848  55.5    3e-06   
ref|XP_006304323.1|  hypothetical protein CARUB_v10010722mg           55.5    4e-06   
emb|CDY37956.1|  BnaC05g08180D                                        55.1    4e-06   
gb|ABK26763.1|  unknown                                               55.5    5e-06   Picea sitchensis
ref|XP_002889822.1|  hypothetical protein ARALYDRAFT_471189           54.7    5e-06   
ref|XP_006417438.1|  hypothetical protein EUTSA_v10009171mg           54.3    7e-06   
ref|NP_001117262.1|  uncharacterized protein                          54.3    8e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007044697.1|  Plant protein 1589 of Uncharacterized protei...  54.3    1e-05   
ref|XP_010458425.1|  PREDICTED: uncharacterized protein LOC104739688  53.9    1e-05   
ref|XP_006840678.1|  hypothetical protein AMTR_s00096p00053280        53.5    1e-05   
ref|NP_001077506.1|  uncharacterized protein                          53.9    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475942.1|  PREDICTED: uncharacterized protein LOC104755287  53.5    1e-05   
gb|ABF59197.1|  unknown protein                                       53.9    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009799430.1|  PREDICTED: uncharacterized protein LOC104245511  53.5    2e-05   
ref|XP_004238655.1|  PREDICTED: uncharacterized protein LOC101248387  53.1    2e-05   
ref|XP_008221877.1|  PREDICTED: uncharacterized protein LOC103321817  54.7    2e-05   
ref|XP_010923199.1|  PREDICTED: uncharacterized protein LOC105046338  53.1    2e-05   
emb|CAB85995.1|  putative protein                                     52.4    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491716.1|  PREDICTED: uncharacterized protein LOC104769248  52.0    5e-05   
gb|ABK25449.1|  unknown                                               52.4    5e-05   Picea sitchensis
emb|CBI33165.3|  unnamed protein product                              50.8    6e-05   
ref|XP_010651551.1|  PREDICTED: uncharacterized protein LOC104879...  51.2    6e-05   
ref|XP_009621064.1|  PREDICTED: uncharacterized protein LOC104112...  51.2    7e-05   
ref|XP_006356431.1|  PREDICTED: uncharacterized protein LOC102588...  51.2    7e-05   
ref|XP_006356430.1|  PREDICTED: uncharacterized protein LOC102588...  50.8    1e-04   
dbj|BAG98245.1|  unnamed protein product                              50.1    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008791190.1|  PREDICTED: uncharacterized protein LOC103708168  50.8    1e-04   
ref|XP_002978259.1|  hypothetical protein SELMODRAFT_443776           53.1    3e-04   
ref|XP_002963248.1|  hypothetical protein SELMODRAFT_69881            48.9    3e-04   
gb|ACG49230.1|  hypothetical protein                                  49.7    4e-04   
ref|XP_006417437.1|  hypothetical protein EUTSA_v10009171mg           48.9    4e-04   
ref|XP_006417436.1|  hypothetical protein EUTSA_v10009171mg           48.5    6e-04   



>ref|XP_009791297.1| PREDICTED: uncharacterized protein LOC104238596 [Nicotiana sylvestris]
Length=123

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 6/103 (6%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+SA+YIHMV HLIEEC++FKM++EECMEALSKHANIQP+ITSTVWKELEKENKEFFE
Sbjct  1    MSDSSAQYIHMVQHLIEECIIFKMNREECMEALSKHANIQPIITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEI------METTRQKVEKMVLGSWKKDPKDEA  584
            AY K   E+S+ I      +ETTRQ++  M+L S  KD  ++ 
Sbjct  61   AYNKTRVEKSSSILSAESQLETTRQRIHNMLLDSSSKDSNEKV  103



>ref|XP_006339039.1| PREDICTED: uncharacterized protein LOC102598663 [Solanum tuberosum]
Length=106

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 80/99 (81%), Gaps = 11/99 (11%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA+YIH+VHHLIEECL+F MS+EECMEALSKHANIQP+ITSTVWKELEKENKEFFE
Sbjct  1    MGDSSAQYIHLVHHLIEECLLFNMSREECMEALSKHANIQPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEI-----------METTRQKVEKMVLGS  611
            +YKK+ ++E +             +E TRQ++ KM+L S
Sbjct  61   SYKKKNKDEESTTTNNNNNNIESKVEITRQRIHKMLLDS  99



>ref|XP_007207580.1| hypothetical protein PRUPE_ppa018485mg [Prunus persica]
 gb|EMJ08779.1| hypothetical protein PRUPE_ppa018485mg [Prunus persica]
Length=99

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIHMVHHLIEEC++F MSKEECMEALSKHANI+P+ITSTVWKELEKENKEFFE
Sbjct  1    MGDSSASYIHMVHHLIEECIIFNMSKEECMEALSKHANIKPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVL  617
            AY K  RE  A  ME T+Q++EKM+ 
Sbjct  61   AYTK-NRETRASEMEITKQRIEKMLF  85



>ref|XP_009613439.1| PREDICTED: uncharacterized protein LOC104106573 [Nicotiana tomentosiformis]
Length=103

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%), Gaps = 6/100 (6%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+S++YIHMVHHLIEECL+F M++EECM+ALSKHANIQP+ITSTVWKELEKENKEFFE
Sbjct  1    MGDSSSQYIHMVHHLIEECLLFNMTREECMKALSKHANIQPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEI-----METTRQKVEKMVLGSWKKDPKD  590
            AY K  REE +       ME TRQ++  M+L S  KD  +
Sbjct  61   AYNK-PREEGSSTGTESQMEITRQRIHDMLLDSSSKDTNE  99



>ref|XP_008241603.1| PREDICTED: uncharacterized protein LOC103340015 [Prunus mume]
Length=100

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIHMVHHLIEEC++F MSKEECMEALSKHANI+P+ITSTVWKELEKENKEFFE
Sbjct  1    MGDSSASYIHMVHHLIEECIIFNMSKEECMEALSKHANIKPIITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVL  617
            AY K  RE  A  ME T+Q++EKM+ 
Sbjct  61   AYTK-NREARAFEMEITKQRIEKMLF  85



>ref|XP_009609527.1| PREDICTED: uncharacterized protein LOC104103332 isoform X1 [Nicotiana 
tomentosiformis]
Length=100

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 4/99 (4%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+SA+YIHMV HLIEEC++FKMS+EECMEAL+KHANIQP+ITSTVWKELEKENKEFFE
Sbjct  1    MSDSSAQYIHMVQHLIEECIIFKMSREECMEALAKHANIQPIITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEI---METTRQKVEKMV-LGSWKKDPKD  590
            AY K   E+S+     +ETTRQ++  M+ L S   D  D
Sbjct  61   AYNKTREEKSSSAESQLETTRQRIHNMLMLDSSSTDSID  99



>ref|XP_010037878.1| PREDICTED: uncharacterized protein LOC104426502 [Eucalyptus grandis]
Length=97

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+S+ YI MVHHLIEEC++FKMSKEECMEALSKHANI+P+ITSTVWKELEKENKEFFE
Sbjct  1    MGDSSSSYIRMVHHLIEECILFKMSKEECMEALSKHANIEPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWK  605
            AY +  REE       TRQ+++KM+  + K
Sbjct  61   AYARSMREEERGSRAETRQRIQKMLSDASK  90



>ref|XP_009803697.1| PREDICTED: uncharacterized protein LOC104249026 [Nicotiana sylvestris]
Length=103

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 6/97 (6%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+S++YIHMVHHLIEECL+F MS+EECM+ALSKHANIQP+ITSTVWKELEKENKEFFE
Sbjct  1    MSDSSSQYIHMVHHLIEECLLFNMSREECMKALSKHANIQPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEI-----METTRQKVEKMVLGSWKKD  599
            AYKK+ REE +       ME T Q++  ++L S  KD
Sbjct  61   AYKKR-REEGSSTSTESQMEITTQRIHNILLESSYKD  96



>gb|KDO37054.1| hypothetical protein CISIN_1g034494mg [Citrus sinensis]
Length=93

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 76/88 (86%), Gaps = 2/88 (2%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+SA YIH+VHHLIEECL+F MSKEECMEALSKHANI+P+ITSTVWKELEKENKEFFE
Sbjct  1    MDDSSASYIHLVHHLIEECLVFNMSKEECMEALSKHANIKPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGS  611
            AY ++  E  A +ME TR+++EKM+  S
Sbjct  61   AYARKNAER-ATVME-TRERIEKMLANS  86



>gb|KHG20981.1| Argininosuccinate lyase [Gossypium arboreum]
Length=93

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 78/95 (82%), Gaps = 2/95 (2%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIHMVHHLIEECL+F MSKEECMEALSKHAN++P+ITSTVW EL+KENKEFFE
Sbjct  1    MGDSSASYIHMVHHLIEECLIFNMSKEECMEALSKHANVKPVITSTVWNELQKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
            AY K GR++ A I    RQ+++  +  S K++ K+
Sbjct  61   AYIK-GRDQRA-IEVEQRQRIQTQLNASIKENQKN  93



>gb|KCW49658.1| hypothetical protein EUGRSUZ_K03172, partial [Eucalyptus grandis]
Length=156

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+S+ YI MVHHLIEEC++FKMSKEECMEALSKHANI+P+ITSTVWKELEKENKEFFE
Sbjct  60   MGDSSSSYIRMVHHLIEECILFKMSKEECMEALSKHANIEPVITSTVWKELEKENKEFFE  119

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWK  605
            AY +  REE       TRQ+++KM+  + K
Sbjct  120  AYARSMREEERGSRAETRQRIQKMLSDASK  149



>ref|XP_006429003.1| hypothetical protein CICLE_v10013206mg [Citrus clementina]
 ref|XP_006480731.1| PREDICTED: uncharacterized protein LOC102617692 [Citrus sinensis]
 gb|ESR42243.1| hypothetical protein CICLE_v10013206mg [Citrus clementina]
 gb|KDO44113.1| hypothetical protein CISIN_1g034486mg [Citrus sinensis]
Length=93

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 76/88 (86%), Gaps = 2/88 (2%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+SA YIH+VHHLIEECL+F MSKEECMEALSKHANI+P+ITSTVWKELEKENKEFFE
Sbjct  1    MDDSSASYIHLVHHLIEECLVFNMSKEECMEALSKHANIKPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGS  611
            AY ++   E A +ME TR+++EK++  S
Sbjct  61   AYARKN-AERATVME-TRERIEKILANS  86



>ref|XP_004249525.1| PREDICTED: MATH and LRR domain-containing protein PFE0570w-like 
[Solanum lycopersicum]
Length=109

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 77/102 (75%), Gaps = 14/102 (14%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA+YIH+VH LIEECL+F MS+EECMEALSKHANIQP+ITSTVWKELEKENKEFF+
Sbjct  1    MGDSSAQYIHLVHRLIEECLLFNMSREECMEALSKHANIQPVITSTVWKELEKENKEFFK  60

Query  694  AYKKQGREESA--------------EIMETTRQKVEKMVLGS  611
            +YKK+  +E +                +E TRQ++  ++L S
Sbjct  61   SYKKKDEDEESTSINNNNNNNNIIESKVEITRQRIHNLLLNS  102



>ref|XP_008369842.1| PREDICTED: uncharacterized protein LOC103433368 [Malus domestica]
Length=107

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIH+VHHLIEEC++F MSKEECME LSKHANI+P+ITSTVWKELEKEN+EFFE
Sbjct  1    MGDSSASYIHLVHHLIEECIIFNMSKEECMETLSKHANIKPIITSTVWKELEKENREFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVL  617
            AY K     S+E++  T+Q+++KM+ 
Sbjct  61   AYTKSREAGSSEMV--TKQRIQKMLF  84



>ref|XP_009341600.1| PREDICTED: uncharacterized protein LOC103933636 [Pyrus x bretschneideri]
Length=105

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIH+V HLIEEC++F MSKEECMEALSKHANI+P+ITSTVWKELEKENKEFFE
Sbjct  1    MGDSSASYIHLVQHLIEECIIFNMSKEECMEALSKHANIKPIITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVL  617
            AY K     S+E++  T Q+++KM+ 
Sbjct  61   AYNKSREARSSEMV--TEQRIQKMLF  84



>ref|XP_006345666.1| PREDICTED: uncharacterized protein LOC102590633 [Solanum tuberosum]
Length=102

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 80/101 (79%), Gaps = 6/101 (6%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+S++YIHMV HLIE+C++F MS+EECM+ALSKHANIQP+ITSTVWKELEKENKEFFE
Sbjct  1    MGDSSSQYIHMVQHLIEKCIIFNMSQEECMDALSKHANIQPIITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREE--SAEI---METTRQKVEKMVL-GSWKKDPKD  590
            AY K+  E   SA I   +E TRQ++  ++L  S  KD  D
Sbjct  61   AYNKKRGEAKISASIHDELEMTRQRIHNIMLDSSSNKDSND  101



>ref|XP_009377113.1| PREDICTED: uncharacterized protein LOC103965762 [Pyrus x bretschneideri]
Length=105

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIH+VH LIEEC++F MSKEECMEALSKHANI+P+ITSTVWKELEKEN+EFFE
Sbjct  1    MGDSSASYIHLVHRLIEECIIFNMSKEECMEALSKHANIKPIITSTVWKELEKENREFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVL  617
            AY K     S+E +  T+Q+++KM+ 
Sbjct  61   AYTKSREAGSSETV--TKQRIQKMLF  84



>ref|XP_004246743.1| PREDICTED: uncharacterized protein LOC101246275 [Solanum lycopersicum]
Length=103

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 80/101 (79%), Gaps = 6/101 (6%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+S++YIHMV HLIEEC++F MS+EECM+ALSKHANIQP+ITSTVWKELEKENKEFFE
Sbjct  1    MGDSSSQYIHMVQHLIEECIIFNMSQEECMDALSKHANIQPIITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESA-----EIMETTRQKVEKMVL-GSWKKDPKD  590
            AY K+ RE        + +E +RQ++  ++L  S  KD K+
Sbjct  61   AYNKKTREARRPSSIHDELEMSRQRIHCIMLDSSSNKDSKE  101



>gb|EYU41673.1| hypothetical protein MIMGU_mgv1a017010mg [Erythranthe guttata]
Length=97

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 2/93 (2%)
 Frame = -1

Query  874  MG-DASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MG ++SA+YIHMV HLIEEC++F MSKEECMEALSKHANI P+ITSTVWKELEKENKEFF
Sbjct  1    MGSESSAQYIHMVQHLIEECIVFNMSKEECMEALSKHANITPVITSTVWKELEKENKEFF  60

Query  697  EAYKKQGREESAEIMET-TRQKVEKMVLGSWKK  602
            E+Y K+  E+S+   ET T Q+++ ++L S KK
Sbjct  61   ESYTKKREEKSSSDQETETSQRIQNILLDSSKK  93



>ref|XP_006436116.1| hypothetical protein CICLE_v10033177mg [Citrus clementina]
 ref|XP_006486020.1| PREDICTED: uncharacterized protein LOC102621417 [Citrus sinensis]
 gb|ESR49356.1| hypothetical protein CICLE_v10033177mg [Citrus clementina]
Length=95

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MG++SA YIHMV HLIE+CL+F+M+KEECMEALSKHANI+P+ITSTVW ELEKENKEFFE
Sbjct  1    MGESSASYIHMVQHLIEKCLIFRMTKEECMEALSKHANIKPVITSTVWNELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
            AY +   +E     E T Q ++KM+  +  K   D
Sbjct  61   AYAQSQSKEDRMSEEETNQMIQKMISTNSSKSQND  95



>ref|XP_007027122.1| Plant protein 1589 of Uncharacterized protein function [Theobroma 
cacao]
 gb|EOY07624.1| Plant protein 1589 of Uncharacterized protein function [Theobroma 
cacao]
Length=95

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 74/89 (83%), Gaps = 2/89 (2%)
 Frame = -1

Query  871  GDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEA  692
            GD+SA YIHMVHHLIEECL+F MSKEEC+EALSKHANI+P+ITSTVW ELEKENKEFFEA
Sbjct  3    GDSSASYIHMVHHLIEECLIFNMSKEECIEALSKHANIKPVITSTVWNELEKENKEFFEA  62

Query  691  YKKQGREESAEIMETTRQKVEKMVLGSWK  605
            Y + GR++ A  +E  RQ+++  +  S +
Sbjct  63   YTR-GRDQRATEIE-KRQRIQSRLKASMR  89



>ref|XP_002282451.1| PREDICTED: uncharacterized protein LOC100244913 [Vitis vinifera]
 emb|CBI33167.3| unnamed protein product [Vitis vinifera]
Length=110

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIHMV HLIE CL+F MSKEECMEALSKHANI+P+ITSTVW ELEKENKEFFE
Sbjct  1    MGDSSASYIHMVQHLIENCLIFHMSKEECMEALSKHANIEPVITSTVWNELEKENKEFFE  60

Query  694  AYKKQGREESAEIMET-TRQKVEKMVLGSWKKD  599
             Y  Q + +   + E  T + ++KM+  S  KD
Sbjct  61   GYNTQTQTKDDRLSEAETDELIQKMISDSTSKD  93



>ref|XP_008359705.1| PREDICTED: uncharacterized protein LOC103423410 [Malus domestica]
Length=105

 Score = 98.6 bits (244),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIH+VHHLIEEC++F MSKEECMEALSK ANI+P+ITSTVWKELEKENKEFFE
Sbjct  1    MGDSSASYIHLVHHLIEECIIFYMSKEECMEALSKRANIKPIITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVL  617
            AY K     S+E++  T Q+ +KM+ 
Sbjct  61   AYXKSREARSSEMV--TEQRSQKMLF  84



>ref|XP_002523034.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39338.1| conserved hypothetical protein [Ricinus communis]
Length=99

 Score = 98.6 bits (244),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIHMV HLIE+CL+F M+KEECMEALSKHANI P+ITSTVW ELEKENKEFFE
Sbjct  1    MGDSSASYIHMVQHLIEKCLIFHMTKEECMEALSKHANITPVITSTVWNELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKDE  587
            AY +  R++     E T Q ++KM+  S  KD  D+
Sbjct  61   AYIESKRKDDRMSEEETSQMIQKMISES-SKDSDDQ  95



>ref|XP_004302796.1| PREDICTED: uncharacterized protein LOC101310911 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=106

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MGD+S A YIHMVHHLIEEC++F M++EECMEALSKHA I+P+ITSTVWKELEKENKEFF
Sbjct  1    MGDSSSASYIHMVHHLIEECIIFNMTREECMEALSKHAKIKPIITSTVWKELEKENKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKDEA  584
            EAY    RE + E     +Q+++KM+ G   K   DE+
Sbjct  61   EAY-TNSREAARESKTERKQRIQKMLSGHLSKTDTDES  97



>ref|XP_002533662.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28721.1| conserved hypothetical protein [Ricinus communis]
Length=98

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YI MV HLIE CL+F+M+KEECMEALSKHANI P+ITSTVW ELEKENKEFFE
Sbjct  1    MGDSSASYIRMVQHLIERCLIFRMTKEECMEALSKHANITPVITSTVWNELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKDEA  584
             Y +   ++     E T Q ++KMVL    +DP D+ 
Sbjct  61   VYAQSKSKDDRMSDEETTQMIQKMVLEP-SRDPDDQT  96



>gb|KHG20463.1| hypothetical protein F383_06911 [Gossypium arboreum]
 gb|KHG23344.1| hypothetical protein F383_05682 [Gossypium arboreum]
Length=90

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 2/83 (2%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YI++V HLIEECL+F MSKEECMEALSKHANI+P+ITSTVW ELEKENKEFFE
Sbjct  1    MGDSSASYINLVQHLIEECLIFNMSKEECMEALSKHANIKPVITSTVWDELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEK  626
            AY K GR++ A  +E  RQ+++K
Sbjct  61   AYIK-GRDQRATEIE-KRQRIQK  81



>gb|ACJ86173.1| unknown [Medicago truncatula]
 gb|AFK35764.1| unknown [Medicago truncatula]
 gb|KEH24000.1| hypothetical protein MTR_7g100335 [Medicago truncatula]
Length=88

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 72/90 (80%), Gaps = 2/90 (2%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+SA YIH+VH LIEEC++F MSKEECM+ALSKHANI+P+ITSTVWKELEKENKEFFE
Sbjct  1    MEDSSAAYIHLVHRLIEECILFNMSKEECMDALSKHANIKPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWK  605
            AY +   E ++E     RQ++  MVL S K
Sbjct  61   AYLRNRAERASET--EMRQRIRNMVLDSSK  88



>ref|XP_004168103.1| PREDICTED: uncharacterized LOC101208991 [Cucumis sativus]
Length=95

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+S+ YIHMV HLIE+CL+F M+KEECM+ALSKHA+I+P+ITSTVW ELEKENKEFFE
Sbjct  1    MADSSSSYIHMVQHLIEKCLIFHMTKEECMDALSKHADIKPIITSTVWNELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
            AY +          E T Q ++KM+  S K DPK+
Sbjct  61   AYAQSHNNSDRMSEEETSQMIQKMISDSGKGDPKN  95



>ref|XP_004493904.1| PREDICTED: uncharacterized protein LOC101501264 [Cicer arietinum]
Length=89

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 2/91 (2%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+ A YIH+VH LIEEC++F M+KEECMEALSKHANI+P+ITSTVWKELEKENKEFFE
Sbjct  1    MEDSPAAYIHLVHRLIEECILFNMNKEECMEALSKHANIKPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWKK  602
            AY +   E+++E    TRQ++  MVL   KK
Sbjct  61   AYLRSRAEKASET--ETRQRIRNMVLDYSKK  89



>ref|XP_011019249.1| PREDICTED: uncharacterized protein LOC105122044 [Populus euphratica]
Length=82

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIHMVHHLIEEC++F MSKEECMEALSKHANI+P+ITSTVWKELEKENKEFFE
Sbjct  1    MGDSSASYIHMVHHLIEECIIFNMSKEECMEALSKHANIKPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAE  659
            AY+K+  E++ +
Sbjct  61   AYEKRRGEKAVQ  72



>ref|XP_008463517.1| PREDICTED: uncharacterized protein LOC103501658 [Cucumis melo]
 ref|XP_008463518.1| PREDICTED: uncharacterized protein LOC103501658 [Cucumis melo]
 ref|XP_008463520.1| PREDICTED: uncharacterized protein LOC103501658 [Cucumis melo]
 ref|XP_008463521.1| PREDICTED: uncharacterized protein LOC103501658 [Cucumis melo]
 ref|XP_008463522.1| PREDICTED: uncharacterized protein LOC103501658 [Cucumis melo]
 ref|XP_008463523.1| PREDICTED: uncharacterized protein LOC103501658 [Cucumis melo]
Length=95

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+S+ YIHMV HLIE+CL+F M+KEECM ALSKHA+I+P+ITSTVW ELEKENKEFFE
Sbjct  1    MADSSSSYIHMVQHLIEKCLIFHMTKEECMNALSKHADIKPIITSTVWSELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
            AY +          E T Q ++KM+  S K DPK+
Sbjct  61   AYAQSHNNSDRMSEEETSQMIQKMISDSGKGDPKN  95



>ref|XP_010096673.1| hypothetical protein L484_025422 [Morus notabilis]
 gb|EXB65341.1| hypothetical protein L484_025422 [Morus notabilis]
Length=94

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIHMV HLIE+CL+F+M+KEECMEALSKHANI+P+ITSTVW ELEKENKEFFE
Sbjct  1    MGDSSASYIHMVQHLIEKCLIFRMNKEECMEALSKHANIKPVITSTVWNELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMV  620
            AY +   +E     E T Q ++KM 
Sbjct  61   AYAQSQSKEDKMSEEETSQMIQKMF  85



>ref|XP_007009555.1| Plant protein 1589 of Uncharacterized protein function [Theobroma 
cacao]
 gb|EOY18365.1| Plant protein 1589 of Uncharacterized protein function [Theobroma 
cacao]
Length=94

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 4/95 (4%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+S+ YIHMV HLIE+CL+FKM+KEECMEALSKHA+I+P+ITSTVW ELEKENKEFFE
Sbjct  1    MGDSSSSYIHMVQHLIEKCLIFKMTKEECMEALSKHASIEPVITSTVWNELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
            AY +   ++     E T Q ++KM+  S    PKD
Sbjct  61   AYAQSQSKQDRMSEEETSQMIQKMISDS----PKD  91



>gb|AFK45002.1| unknown [Lotus japonicus]
Length=92

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MGD+S A YIH+VH LIEEC++F MSKEECMEALSKHANIQP+ITSTVWKELEKENKEFF
Sbjct  1    MGDSSSAAYIHLVHRLIEECILFNMSKEECMEALSKHANIQPVITSTVWKELEKENKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMV  620
            EAY +   E  A   E TRQ+++ M+
Sbjct  61   EAYSRSRAEIRASETE-TRQRIQNMI  85



>ref|XP_004150990.1| PREDICTED: uncharacterized protein LOC101208991 [Cucumis sativus]
 gb|KGN51261.1| hypothetical protein Csa_5G505220 [Cucumis sativus]
Length=95

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+S+ Y+HMV HLIE+CL+F M+KEECM+ALSKHA+I+P+ITSTVW ELEKENKEFFE
Sbjct  1    MADSSSSYMHMVQHLIEKCLIFHMTKEECMDALSKHADIKPIITSTVWNELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
            AY +          E T Q ++KM+  S K DPK+
Sbjct  61   AYAQSHNNSDRMSEEETSQMIQKMISDSGKGDPKN  95



>ref|XP_002308479.1| hypothetical protein POPTR_0006s23000g [Populus trichocarpa]
 gb|EEE92002.1| hypothetical protein POPTR_0006s23000g [Populus trichocarpa]
Length=82

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIHMVHHLIEEC++F MSKEECMEALSKHA+I+P+ITSTVWKELEKENKEFFE
Sbjct  1    MGDSSASYIHMVHHLIEECIIFNMSKEECMEALSKHADIKPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAE  659
            AY+K+  E++ +
Sbjct  61   AYEKRRGEKAVQ  72



>emb|CDP00027.1| unnamed protein product [Coffea canephora]
Length=108

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIHMV HLIEECL+F MSKEECMEALSKHANI P+IT+TVW ELEKENKEFFE
Sbjct  1    MGDSSASYIHMVQHLIEECLIFNMSKEECMEALSKHANITPVITATVWNELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMV  620
            AY +  ++E       T   ++K+V
Sbjct  61   AYSRSRKKEDRMSETETNAMIQKIV  85



>ref|XP_011027103.1| PREDICTED: uncharacterized protein LOC105127482 [Populus euphratica]
Length=101

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIHMV HLIE+CL+F M+KEECMEALSKHANI+P+ITSTVWKELEKENKEFFE
Sbjct  1    MGDSSASYIHMVQHLIEKCLIFNMTKEECMEALSKHANIEPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMV  620
            AY +   ++     E T + +++M+
Sbjct  61   AYAQSKSKDDRMSEEETSRVIQRMI  85



>ref|XP_011077432.1| PREDICTED: uncharacterized protein LOC105161438 [Sesamum indicum]
Length=111

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 66/70 (94%), Gaps = 2/70 (3%)
 Frame = -1

Query  874  MG-DASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MG D+SA+YIHMV HLIEEC++F MSKEECMEALSKHANIQP+ITSTVWKELEKENKEFF
Sbjct  1    MGSDSSAKYIHMVQHLIEECIVFNMSKEECMEALSKHANIQPVITSTVWKELEKENKEFF  60

Query  697  EAYKKQGREE  668
            EAY+K+ REE
Sbjct  61   EAYRKR-REE  69



>ref|XP_007139279.1| hypothetical protein PHAVU_008G015900g [Phaseolus vulgaris]
 gb|ESW11273.1| hypothetical protein PHAVU_008G015900g [Phaseolus vulgaris]
Length=98

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -1

Query  871  GDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEA  692
             ++SA YIHMVHHLIE+CL+F MSKEECMEALSKHANI+P+ITSTVWKELEKENKEFFE 
Sbjct  5    SNSSASYIHMVHHLIEKCLIFHMSKEECMEALSKHANIKPVITSTVWKELEKENKEFFEE  64

Query  691  YKKQGREESAEIMETTRQKVEKMVLGSWK  605
            Y K   +E     E T Q ++KM+  S K
Sbjct  65   YAKAKSKEDRMSEEETSQMIQKMISDSTK  93



>ref|XP_006378740.1| hypothetical protein POPTR_0010s21830g [Populus trichocarpa]
 gb|ERP56537.1| hypothetical protein POPTR_0010s21830g [Populus trichocarpa]
Length=101

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIHMV HLIE+CL+F M+KEECMEALSKHANI+P+ITSTVWKELEKENKEFFE
Sbjct  1    MGDSSASYIHMVQHLIEKCLIFNMTKEECMEALSKHANIEPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMV  620
            AY +   ++     E T + +++M+
Sbjct  61   AYAQSKSKDDRMSEEETSRVIQRMI  85



>ref|XP_009374695.1| PREDICTED: uncharacterized protein LOC103963586 [Pyrus x bretschneideri]
Length=116

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 73/97 (75%), Gaps = 13/97 (13%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITST-----------VWk  728
            MGD+SA YIH+V HLIEEC++F MSKEECMEALSKHANI+P+ITST           VWK
Sbjct  1    MGDSSASYIHLVQHLIEECIIFNMSKEECMEALSKHANIKPIITSTLINGLTDQLTAVWK  60

Query  727  elekenkeffEAYKKQGREESAEIMETTRQKVEKMVL  617
            ELEKENKEFFEAY K     S+E++  T Q+++KM+ 
Sbjct  61   ELEKENKEFFEAYNKSREARSSEMV--TEQRIQKMLF  95



>gb|KHG22424.1| Argininosuccinate lyase [Gossypium arboreum]
Length=96

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+SA YIHMVHHLIEECL+F MSKEECMEALSKHA+++P+ITSTVW ELEKENKEFFE
Sbjct  3    MDDSSASYIHMVHHLIEECLIFNMSKEECMEALSKHASVKPVITSTVWNELEKENKEFFE  62

Query  694  AYKKQGREESAEIME  650
            AY +  R++ A  ME
Sbjct  63   AYTR-NRDQRATDME  76



>ref|XP_010669812.1| PREDICTED: uncharacterized protein LOC104886949 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=94

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+S+ YIHMV HLIE+CL+F M+KEECMEALSKHA+I+P+ITSTVW ELEKENK+FF+
Sbjct  1    MDDSSSSYIHMVQHLIEKCLIFHMTKEECMEALSKHADIKPVITSTVWNELEKENKDFFD  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
             Y K   EE       T + ++KM+  S  KD KD
Sbjct  61   NYSKSKNEEDRMSEAETSEMIQKMISDS-SKDSKD  94



>ref|XP_006361434.1| PREDICTED: uncharacterized protein LOC102592404 [Solanum tuberosum]
Length=102

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  865  ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYK  686
            +SA YIHMV HLIE+CL++KM+KEECMEALSKHANI+P+IT+TVWKELEKENKEFFE YK
Sbjct  6    SSASYIHMVQHLIEKCLIYKMTKEECMEALSKHANIKPVITATVWKELEKENKEFFEEYK  65

Query  685  KQGREESAEIMETTRQKVEKMVLGSWKKDPKDEA  584
            +    + +   E T   +EKM+L S +  P  E+
Sbjct  66   ESQNNKDSMTEEETSAMIEKMILDSKEPGPSRES  99



>ref|XP_002278074.1| PREDICTED: uncharacterized protein LOC100256772 [Vitis vinifera]
 emb|CBI32670.3| unnamed protein product [Vitis vinifera]
Length=94

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MG++SA YIHMV  LIEEC++F MS+EECMEALSKHA+I+P+ITSTVWKELEKENKEFFE
Sbjct  1    MGESSASYIHMVQRLIEECIIFNMSREECMEALSKHADIKPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
            +Y K  RE     ME TR+  + M+  S ++D  +
Sbjct  61   SYAK-SREARGSDME-TRENFQNMLSDSSERDTSE  93



>ref|XP_007219284.1| hypothetical protein PRUPE_ppa018490mg [Prunus persica]
 gb|EMJ20483.1| hypothetical protein PRUPE_ppa018490mg [Prunus persica]
Length=95

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+SA YIH+VHHLIE CL+F M+KE+CMEALSKHANI+P+ITSTVW EL KENKEFFE
Sbjct  1    MADSSATYIHLVHHLIETCLIFHMTKEDCMEALSKHANIKPVITSTVWNELAKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWK  605
            AY +   ++ A   E T Q +   +  S K
Sbjct  61   AYAQSTNKQDAMSEEETSQLIRSTIQESSK  90



>ref|XP_004142092.1| PREDICTED: uncharacterized protein LOC101219487 [Cucumis sativus]
 ref|XP_004168691.1| PREDICTED: uncharacterized protein LOC101227153 [Cucumis sativus]
 gb|KGN54219.1| hypothetical protein Csa_4G293290 [Cucumis sativus]
Length=97

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  868  DASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAY  689
            D SA YIHMVHHLIE+C++F M+KEEC+EALSKHANI+P+ITSTVW ELEKENKEFFEAY
Sbjct  4    DPSASYIHMVHHLIEKCIIFNMTKEECLEALSKHANIEPVITSTVWNELEKENKEFFEAY  63

Query  688  KKQGRE  671
            KK+ R+
Sbjct  64   KKKRRD  69



>ref|XP_007009551.1| Plant protein 1589 of Uncharacterized protein function [Theobroma 
cacao]
 gb|EOY18361.1| Plant protein 1589 of Uncharacterized protein function [Theobroma 
cacao]
Length=94

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+S  YI +V HLIE+CL+FKM+KEECM ALSKHANI+P+ITSTVW ELEKENKEFFE
Sbjct  1    MGDSSQSYIRLVQHLIEKCLIFKMTKEECMVALSKHANIKPVITSTVWNELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWKKDP  596
            AY +   ++     E T Q ++KM+  S  KDP
Sbjct  61   AYAQSQSKQDRMSEEETSQMIQKMISDS-PKDP  92



>ref|XP_009357652.1| PREDICTED: uncharacterized protein LOC103948365 [Pyrus x bretschneideri]
 ref|XP_009335909.1| PREDICTED: uncharacterized protein LOC103928567 [Pyrus x bretschneideri]
Length=94

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 72/96 (75%), Gaps = 3/96 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MGD+S A YIHMV HLIE+CL++ M+KEECMEALSKHANIQP+ITSTVW ELEK NKEFF
Sbjct  1    MGDSSSASYIHMVQHLIEKCLIYHMTKEECMEALSKHANIQPVITSTVWNELEKVNKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
            EAY++   +      E T Q ++KM+  S  KD  D
Sbjct  61   EAYEESQNKGDRMSEEETSQLIQKMISDS--KDSDD  94



>ref|XP_010253343.1| PREDICTED: uncharacterized protein LOC104594647 [Nelumbo nucifera]
Length=90

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MG++SA YI MV HLIE+CL+F M+KEECMEALS+HANI P+ITSTVWKELEKENKEFF+
Sbjct  1    MGESSASYIRMVQHLIEKCLLFHMTKEECMEALSRHANINPVITSTVWKELEKENKEFFD  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGSWKKD  599
            AY K   +E AE+    +Q ++KM+  S   D
Sbjct  61   AYMKSREDEMAEM--EIKQMIQKMISQSSTGD  90



>emb|CDP06660.1| unnamed protein product [Coffea canephora]
Length=101

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 75/97 (77%), Gaps = 4/97 (4%)
 Frame = -1

Query  874  MGDASA--EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkef  701
            M D+S+  EYIH++ HLIEEC++F MSKEECMEAL KHANI+P+IT+TVWKELEKENKEF
Sbjct  1    MADSSSPHEYIHLIQHLIEECILFHMSKEECMEALFKHANIKPVITATVWKELEKENKEF  60

Query  700  fEAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
            FEAY K  REE A   E TRQ+++K +L       KD
Sbjct  61   FEAYTK-DREERASETE-TRQRIQKRMLSLHSSTAKD  95



>ref|XP_002282487.1| PREDICTED: uncharacterized protein LOC100267224 [Vitis vinifera]
 emb|CBI33166.3| unnamed protein product [Vitis vinifera]
Length=93

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YIHMV HLIE+CL+F MSKEECMEALSKHA+I  +ITSTVW ELEKENKEFFE
Sbjct  1    MGDSSASYIHMVQHLIEKCLIFHMSKEECMEALSKHADINQVITSTVWNELEKENKEFFE  60

Query  694  AYKKQGREESAEIMET-TRQKVEKMVLGSWKKD  599
            AY  Q +     + E  T + ++KM+  S   D
Sbjct  61   AYHTQTQTRDDRMSEAETNEMIQKMIADSKDSD  93



>ref|XP_010260038.1| PREDICTED: uncharacterized protein LOC104599268 isoform X2 [Nelumbo 
nucifera]
Length=90

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 2/88 (2%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YI +V HLIE+C++F M+KEEC+EALSKHANI+P+ITSTVWKELEKENKEFFE
Sbjct  1    MGDSSASYIRLVQHLIEKCILFHMTKEECVEALSKHANIKPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGS  611
            AY K      AE+   TRQ ++KM+  S
Sbjct  61   AYTKSREGRMAEM--ETRQMIQKMLSDS  86



>ref|XP_008371124.1| PREDICTED: uncharacterized protein LOC103434533 [Malus domestica]
Length=94

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 72/96 (75%), Gaps = 3/96 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MGD+S A YIHMV HLIE+CL++ M+KEECMEALSKHANIQP+ITSTVW ELEK NKEFF
Sbjct  1    MGDSSSASYIHMVQHLIEKCLIYHMTKEECMEALSKHANIQPVITSTVWNELEKVNKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
            EAY++   +      E T Q ++KM+  S  KD  D
Sbjct  61   EAYEESQNKGDRMSEEETSQLIQKMLSDS--KDSDD  94



>ref|XP_007220496.1| hypothetical protein PRUPE_ppa013960mg [Prunus persica]
 gb|EMJ21695.1| hypothetical protein PRUPE_ppa013960mg [Prunus persica]
Length=94

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 71/96 (74%), Gaps = 3/96 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MGD+S A YIHMV HLIE+CL++ MSKEECMEALSKHANI+P+ITSTVW ELEK NKEFF
Sbjct  1    MGDSSSASYIHMVQHLIEKCLIYHMSKEECMEALSKHANIEPVITSTVWNELEKVNKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
            EAY +   +      E T Q ++KM+  S  KD  D
Sbjct  61   EAYAQSQNKGDRMSEEETSQLIQKMISDS--KDSDD  94



>ref|XP_004497310.1| PREDICTED: uncharacterized protein LOC101495981 [Cicer arietinum]
Length=101

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -1

Query  874  MGDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkef  701
            MGD+S  A YIHMV HLIE+CL+F M+KEECMEALSKHANI P+ITSTVW ELEKENKEF
Sbjct  1    MGDSSSSASYIHMVQHLIEKCLIFHMTKEECMEALSKHANINPIITSTVWNELEKENKEF  60

Query  700  fEAYKKQGREESAEIMETTRQKVEKMV  620
            FE Y K   +E     E T Q +EKM+
Sbjct  61   FEPYMKSKSKEGMMSKEETTQMLEKMI  87



>ref|XP_010922425.1| PREDICTED: uncharacterized protein LOC105045741 [Elaeis guineensis]
Length=96

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 75/97 (77%), Gaps = 3/97 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            M D+S A YI MV HLIE+CL+F M+K+EC+EALSKHANI P+ITSTVW ELEKENKEFF
Sbjct  1    MADSSSASYIRMVQHLIEKCLLFHMNKDECVEALSKHANINPVITSTVWTELEKENKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKDE  587
            EAY ++ REE    ME   ++V+KM+  +  +DP DE
Sbjct  61   EAYTRE-REERVLEMEAM-ERVQKMLAETAARDPDDE  95



>ref|XP_008233551.1| PREDICTED: uncharacterized protein LOC103332586 [Prunus mume]
Length=94

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 71/96 (74%), Gaps = 3/96 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MGD+S A YIHMV HLIE+CL++ MSKEECMEALSKHANI+P+ITSTVW ELEK NKEFF
Sbjct  1    MGDSSSASYIHMVQHLIEKCLIYHMSKEECMEALSKHANIEPVITSTVWNELEKVNKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
            EAY +   +      E T Q ++KM+  S  KD  D
Sbjct  61   EAYAESQNKGDRMSEEETSQLIQKMISDS--KDSDD  94



>ref|XP_003554334.1| PREDICTED: uncharacterized protein LOC100785268 [Glycine max]
Length=93

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 2/89 (2%)
 Frame = -1

Query  871  GDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEA  692
              +SA YI +VH LIEEC++F MSKEECMEALSKHANI+P+ITSTVWKELEKENKEFFEA
Sbjct  4    SSSSAAYIRLVHRLIEECILFNMSKEECMEALSKHANIKPVITSTVWKELEKENKEFFEA  63

Query  691  YKKQGREESAEIMETTRQKVEKMVLGSWK  605
            Y +   E ++E    TRQ+++ +V  S K
Sbjct  64   YTRSRAERASE--RETRQRIQSVVSDSSK  90



>ref|XP_011094802.1| PREDICTED: uncharacterized protein LOC105174403 isoform X2 [Sesamum 
indicum]
Length=87

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -1

Query  868  DASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAY  689
            ++SA+YIH V HLIEEC++FKMSKEECMEALSKHANI P+ITSTVWKELEKEN EFFEAY
Sbjct  5    ESSAKYIHKVQHLIEECIVFKMSKEECMEALSKHANINPIITSTVWKELEKENTEFFEAY  64

Query  688  KKQGREESAEIM  653
             KQ  E S+  M
Sbjct  65   TKQRSEGSSRTM  76



>ref|XP_010529096.1| PREDICTED: uncharacterized protein LOC104806077 [Tarenaya hassleriana]
 ref|XP_010534461.1| PREDICTED: uncharacterized protein LOC104810007 [Tarenaya hassleriana]
Length=95

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 3/92 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MGD+S A YIHMV HLIE+CL+F MSKEECMEALSKHANI P+ITSTVWKELEKENKEFF
Sbjct  1    MGDSSSASYIHMVQHLIEKCLIFHMSKEECMEALSKHANITPVITSTVWKELEKENKEFF  60

Query  697  EAY-KKQGREESAEIMETTRQKVEKMVLGSWK  605
            EAY ++Q R+E     ET +  ++K++  S K
Sbjct  61   EAYEQRQSRQERMSEEETNKM-IQKIISDSSK  91



>ref|XP_009778459.1| PREDICTED: uncharacterized protein LOC104227819 [Nicotiana sylvestris]
Length=94

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YI+MVHHLIE+CL+F M+KEECMEALSKHANI+P+IT+TVW ELEKEN+EFFE
Sbjct  1    MGDSSASYIYMVHHLIEKCLIFHMTKEECMEALSKHANIKPVITATVWNELEKENREFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGS  611
             Y  Q   +     E T   ++KM+L +
Sbjct  61   TY-AQSHNKDFITEEETSAMIQKMILDN  87



>ref|XP_008461625.1| PREDICTED: uncharacterized protein LOC103500185 [Cucumis melo]
Length=93

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+SA YIHMV HLIE+CL+F M+K+EC+EALSKHANI P+ITSTVWKELEKEN+EFFE
Sbjct  1    MADSSAAYIHMVQHLIEKCLIFHMNKDECIEALSKHANISPVITSTVWKELEKENREFFE  60

Query  694  AYKK-QGREESAEIMETTRQKVEKMVLG  614
            AY + +GR +     E TR+ +++M++ 
Sbjct  61   AYSECKGRNDRILAEEETRKLIQRMMMS  88



>ref|XP_004147706.1| PREDICTED: uncharacterized protein LOC101203417 [Cucumis sativus]
 ref|XP_004164343.1| PREDICTED: uncharacterized LOC101203417 [Cucumis sativus]
 gb|KGN50512.1| hypothetical protein Csa_5G179770 [Cucumis sativus]
Length=92

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+SA YIHMV HLIE+CL+F M+K+EC+EALSKHANI P+ITSTVWKELEKEN+EFFE
Sbjct  1    MADSSAAYIHMVQHLIEKCLIFHMNKDECIEALSKHANISPIITSTVWKELEKENREFFE  60

Query  694  AYKK-QGREESAEIMETTRQKVEKMV  620
            AY + +GR +     E TR+ +++M+
Sbjct  61   AYSECKGRNDRILAEEETRKLIQRMM  86



>ref|XP_003521351.1| PREDICTED: uncharacterized protein LOC100808933 [Glycine max]
 gb|KHN09441.1| hypothetical protein glysoja_016540 [Glycine soja]
Length=93

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 2/87 (2%)
 Frame = -1

Query  871  GDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEA  692
              +SA YI +VH LIEEC++F MSKEECMEALSKHANI+P+ITSTVWKELEKENKEFFEA
Sbjct  4    SSSSAAYIRLVHRLIEECILFNMSKEECMEALSKHANIKPVITSTVWKELEKENKEFFEA  63

Query  691  YKKQGREESAEIMETTRQKVEKMVLGS  611
            Y +   E+++E    TRQ+++ +V  S
Sbjct  64   YTRSRVEKASE--RETRQRIQNVVSDS  88



>ref|XP_003551816.1| PREDICTED: uncharacterized protein LOC100797035 [Glycine max]
 gb|KHN13861.1| hypothetical protein glysoja_016145 [Glycine soja]
Length=99

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGR  674
            YIHMVHHLIE+CL F MSKEECMEALSKHANI+P+ITSTVW ELEKENKEFFE Y K   
Sbjct  12   YIHMVHHLIEKCLTFHMSKEECMEALSKHANIKPVITSTVWNELEKENKEFFEEYAKGKS  71

Query  673  EESAEIMETTRQKVEKMVLGSWKKDPKD  590
            +E     E T Q ++KM+  S K   KD
Sbjct  72   KEDRMSEEETTQMLQKMISDSSKGAAKD  99



>ref|XP_009622864.1| PREDICTED: uncharacterized protein LOC104114190 [Nicotiana tomentosiformis]
Length=94

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+SA YI+MVHHLIE+CL+F M+KEECM+ALSKHANI P+IT+TVW ELEKENKEFFE
Sbjct  1    MGDSSASYIYMVHHLIEKCLIFHMTKEECMDALSKHANINPVITATVWNELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGS  611
             Y  Q   +     E T   ++KM+L +
Sbjct  61   TY-AQSHNKDCITEEETSAMIQKMILDN  87



>ref|XP_010253307.1| PREDICTED: uncharacterized protein LOC104594625 [Nelumbo nucifera]
Length=88

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            M D+SA YIHMV HLIE+CL+F M+KEEC+EALSKHANI+P+ITSTVWKELEKENKEFFE
Sbjct  1    MADSSASYIHMVQHLIEKCLLFYMTKEECIEALSKHANIKPVITSTVWKELEKENKEFFE  60

Query  694  AYKKQGREESAEIMETTRQKVEKMVLGS  611
            AY +      AE    T+Q + +M+  S
Sbjct  61   AYARSRAHRVAEA--ETKQMIHRMLSNS  86



>ref|XP_010097379.1| hypothetical protein L484_008902 [Morus notabilis]
 gb|EXB67885.1| hypothetical protein L484_008902 [Morus notabilis]
Length=118

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 64/72 (89%), Gaps = 1/72 (1%)
 Frame = -1

Query  874  MGD-ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MGD +SA YIHMVHHLIEEC++F MSKEECMEALSKHANI+P+ITSTVWKELEKENKEFF
Sbjct  1    MGDQSSASYIHMVHHLIEECIVFNMSKEECMEALSKHANIKPVITSTVWKELEKENKEFF  60

Query  697  EAYKKQGREESA  662
            E Y  + +E+S 
Sbjct  61   EEYAMRRKEKSG  72



>ref|XP_010067359.1| PREDICTED: uncharacterized protein LOC104454261 [Eucalyptus grandis]
 gb|KCW65482.1| hypothetical protein EUGRSUZ_G02891 [Eucalyptus grandis]
Length=112

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 1/49 (2%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            MGD+S A YIHMVHHLIE+CL F+MSKEECMEALSKHANI+P+ITSTVW
Sbjct  1    MGDSSSASYIHMVHHLIEKCLTFRMSKEECMEALSKHANIKPVITSTVW  49



>ref|XP_010908879.1| PREDICTED: uncharacterized protein LOC105035139 [Elaeis guineensis]
Length=96

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 75/97 (77%), Gaps = 3/97 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MGD+S A YI MV HLIE+CL+F M+K+EC++ALSKHANI+P+ITSTVW EL KENKEFF
Sbjct  1    MGDSSSASYIRMVQHLIEKCLLFHMNKQECVDALSKHANIKPVITSTVWTELVKENKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKDE  587
            EAY ++ REE    MET  Q+++KM+     +D  DE
Sbjct  61   EAYNRE-REEWLSEMETM-QRIQKMLAEIAARDSNDE  95



>ref|XP_003520029.1| PREDICTED: uncharacterized protein LOC100795820 isoform X1 [Glycine 
max]
 gb|KHN27200.1| hypothetical protein glysoja_025484 [Glycine soja]
Length=98

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -1

Query  868  DASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAY  689
            ++SA YIHMV H+IE+CL+F MSKEECMEALSKHANI+P+ITSTVW ELEKENKEFFE Y
Sbjct  6    NSSASYIHMVQHMIEKCLIFHMSKEECMEALSKHANIKPVITSTVWNELEKENKEFFEEY  65

Query  688  KKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
             K   ++     E T Q ++KM+  S K    D
Sbjct  66   AKAKSKDERMSEEETSQMIQKMISDSSKGAGND  98



>ref|XP_010067216.1| PREDICTED: uncharacterized protein LOC104454150 [Eucalyptus grandis]
 gb|KCW65305.1| hypothetical protein EUGRSUZ_G02763 [Eucalyptus grandis]
Length=112

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 47/49 (96%), Gaps = 1/49 (2%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            MGD+S A YIHMVHHLIE+CL+F+MSKEECM+ALSKHANI+P+ITSTVW
Sbjct  1    MGDSSSASYIHMVHHLIEKCLIFRMSKEECMDALSKHANIKPVITSTVW  49



>ref|XP_008776339.1| PREDICTED: uncharacterized protein LOC103696468 [Phoenix dactylifera]
Length=96

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 76/97 (78%), Gaps = 3/97 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MGD+S A YI MV HLIE CL+F M+KEEC++ALSKHANI P+ITSTVWKELEKENKEFF
Sbjct  1    MGDSSTASYIRMVQHLIERCLLFHMNKEECVDALSKHANINPVITSTVWKELEKENKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKDE  587
            E Y ++ REE    MET  Q+++KM++ +  +D  +E
Sbjct  61   EGYTRE-REEWLSEMETM-QRIQKMLVETAARDSNNE  95



>gb|KDP35579.1| hypothetical protein JCGZ_09017 [Jatropha curcas]
Length=85

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 3/73 (4%)
 Frame = -1

Query  874  MGDASA--EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkef  701
            MGD+SA   YIH VHHLIEEC++F MSKEECMEALSKHANI+P+ITSTVWKELEKENKEF
Sbjct  1    MGDSSAAASYIHTVHHLIEECILFNMSKEECMEALSKHANIKPVITSTVWKELEKENKEF  60

Query  700  fEAYKKQGREESA  662
            FE Y K+ RE+ A
Sbjct  61   FEGYTKR-REDRA  72



>ref|XP_003542470.1| PREDICTED: uncharacterized protein LOC100811683 [Glycine max]
Length=96

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = -1

Query  871  GDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEA  692
              +SA YIH+VH LIEEC++F MS+EECMEALSKHANI+P+ITSTVWK LEKENKEFF+A
Sbjct  3    DSSSAAYIHLVHRLIEECILFHMSQEECMEALSKHANIKPVITSTVWKGLEKENKEFFKA  62

Query  691  YKKQGREESAEIMETTRQKVEKMV  620
            Y K   E +++     RQK+ KMV
Sbjct  63   YSKSKAERASKT--EVRQKIHKMV  84



>ref|XP_010260055.1| PREDICTED: uncharacterized protein LOC104599279 [Nelumbo nucifera]
Length=91

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 72/89 (81%), Gaps = 3/89 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            M D+S A YIHMV H+IE+CL+F M+KEEC+EALSKHANI+P+ITSTVWKELEKENKEFF
Sbjct  1    MADSSSASYIHMVQHMIEKCLLFYMTKEECVEALSKHANIKPVITSTVWKELEKENKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGS  611
            EAY +   +  A++   TRQ ++KM+  S
Sbjct  61   EAYTRSREDRMAQV--ETRQMIQKMLTDS  87



>ref|XP_004307462.1| PREDICTED: uncharacterized protein LOC101296040 [Fragaria vesca 
subsp. vesca]
Length=94

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            MGD+SA YIH+V HLIE+CL+F MSKEECMEALSKHANI P+ITSTVW
Sbjct  1    MGDSSASYIHLVQHLIEKCLIFHMSKEECMEALSKHANITPVITSTVW  48



>gb|KHG18162.1| hypothetical protein F383_05478 [Gossypium arboreum]
Length=104

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 2/76 (3%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGR  674
            YIHMVH LIEECL+FKMSKEECMEALSKHANI+P+ITSTVW ELEKENKEFFEAY +   
Sbjct  14   YIHMVHRLIEECLVFKMSKEECMEALSKHANIKPVITSTVWNELEKENKEFFEAYTRGSH  73

Query  673  EESAEIMETTRQKVEK  626
            E + EI    RQ++++
Sbjct  74   ERATEI--EKRQRIQR  87



>ref|XP_010067931.1| PREDICTED: uncharacterized protein LOC104454716 [Eucalyptus grandis]
Length=73

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 47/49 (96%), Gaps = 1/49 (2%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            MGD+S A YIHMVHHLIE+CL+F+MSKEECM+ALSKHANI+P+ITSTVW
Sbjct  1    MGDSSSASYIHMVHHLIEKCLIFRMSKEECMDALSKHANIKPVITSTVW  49



>gb|KCW65481.1| hypothetical protein EUGRSUZ_G028901, partial [Eucalyptus grandis]
Length=64

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 47/49 (96%), Gaps = 1/49 (2%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            MGD+S A YIHMVHHLIE+CL+F+MSKEECM+ALSKHANI+P+ITSTVW
Sbjct  1    MGDSSSASYIHMVHHLIEKCLIFRMSKEECMDALSKHANIKPVITSTVW  49



>ref|XP_009116221.1| PREDICTED: uncharacterized protein LOC103841436 [Brassica rapa]
 emb|CDY40206.1| BnaA09g34880D [Brassica napus]
 emb|CDX73396.1| BnaC08g26070D [Brassica napus]
Length=95

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = -1

Query  871  GDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEA  692
            G +SA YIHMV H+IE+CL+F MSKEEC+EALSKHANI P+ITSTVWKELEKENKEFF+A
Sbjct  3    GSSSASYIHMVQHMIEKCLIFHMSKEECVEALSKHANITPVITSTVWKELEKENKEFFKA  62

Query  691  YKKQGREESAEIMETTRQKVEKMVLGSWK  605
            Y+++  ++     E T Q ++K++  S K
Sbjct  63   YEERQSKQEQMSEEETNQMIQKIISDSPK  91



>ref|XP_002265038.1| PREDICTED: uncharacterized protein LOC100245098 [Vitis vinifera]
 emb|CBI22392.3| unnamed protein product [Vitis vinifera]
Length=99

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 72/95 (76%), Gaps = 5/95 (5%)
 Frame = -1

Query  874  MGDASAE---YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD+SA    YIHMV HLIE+CL+F M+KE+CMEALSKHA+IQP+ITSTVW ELEKENKE
Sbjct  1    MGDSSASSASYIHMVQHLIEKCLIFHMTKEQCMEALSKHADIQPVITSTVWNELEKENKE  60

Query  703  ffEAYKKQGREESAEIM-ET-TRQKVEKMVLGSWK  605
            FFE Y  Q R    + M ET T + ++KM+  S K
Sbjct  61   FFEVYYTQTRTRDDDQMSETETTEMIQKMITKSSK  95



>ref|XP_006574868.1| PREDICTED: uncharacterized protein LOC100795820 isoform X2 [Glycine 
max]
Length=113

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -1

Query  871  GDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEA  692
             ++SA YIHMV H+IE+CL+F MSKEECMEALSKHANI+P+ITSTVW ELEKENKEFFE 
Sbjct  5    SNSSASYIHMVQHMIEKCLIFHMSKEECMEALSKHANIKPVITSTVWNELEKENKEFFEE  64

Query  691  YKKQGREESAEIMETTRQKVEKMVLGSWK  605
            Y K   ++     E T Q ++KM+  S K
Sbjct  65   YAKAKSKDERMSEEETSQMIQKMISDSSK  93



>ref|XP_010669811.1| PREDICTED: uncharacterized protein LOC104886949 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=96

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = -1

Query  874  MGDASAEYIHMVH--HLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkef  701
            M D+S+ YIHMV+  HLIE+CL+F M+KEECMEALSKHA+I+P+ITSTVW ELEKENK+F
Sbjct  1    MDDSSSSYIHMVNVQHLIEKCLIFHMTKEECMEALSKHADIKPVITSTVWNELEKENKDF  60

Query  700  fEAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
            F+ Y K   EE       T + ++KM+  S  KD KD
Sbjct  61   FDNYSKSKNEEDRMSEAETSEMIQKMISDS-SKDSKD  96



>gb|KEH17753.1| hypothetical protein MTR_0001s0190 [Medicago truncatula]
Length=102

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 8/94 (9%)
 Frame = -1

Query  874  MGDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkef  701
            MGD+S  A YIH+V HLIE+CL+F M+KEECMEALSKHANI P ITSTVW ELEK NKEF
Sbjct  1    MGDSSSSASYIHLVQHLIEKCLIFHMTKEECMEALSKHANINPTITSTVWNELEKVNKEF  60

Query  700  fEAYKKQGREESAEIM----ETTRQKVEKMVLGS  611
            FEAYK + +  + EIM    ETTR  ++KM+  S
Sbjct  61   FEAYKMKPK-NNEEIMMSQEETTRM-LQKMISAS  92



>ref|XP_006574869.1| PREDICTED: uncharacterized protein LOC100795820 isoform X3 [Glycine 
max]
Length=108

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -1

Query  871  GDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEA  692
             ++SA YIHMV H+IE+CL+F MSKEECMEALSKHANI+P+ITSTVW ELEKENKEFFE 
Sbjct  5    SNSSASYIHMVQHMIEKCLIFHMSKEECMEALSKHANIKPVITSTVWNELEKENKEFFEE  64

Query  691  YKKQGREESAEIMETTRQKVEKMVLGSWK  605
            Y K   ++     E T Q ++KM+  S K
Sbjct  65   YAKAKSKDERMSEEETSQMIQKMISDSSK  93



>ref|XP_008362697.1| PREDICTED: uncharacterized protein LOC103426379 [Malus domestica]
Length=94

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 3/96 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MGD+S A YIHMV HLIE+CL + ++KEECMEALSKHANI+P+ITSTVW ELEK NKEFF
Sbjct  1    MGDSSSASYIHMVQHLIEKCLTYHLTKEECMEALSKHANIKPVITSTVWNELEKVNKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKD  590
            EAY++   +      E T Q ++KM+  S  KD  D
Sbjct  61   EAYEESQNKGDRMSEEETSQLIQKMISDS--KDSDD  94



>ref|XP_007162681.1| hypothetical protein PHAVU_001G171100g [Phaseolus vulgaris]
 gb|ESW34675.1| hypothetical protein PHAVU_001G171100g [Phaseolus vulgaris]
Length=92

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = -1

Query  871  GDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEA  692
              +SA YI +VH LIEEC++F MSKEECMEALSKHANI P+ITSTVWKEL KEN+EFFE 
Sbjct  3    DSSSAAYIRLVHRLIEECILFNMSKEECMEALSKHANINPVITSTVWKELAKENQEFFEV  62

Query  691  YKKQGREESAEIMETTRQKVEKMVLGSWK  605
            Y +   E ++E    T+++++ MV  S K
Sbjct  63   YSRSRAERASE--RETKERIQNMVSDSSK  89



>ref|XP_003555622.1| PREDICTED: uncharacterized protein LOC100800093 [Glycine max]
Length=98

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 67/90 (74%), Gaps = 5/90 (6%)
 Frame = -1

Query  874  MGD-----ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkeleken  710
            MGD       A YIHMV HLIE+CL+F M+KEECMEALSKHANI P+ITSTVWKELEKEN
Sbjct  1    MGDSSSSSCPASYIHMVQHLIEKCLIFHMTKEECMEALSKHANINPIITSTVWKELEKEN  60

Query  709  keffEAYKKQGREESAEIMETTRQKVEKMV  620
            KEFFEAY K   ++     E T Q ++KM+
Sbjct  61   KEFFEAYMKSKAKDDRMSQEETNQIIQKMI  90



>emb|CDY02930.1| BnaC04g25560D [Brassica napus]
Length=95

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 75/93 (81%), Gaps = 3/93 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            M D+S A YIHMVHH+IE+CL+F MSKEEC+EALS HANI P+ITSTVWKELEKENKEFF
Sbjct  1    MADSSSASYIHMVHHMIEKCLIFNMSKEECVEALSTHANITPVITSTVWKELEKENKEFF  60

Query  697  EAY-KKQGREESAEIMETTRQKVEKMVLGSWKK  602
            +AY ++Q ++E     ETT Q ++K++  S K+
Sbjct  61   KAYEERQSKQEQMSEEETT-QLIQKIISDSSKE  92



>ref|XP_009419267.1| PREDICTED: uncharacterized protein LOC103999278 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=97

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MG++S A YI MV HLIE+CL+F M+K ECMEAL+KHANIQP+ITSTVWKELEKEN+EFF
Sbjct  1    MGESSSASYIRMVQHLIEQCLVFHMNKNECMEALAKHANIQPVITSTVWKELEKENEEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKDE  587
            + Y K   E++ E ME   ++++K++  +  KD   E
Sbjct  61   QTYMKDQEEKALE-MEAVERRIQKILAETAAKDSDKE  96



>ref|XP_010543332.1| PREDICTED: uncharacterized protein LOC104816293 [Tarenaya hassleriana]
Length=92

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 64/80 (80%), Gaps = 3/80 (4%)
 Frame = -1

Query  871  GDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            GD S  A YIH+VHHLIEECL+F M KEECMEALSKHANI+P++TSTVW ELEKENKEFF
Sbjct  4    GDHSSPASYIHLVHHLIEECLLFNMGKEECMEALSKHANIEPVVTSTVWNELEKENKEFF  63

Query  697  EAYKKQGREESAEIMETTRQ  638
            EAY+K  RE      ET R+
Sbjct  64   EAYEK-SRETRPTEKETARR  82



>ref|XP_009139191.1| PREDICTED: uncharacterized protein LOC103863183 [Brassica rapa]
 emb|CDX76114.1| BnaA04g03780D [Brassica napus]
Length=95

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 3/92 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            M D+S A YIHMVHH+IE+CL+F MSKEEC+EAL KHANI P+ITSTVWKELEKENKEFF
Sbjct  1    MADSSSASYIHMVHHMIEKCLIFNMSKEECVEALFKHANITPVITSTVWKELEKENKEFF  60

Query  697  EAY-KKQGREESAEIMETTRQKVEKMVLGSWK  605
            +AY ++Q ++E     ETT Q ++K++  S K
Sbjct  61   KAYEERQSKQEQMSEEETT-QLIQKIISDSSK  91



>ref|XP_009609528.1| PREDICTED: uncharacterized protein LOC104103332 isoform X2 [Nicotiana 
tomentosiformis]
Length=91

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 69/88 (78%), Gaps = 4/88 (5%)
 Frame = -1

Query  841  VHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGREESA  662
            V HLIEEC++FKMS+EECMEAL+KHANIQP+ITSTVWKELEKENKEFFEAY K   E+S+
Sbjct  3    VQHLIEECIIFKMSREECMEALAKHANIQPIITSTVWKELEKENKEFFEAYNKTREEKSS  62

Query  661  EI---METTRQKVEKMV-LGSWKKDPKD  590
                 +ETTRQ++  M+ L S   D  D
Sbjct  63   SAESQLETTRQRIHNMLMLDSSSTDSID  90



>ref|XP_009804271.1| PREDICTED: uncharacterized protein LOC104249530 isoform X1 [Nicotiana 
sylvestris]
Length=107

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            M D+SA YIHMV HLIE+CL+F M+KEECMEALSKHANI+P+ITSTVW
Sbjct  1    MSDSSASYIHMVQHLIEKCLIFHMTKEECMEALSKHANIKPVITSTVW  48



>ref|NP_191084.1| uncharacterized protein [Arabidopsis thaliana]
 ref|XP_002878026.1| hypothetical protein ARALYDRAFT_485945 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006403482.1| hypothetical protein EUTSA_v10010856mg [Eutrema salsugineum]
 ref|XP_010504371.1| PREDICTED: uncharacterized protein LOC104781402 [Camelina sativa]
 emb|CAB75758.1| putative protein [Arabidopsis thaliana]
 gb|AAL85022.1| unknown protein [Arabidopsis thaliana]
 gb|AAN41364.1| unknown protein [Arabidopsis thaliana]
 gb|EFH54285.1| hypothetical protein ARALYDRAFT_485945 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE79356.1| uncharacterized protein AT3G55240 [Arabidopsis thaliana]
 gb|ESQ44935.1| hypothetical protein EUTSA_v10010856mg [Eutrema salsugineum]
Length=95

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            M D+S A YIHMV H+IE+CL+F MSKEEC+EALSKHANI P+ITSTVWKELEKENKEFF
Sbjct  1    MADSSSASYIHMVQHMIEKCLIFHMSKEECVEALSKHANITPVITSTVWKELEKENKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWK  605
            +AY+++  ++     E T Q ++K++  S K
Sbjct  61   KAYEERQSKQEQMSEEETNQMIQKIISDSSK  91



>ref|XP_006288973.1| hypothetical protein CARUB_v10002347mg [Capsella rubella]
 gb|EOA21871.1| hypothetical protein CARUB_v10002347mg [Capsella rubella]
Length=91

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -1

Query  874  MGD---ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD   + A YIH+VHHLIEEC++F M KEECM+AL KHANI+P+ITSTVWKELE+ENKE
Sbjct  1    MGDQNSSQASYIHLVHHLIEECILFNMGKEECMDALFKHANIKPIITSTVWKELERENKE  60

Query  703  ffEAYKKQGREESAEIMETTRQ  638
            FFEAY+++ REE     ET R+
Sbjct  61   FFEAYERR-REEIPTEKETARR  81



>ref|XP_009388635.1| PREDICTED: uncharacterized protein LOC103975403 [Musa acuminata 
subsp. malaccensis]
Length=96

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 76/97 (78%), Gaps = 3/97 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MG++S A YI MV HLIE+CL+F MSK+ECMEAL+KHA+I+P+ITSTVWKELEKENKEFF
Sbjct  1    MGESSSASYIRMVQHLIEQCLVFHMSKDECMEALAKHADIKPVITSTVWKELEKENKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKDE  587
            +AY K   E++ E+     Q+++KM+  S  KD + E
Sbjct  61   QAYMKDQAEKAMEM--EAAQRIQKMLSESAAKDSEKE  95



>ref|XP_010516084.1| PREDICTED: uncharacterized protein LOC104791810 [Camelina sativa]
Length=95

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            M D+S A YIHMV H+IE+CL+F MSKEEC+EALSKHANI P+ITSTVWKELEKENKEFF
Sbjct  1    MADSSSASYIHMVQHMIEKCLIFHMSKEECVEALSKHANITPVITSTVWKELEKENKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWK  605
            +AY+++  ++     E T Q ++K++  S K
Sbjct  61   KAYEERQSKQEQMSEEETNQMIQKIISDSSK  91



>ref|XP_010427285.1| PREDICTED: uncharacterized protein LOC104712150 [Camelina sativa]
Length=95

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -1

Query  871  GDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEA  692
              +SA YIHMV H+IE+CL+F MSKEEC+EALSKHANI P+ITSTVWKELEKENKEFF+A
Sbjct  3    NSSSASYIHMVQHMIEKCLIFHMSKEECVEALSKHANITPVITSTVWKELEKENKEFFKA  62

Query  691  YKKQGREESAEIMETTRQKVEKMVLGSWK  605
            Y+++  ++     E T Q ++K++  S K
Sbjct  63   YEERQSKQEQMSEEETNQMIQKIISDSSK  91



>ref|NP_568103.3| uncharacterized protein [Arabidopsis thaliana]
 gb|AAO64770.1| At5g02580 [Arabidopsis thaliana]
 dbj|BAE99442.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED90493.1| uncharacterized protein AT5G02580 [Arabidopsis thaliana]
Length=91

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 4/82 (5%)
 Frame = -1

Query  874  MGD---ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD   + A YIH+VHHLIEEC++F M KEECM+AL KHANI+P+ITSTVWKEL KENKE
Sbjct  1    MGDHNSSQASYIHLVHHLIEECIVFNMGKEECMDALFKHANIKPIITSTVWKELAKENKE  60

Query  703  ffEAYKKQGREESAEIMETTRQ  638
            FFEAY+++ REE     ET R+
Sbjct  61   FFEAYERR-REEIPTEKETARR  81



>ref|XP_009622570.1| PREDICTED: uncharacterized protein LOC104113949 [Nicotiana tomentosiformis]
Length=107

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            M D+SA YIH+V HLIE+CL+F M+KEECMEALSKHANI+P+ITSTVW
Sbjct  1    MSDSSASYIHLVQHLIEKCLIFHMTKEECMEALSKHANIKPVITSTVW  48



>ref|XP_003621784.1| Plant-specific domain TIGR01589 family protein [Medicago truncatula]
 gb|AES78002.1| hypothetical protein MTR_7g022840 [Medicago truncatula]
Length=102

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGR  674
            YIHMV HLIE+CL+F M+KEECMEALSKHANI+P+ITSTVWKELEKENKEFFEAY K   
Sbjct  15   YIHMVQHLIEKCLIFHMTKEECMEALSKHANIKPVITSTVWKELEKENKEFFEAYAKSKS  74

Query  673  EESAEIMETTRQKVEKMVLGSWKKDPKD  590
            ++     E T Q ++K++  S K    D
Sbjct  75   KDERMSEEETNQMLQKIISDSSKGSTND  102



>ref|XP_002870980.1| hypothetical protein ARALYDRAFT_487036 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47239.1| hypothetical protein ARALYDRAFT_487036 [Arabidopsis lyrata subsp. 
lyrata]
Length=91

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -1

Query  874  MGD---ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD   + A YIH+VHHLIEEC++F M KEECM+AL KHANI+P++TSTVWKELEKENKE
Sbjct  1    MGDHNSSQASYIHLVHHLIEECIVFNMGKEECMDALFKHANIKPIVTSTVWKELEKENKE  60

Query  703  ffEAYKKQGREESAEIMETTRQ  638
            FFEAY+++ REE     ET R+
Sbjct  61   FFEAYERR-REEIPTEKETARR  81



>gb|ACJ85968.1| unknown [Medicago truncatula]
 gb|AFK42023.1| unknown [Medicago truncatula]
 gb|KEH44497.1| hypothetical protein MTR_1g115490 [Medicago truncatula]
Length=101

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 68/94 (72%), Gaps = 6/94 (6%)
 Frame = -1

Query  874  MGDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkef  701
            MGD+S  A YIH+V HLIE+CL+F M+KEECMEALSKHANI P+ITSTVW ELEK NKEF
Sbjct  1    MGDSSSSASYIHLVQHLIEKCLIFHMTKEECMEALSKHANINPIITSTVWNELEKVNKEF  60

Query  700  fEAYK---KQGREESAEI-METTRQKVEKMVLGS  611
            FE Y    K  +E    +  E T Q ++KM+  S
Sbjct  61   FEPYNMKPKNSKEMMMMMSQEETTQMLQKMISAS  94



>emb|CDX80829.1| BnaC03g00830D [Brassica napus]
Length=91

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 4/82 (5%)
 Frame = -1

Query  874  MGDAS---AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD S   A YIH+VHHLIEEC++F M K+ECM+AL KHANI P+ITSTVWKELEKENKE
Sbjct  1    MGDHSSSQASYIHLVHHLIEECIVFNMGKKECMDALFKHANINPIITSTVWKELEKENKE  60

Query  703  ffEAYKKQGREESAEIMETTRQ  638
            FFEAY+++ REE     ET R+
Sbjct  61   FFEAYERR-REEIPTEKETARR  81



>gb|AAM62863.1| unknown [Arabidopsis thaliana]
Length=91

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 65/82 (79%), Gaps = 4/82 (5%)
 Frame = -1

Query  874  MGD---ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD   + A YIH+VHHLIEEC++F M KEECM+AL KH NI+P+ITSTVWKEL KENKE
Sbjct  1    MGDHNSSQASYIHLVHHLIEECIVFNMGKEECMDALFKHTNIKPIITSTVWKELAKENKE  60

Query  703  ffEAYKKQGREESAEIMETTRQ  638
            FFEAY+++ REE     ET R+
Sbjct  61   FFEAYERR-REEIPTEKETARR  81



>ref|XP_006292115.1| hypothetical protein CARUB_v10018311mg [Capsella rubella]
 gb|EOA25013.1| hypothetical protein CARUB_v10018311mg [Capsella rubella]
Length=95

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            M D+S A YIHMV H+IE+CL+F MSKEEC+EALSKHANI P+ITSTVWKELEKENKEFF
Sbjct  1    MADSSSASYIHMVQHMIEKCLIFHMSKEECVEALSKHANITPVITSTVWKELEKENKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWK  605
            + Y+++  ++     E T Q ++K++  S K
Sbjct  61   KEYEERQSKQEQMSEEETNQMIQKIISDSSK  91



>ref|NP_001055765.1| Os05g0462000 [Oryza sativa Japonica Group]
 gb|AAT39177.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAT39184.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17679.1| Os05g0462000 [Oryza sativa Japonica Group]
 gb|EEE63995.1| hypothetical protein OsJ_18824 [Oryza sativa Japonica Group]
Length=102

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 4/87 (5%)
 Frame = -1

Query  874  MGDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkef  701
            MGD+S  A YI MVHHLIE+C+ F ++KEECMEAL KHANI P++TSTVWKELEKENKEF
Sbjct  1    MGDSSSSASYIRMVHHLIEKCICFNLNKEECMEALEKHANINPVVTSTVWKELEKENKEF  60

Query  700  fEAYKKQGREESAEIMETTRQKVEKMV  620
            FE Y K   E + E    T Q+++KM+
Sbjct  61   FETYNKDRAERNIEA--ETMQRIQKML  85



>gb|EAY98332.1| hypothetical protein OsI_20242 [Oryza sativa Indica Group]
Length=102

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 4/87 (5%)
 Frame = -1

Query  874  MGDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkef  701
            MGD+S  A YI MVHHLIE+C+ F ++KEECMEAL KHANI P++TSTVWKELEKEN+EF
Sbjct  1    MGDSSSSASYIRMVHHLIEKCICFNLNKEECMEALEKHANINPVVTSTVWKELEKENREF  60

Query  700  fEAYKKQGREESAEIMETTRQKVEKMV  620
            FE Y K   E + E    T Q+++KM+
Sbjct  61   FETYNKDRAERNIEA--ETMQRIQKML  85



>ref|XP_010423844.1| PREDICTED: uncharacterized protein LOC104708886 [Camelina sativa]
Length=91

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 4/82 (5%)
 Frame = -1

Query  874  MGD---ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD   + A YIH+VHHLIEEC++F M KEECM+AL KHANI+P+ITSTVWKELEKENKE
Sbjct  1    MGDQNSSQASYIHLVHHLIEECILFNMGKEECMDALFKHANIKPIITSTVWKELEKENKE  60

Query  703  ffEAYKKQGREESAEIMETTRQ  638
            FFEAY+++  E   E  ET R+
Sbjct  61   FFEAYERRRVEIPTE-KETARR  81



>ref|XP_009122767.1| PREDICTED: uncharacterized protein LOC103847438 [Brassica rapa]
Length=91

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 4/81 (5%)
 Frame = -1

Query  874  MGD---ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD   + A YIH+VHHLIEEC++  M KEECM+AL KHANI+P+ITSTVWKELEKENKE
Sbjct  1    MGDHNSSQASYIHLVHHLIEECIVLNMGKEECMDALFKHANIKPIITSTVWKELEKENKE  60

Query  703  ffEAYKKQGREESAEIMETTR  641
            FFEAY+++ REE A   ET R
Sbjct  61   FFEAYERR-REEIATEKETAR  80



>emb|CDY11219.1| BnaA03g00550D [Brassica napus]
Length=91

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 4/82 (5%)
 Frame = -1

Query  874  MGDAS---AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD S   A YIH+VHHLIEEC++F M K+ECM+AL KHANI P+ITSTVWKELEKENKE
Sbjct  1    MGDHSSSQASYIHLVHHLIEECIVFNMGKKECMDALFKHANINPIITSTVWKELEKENKE  60

Query  703  ffEAYKKQGREESAEIMETTRQ  638
            FFEAY+++ +E   E  ET R+
Sbjct  61   FFEAYERRRKEIPTE-KETARR  81



>ref|XP_009416123.1| PREDICTED: uncharacterized protein LOC103996829 [Musa acuminata 
subsp. malaccensis]
Length=100

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 6/100 (6%)
 Frame = -1

Query  874  MGDASAE----YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenk  707
            MGD+S+     YI MV HLIE+CL+F MSKEEC+EALSKHANI+P+IT+TVW ELEKEN 
Sbjct  1    MGDSSSSSSASYIRMVQHLIEKCLLFHMSKEECVEALSKHANIKPVITATVWAELEKENT  60

Query  706  effEAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKDE  587
            EFFEAY K  REES   M T  Q +  M+     +DP ++
Sbjct  61   EFFEAYSK-NREESVMEMRTM-QMIRTMLTRMASRDPDED  98



>ref|XP_006398715.1| hypothetical protein EUTSA_v10015145mg [Eutrema salsugineum]
 gb|ESQ40168.1| hypothetical protein EUTSA_v10015145mg [Eutrema salsugineum]
Length=91

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 1/78 (1%)
 Frame = -1

Query  871  GDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEA  692
              + A YIH+VHHLIEEC++F M KEECM+AL KHANI+P+ITSTVWKELEKENKEFFEA
Sbjct  5    NSSQASYIHLVHHLIEECIVFNMGKEECMDALFKHANIKPIITSTVWKELEKENKEFFEA  64

Query  691  YKKQGREESAEIMETTRQ  638
            Y+++ REE     ET R+
Sbjct  65   YERR-REEIPTEKETARR  81



>ref|XP_009130713.1| PREDICTED: uncharacterized protein LOC103855476 [Brassica rapa]
Length=118

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 4/82 (5%)
 Frame = -1

Query  874  MGDAS---AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD S   A YIH+VHHLIEEC++F M K+ECM+AL KHANI P+ITSTVWKELEKENKE
Sbjct  28   MGDHSSSQASYIHLVHHLIEECIVFNMGKKECMDALFKHANINPIITSTVWKELEKENKE  87

Query  703  ffEAYKKQGREESAEIMETTRQ  638
            FFEAY+++ +E   E  ET R+
Sbjct  88   FFEAYERRRKEIPTE-KETARR  108



>ref|XP_010490719.1| PREDICTED: uncharacterized protein LOC104768427 [Camelina sativa]
Length=91

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 65/81 (80%), Gaps = 4/81 (5%)
 Frame = -1

Query  874  MGD---ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD   + A YIH+VHHLIEEC++F M KEECM+AL KHANI+P+ITSTVWKELEKENKE
Sbjct  1    MGDQNSSQASYIHLVHHLIEECILFNMGKEECMDALFKHANIKPIITSTVWKELEKENKE  60

Query  703  ffEAYKKQGREESAEIMETTR  641
            FFEAY+++  E   E  ET R
Sbjct  61   FFEAYERRRVEIPTE-KETAR  80



>gb|EYU38477.1| hypothetical protein MIMGU_mgv1a021970mg [Erythranthe guttata]
Length=93

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -1

Query  862  SAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKK  683
            S EYI MVHHLIEEC++FKM+KEECMEAL+KHAN+ P+I STVWKELEKENKEFFE Y K
Sbjct  6    SVEYIRMVHHLIEECIVFKMNKEECMEALTKHANVNPIIASTVWKELEKENKEFFEDYNK  65

Query  682  QGREESAEIMET  647
            +  E ++   ET
Sbjct  66   EIEERASSSAET  77



>ref|XP_010452102.1| PREDICTED: uncharacterized protein LOC104734268 [Camelina sativa]
Length=91

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 3/68 (4%)
 Frame = -1

Query  874  MGD---ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD   + A YIH+VHHLIEEC++F M KEECM+AL KHANI+P+ITSTVWKELEKENKE
Sbjct  1    MGDQNSSQASYIHLVHHLIEECILFNMGKEECMDALFKHANIKPIITSTVWKELEKENKE  60

Query  703  ffEAYKKQ  680
            FFEAY+++
Sbjct  61   FFEAYERR  68



>gb|KDO67780.1| hypothetical protein CISIN_1g0344022mg, partial [Citrus sinensis]
Length=46

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITST  737
            MG++SA YIHMV HLIE+CL+F+M+KEECMEALSKHANI+P+ITST
Sbjct  1    MGESSASYIHMVQHLIEKCLIFRMTKEECMEALSKHANIKPVITST  46



>gb|KFK34760.1| hypothetical protein AALP_AA5G190000 [Arabis alpina]
Length=95

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            M D+S A YIHMV H+IE+CL+F M+KEEC +ALSKHANI P+ITSTVWKELEKENKEFF
Sbjct  1    MADSSSASYIHMVQHMIEKCLIFHMTKEECEQALSKHANITPVITSTVWKELEKENKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWK  605
            +AY+++  ++     E T Q ++K++  S K
Sbjct  61   KAYEERQSKQEQMSEEETNQMIQKIISDSSK  91



>ref|XP_006589753.1| PREDICTED: uncharacterized protein LOC102662475 [Glycine max]
Length=106

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = -1

Query  859  AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQ  680
            A YI MV HLIE+CL+F M+KEECMEALSKHANI P+ITSTVWKELEKENKEFFE Y K 
Sbjct  18   ATYIRMVQHLIEKCLIFHMTKEECMEALSKHANINPIITSTVWKELEKENKEFFEPYMKS  77

Query  679  GREESAEIMETTRQKVEKMV--LGSWKKD  599
              ++     E T Q ++KM+  L S K D
Sbjct  78   KAKDDRMSQEETNQIIQKMMSELDSSKDD  106



>ref|XP_006654519.1| PREDICTED: uncharacterized protein LOC102715759 [Oryza brachyantha]
Length=98

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 4/87 (5%)
 Frame = -1

Query  874  MGDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkef  701
            MGD+S  A YI MVHHLIE+C+ F ++K+ECM+AL KHANI P++TSTVWKELEKEN+EF
Sbjct  1    MGDSSSSASYIRMVHHLIEKCICFNLNKQECMDALEKHANINPVVTSTVWKELEKENREF  60

Query  700  fEAYKKQGREESAEIMETTRQKVEKMV  620
            FE Y K   E + E    T Q+++KM+
Sbjct  61   FETYNKDRAERNIEA--ETMQRIQKML  85



>gb|KHN37320.1| hypothetical protein glysoja_013535 [Glycine soja]
Length=108

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = -1

Query  859  AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQ  680
            A YI MV HLIE+CL+F M+KEECMEALSKHANI P+ITSTVWKELEKENKEFFE Y K 
Sbjct  20   ATYIRMVQHLIEKCLIFHMTKEECMEALSKHANINPIITSTVWKELEKENKEFFEPYMKS  79

Query  679  GREESAEIMETTRQKVEKMV--LGSWKKD  599
              ++     E T Q ++KM+  L S K D
Sbjct  80   KAKDDRMSQEETNQIIQKMMSELDSSKDD  108



>ref|XP_002441225.1| hypothetical protein SORBIDRAFT_09g022720 [Sorghum bicolor]
 gb|EES19655.1| hypothetical protein SORBIDRAFT_09g022720 [Sorghum bicolor]
Length=102

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 69/87 (79%), Gaps = 3/87 (3%)
 Frame = -1

Query  874  MGDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkef  701
            MGD+S  A YI MVHH+IE+C+ F ++KEECM+AL KHAN+ P++T+TVWKELEKENKEF
Sbjct  1    MGDSSSSASYIRMVHHMIEKCICFNLNKEECMDALEKHANVNPVVTATVWKELEKENKEF  60

Query  700  fEAYKKQGREESAEIMETTRQKVEKMV  620
            FE Y K+ REE   I   T ++++KM+
Sbjct  61   FETYNKE-REERNIIEAETMERIQKML  86



>ref|XP_003568285.1| PREDICTED: uncharacterized protein LOC100835403 [Brachypodium 
distachyon]
Length=99

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 71/101 (70%), Gaps = 6/101 (6%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MGD+S A YI MVHHLIE+C+ F ++KEEC+EAL KHA+I P++TSTVWKELEKEN+EFF
Sbjct  1    MGDSSSASYIRMVHHLIEKCICFNLNKEECIEALEKHASINPVVTSTVWKELEKENREFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMV---LGSWKKDPKDEA  584
            E Y+K   E   E    T Q+V+KM+     S   D  D+ 
Sbjct  61   ETYQKDRAERKIEA--ETMQRVQKMLSDAAASRTSDDDDDG  99



>gb|EPS60536.1| hypothetical protein M569_14268, partial [Genlisea aurea]
Length=79

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  865  ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            + A YIHMV HLIEECL+ KMSKEECMEAL KHANI+P+ITSTVW
Sbjct  4    SEARYIHMVQHLIEECLILKMSKEECMEALEKHANIKPVITSTVW  48



>ref|XP_008649715.1| PREDICTED: uncharacterized protein LOC103630439 [Zea mays]
 gb|AFW78285.1| hypothetical protein ZEAMMB73_144584 [Zea mays]
Length=99

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 5/88 (6%)
 Frame = -1

Query  874  MGDAS---AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD+S   A YI MVHH+IE+C+ F +SKEECM+AL KHAN++P++TSTVWKELEKENKE
Sbjct  1    MGDSSSSSAAYIKMVHHMIEKCICFNLSKEECMDALEKHANVKPVVTSTVWKELEKENKE  60

Query  703  ffEAYKKQGREESAEIMETTRQKVEKMV  620
            FFE Y K   E   E    T  ++EKM+
Sbjct  61   FFETYNKDREERKVEA--ETMARIEKML  86



>ref|XP_007142706.1| hypothetical protein PHAVU_007G010000g [Phaseolus vulgaris]
 gb|ESW14700.1| hypothetical protein PHAVU_007G010000g [Phaseolus vulgaris]
Length=177

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 3/80 (4%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAY--KKQ  680
            YIHMV HLIE+CL+F M+KEECMEALSKHANI P+ITSTVW ELEKENKEFFE Y  K +
Sbjct  87   YIHMVQHLIEKCLIFHMTKEECMEALSKHANINPVITSTVWNELEKENKEFFEPYHMKWK  146

Query  679  GREESAEIMETTRQKVEKMV  620
            G++E     ETT Q +EKM+
Sbjct  147  GKKERVSEEETT-QIIEKMI  165



>ref|XP_009420078.1| PREDICTED: uncharacterized protein LOC103999903 [Musa acuminata 
subsp. malaccensis]
Length=93

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 9/98 (9%)
 Frame = -1

Query  874  MGDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkef  701
            MGD+S  A YI MV  LIE+CL+F M+K+EC+EALSKHA I P+ITSTVW ELEKENKEF
Sbjct  1    MGDSSSPASYIRMVQLLIEKCLIFHMNKDECVEALSKHAAIDPVITSTVWTELEKENKEF  60

Query  700  fEAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKDE  587
            FEAY K  RE S  +ME  R+ V +M      +DP+D+
Sbjct  61   FEAYSK-NREGS--VMEMMREMVTEMA----SRDPEDD  91



>ref|XP_009804272.1| PREDICTED: uncharacterized protein LOC104249530 isoform X2 [Nicotiana 
sylvestris]
Length=105

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 2/48 (4%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            M D+SA YIHM  HLIE+CL+F M+KEECMEALSKHANI+P+ITSTVW
Sbjct  1    MSDSSASYIHM--HLIEKCLIFHMTKEECMEALSKHANIKPVITSTVW  46



>gb|EMT33812.1| hypothetical protein F775_28626 [Aegilops tauschii]
Length=157

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  868  DASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAY  689
            D+ A YI MVHHLIE+C+ F+MS EECMEALSK A++QP++TSTVWKELEKENKEFF++Y
Sbjct  78   DSPASYIRMVHHLIEKCMTFRMSMEECMEALSKRADVQPVVTSTVWKELEKENKEFFDSY  137

Query  688  KKQGREES  665
             KQ R E 
Sbjct  138  NKQLRSEG  145



>ref|XP_008447483.1| PREDICTED: uncharacterized protein LOC103489916 [Cucumis melo]
Length=86

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -1

Query  844  MVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGRE  671
            MVHHLIE+C++F M+KEEC+EALSKHANI+P+ITSTVW ELEKENKEFFEAYKK+ R+
Sbjct  1    MVHHLIEKCIIFNMTKEECLEALSKHANIEPVITSTVWNELEKENKEFFEAYKKKRRD  58



>ref|XP_009397500.1| PREDICTED: uncharacterized protein LOC103982326 [Musa acuminata 
subsp. malaccensis]
Length=97

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 73/98 (74%), Gaps = 4/98 (4%)
 Frame = -1

Query  874  MGDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkef  701
            MG++S  A YI  V HLIE+CL+F+MSKEECMEAL+KHA+I+ +ITSTVWKELEKEN EF
Sbjct  1    MGESSSSASYIRTVQHLIEQCLLFRMSKEECMEALAKHADIKSVITSTVWKELEKENGEF  60

Query  700  fEAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKDE  587
            F+AY K+  E++ E+     Q+++K++     KD   E
Sbjct  61   FQAYMKEQEEKAMEV--EAAQRMQKILTELASKDYDKE  96



>ref|XP_006345928.1| PREDICTED: uncharacterized protein LOC102600127 isoform X1 [Solanum 
tuberosum]
Length=104

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+ A YI+MV HLIE+CL+F M+KEEC+EALSKHANI+ +IT TVW ELEKEN+EFFE
Sbjct  1    MGDSPASYIYMVQHLIEKCLIFHMTKEECIEALSKHANIKSVITVTVWNELEKENREFFE  60

Query  694  AYKKQGREESA  662
            AY K   +  A
Sbjct  61   AYAKSHNKNRA  71



>ref|XP_009143317.1| PREDICTED: uncharacterized protein LOC103867041 [Brassica rapa]
Length=92

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MGD+S A YIHMV ++IE+CL+F MSKEECM+ LS++ANI P+ITSTVWKEL K NKEFF
Sbjct  1    MGDSSPAAYIHMVQYMIEKCLIFNMSKEECMKVLSENANINPVITSTVWKELVKTNKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGS  611
            E Y+++  +  +   E T + ++K++  S
Sbjct  61   ETYERKHTKNESMSEEETDEMIQKIISDS  89



>ref|XP_004302795.1| PREDICTED: uncharacterized protein LOC101310911 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=148

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITST  737
            MGD+S A YIHMVHHLIEEC++F M++EECMEALSKHA I+P+ITST
Sbjct  1    MGDSSSASYIHMVHHLIEECIIFNMTREECMEALSKHAKIKPIITST  47



>gb|EPS58057.1| hypothetical protein M569_16760 [Genlisea aurea]
Length=93

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  862  SAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            +A+YIHMV HLIEEC++F +SKEE MEALSKHANI+P+ITSTVW
Sbjct  12   AAQYIHMVQHLIEECMVFNLSKEESMEALSKHANIKPVITSTVW  55



>ref|XP_010260037.1| PREDICTED: uncharacterized protein LOC104599268 isoform X1 [Nelumbo 
nucifera]
Length=155

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 71/103 (69%), Gaps = 17/103 (17%)
 Frame = -1

Query  874  MGDASAEYIHM---------------VHHLIEECLMFKMSKEECMEALSKHANIQPLITS  740
            MGD+SA YI +               V HLIE+C++F M+KEEC+EALSKHANI+P+ITS
Sbjct  51   MGDSSASYIRLGAGSGCWYGGDVMMQVQHLIEKCILFHMTKEECVEALSKHANIKPVITS  110

Query  739  TVWkelekenkeffEAYKKQGREESAEIMETTRQKVEKMVLGS  611
            TVWKELEKENKEFFEAY K      AE+   TRQ ++KM+  S
Sbjct  111  TVWKELEKENKEFFEAYTKSREGRMAEM--ETRQMIQKMLSDS  151



>ref|XP_004961827.1| PREDICTED: uncharacterized protein LOC101776577 [Setaria italica]
Length=100

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 67/88 (76%), Gaps = 5/88 (6%)
 Frame = -1

Query  874  MGDASAE---YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD+S+    YI MVHHLIE+C+ F ++KEECM+AL KHAN+ P+ITSTVWKELEKENKE
Sbjct  1    MGDSSSSSASYIRMVHHLIEKCICFNLNKEECMDALEKHANVNPVITSTVWKELEKENKE  60

Query  703  ffEAYKKQGREESAEIMETTRQKVEKMV  620
            FFE Y K   E + E    T Q+++KM+
Sbjct  61   FFETYNKDRVERNIEA--ETMQRIQKML  86



>ref|XP_011094801.1| PREDICTED: uncharacterized protein LOC105174403 isoform X1 [Sesamum 
indicum]
Length=124

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  841  VHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGREESA  662
            V HLIEEC++FKMSKEECMEALSKHANI P+ITSTVWKELEKEN EFFEAY KQ  E S+
Sbjct  51   VQHLIEECIVFKMSKEECMEALSKHANINPIITSTVWKELEKENTEFFEAYTKQRSEGSS  110

Query  661  EIMET  647
              M  
Sbjct  111  RTMRN  115



>ref|XP_008788054.1| PREDICTED: uncharacterized protein LOC103705925 [Phoenix dactylifera]
Length=96

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            M D+S A YI MV HLIE+CL+F M+K+EC+EALSKHANI P+ITSTVW ELEKENKEFF
Sbjct  1    MADSSSASYIRMVQHLIEKCLLFHMNKDECVEALSKHANINPVITSTVWTELEKENKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKDE  587
            EAY+++  E   E    T Q ++KM+  +   DP DE
Sbjct  61   EAYRREREERVLE--METMQMIQKMLAETAAIDPDDE  95



>ref|XP_006646464.1| PREDICTED: uncharacterized protein LOC102710086, partial [Oryza 
brachyantha]
Length=94

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = -1

Query  871  GDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            GD+S  A YI +V HLIE+C+ + M+KEECME L KHANI+P+ITSTVWKELEKEN EFF
Sbjct  2    GDSSSPASYIRLVQHLIEKCICYNMNKEECMETLEKHANIKPVITSTVWKELEKENSEFF  61

Query  697  EAYKKQGREESAEIMETTRQ  638
              YKK   EES +   ++ Q
Sbjct  62   ATYKKCPGEESVQNKSSSSQ  81



>gb|KHN20281.1| hypothetical protein glysoja_023844, partial [Glycine soja]
Length=82

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -1

Query  841  VHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGREESA  662
            V HLIE+CL+F M+KEECMEALSKHANI P+ITSTVWKELEKENKEFFEAY K   ++  
Sbjct  1    VQHLIEKCLIFHMTKEECMEALSKHANINPIITSTVWKELEKENKEFFEAYMKSKAKDDR  60

Query  661  EIMETTRQKVEKMVLGS  611
               E T Q ++KM+  S
Sbjct  61   MSQEETNQIIQKMISES  77



>gb|EMT28184.1| hypothetical protein F775_19095 [Aegilops tauschii]
Length=98

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 66/86 (77%), Gaps = 3/86 (3%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            MGD+S A YI MVHHLIE+C+ F ++KE CMEAL KHA I P++T+TVWKELEKENKEFF
Sbjct  1    MGDSSSASYIRMVHHLIEKCICFNLNKEGCMEALEKHAKINPVVTATVWKELEKENKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMV  620
            E+Y +   E + E    T ++++KM+
Sbjct  61   ESYNRDRVERNIEA--ATMERIQKML  84



>ref|XP_003558209.1| PREDICTED: uncharacterized protein LOC100821340 [Brachypodium 
distachyon]
Length=86

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -1

Query  868  DASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            D+ A YI MVHHLIE+C+ F MS EECMEALSK A++QP++TSTVW
Sbjct  6    DSPASYIRMVHHLIEKCMTFGMSMEECMEALSKRADVQPVVTSTVW  51



>ref|XP_007144475.1| hypothetical protein PHAVU_007G159200g [Phaseolus vulgaris]
 gb|ESW16469.1| hypothetical protein PHAVU_007G159200g [Phaseolus vulgaris]
Length=126

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 68/92 (74%), Gaps = 4/92 (4%)
 Frame = -1

Query  862  SAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKK  683
            SA YIH VH LIEEC++F M++EEC EALSK+ANI+P+ITSTVWKELEKENKEFFEAY  
Sbjct  37   SAAYIHQVHRLIEECILFNMNEEECKEALSKYANIKPVITSTVWKELEKENKEFFEAYSS  96

Query  682  QGREESAEIMETTRQKVEKMVLGSWKKDPKDE  587
               E  ++     RQK+  +V+ S  K+  +E
Sbjct  97   SQAEGGSK--AEKRQKI--LVMASELKNSSNE  124



>gb|EMS54926.1| hypothetical protein TRIUR3_13829 [Triticum urartu]
Length=99

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = -1

Query  874  MGDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkef  701
            MGD+S  A YI MVHHLIE+C+ F ++KE CMEAL KHA I P++T+TVWKELEKENKEF
Sbjct  1    MGDSSSSASYIRMVHHLIEKCICFNLNKEGCMEALEKHAKINPVVTATVWKELEKENKEF  60

Query  700  fEAYKKQGREESAEIMETTRQKVEKMV  620
            FE+Y +   E + E    T ++++KM+
Sbjct  61   FESYNRDRVERNIEA--ATMERIQKML  85



>ref|XP_006844259.1| hypothetical protein AMTR_s00145p00032450 [Amborella trichopoda]
 gb|ERN05934.1| hypothetical protein AMTR_s00145p00032450 [Amborella trichopoda]
Length=91

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  871  GDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
             D+SA YI MV HLIE+CL+F M+ EEC EALSKHANI+P+ITSTVW
Sbjct  3    ADSSASYIRMVQHLIEKCLLFHMTLEECEEALSKHANIKPVITSTVW  49



>ref|XP_010315066.1| PREDICTED: uncharacterized protein LOC104645376 [Solanum lycopersicum]
Length=49

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -1

Query  865  ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITST  737
            +SA YIHMV HLIE+CL++KM+KEECMEALSKHANI+P+IT+T
Sbjct  6    SSASYIHMVQHLIEKCLIYKMTKEECMEALSKHANIKPVITAT  48



>ref|XP_006301364.1| hypothetical protein CARUB_v10021775mg [Capsella rubella]
 gb|EOA34262.1| hypothetical protein CARUB_v10021775mg [Capsella rubella]
Length=94

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 2/50 (4%)
 Frame = -1

Query  874  MGDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            M D S  A +IHMV H+IE CL+F M+KEECMEALSK+ANI P+ITSTVW
Sbjct  1    MCDCSSPAAFIHMVQHMIETCLVFNMNKEECMEALSKNANINPIITSTVW  50



>ref|NP_001049737.1| Os03g0280400 [Oryza sativa Japonica Group]
 gb|ABF95301.1| uncharacterized plant-specific domain TIGR01589 family protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11651.1| Os03g0280400 [Oryza sativa Japonica Group]
 gb|EAY89494.1| hypothetical protein OsI_11026 [Oryza sativa Indica Group]
 gb|EAZ26474.1| hypothetical protein OsJ_10363 [Oryza sativa Japonica Group]
 dbj|BAG88888.1| unnamed protein product [Oryza sativa Japonica Group]
Length=78

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -1

Query  868  DASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            D+ A YIHMV HLIE+C+ F MS EECME LSK A++QP++TSTVW
Sbjct  6    DSPASYIHMVQHLIEKCMTFGMSMEECMETLSKRADVQPVVTSTVW  51



>ref|NP_974722.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90492.1| uncharacterized protein AT5G02580 [Arabidopsis thaliana]
Length=66

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 3/49 (6%)
 Frame = -1

Query  874  MGD---ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITST  737
            MGD   + A YIH+VHHLIEEC++F M KEECM+AL KHANI+P+ITST
Sbjct  1    MGDHNSSQASYIHLVHHLIEECIVFNMGKEECMDALFKHANIKPIITST  49



>ref|XP_006649869.1| PREDICTED: uncharacterized protein LOC102720412 [Oryza brachyantha]
Length=78

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  868  DASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            D+ A YIHMV HLIE C+ F MS EECME LSK A++QP++TSTVW
Sbjct  6    DSPASYIHMVQHLIERCMTFGMSMEECMETLSKRADVQPVVTSTVW  51



>ref|XP_002533007.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29382.1| conserved hypothetical protein [Ricinus communis]
Length=69

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  841  VHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGREES  665
            VHHLIEEC++F M++EECMEALSKHANI+P+ITSTVW ELEKENKEFFEAYK +   ++
Sbjct  3    VHHLIEECIIFNMTREECMEALSKHANIKPVITSTVWNELEKENKEFFEAYKNKKENQN  61



>ref|NP_189541.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAA95752.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77518.1| uncharacterized protein AT3G28990 [Arabidopsis thaliana]
Length=88

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -1

Query  868  DASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAY  689
             + A YIH+V H+IE CL F MSKEECMEALS++ANI P+ITSTVWKEL KENK+FFE Y
Sbjct  4    SSPAVYIHLVQHMIETCLTFNMSKEECMEALSENANINPIITSTVWKELVKENKDFFETY  63

Query  688  KKQGREESAEIMETTRQKVEKMV  620
            +++  ++ +   E T Q ++ ++
Sbjct  64   EQKLMKKESMSEEETNQLIQNII  86



>ref|XP_004970506.1| PREDICTED: uncharacterized protein LOC101783138 isoform X1 [Setaria 
italica]
 ref|XP_004970507.1| PREDICTED: uncharacterized protein LOC101783138 isoform X2 [Setaria 
italica]
 ref|XP_004970508.1| PREDICTED: uncharacterized protein LOC101783138 isoform X3 [Setaria 
italica]
Length=177

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = -1

Query  865  ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYK  686
            + A YI +V HLIE+C+ + M+KEECM  L KHANIQP+ITSTVWKELEKEN+EFFE Y+
Sbjct  55   SPASYIRLVQHLIEKCICYSMNKEECMVTLEKHANIQPVITSTVWKELEKENREFFETYR  114

Query  685  KQGREESAEIMETTRQKVEKMVLGSWKKDPKDE  587
            K+ R    E  ET ++  ++    S +K+P DE
Sbjct  115  KENR----EFFETYKK--DRPGEESTQKNPSDE  141



>emb|CDY20432.1| BnaC04g06120D [Brassica napus]
Length=79

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            MGD+S A YI MV ++IE+CL+F MSKEECM+ALS++ANI P+ITSTVW
Sbjct  1    MGDSSPAAYIPMVQYMIEKCLIFNMSKEECMKALSENANINPVITSTVW  49



>emb|CDY72004.1| BnaCnng75530D [Brassica napus]
Length=57

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -1

Query  874  MGDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITST  737
            MG  S  A YIH+VHHLIEEC++F M KEECM+AL KHANI+P+ITST
Sbjct  1    MGHNSSQASYIHLVHHLIEECIVFNMGKEECMDALFKHANIKPIITST  48



>gb|ABK21648.1| unknown [Picea sitchensis]
Length=79

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  865  ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAY-  689
            A   YI +V HLIE+CL+F M ++EC++ALSKHANIQPLIT TVW EL+KEN+EFF +Y 
Sbjct  13   APPSYIFLVQHLIEKCLVFNMDQQECVDALSKHANIQPLITITVWNELKKENEEFFSSYL  72

Query  688  KKQGREE  668
            +KQ R +
Sbjct  73   QKQNRRK  79



>dbj|BAJ92977.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=100

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 5/99 (5%)
 Frame = -1

Query  874  MGDASAE---YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            MGD+S+    YI MVHHLIE+C+ F ++KE CMEAL KHA I P++TSTVWKELEKENKE
Sbjct  1    MGDSSSSSASYIRMVHHLIEKCICFNLNKEGCMEALEKHAKINPVVTSTVWKELEKENKE  60

Query  703  ffEAYKKQGREESAEIMETTRQKVEKMVLGSWKKDPKDE  587
            FFE+Y K   E + E    T ++++KM+  +      D+
Sbjct  61   FFESYNKDRVERNIEA--ETMERIQKMLTDAAASKSSDD  97



>ref|XP_009419268.1| PREDICTED: uncharacterized protein LOC103999278 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=83

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITST  737
            MG++S A YI MV HLIE+CL+F M+K ECMEAL+KHANIQP+ITST
Sbjct  1    MGESSSASYIRMVQHLIEQCLVFHMNKNECMEALAKHANIQPVITST  47



>ref|XP_006345929.1| PREDICTED: uncharacterized protein LOC102600127 isoform X2 [Solanum 
tuberosum]
Length=102

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 2/71 (3%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            MGD+ A YI+M  HLIE+CL+F M+KEEC+EALSKHANI+ +IT TVW ELEKEN+EFFE
Sbjct  1    MGDSPASYIYM--HLIEKCLIFHMTKEECIEALSKHANIKSVITVTVWNELEKENREFFE  58

Query  694  AYKKQGREESA  662
            AY K   +  A
Sbjct  59   AYAKSHNKNRA  69



>ref|XP_007009559.1| Plant protein 1589 of Uncharacterized protein function [Theobroma 
cacao]
 gb|EOY18369.1| Plant protein 1589 of Uncharacterized protein function [Theobroma 
cacao]
Length=79

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 57/82 (70%), Gaps = 8/82 (10%)
 Frame = -1

Query  844  MVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAY----KKQG  677
            MV HLIE+CL+  M+KEECMEALSKHA+IQP+IT TVW ELE   K+FFEAY     KQ 
Sbjct  1    MVQHLIEKCLISNMTKEECMEALSKHASIQPVITFTVWNELETVIKDFFEAYAQSQSKQD  60

Query  676  REESAEIMETTRQKVEKMVLGS  611
            R   AE    T Q ++K +L S
Sbjct  61   RMSEAE----TSQMIQKTILDS  78



>ref|XP_004984769.1| PREDICTED: uncharacterized protein LOC101775534 [Setaria italica]
Length=80

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 2/50 (4%)
 Frame = -1

Query  874  MGDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            +GD S  A YIH V HLIE C+ F MS EECMEAL+K A++QP++TSTVW
Sbjct  3    LGDNSNPASYIHTVQHLIERCMTFGMSMEECMEALAKRADVQPVVTSTVW  52



>ref|XP_010507116.1| PREDICTED: uncharacterized protein LOC104783692 [Camelina sativa]
Length=92

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeff  698
            M D+S A YIHMV H+IE CL F M+KEEC+EALS+ ANI P+I STVWKEL KENKEFF
Sbjct  1    MSDSSPAAYIHMVQHMIEICLRFNMNKEECVEALSRIANINPIIVSTVWKELAKENKEFF  60

Query  697  EAYKKQGREESAEIMETTRQKVEKMVLGS  611
            E Y+++  +      + T + ++ ++ GS
Sbjct  61   EMYEQKFMKNKPMSEDETNKMIQNIIGGS  89



>ref|NP_001148858.1| plant-specific domain TIGR01589 family protein [Zea mays]
 gb|ACF80905.1| unknown [Zea mays]
 gb|ACG33164.1| plant-specific domain TIGR01589 family protein [Zea mays]
 gb|AFW88787.1| hypothetical protein ZEAMMB73_240957 [Zea mays]
Length=81

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -1

Query  871  GDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            GD S  A YIH V HLIE C+ F MS EECMEAL+K A++QP++TSTVW
Sbjct  6    GDDSDPASYIHTVQHLIERCMTFGMSMEECMEALAKRADVQPVVTSTVW  54



>ref|NP_001044739.1| Os01g0837600 [Oryza sativa Japonica Group]
 dbj|BAB67870.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06653.1| Os01g0837600 [Oryza sativa Japonica Group]
 gb|EAY76423.1| hypothetical protein OsI_04355 [Oryza sativa Indica Group]
 gb|EAZ14083.1| hypothetical protein OsJ_04007 [Oryza sativa Japonica Group]
Length=102

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = -1

Query  865  ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYK  686
            + A YI +V HLIE+C+ + M+KEECME L KHANI+P+ITSTVWKELEKEN EFF  YK
Sbjct  13   SPASYIRLVQHLIEKCICYNMNKEECMETLEKHANIKPVITSTVWKELEKENSEFFATYK  72

Query  685  K-QG  677
            K QG
Sbjct  73   KGQG  76



>ref|XP_002468074.1| hypothetical protein SORBIDRAFT_01g039100 [Sorghum bicolor]
 gb|EER95072.1| hypothetical protein SORBIDRAFT_01g039100 [Sorghum bicolor]
Length=79

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -1

Query  871  GDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            GD S  A YIH V HLIE C+ F MS EECMEAL+K A++QP++TSTVW
Sbjct  4    GDDSNPASYIHTVQHLIERCMTFGMSMEECMEALAKRADVQPVVTSTVW  52



>emb|CDY53585.1| BnaA05g34580D [Brassica napus]
Length=53

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITST  737
            MGD+S A YIHMV ++IE+CL+F M+KEECM+ALS++ANI P+ITST
Sbjct  1    MGDSSPAAYIHMVQYMIEKCLIFNMNKEECMKALSENANINPVITST  47



>ref|XP_002877149.1| hypothetical protein ARALYDRAFT_905187 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53408.1| hypothetical protein ARALYDRAFT_905187 [Arabidopsis lyrata subsp. 
lyrata]
Length=83

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  841  VHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGREESA  662
            V H+IE CL F MSKEECMEALSK+ANI P+ITS+VWKEL KENK+FFEAY+++  +   
Sbjct  4    VQHMIETCLTFNMSKEECMEALSKNANINPIITSSVWKELVKENKDFFEAYEQKLVKNEQ  63

Query  661  EIMETTRQKVEKMVLGS  611
               E T Q ++ ++ GS
Sbjct  64   ISEEETNQMIQNIISGS  80



>gb|EMS54935.1| hypothetical protein TRIUR3_28104 [Triticum urartu]
Length=93

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  841  VHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGREESA  662
            VHHLIE+C+ F MS EECMEALSK A++QP++TSTVWKELEKENKEFF+ Y KQ R E  
Sbjct  21   VHHLIEKCMTFGMSMEECMEALSKRADVQPVVTSTVWKELEKENKEFFDRYNKQLRSEKG  80



>gb|EMT02558.1| hypothetical protein F775_03104 [Aegilops tauschii]
Length=95

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 3/73 (4%)
 Frame = -1

Query  874  MGDAS---AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            M D S   A YI +V HLIE+C+ + M+KEEC++AL KHANI P +TSTVWKELEKEN+E
Sbjct  1    MADDSSSPASYIRLVQHLIEKCICYDMNKEECVQALEKHANILPAVTSTVWKELEKENRE  60

Query  703  ffEAYKKQGREES  665
            FFE YKK    ES
Sbjct  61   FFETYKKDRGGES  73



>emb|CDM84877.1| unnamed protein product [Triticum aestivum]
Length=96

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 3/73 (4%)
 Frame = -1

Query  874  MGDAS---AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenke  704
            M D S   A YI +V HLIE+C+ + M+KEEC++AL KHANI P +TSTVWKELEKEN+E
Sbjct  1    MADDSSSPASYIRLVQHLIEKCICYDMNKEECVQALEKHANIMPAVTSTVWKELEKENRE  60

Query  703  ffEAYKKQGREES  665
            FFE YKK    ES
Sbjct  61   FFETYKKDRGGES  73



>ref|NP_001150934.1| LOC100284567 [Zea mays]
 gb|ACG41000.1| plant-specific domain TIGR01589 family protein [Zea mays]
Length=79

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = -1

Query  871  GDAS--AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            GD S  A YIH V HLIE C+ F MS EECMEAL+K A++ P++TSTVW
Sbjct  4    GDDSNPASYIHTVQHLIERCMTFGMSMEECMEALAKRADVLPVVTSTVW  52



>ref|XP_008678773.1| PREDICTED: LOC100284567 isoform X1 [Zea mays]
 tpg|DAA44728.1| TPA: plant-specific domain TIGR01589 family protein [Zea mays]
Length=80

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  871  GDAS---AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            GD S   A YIH V HLIE C+ F MS EECMEAL+K A++ P++TSTVW
Sbjct  4    GDDSNPAASYIHTVQHLIERCMTFGMSMEECMEALAKRADVLPVVTSTVW  53



>ref|XP_002456605.1| hypothetical protein SORBIDRAFT_03g039210 [Sorghum bicolor]
 gb|EES01725.1| hypothetical protein SORBIDRAFT_03g039210 [Sorghum bicolor]
Length=171

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 53/66 (80%), Gaps = 3/66 (5%)
 Frame = -1

Query  871  GDAS---AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkef  701
             DAS   A YI +V HLIE+C+ +K++KEECME L KHA I P+ITSTVWKELEKENKEF
Sbjct  3    DDASSSPASYIRLVQHLIEKCICYKLNKEECMETLEKHAKIMPVITSTVWKELEKENKEF  62

Query  700  fEAYKK  683
            FE YKK
Sbjct  63   FETYKK  68



>ref|XP_010029145.1| PREDICTED: uncharacterized protein LOC104419238 [Eucalyptus grandis]
 gb|KCW55985.1| hypothetical protein EUGRSUZ_I01761 [Eucalyptus grandis]
Length=104

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MVHHLIE CL+F M++++C++AL+KHA IQP++T TVW
Sbjct  23   YIRMVHHLIERCLLFHMTRDDCIQALAKHAGIQPIVTLTVW  63



>ref|XP_008657081.1| PREDICTED: uncharacterized protein LOC103636516 isoform X2 [Zea 
mays]
 gb|AFW84647.1| hypothetical protein ZEAMMB73_817116 [Zea mays]
Length=102

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGR  674
            Y+ +V HLIE+C+ +K++KEECME L KHA + P+ITSTVWKELEKEN+EFFE YKK   
Sbjct  15   YVRLVQHLIEKCICYKLNKEECMETLEKHAKVMPVITSTVWKELEKENREFFETYKKYLG  74

Query  673  EESA  662
            +ESA
Sbjct  75   QESA  78



>ref|XP_006292922.1| hypothetical protein CARUB_v10019189mg [Capsella rubella]
 gb|EOA25820.1| hypothetical protein CARUB_v10019189mg [Capsella rubella]
Length=71

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = -1

Query  874  MGDAS-AEYIHMVHHLIEECLMFKMSKEECMEALSKH-ANIQPLITSTVW  731
            M D++ A YIHMV H+IE CL   MSKEECMEALSK   NI P+ITSTVW
Sbjct  1    MSDSTPAAYIHMVQHMIEICLGLNMSKEECMEALSKSTGNINPIITSTVW  50



>ref|NP_001143287.1| uncharacterized protein LOC100275821 [Zea mays]
 ref|XP_008672576.1| PREDICTED: uncharacterized protein LOC100275821 isoform X1 [Zea 
mays]
 gb|ACF82517.1| unknown [Zea mays]
 gb|ACG30360.1| hypothetical protein [Zea mays]
Length=191

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -1

Query  865  ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYK  686
             +A YI +V HLIE+C+ +K++KEECME L KHA I P++TSTVWKELEKEN+EFFE YK
Sbjct  9    PAASYIRLVQHLIEKCICYKLNKEECMETLEKHAKIMPVVTSTVWKELEKENREFFETYK  68

Query  685  K  683
            K
Sbjct  69   K  69



>ref|XP_002521440.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40930.1| conserved hypothetical protein [Ricinus communis]
Length=98

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  856  EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            EYI MV HLIE CL+F MS+++C++AL KHANIQP+IT  VW
Sbjct  16   EYIRMVQHLIERCLLFHMSRDDCIKALEKHANIQPVITLAVW  57



>tpg|DAA56931.1| TPA: hypothetical protein ZEAMMB73_134028 [Zea mays]
Length=191

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -1

Query  865  ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYK  686
             +A YI +V HLIE+C+ +K++KEECME L KHA I P++TSTVWKELEKEN+EFFE YK
Sbjct  9    PAASYIRLVQHLIEKCICYKLNKEECMETLEKHAKIMPVVTSTVWKELEKENREFFETYK  68

Query  685  K  683
            K
Sbjct  69   K  69



>ref|XP_007031530.1| Plant protein 1589 of Uncharacterized protein function [Theobroma 
cacao]
 gb|EOY02456.1| Plant protein 1589 of Uncharacterized protein function [Theobroma 
cacao]
Length=98

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 58/79 (73%), Gaps = 5/79 (6%)
 Frame = -1

Query  856  EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAY----  689
            +YI MV H+IE CL+F+MS+++C++AL+KHA I+P+IT TVWKEL KENK FF+AY    
Sbjct  16   DYIRMVQHMIERCLLFQMSRDDCVKALAKHAKIEPIITLTVWKELLKENKGFFQAYFQAN  75

Query  688  -KKQGREESAEIMETTRQK  635
              +Q    S + M T R++
Sbjct  76   SPRQFNNWSTQSMATFRRR  94



>ref|XP_010029143.1| PREDICTED: uncharacterized protein LOC104419236 [Eucalyptus grandis]
 gb|KCW55989.1| hypothetical protein EUGRSUZ_I01765 [Eucalyptus grandis]
Length=105

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV HLIE CL+F M++++C++AL+KHA+IQP++T TVW
Sbjct  24   YIRMVQHLIERCLLFHMTRDDCIQALAKHASIQPIVTLTVW  64



>tpg|DAA56932.1| TPA: hypothetical protein ZEAMMB73_134028 [Zea mays]
Length=228

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -1

Query  865  ASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYK  686
             +A YI +V HLIE+C+ +K++KEECME L KHA I P++TSTVWKELEKEN+EFFE YK
Sbjct  9    PAASYIRLVQHLIEKCICYKLNKEECMETLEKHAKIMPVVTSTVWKELEKENREFFETYK  68

Query  685  K  683
            K
Sbjct  69   K  69



>ref|XP_010096676.1| hypothetical protein L484_025425 [Morus notabilis]
 gb|EXB65344.1| hypothetical protein L484_025425 [Morus notabilis]
Length=153

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 62/89 (70%), Gaps = 4/89 (4%)
 Frame = -1

Query  871  GDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEA  692
            GD   + +  VH+LIE+CL+ ++SKEE MEALSKHANI P+IT TVW EL+KENKEFFEA
Sbjct  59   GDV--DPVITVHYLIEKCLIMRLSKEESMEALSKHANISPIITCTVWNELQKENKEFFEA  116

Query  691  YKKQGREESAEIM--ETTRQKVEKMVLGS  611
            Y    +    EI+  + T Q + K++  S
Sbjct  117  YNSHFQSREREILPEKETNQILRKLISDS  145



>ref|XP_010041988.1| PREDICTED: uncharacterized protein LOC104430987 isoform X1 [Eucalyptus 
grandis]
Length=108

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV HLIE CL+F M++++C++AL+KHA+IQP++T TVW
Sbjct  27   YIRMVQHLIERCLLFHMTRDDCIQALAKHASIQPIVTLTVW  67



>ref|XP_009409534.1| PREDICTED: uncharacterized protein LOC103991724 [Musa acuminata 
subsp. malaccensis]
Length=78

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  868  DASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAY  689
              +A YI +V HLIE CL++ MS EECMEAL  HA++ P ITSTVWKELEKEN+EFF AY
Sbjct  6    SPAAAYIRLVQHLIETCLLWHMSMEECMEALLLHADVSPAITSTVWKELEKENQEFFRAY  65

Query  688  KK  683
            ++
Sbjct  66   RR  67



>ref|XP_010319543.1| PREDICTED: uncharacterized protein LOC104646787 [Solanum lycopersicum]
Length=42

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = -1

Query  841  VHHLIEECLMFKMSKEECMEALSKHANIQPLITST  737
            V HLIE+CL++KM+KEECMEALSKHANI+P+IT+T
Sbjct  7    VQHLIEKCLIYKMTKEECMEALSKHANIKPVITAT  41



>ref|XP_008444348.1| PREDICTED: uncharacterized protein LOC103487701 isoform X2 [Cucumis 
melo]
Length=103

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV HLIE CL+  MS++EC++AL+ HANI+PLIT TVW
Sbjct  20   YIRMVQHLIERCLLLHMSRDECVKALAHHANIRPLITLTVW  60



>ref|XP_010321370.1| PREDICTED: uncharacterized protein LOC101266225 isoform X1 [Solanum 
lycopersicum]
Length=99

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  856  EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQG  677
            E  + V HLIE+CL+F M+KEEC+EALSKHANI+ +IT TVW ELEKENKEFFEAY K  
Sbjct  6    ELWNQVQHLIEKCLIFHMTKEECIEALSKHANIKSVITITVWNELEKENKEFFEAYTKSN  65

Query  676  REESA  662
             +  A
Sbjct  66   NKNRA  70



>ref|XP_004143067.1| PREDICTED: uncharacterized protein LOC101211262 [Cucumis sativus]
Length=95

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV HLIE CL+  MS++EC++AL+ HANI+PLIT TVW
Sbjct  20   YIRMVQHLIERCLLLHMSRDECVKALADHANIRPLITLTVW  60



>ref|XP_004174137.1| PREDICTED: uncharacterized LOC101211262 [Cucumis sativus]
 gb|KGN62299.1| hypothetical protein Csa_2G348860 [Cucumis sativus]
Length=103

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV HLIE CL+  MS++EC++AL+ HANI+PLIT TVW
Sbjct  20   YIRMVQHLIERCLLLHMSRDECVKALADHANIRPLITLTVW  60



>ref|XP_002312687.1| hypothetical protein POPTR_0008s19340g [Populus trichocarpa]
 gb|EEE90054.1| hypothetical protein POPTR_0008s19340g [Populus trichocarpa]
Length=116

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV HLIE CL+ +MS+++C++AL KHANI+P++T TVW
Sbjct  20   YIRMVQHLIERCLLLQMSRDQCIKALYKHANIRPIVTLTVW  60



>ref|XP_003564568.1| PREDICTED: uncharacterized protein LOC100836743 isoform X2 [Brachypodium 
distachyon]
Length=98

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 5/74 (7%)
 Frame = -1

Query  874  MGDAS----AEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenk  707
            M D S    A YI +V HLIE+C+ + M +EEC++ L K ANI P +TSTVWKELEKEN+
Sbjct  1    MADDSPSSPASYIRLVQHLIEKCICYNMDREECVKTLEKQANIMPTVTSTVWKELEKENR  60

Query  706  effEAYKK-QGREE  668
            EFFE YKK +G +E
Sbjct  61   EFFETYKKERGDQE  74



>ref|XP_010248515.1| PREDICTED: uncharacterized protein LOC104591411 [Nelumbo nucifera]
Length=98

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  856  EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
             YI MV HLIE CL+ +MS+++C+EAL++HA I+PL+T TVW
Sbjct  16   RYIRMVQHLIERCLLLRMSRDDCVEALAEHARIRPLVTLTVW  57



>ref|XP_011034121.1| PREDICTED: uncharacterized protein LOC105132360 [Populus euphratica]
Length=88

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV HLIE CL+ +MS+++C++AL KHANI+P++T TVW
Sbjct  20   YIRMVQHLIERCLLLQMSRDQCIKALYKHANIRPIVTLTVW  60



>ref|XP_010321372.1| PREDICTED: uncharacterized protein LOC101266225 isoform X3 [Solanum 
lycopersicum]
Length=88

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  835  HLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGREESA  662
            HLIE+CL+F M+KEEC+EALSKHANI+ +IT TVW ELEKENKEFFEAY K   +  A
Sbjct  2    HLIEKCLIFHMTKEECIEALSKHANIKSVITITVWNELEKENKEFFEAYTKSNNKNRA  59



>gb|KHG17414.1| hypothetical protein F383_00341 [Gossypium arboreum]
Length=72

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -1

Query  805  MSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGREESAEIMETTRQKVEK  626
            M+KEECMEALSKHANI+P+ITSTVW ELEKENKEFFEAY +   ++     E T + ++K
Sbjct  1    MTKEECMEALSKHANIKPVITSTVWNELEKENKEFFEAYAQSQSKQDRMSEEETSRMIQK  60

Query  625  MVLGSWKKDP  596
            M+  S  KDP
Sbjct  61   MISDSSSKDP  70



>ref|XP_008657080.1| PREDICTED: uncharacterized protein LOC103636516 isoform X1 [Zea 
mays]
Length=103

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITST-VWkelekenkeffEAYKKQG  677
            Y+ +V HLIE+C+ +K++KEECME L KHA + P+ITST VWKELEKEN+EFFE YKK  
Sbjct  15   YVRLVQHLIEKCICYKLNKEECMETLEKHAKVMPVITSTAVWKELEKENREFFETYKKYL  74

Query  676  REESA  662
             +ESA
Sbjct  75   GQESA  79



>ref|XP_010321371.1| PREDICTED: uncharacterized protein LOC101266225 isoform X2 [Solanum 
lycopersicum]
Length=97

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  835  HLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGREESA  662
            HLIE+CL+F M+KEEC+EALSKHANI+ +IT TVW ELEKENKEFFEAY K   +  A
Sbjct  11   HLIEKCLIFHMTKEECIEALSKHANIKSVITITVWNELEKENKEFFEAYTKSNNKNRA  68



>gb|KHN02407.1| hypothetical protein glysoja_002431 [Glycine soja]
Length=68

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 2/67 (3%)
 Frame = -1

Query  805  MSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGREESAEIMETTRQKVEK  626
            MSKEECMEALSKHANI+P+ITSTVWKELEKENKEFFEAY +   E ++E    TRQ+++ 
Sbjct  1    MSKEECMEALSKHANIKPVITSTVWKELEKENKEFFEAYTRSRAERASE--RETRQRIQS  58

Query  625  MVLGSWK  605
            +V  S K
Sbjct  59   VVSDSSK  65



>ref|XP_010533945.1| PREDICTED: uncharacterized protein LOC104809602 isoform X2 [Tarenaya 
hassleriana]
Length=98

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MVH LIE C+M +M++++C+EAL++HA+I+PL+T TVW
Sbjct  18   YIRMVHQLIERCIMLQMTRDQCVEALAEHASIRPLVTLTVW  58



>ref|XP_010533943.1| PREDICTED: uncharacterized protein LOC104809602 isoform X1 [Tarenaya 
hassleriana]
Length=104

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MVH LIE C+M +M++++C+EAL++HA+I+PL+T TVW
Sbjct  18   YIRMVHQLIERCIMLQMTRDQCVEALAEHASIRPLVTLTVW  58



>ref|XP_002525392.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37030.1| conserved hypothetical protein [Ricinus communis]
Length=122

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MVHHLIE CL+  MS+++C++AL++HA+I+PL+T  VW
Sbjct  54   YIRMVHHLIERCLLLHMSRDQCIQALAEHASIRPLVTLAVW  94



>ref|XP_008444347.1| PREDICTED: uncharacterized protein LOC103487701 isoform X1 [Cucumis 
melo]
Length=104

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  847  HMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            H V HLIE CL+  MS++EC++AL+ HANI+PLIT TVW
Sbjct  23   HTVQHLIERCLLLHMSRDECVKALAHHANIRPLITLTVW  61



>ref|XP_009144424.1| PREDICTED: uncharacterized protein LOC103868079 isoform X2 [Brassica 
rapa]
Length=105

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YIHMV H+IE C++ +M+++EC++AL  HA I PL+T TVW
Sbjct  25   YIHMVQHMIERCIILRMNRDECVQALDHHATIPPLVTLTVW  65



>ref|XP_010682527.1| PREDICTED: uncharacterized protein LOC104897364 [Beta vulgaris 
subsp. vulgaris]
Length=105

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV HLIE CL+ +M++++C++AL++HA I+PL+T TVW
Sbjct  24   YIRMVQHLIERCLLLQMNRDQCIKALAEHAKIKPLVTLTVW  64



>emb|CDP13183.1| unnamed protein product [Coffea canephora]
Length=99

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MVH LIE CLM  M +++C++AL+KHA IQP IT TVW
Sbjct  18   YIRMVHSLIERCLMLHMDRDQCIKALAKHARIQPQITLTVW  58



>gb|EMS52401.1| hypothetical protein TRIUR3_18607 [Triticum urartu]
Length=232

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -1

Query  862  SAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKK  683
            SA     V HLIE+C+ + M+KEEC+EAL KHANI P +TSTVWKELEKEN+EFFE YKK
Sbjct  145  SAMCCKQVQHLIEKCICYDMNKEECVEALEKHANIMPAVTSTVWKELEKENREFFETYKK  204

Query  682  QGREESA  662
                ES 
Sbjct  205  DRGGESP  211



>ref|XP_002315690.1| hypothetical protein POPTR_0010s05210g [Populus trichocarpa]
 gb|EEF01861.1| hypothetical protein POPTR_0010s05210g [Populus trichocarpa]
Length=90

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV HLIE CL+  MS+++C++AL+KHA++ PL+T TVW
Sbjct  20   YIRMVQHLIERCLLLHMSRDQCVKALAKHASVHPLVTLTVW  60



>ref|XP_011045292.1| PREDICTED: uncharacterized protein LOC105140247 [Populus euphratica]
Length=98

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV HLIE CL+  MS+++C++AL+KHA++ PL+T TVW
Sbjct  20   YIRMVQHLIERCLLLHMSRDQCVKALAKHASVHPLVTLTVW  60



>ref|XP_010041989.1| PREDICTED: uncharacterized protein LOC104430987 isoform X2 [Eucalyptus 
grandis]
Length=80

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  841  VHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            V HLIE CL+F M++++C++AL+KHA+IQP++T TVW
Sbjct  3    VQHLIERCLLFHMTRDDCIQALAKHASIQPIVTLTVW  39



>ref|XP_006438332.1| hypothetical protein CICLE_v10033163mg [Citrus clementina]
 gb|ESR51572.1| hypothetical protein CICLE_v10033163mg [Citrus clementina]
Length=93

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  856  EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
             YI MV HLIE CL+  MS+++C++AL++HA+I+PL+T TVW
Sbjct  17   SYIRMVQHLIERCLLLHMSRDQCIKALAEHASIRPLVTLTVW  58



>ref|XP_009144423.1| PREDICTED: uncharacterized protein LOC103868079 isoform X1 [Brassica 
rapa]
Length=111

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YIHMV H+IE C++ +M+++EC++AL  HA I PL+T TVW
Sbjct  25   YIHMVQHMIERCIILRMNRDECVQALDHHATIPPLVTLTVW  65



>gb|KDP26613.1| hypothetical protein JCGZ_17771 [Jatropha curcas]
Length=106

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MVH LIE CL+  +S+++C++ L KHAN++PL+T TVW
Sbjct  25   YIRMVHQLIERCLLLHLSRDQCIKVLEKHANVRPLVTLTVW  65



>ref|XP_007153749.1| hypothetical protein PHAVU_003G061900g [Phaseolus vulgaris]
 gb|ESW25743.1| hypothetical protein PHAVU_003G061900g [Phaseolus vulgaris]
Length=101

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV +LIE C++F MS+E+C+ AL++HA I+PL+T TVW
Sbjct  19   YIRMVQNLIERCMLFHMSQEQCIRALAEHAGIKPLVTVTVW  59



>gb|KDO82359.1| hypothetical protein CISIN_1g034241mg [Citrus sinensis]
Length=93

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  856  EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
             YI MV HLIE CL+  MS+++C++AL++HA I+PL+T TVW
Sbjct  17   SYIRMVQHLIERCLLLHMSRDQCIKALAEHAGIRPLVTLTVW  58



>ref|XP_008672574.1| PREDICTED: uncharacterized protein LOC100275821 isoform X2 [Zea 
mays]
 ref|XP_008672575.1| PREDICTED: uncharacterized protein LOC100275821 isoform X2 [Zea 
mays]
Length=192

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  844  MVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKK  683
             V HLIE+C+ +K++KEECME L KHA I P++TSTVWKELEKEN+EFFE YKK
Sbjct  17   QVQHLIEKCICYKLNKEECMETLEKHAKIMPVVTSTVWKELEKENREFFETYKK  70



>gb|KDP46441.1| hypothetical protein JCGZ_10281 [Jatropha curcas]
Length=78

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  856  EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITST  737
            EYI MV HLIE CL+F M++++C++AL+KHA++ P +TST
Sbjct  17   EYIRMVQHLIERCLLFHMNRDDCVKALAKHASVHPTVTST  56



>ref|XP_008444349.1| PREDICTED: uncharacterized protein LOC103487701 isoform X3 [Cucumis 
melo]
Length=100

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  847  HMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAY  689
            H V HLIE CL+  MS++EC++AL+ HANI+PLIT TVWKEL+KEN +FF AY
Sbjct  23   HTVQHLIERCLLLHMSRDECVKALAHHANIRPLITLTVWKELQKENSDFFRAY  75



>emb|CDY20964.1| BnaA08g25610D [Brassica napus]
Length=412

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -1

Query  856  EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
             YIHMV H+IE C++ +MS++EC++AL  HA I PL+T TVW
Sbjct  25   SYIHMVQHMIERCIILRMSRDECVQALDHHATIPPLVTLTVW  66



>ref|XP_003552028.1| PREDICTED: uncharacterized protein LOC100784875 [Glycine max]
 gb|KHN23198.1| hypothetical protein glysoja_043643 [Glycine soja]
Length=102

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV +LIE C++F MS+++C+ AL++HA I+PL+T TVW
Sbjct  20   YIRMVQNLIERCILFHMSQDQCVRALAEHAGIKPLVTVTVW  60



>emb|CDY20609.1| BnaC08g14490D [Brassica napus]
Length=408

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -1

Query  856  EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
             YIHMV H+IE C++ +MS++EC++AL  HA I PL+T TVW
Sbjct  24   SYIHMVQHMIERCIILRMSRDECVQALDHHATIPPLVTLTVW  65



>ref|NP_001238177.1| uncharacterized protein LOC100306139 [Glycine max]
 gb|ACU14174.1| unknown [Glycine max]
Length=102

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV +LIE C++F MS+++C+ AL++HA I+PL+T TVW
Sbjct  20   YIRMVQNLIERCMLFHMSQDQCIRALAEHAGIKPLVTVTVW  60



>ref|XP_010251198.1| PREDICTED: uncharacterized protein LOC104593166 isoform X2 [Nelumbo 
nucifera]
Length=100

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MVHHLIE CL+  M++++C++AL+ HA I+PLIT TVW
Sbjct  17   YIRMVHHLIERCLLLGMTRDDCVKALAVHAKIRPLITLTVW  57



>gb|KHN26895.1| hypothetical protein glysoja_035534 [Glycine soja]
Length=102

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV +LIE C++F MS+++C+ AL++HA I+PL+T TVW
Sbjct  20   YIRMVQNLIERCMLFHMSQDQCIRALAEHAGIKPLVTVTVW  60



>emb|CDX93395.1| BnaA06g06530D [Brassica napus]
Length=101

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV H+IE C++ +M+++EC++AL  HA+IQPL+T T+W
Sbjct  23   YIRMVQHMIERCIILRMTRDECVKALDHHASIQPLVTLTIW  63



>ref|XP_008340067.1| PREDICTED: uncharacterized protein LOC103403035 [Malus domestica]
Length=98

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -1

Query  862  SAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAY  689
            S  YI MV HLIE CL+ +MS+++C++ L++HA+I+PL+T TVW+EL+KEN+ FF+AY
Sbjct  15   SQSYIRMVQHLIERCLLLQMSRDQCVKVLAEHASIRPLVTLTVWRELQKENRHFFQAY  72



>emb|CBI28559.3| unnamed protein product [Vitis vinifera]
Length=99

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI  V HLIE CL+ +MS+++C++AL++HA I PL+T TVW
Sbjct  17   YIRTVQHLIERCLLLRMSRDQCIKALAEHARIWPLVTLTVW  57



>gb|KDO82358.1| hypothetical protein CISIN_1g034241mg [Citrus sinensis]
Length=100

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAY  689
            YI MV HLIE CL+  MS+++C++AL++HA I+PL+T TVW+EL+KENK+FF AY
Sbjct  18   YIRMVQHLIERCLLLHMSRDQCIKALAEHAGIRPLVTLTVWRELQKENKDFFRAY  72



>ref|XP_004509574.1| PREDICTED: uncharacterized protein LOC101509029 [Cicer arietinum]
Length=101

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV +LIE CL+F MS+++C++AL++HA I+PL+T TVW
Sbjct  20   YIMMVQNLIERCLIFHMSQDQCIKALAEHAGIKPLVTITVW  60



>ref|XP_006438331.1| hypothetical protein CICLE_v10033163mg [Citrus clementina]
 ref|XP_006483896.1| PREDICTED: uncharacterized protein LOC102625185 [Citrus sinensis]
 gb|ESR51571.1| hypothetical protein CICLE_v10033163mg [Citrus clementina]
Length=100

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAY  689
            YI MV HLIE CL+  MS+++C++AL++HA+I+PL+T TVW+EL+KENK+FF AY
Sbjct  18   YIRMVQHLIERCLLLHMSRDQCIKALAEHASIRPLVTLTVWRELQKENKDFFRAY  72



>ref|XP_010651547.1| PREDICTED: uncharacterized protein LOC104879657 isoform X1 [Vitis 
vinifera]
Length=104

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI  V HLIE CL+ +MS+++C++AL++HA I PL+T TVW
Sbjct  22   YIRTVQHLIERCLLLRMSRDQCIKALAEHARIWPLVTLTVW  62



>ref|NP_001117263.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE28619.1| uncharacterized protein AT1G10657 [Arabidopsis thaliana]
Length=106

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV H+IE C++ +M+++EC++AL  HA+I PL+T TVW
Sbjct  23   YIRMVQHMIERCILLRMTRDECVKALDHHASILPLVTLTVW  63



>ref|XP_006417439.1| hypothetical protein EUTSA_v10009171mg [Eutrema salsugineum]
 gb|ESQ35792.1| hypothetical protein EUTSA_v10009171mg [Eutrema salsugineum]
Length=103

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV H+IE C++ +M+++EC++AL  HA+I PL+T TVW
Sbjct  23   YIRMVQHMIERCILLRMTRDECVKALDHHASILPLVTLTVW  63



>ref|XP_010044610.1| PREDICTED: uncharacterized protein LOC104433525 isoform X3 [Eucalyptus 
grandis]
Length=112

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -1

Query  856  EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
             YI +V HLIE CL+  M++++C++AL +HA I P+IT TVW
Sbjct  17   SYIRLVQHLIERCLLLHMTRDQCIKALYRHAGIHPIITFTVW  58



>ref|XP_010044609.1| PREDICTED: uncharacterized protein LOC104433525 isoform X2 [Eucalyptus 
grandis]
 gb|KCW86701.1| hypothetical protein EUGRSUZ_B03311 [Eucalyptus grandis]
Length=119

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -1

Query  856  EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
             YI +V HLIE CL+  M++++C++AL +HA I P+IT TVW
Sbjct  17   SYIRLVQHLIERCLLLHMTRDQCIKALYRHAGIHPIITFTVW  58



>ref|XP_010044608.1| PREDICTED: uncharacterized protein LOC104433525 isoform X1 [Eucalyptus 
grandis]
Length=122

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -1

Query  856  EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
             YI +V HLIE CL+  M++++C++AL +HA I P+IT TVW
Sbjct  17   SYIRLVQHLIERCLLLHMTRDQCIKALYRHAGIHPIITFTVW  58



>ref|XP_007226033.1| hypothetical protein PRUPE_ppa013869mg [Prunus persica]
 gb|EMJ27232.1| hypothetical protein PRUPE_ppa013869mg [Prunus persica]
Length=98

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  856  EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
             YI MV HLIE CL+  MS ++C++AL++HA+I+P++T TVW
Sbjct  17   SYIRMVQHLIERCLLLHMSCDQCIKALAEHASIRPIVTLTVW  58



>ref|XP_008389679.1| PREDICTED: uncharacterized protein LOC103451994 [Malus domestica]
Length=100

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV HLIE CL+  M++++C++ L++HA I+PL+T TVW
Sbjct  18   YIRMVQHLIERCLLLHMNRDQCIKVLAEHARIRPLVTLTVW  58



>gb|ABK28322.1| unknown [Arabidopsis thaliana]
Length=102

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV H+IE C++ +M+++EC++AL  HA+I PL+T TVW
Sbjct  23   YIRMVQHMIERCILLRMTRDECVKALDHHASILPLVTLTVW  63



>ref|XP_010251197.1| PREDICTED: uncharacterized protein LOC104593166 isoform X1 [Nelumbo 
nucifera]
Length=107

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  856  EYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITST  737
             YI MVHHLIE CL+  M++++C++AL+ HA I+PLIT T
Sbjct  16   RYIRMVHHLIERCLLLGMTRDDCVKALAVHAKIRPLITLT  55



>gb|EPS59396.1| hypothetical protein M569_15415 [Genlisea aurea]
Length=89

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffEAYKKQGR  674
            YI MV +LIE CLMF+M ++EC+E L++HA I+P +T  VW+EL KENKEFF+AY    R
Sbjct  21   YIRMVQNLIEWCLMFRMDRDECVETLARHARIRPPVTLAVWRELLKENKEFFDAYFTYDR  80

Query  673  EESAEIME  650
             E+  + +
Sbjct  81   SEATHLCD  88



>ref|XP_010232537.1| PREDICTED: uncharacterized protein LOC100836743 isoform X1 [Brachypodium 
distachyon]
Length=111

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -1

Query  874  MGDASAEYIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVWkelekenkeffE  695
            +G ++      V HLIE+C+ + M +EEC++ L K ANI P +TSTVWKELEKEN+EFFE
Sbjct  18   VGRSAGHPDMQVQHLIEKCICYNMDREECVKTLEKQANIMPTVTSTVWKELEKENREFFE  77

Query  694  AYKKQ  680
             YKK+
Sbjct  78   TYKKE  82



>ref|NP_001077507.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABF59198.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH19720.1| AT1G10657 [Arabidopsis thaliana]
 gb|AEE28617.1| uncharacterized protein AT1G10657 [Arabidopsis thaliana]
Length=101

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  853  YIHMVHHLIEECLMFKMSKEECMEALSKHANIQPLITSTVW  731
            YI MV H+IE C++ +M+++EC++AL  HA+I PL+T TVW
Sbjct  23   YIRMVQHMIERCILLRMTRDECVKALDHHASILPLVTLTVW  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2424532346784