BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c85108_g1_i1 len=1310 path=[1:0-1309]

Length=1310
                                                                      Score     E

emb|CAJ46252.1|  putrescine N-methyltransferase                         604   0.0      Calystegia sepium
dbj|BAA82262.1|  putrescine N-methyltransferase 2                       545   0.0      Atropa belladonna [deadly nightshade]
dbj|BAA82263.1|  putrescine N-methyltransferase                         542   0.0      Hyoscyamus niger [black henbane]
gb|ACF21006.1|  putrescine N-methyltransferase 2                        541   0.0      Anisodus acutangulus
ref|XP_004244762.1|  PREDICTED: putrescine N-methyltransferase 2 ...    540   0.0      
ref|XP_009606202.1|  PREDICTED: putrescine N-methyltransferase 1        538   0.0      
ref|XP_009771961.1|  PREDICTED: putrescine N-methyltransferase 2        520   2e-180   
sp|Q9SEH7.1|PMT2_TOBAC  RecName: Full=Putrescine N-methyltransfer...    518   9e-180   Nicotiana tabacum [American tobacco]
emb|CAE53633.1|  putrescine N-methyltransferase                         517   2e-179   Solanum tuberosum [potatoes]
gb|AGL76988.1|  putrescine N-methyltransferase                          516   3e-179   
gb|AAT99576.1|  putrescine N-methyltransferase                          516   3e-179   Anisodus tanguticus
emb|CAQ19733.1|  putrescine N-methyltransferase                         516   5e-179   Solanum dulcamara [climbing nightshade]
ref|XP_009771962.1|  PREDICTED: putrescine N-methyltransferase 3        517   5e-179   
gb|ACF21005.1|  putrescine N-methyltransferase 1                        514   1e-178   Anisodus acutangulus
dbj|BAA74544.1|  putrescine N-methyltransferase                         517   4e-178   Nicotiana sylvestris
emb|CAE47481.1|  putrescine N-methyltransferase                         513   5e-178   Datura stramonium [common thornapple]
gb|AAY53933.1|  tropane alkaloid biosynthesis protein                   514   5e-178   Scopolia parviflora
gb|AAK49871.1|AF280403_1  putrescine N-methyltransferase 2              513   1e-177   Nicotiana attenuata
sp|Q9SEH4.1|PMT4_TOBAC  RecName: Full=Putrescine N-methyltransfer...    514   4e-177   Nicotiana tabacum [American tobacco]
gb|AAK49870.1|AF280402_1  putrescine N-methyltransferase 1              513   5e-177   Nicotiana attenuata
gb|AAF14879.1|AF126810_1  putrescine N-methyltransferase                512   5e-177   Nicotiana tabacum [American tobacco]
emb|CAJ46253.1|  putrescine N-methyltransferase 1                       510   6e-177   Datura inoxia [downy thornapple]
gb|ABY25273.1|  putrescine N-methyltransferase                          511   1e-176   Nicotiana benthamiana
ref|XP_009786666.1|  PREDICTED: putrescine N-methyltransferase 4 ...    511   1e-176   
sp|Q42963.1|PMT1_TOBAC  RecName: Full=Putrescine N-methyltransfer...    511   2e-176   Nicotiana tabacum [American tobacco]
ref|XP_009786665.1|  PREDICTED: putrescine N-methyltransferase 4 ...    513   2e-176   
ref|XP_006351049.1|  PREDICTED: putrescine N-methyltransferase 2-...    509   2e-176   
dbj|BAA82261.1|  putrescine N-methyltransferase 1                       509   2e-176   Atropa belladonna [deadly nightshade]
gb|AGC24706.1|  PMT                                                     509   5e-176   
gb|AAQ94738.1|  putrescine methyl transferase                           504   2e-174   Datura metel
emb|CAJ46254.1|  putrescine N-methyltransferase 2                       504   2e-174   Datura inoxia [downy thornapple]
emb|CAJ46255.1|  putrescine N-methyltransferase                         501   2e-173   Physalis divaricata
ref|NP_001233790.1|  putrescine N-methyltransferase                     501   3e-173   
ref|XP_006350699.1|  PREDICTED: putrescine N-methyltransferase 3-...    498   7e-172   
ref|XP_007044553.1|  Spermidine synthase 1                              464   1e-158   
gb|AGW82430.1|  spermidine synthase                                     462   3e-158   
ref|XP_011086544.1|  PREDICTED: spermidine synthase                     461   6e-158   
ref|XP_010552638.1|  PREDICTED: spermidine synthase 1                   461   2e-157   
ref|XP_011071079.1|  PREDICTED: spermidine synthase 1-like              459   4e-157   
ref|XP_006438425.1|  hypothetical protein CICLE_v10031988mg             458   2e-156   
ref|XP_010271957.1|  PREDICTED: spermidine synthase 1                   459   4e-156   
ref|XP_004237263.1|  PREDICTED: spermidine synthase 1                   455   9e-156   
sp|Q96556.1|SPD1_DATST  RecName: Full=Spermidine synthase 1; Shor...    454   2e-155   Datura stramonium [common thornapple]
gb|KDO82498.1|  hypothetical protein CISIN_1g019187mg                   456   2e-155   
ref|XP_010251305.1|  PREDICTED: spermidine synthase 1                   455   4e-155   
gb|EYU31283.1|  hypothetical protein MIMGU_mgv1a010658mg                452   1e-154   
sp|O82147.1|SPDE_COFAR  RecName: Full=Spermidine synthase; Short=...    452   3e-154   Coffea arabica [arabica coffee]
sp|O48659.1|SPD2_HYONI  RecName: Full=Spermidine synthase 2; Shor...    451   3e-154   Hyoscyamus niger [black henbane]
ref|XP_009385312.1|  PREDICTED: spermidine synthase 2-like              452   4e-154   
ref|XP_010023584.1|  PREDICTED: spermidine synthase 1                   452   7e-154   
ref|XP_006340116.1|  PREDICTED: spermidine synthase 1-like              450   8e-154   
gb|AHL84162.1|  spermidine synthase                                     452   9e-154   
gb|EYU22481.1|  hypothetical protein MIMGU_mgv1a010375mg                450   1e-153   
ref|XP_003613246.1|  Spermidine synthase                                451   1e-153   
ref|XP_008221787.1|  PREDICTED: spermidine synthase                     450   3e-153   
ref|NP_001289514.1|  spermidine synthase                                449   3e-153   
gb|AEX20346.1|  spermidine synthase                                     450   4e-153   
ref|XP_010551561.1|  PREDICTED: spermidine synthase 1-like              450   6e-153   
emb|CAM35497.1|  spermidine synthase                                    448   2e-152   Lotus japonicus
gb|ACT21542.1|  spermidine synthase                                     448   2e-152   Panax ginseng [Chinese ginseng]
ref|XP_009785991.1|  PREDICTED: spermidine synthase 1                   447   2e-152   
ref|XP_004489856.1|  PREDICTED: spermidine synthase 1-like              447   4e-152   
gb|AIL49302.1|  spermidine synthase                                     447   6e-152   
gb|ABF66657.1|  spermidine synthase                                     447   6e-152   Ammopiptanthus mongolicus
ref|XP_010942212.1|  PREDICTED: spermidine synthase 1                   447   7e-152   
ref|XP_002534321.1|  spermidine synthase 1, putative                    446   1e-151   Ricinus communis
ref|XP_006302420.1|  hypothetical protein CARUB_v10020501mg             447   1e-151   
ref|XP_007222503.1|  hypothetical protein PRUPE_ppa008283mg             446   2e-151   
gb|KDP26563.1|  hypothetical protein JCGZ_17721                         446   2e-151   
gb|AFH96952.1|  spermidine synthase                                     445   2e-151   
ref|XP_009115499.1|  PREDICTED: spermidine synthase 1                   445   3e-151   
sp|Q9ZTR1.1|SPD1_PEA  RecName: Full=Spermidine synthase 1; Short=...    444   4e-151   Pisum sativum [garden pea]
ref|XP_010471027.1|  PREDICTED: spermidine synthase 2-like              444   6e-151   
ref|XP_009363529.1|  PREDICTED: spermidine synthase                     443   6e-151   
ref|XP_003561251.1|  PREDICTED: spermidine synthase 1                   446   6e-151   
ref|XP_008779450.1|  PREDICTED: spermidine synthase 1-like              444   7e-151   
ref|XP_010415708.1|  PREDICTED: spermidine synthase 2                   444   8e-151   
ref|XP_002263762.1|  PREDICTED: spermidine synthase 2                   443   9e-151   Vitis vinifera
ref|XP_009395504.1|  PREDICTED: spermidine synthase 1-like              443   1e-150   
emb|CBI32130.3|  unnamed protein product                                442   1e-150   
ref|XP_002311589.1|  spermidine synthase family protein                 443   2e-150   Populus trichocarpa [western balsam poplar]
gb|EMS48579.1|  Spermidine synthase 1                                   442   2e-150   
gb|ACN27352.1|  unknown                                                 442   3e-150   Zea mays [maize]
gb|ACZ73829.1|  spermidine synthase                                     442   3e-150   Olea europaea
ref|XP_011025698.1|  PREDICTED: spermidine synthase 2                   442   4e-150   
ref|NP_001280805.1|  uncharacterized protein LOC103451952               442   5e-150   
ref|XP_006662051.1|  PREDICTED: spermidine synthase 1-like isofor...    441   6e-150   
ref|XP_008446225.1|  PREDICTED: spermidine synthase                     441   6e-150   
ref|XP_004297643.1|  PREDICTED: spermidine synthase 1-like              441   6e-150   
ref|XP_010477685.1|  PREDICTED: spermidine synthase 1-like              444   7e-150   
ref|NP_001140791.1|  hypothetical protein                               441   7e-150   Zea mays [maize]
ref|NP_001059438.1|  Os07g0408700                                       441   9e-150   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006416052.1|  hypothetical protein EUTSA_v10007822mg             443   1e-149   
ref|XP_010929093.1|  PREDICTED: spermidine synthase 1-like              441   1e-149   
ref|NP_001234493.1|  spermidine synthase                                441   1e-149   
ref|XP_010498889.1|  PREDICTED: spermidine synthase 1-like              443   1e-149   
ref|XP_010460158.1|  PREDICTED: spermidine synthase 1                   442   2e-149   
sp|Q96557.1|SPD2_DATST  RecName: Full=Spermidine synthase 2; Shor...    439   2e-149   Datura stramonium [common thornapple]
ref|XP_002888767.1|  hypothetical protein ARALYDRAFT_476155             440   2e-149   
sp|Q9ZUB3.1|SPD1_ARATH  RecName: Full=Spermidine synthase 1; Shor...    440   2e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890597.1|  hypothetical protein ARALYDRAFT_889925             442   3e-149   
gb|EPS71978.1|  spermidine synthase 1                                   438   3e-149   
ref|NP_001149286.1|  LOC100282908                                       441   4e-149   Zea mays [maize]
ref|XP_002315806.1|  spermidine synthase family protein                 439   4e-149   Populus trichocarpa [western balsam poplar]
gb|KFK44455.1|  hypothetical protein AALP_AA1G259000                    439   4e-149   
gb|KGN51816.1|  hypothetical protein Csa_5G602150                       439   5e-149   
emb|CAO02391.1|  spermidine synthase                                    439   5e-149   Cochlearia officinalis [scurvy-grass]
sp|O48658.1|SPD1_HYONI  RecName: Full=Spermidine synthase 1; Shor...    438   5e-149   Hyoscyamus niger [black henbane]
ref|XP_006305089.1|  hypothetical protein CARUB_v10009456mg             441   5e-149   
ref|XP_004956020.1|  PREDICTED: spermidine synthase 1-like              439   5e-149   
ref|NP_173794.2|  spermidine synthase 1                                 440   1e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427802.1|  PREDICTED: spermidine synthase 2                   439   1e-148   
ref|NP_001275022.1|  spermidine synthase-like                           439   1e-148   
dbj|BAC55523.1|  spermidine synthase                                    437   1e-148   Petunia x hybrida [garden petunia]
ref|XP_008340017.1|  PREDICTED: spermidine synthase 1-like isofor...    438   2e-148   
gb|AET79382.1|  spermidine synthase                                     437   5e-148   
ref|XP_010324709.1|  PREDICTED: putrescine N-methyltransferase 2 ...    435   5e-148   
gb|EEC81895.1|  hypothetical protein OsI_25717                          441   7e-148   Oryza sativa Indica Group [Indian rice]
ref|XP_010682580.1|  PREDICTED: spermidine synthase 1                   436   1e-147   
ref|NP_001267711.1|  spermidine synthase-like                           435   1e-147   
gb|KHN00346.1|  Spermidine synthase 1                                   436   1e-147   
emb|CDY59080.1|  BnaA09g54560D                                          436   2e-147   
ref|XP_011021626.1|  PREDICTED: spermidine synthase 1-like              435   2e-147   
ref|XP_009412314.1|  PREDICTED: spermidine synthase 2-like              435   2e-147   
ref|NP_001241525.1|  uncharacterized protein LOC100790506               435   3e-147   
emb|CDY47635.1|  BnaC05g18910D                                          435   4e-147   
ref|NP_177188.1|  Spermidine synthase 2                                 434   5e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007157469.1|  hypothetical protein PHAVU_002G072200g             434   5e-147   
ref|XP_004509836.1|  PREDICTED: spermidine synthase 2-like              434   5e-147   
ref|NP_001239861.1|  uncharacterized protein LOC100792107               434   5e-147   
ref|XP_009110079.1|  PREDICTED: spermidine synthase 1-like              434   5e-147   
sp|Q9ZTR0.1|SPD2_PEA  RecName: Full=Spermidine synthase 2; Short=...    434   6e-147   Pisum sativum [garden pea]
ref|XP_007153640.1|  hypothetical protein PHAVU_003G052600g             433   2e-146   
ref|XP_003552013.1|  PREDICTED: spermidine synthase 2                   432   2e-146   
ref|XP_006857635.1|  hypothetical protein AMTR_s00061p00133330          432   3e-146   
gb|KEH27761.1|  spermidine synthase                                     432   4e-146   
ref|XP_009103153.1|  PREDICTED: spermidine synthase 1-like              431   6e-146   
emb|CDX91725.1|  BnaC08g06440D                                          431   7e-146   
ref|XP_003532012.1|  PREDICTED: spermidine synthase 2 isoform 1         431   1e-145   
emb|CDY57319.1|  BnaA08g20290D                                          431   1e-145   
gb|KHN10600.1|  Spermidine synthase 2                                   430   2e-145   
dbj|BAA24536.1|  spermidine synthase                                    428   4e-145   Arabidopsis thaliana [mouse-ear cress]
gb|KEH19965.1|  spermidine synthase                                     429   4e-145   
ref|XP_010100485.1|  Spermidine synthase                                429   7e-145   
ref|XP_009631179.1|  PREDICTED: spermidine synthase 1-like              427   8e-145   
emb|CDY28474.1|  BnaC07g13020D                                          427   3e-144   
ref|XP_009623577.1|  PREDICTED: spermidine synthase                     427   3e-144   
pdb|1XJ5|A  Chain A, X-Ray Structure Of Spermidine Synthase From ...    426   8e-144   
ref|XP_006655571.1|  PREDICTED: spermidine synthase 1-like              422   4e-143   
dbj|BAF91875.1|  spermidine synthase                                    421   7e-143   Nicotiana benthamiana
gb|ADK89558.1|  spermidine synthase                                     425   8e-143   
gb|ADQ37303.1|  putative spermidine synthase                            421   7e-142   
emb|CDY28473.1|  BnaC07g13010D                                          421   7e-142   
tpg|DAA60340.1|  TPA: hypothetical protein ZEAMMB73_606346              419   8e-142   
gb|AFJ11561.1|  putrescine N-methyltransferase                          417   9e-142   
gb|ABK23753.1|  unknown                                                 420   2e-141   Picea sitchensis
dbj|BAA74543.1|  putrescine N-methyltransferase                         416   5e-140   Nicotiana sylvestris
gb|AAW30410.1|  spermidine synthase X                                   414   6e-140   Silene latifolia
ref|NP_001281060.1|  uncharacterized protein LOC103403001               414   9e-140   
gb|KHG11978.1|  Spermidine synthase                                     413   9e-139   
gb|AAW30409.1|  spermidine synthase                                     409   3e-138   Silene vulgaris [maiden's-tears]
gb|AAW30411.1|  spermidine synthase Y                                   406   7e-137   Silene latifolia
ref|XP_008778867.1|  PREDICTED: spermidine synthase 1-like              402   5e-135   
gb|ACB86615.1|  putative spermidine synthase                            399   3e-134   Silene diclinis
ref|XP_001752964.1|  predicted protein                                  401   7e-134   
gb|ACB86613.1|  putative spermidine synthase                            396   4e-133   Silene conica
gb|ACB86612.1|  putative spermidine synthase                            393   4e-132   Silene noctiflora [sticky cockle]
gb|ACB86614.1|  putative spermidine synthase                            392   2e-131   Silene diclinis
gb|ACB86617.1|  putative spermidine synthase                            391   3e-131   Silene dioica [morning campion]
ref|XP_001757204.1|  predicted protein                                  392   3e-130   
gb|ABZ01527.1|  spermidine synthase X                                   387   8e-130   Silene latifolia
gb|ABZ01524.1|  spermidine synthase X                                   387   1e-129   Silene latifolia
gb|ABZ01528.1|  spermidine synthase X                                   386   2e-129   Silene latifolia
gb|ABZ01548.1|  spermidine synthase X                                   386   2e-129   Silene latifolia
ref|XP_008776841.1|  PREDICTED: spermine synthase-like isoform X1       389   1e-128   
ref|XP_006850528.1|  hypothetical protein AMTR_s00159p00023000          387   3e-128   
emb|CDY25802.1|  BnaA07g09800D                                          384   5e-128   
gb|ABZ01566.1|  spermidine synthase X                                   382   5e-128   Silene vulgaris [maiden's-tears]
ref|XP_010913625.1|  PREDICTED: spermine synthase-like isoform X1       387   9e-128   
ref|XP_002453195.1|  hypothetical protein SORBIDRAFT_04g001510          385   2e-127   Sorghum bicolor [broomcorn]
ref|XP_009378778.1|  PREDICTED: spermine synthase-like                  384   8e-127   
ref|XP_002453626.1|  hypothetical protein SORBIDRAFT_04g009230          384   2e-126   Sorghum bicolor [broomcorn]
ref|XP_008234722.1|  PREDICTED: spermine synthase isoform X1            382   2e-126   
ref|XP_008677069.1|  PREDICTED: uncharacterized protein LOC100279...    382   9e-126   
ref|NP_001149310.1|  spermidine synthase 1                              381   2e-125   Zea mays [maize]
ref|XP_004951294.1|  PREDICTED: spermine synthase-like                  381   2e-125   
gb|ACG33952.1|  spermidine synthase 1                                   381   2e-125   Zea mays [maize]
ref|XP_008234725.1|  PREDICTED: spermine synthase isoform X2            378   3e-125   
ref|XP_002974059.1|  hypothetical protein SELMODRAFT_149426             377   2e-124   
ref|XP_006350698.1|  PREDICTED: spermidine synthase 2-like              375   2e-124   
ref|XP_006647125.1|  PREDICTED: spermine synthase-like                  378   3e-124   
ref|XP_009396566.1|  PREDICTED: spermine synthase-like isoform X1       377   3e-124   
gb|ACD87085.1|  spermidine synthase 3                                   378   3e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002983431.1|  hypothetical protein SELMODRAFT_271631             377   4e-124   
gb|AAQ14853.1|AF321139_1  spermidine synthase                           373   4e-124   Nicotiana tabacum [American tobacco]
gb|EEC72856.1|  hypothetical protein OsI_06609                          378   5e-124   Oryza sativa Indica Group [Indian rice]
dbj|BAD29687.1|  putative aminopropyl transferase                       378   5e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004241004.1|  PREDICTED: spermidine synthase 2-like              375   5e-124   
ref|XP_004307972.1|  PREDICTED: spermine synthase-like                  375   2e-123   
ref|XP_004145928.1|  PREDICTED: spermine synthase-like                  375   3e-123   
ref|XP_008343788.1|  PREDICTED: spermine synthase-like                  374   4e-123   
gb|ACU18139.1|  unknown                                                 370   4e-123   Glycine max [soybeans]
ref|XP_007038989.1|  Spermidine synthase 3 isoform 3                    374   8e-123   
ref|XP_003572094.1|  PREDICTED: spermine synthase-like                  374   1e-122   
ref|XP_007218153.1|  hypothetical protein PRUPE_ppa007399mg             373   1e-122   
gb|KHG00313.1|  Spermine synthase                                       372   3e-122   
ref|XP_010049302.1|  PREDICTED: spermine synthase isoform X2            371   6e-122   
ref|XP_007038987.1|  Spermidine synthase 3 isoform 1                    372   6e-122   
ref|XP_010049294.1|  PREDICTED: spermine synthase isoform X1            371   6e-122   
ref|XP_008382792.1|  PREDICTED: spermine synthase-like                  370   1e-121   
ref|XP_010915659.1|  PREDICTED: LOW QUALITY PROTEIN: spermine syn...    372   1e-121   
emb|CDP05080.1|  unnamed protein product                                370   2e-121   
ref|XP_008441613.1|  PREDICTED: spermine synthase-like                  370   2e-121   
ref|XP_008437587.1|  PREDICTED: spermine synthase                       369   3e-121   
ref|XP_009351994.1|  PREDICTED: spermine synthase-like                  369   8e-121   
dbj|BAK01445.1|  predicted protein                                      369   1e-120   
gb|EMT24635.1|  Spermidine synthase                                     368   1e-120   
emb|CDY25803.1|  BnaA07g09790D                                          365   2e-120   
ref|XP_006401743.1|  hypothetical protein EUTSA_v10013929mg             367   3e-120   
ref|NP_568785.1|  Spermine synthase                                     366   4e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119852.1|  PREDICTED: spermine synthase-like                  366   4e-120   
dbj|BAH19534.1|  AT5G53120                                              366   5e-120   Arabidopsis thaliana [mouse-ear cress]
gb|KDP22157.1|  hypothetical protein JCGZ_25988                         366   5e-120   
ref|XP_010103219.1|  Spermine synthase                                  367   6e-120   
emb|CDY49457.1|  BnaA10g06470D                                          365   8e-120   
ref|XP_004150312.1|  PREDICTED: spermine synthase-like                  366   8e-120   
ref|XP_006350697.1|  PREDICTED: spermidine synthase 2-like              362   9e-120   
ref|XP_008776842.1|  PREDICTED: spermine synthase-like isoform X2       365   1e-119   
ref|XP_003602215.1|  Spermidine synthase                                365   1e-119   
gb|AAL11565.1|AF424571_1  AT5g53120/MFH8_5                              365   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002318386.2|  hypothetical protein POPTR_0012s01730g             364   2e-119   Populus trichocarpa [western balsam poplar]
gb|EMS58513.1|  Spermine synthase                                       365   3e-119   
emb|CDO96633.1|  spermine synthase                                      364   4e-119   
emb|CBI22532.3|  unnamed protein product                                363   4e-119   
emb|CDY19678.1|  BnaC09g29340D                                          364   4e-119   
ref|XP_006577863.1|  PREDICTED: uncharacterized protein LOC100816...    361   4e-119   
ref|XP_006490517.1|  PREDICTED: spermine synthase-like isoform X1       364   5e-119   
dbj|BAB08415.1|  spermidine synthase                                    363   6e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010913642.1|  PREDICTED: spermine synthase-like isoform X2       363   6e-119   
ref|XP_002270790.1|  PREDICTED: spermine synthase                       363   6e-119   Vitis vinifera
ref|XP_006438426.1|  hypothetical protein CICLE_v10031988mg             362   8e-119   
ref|XP_007136557.1|  hypothetical protein PHAVU_009G054800g             363   1e-118   
ref|XP_002864224.1|  hypothetical protein ARALYDRAFT_495379             362   1e-118   
emb|CAN73402.1|  hypothetical protein VITISV_020278                     363   1e-118   Vitis vinifera
ref|XP_008393049.1|  PREDICTED: spermidine synthase 2-like              362   1e-118   
gb|KDO82499.1|  hypothetical protein CISIN_1g019187mg                   361   2e-118   
ref|XP_002513571.1|  spermidine synthase 1, putative                    362   2e-118   Ricinus communis
ref|XP_006280696.1|  hypothetical protein CARUB_v10026659mg             362   2e-118   
emb|CDY27025.1|  BnaA02g10450D                                          361   3e-118   
ref|XP_009127192.1|  PREDICTED: spermine synthase                       361   4e-118   
gb|AAM64782.1|  spermidine synthase                                     360   4e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010671486.1|  PREDICTED: spermine synthase isoform X1            361   7e-118   
ref|XP_010445566.1|  PREDICTED: spermine synthase-like                  360   8e-118   
ref|XP_010671488.1|  PREDICTED: spermine synthase isoform X2            359   8e-118   
emb|CDP00181.1|  unnamed protein product                                358   8e-118   
ref|NP_001242248.1|  uncharacterized protein LOC100816988               360   9e-118   
ref|XP_010442869.1|  PREDICTED: spermine synthase                       360   9e-118   
emb|CDX96194.1|  BnaC02g14570D                                          362   9e-118   
ref|XP_008783858.1|  PREDICTED: spermine synthase-like isoform X4       360   2e-117   
ref|XP_009592342.1|  PREDICTED: spermine synthase                       360   2e-117   
emb|CAM35498.1|  spermine synthase                                      359   3e-117   Lotus japonicus
ref|XP_011001891.1|  PREDICTED: spermine synthase-like                  359   3e-117   
gb|AII99819.1|  SPM1 protein                                            358   5e-117   
ref|XP_003528156.1|  PREDICTED: spermidine synthase-like                357   6e-117   
gb|EMT31105.1|  Spermidine synthase 1                                   353   1e-116   
ref|XP_003526698.1|  PREDICTED: spermine synthase-like isoform X1       357   1e-116   
ref|XP_011076013.1|  PREDICTED: spermine synthase                       357   2e-116   
gb|AAV80841.1|  spermidine synthase                                     352   2e-116   Phaseolus vulgaris [French bean]
ref|XP_008783853.1|  PREDICTED: spermine synthase-like isoform X2       360   3e-116   
ref|XP_010482696.1|  PREDICTED: spermine synthase-like isoform X1       356   4e-116   
ref|XP_010261580.1|  PREDICTED: spermine synthase                       357   4e-116   
ref|XP_009415482.1|  PREDICTED: spermine synthase-like                  356   4e-116   
ref|NP_001190527.1|  Spermine synthase                                  357   4e-116   
gb|EYU25208.1|  hypothetical protein MIMGU_mgv1a008990mg                355   1e-115   
gb|KGN63593.1|  hypothetical protein Csa_1G005540                       355   1e-115   
ref|XP_010521397.1|  PREDICTED: spermine synthase isoform X2            355   2e-115   
ref|XP_004155011.1|  PREDICTED: spermidine synthase-like                354   3e-115   
ref|XP_010521396.1|  PREDICTED: spermine synthase isoform X1            354   6e-115   
ref|XP_006350569.1|  PREDICTED: spermine synthase-like                  353   7e-115   
gb|KDO46749.1|  hypothetical protein CISIN_1g016578mg                   353   1e-114   
ref|NP_973900.2|  spermidine synthase 1                                 350   2e-114   
ref|XP_008453103.1|  PREDICTED: spermidine synthase 2-like isofor...    351   4e-114   
ref|XP_006379818.1|  hypothetical protein POPTR_0008s14650g             348   5e-114   
ref|NP_001057773.1|  Os06g0528600                                       351   1e-113   
ref|NP_001234407.1|  SPM1 protein                                       349   1e-113   
ref|XP_004965516.1|  PREDICTED: spermine synthase-like isoform X1       350   1e-113   
ref|XP_002321935.2|  hypothetical protein POPTR_0015s00210g             349   3e-113   
ref|XP_010537109.1|  PREDICTED: LOW QUALITY PROTEIN: spermine syn...    348   3e-113   
ref|XP_006656137.1|  PREDICTED: spermine synthase-like                  349   6e-113   
gb|ACO57441.1|  spermidine synthase I                                   348   8e-113   
ref|XP_007036172.1|  Spermidine synthase 1                              347   8e-113   
ref|NP_001105842.1|  spermidine synthase                                348   2e-112   
ref|XP_003563796.1|  PREDICTED: spermine synthase-like isoform X1       346   9e-112   
ref|XP_008783854.1|  PREDICTED: spermine synthase-like isoform X3       347   9e-112   
ref|XP_002280061.1|  PREDICTED: spermidine synthase 2                   344   2e-111   
ref|XP_008659040.1|  PREDICTED: spermidine synthase isoform X2          344   2e-111   
gb|ACG48418.1|  spermidine synthase 1                                   344   5e-111   
ref|XP_004502127.1|  PREDICTED: spermidine synthase-like                342   6e-111   
ref|XP_008239792.1|  PREDICTED: spermidine synthase 2-like              348   6e-111   
gb|ACN34900.1|  unknown                                                 343   8e-111   
dbj|BAK05930.1|  predicted protein                                      343   1e-110   
ref|XP_008783851.1|  PREDICTED: spermine synthase-like isoform X1       346   1e-110   
gb|KEH40403.1|  spermine/spermidine synthase                            342   2e-110   
ref|XP_004498439.1|  PREDICTED: spermine synthase-like                  339   1e-109   
gb|AHJ14574.1|  spermidine synthase                                     340   2e-109   
gb|AHJ14572.1|  spermidine synthase                                     340   3e-109   
ref|XP_006439782.1|  hypothetical protein CICLE_v10024359mg             337   3e-109   
gb|AEL33692.1|  spermidine synthase                                     339   3e-109   
ref|XP_009396567.1|  PREDICTED: spermine synthase-like isoform X2       337   3e-109   
ref|XP_007210036.1|  hypothetical protein PRUPE_ppa017088mg             338   5e-109   
ref|XP_002437065.1|  hypothetical protein SORBIDRAFT_10g020570          337   2e-108   
gb|KHN19320.1|  Spermidine synthase 2                                   335   4e-108   
ref|XP_006477539.1|  PREDICTED: spermidine synthase 1-like              336   1e-107   
ref|XP_010028157.1|  PREDICTED: spermidine synthase 1-like isofor...    334   1e-107   
ref|XP_004138285.1|  PREDICTED: spermidine synthase 2-like              331   5e-107   
gb|AER27719.1|  spermidine synthase                                     326   2e-106   
ref|XP_006600651.1|  PREDICTED: spermidine synthase 2-like              330   3e-106   
ref|XP_002964137.1|  hypothetical protein SELMODRAFT_227474             329   5e-106   
gb|AER27718.1|  spermidine synthase                                     325   6e-106   
ref|XP_002993169.1|  hypothetical protein SELMODRAFT_449034             328   7e-106   
gb|KHN48603.1|  Spermidine synthase                                     328   9e-106   
ref|XP_006579563.1|  PREDICTED: spermidine synthase 2-like              328   2e-105   
ref|XP_010028163.1|  PREDICTED: spermidine synthase 1-like isofor...    328   5e-105   
ref|XP_006844244.1|  hypothetical protein AMTR_s00006p00268680          319   2e-103   
gb|KHN44223.1|  Spermine synthase                                       321   1e-102   
gb|KDP31122.1|  hypothetical protein JCGZ_11498                         320   2e-102   
gb|EMT30114.1|  Spermidine synthase 1                                   319   2e-102   
gb|KDO46751.1|  hypothetical protein CISIN_1g016578mg                   320   2e-102   
ref|XP_010913650.1|  PREDICTED: spermine synthase-like isoform X3       320   2e-102   
ref|XP_007155408.1|  hypothetical protein PHAVU_003G199000g             320   3e-102   
ref|XP_010101188.1|  Spermidine synthase 1                              320   1e-101   
ref|XP_010482697.1|  PREDICTED: spermine synthase-like isoform X2       315   4e-101   
ref|XP_007036170.1|  Spermidine synthase 1                              319   1e-100   
ref|XP_007155409.1|  hypothetical protein PHAVU_003G199000g             314   5e-100   
ref|XP_005647442.1|  spermidine synthase                                311   2e-99    
ref|XP_004300891.1|  PREDICTED: spermidine synthase 2-like              312   6e-99    
ref|XP_002511426.1|  spermidine synthase 1, putative                    311   1e-98    
ref|XP_011028723.1|  PREDICTED: spermidine synthase 1-like              311   2e-98    
gb|KEH35054.1|  spermidine synthase                                     309   3e-98    
ref|XP_003061691.1|  predicted protein                                  308   4e-98    
ref|NP_001239741.1|  uncharacterized protein LOC100792085               308   8e-98    
gb|EKC22547.1|  Spermidine synthase                                     306   2e-97    
ref|XP_005845386.1|  hypothetical protein CHLNCDRAFT_26108              306   2e-97    
ref|XP_006785580.1|  PREDICTED: spermidine synthase-like                305   4e-97    
ref|XP_007509632.1|  spermidine synthase                                305   9e-97    
ref|XP_004554226.1|  PREDICTED: spermidine synthase-like                303   2e-96    
ref|XP_003444845.1|  PREDICTED: spermidine synthase-like                303   2e-96    
ref|XP_010779492.1|  PREDICTED: spermidine synthase                     303   2e-96    
ref|XP_010913662.1|  PREDICTED: spermine synthase-like isoform X4       303   2e-96    
ref|XP_004070426.1|  PREDICTED: spermidine synthase-like                303   2e-96    
gb|KHN18469.1|  Spermidine synthase 2                                   303   2e-96    
ref|XP_002509074.1|  predicted protein                                  304   2e-96    
ref|XP_008316901.1|  PREDICTED: spermidine synthase                     302   3e-96    
ref|XP_006422175.1|  hypothetical protein CICLE_v10006705mg             303   7e-96    
ref|XP_008609164.1|  spermidine synthase                                302   1e-95    
ref|XP_008289191.1|  PREDICTED: spermidine synthase                     300   3e-95    
ref|XP_008411650.1|  PREDICTED: spermidine synthase                     300   3e-95    
ref|XP_007553389.1|  PREDICTED: spermidine synthase                     300   5e-95    
ref|XP_008446082.1|  PREDICTED: spermidine synthase 1-like              301   8e-95    
ref|XP_005808260.1|  PREDICTED: spermidine synthase-like                298   2e-94    
gb|KHN18482.1|  Spermidine synthase                                     300   2e-94    
emb|CAG07557.1|  unnamed protein product                                298   2e-94    
ref|XP_008998651.1|  PREDICTED: LOW QUALITY PROTEIN: spermidine s...    298   5e-94    
gb|KDO26346.1|  spermidine synthase                                     297   5e-94    
ref|XP_010729752.1|  PREDICTED: spermidine synthase                     296   6e-94    
gb|ESX02214.1|  Spermidine synthase                                     296   9e-94    
ref|XP_001702843.1|  spermidine synthase                                297   9e-94    
ref|XP_004152549.1|  PREDICTED: spermidine synthase 2-like              298   1e-93    
ref|XP_003471253.2|  PREDICTED: spermidine synthase                     296   2e-93    
ref|XP_007246840.1|  PREDICTED: spermidine synthase                     295   4e-93    
ref|NP_001244736.1|  spermidine synthase                                295   4e-93    
ref|XP_005528349.1|  PREDICTED: spermidine synthase                     294   6e-93    
gb|KCW89172.1|  hypothetical protein EUGRSUZ_A01487                     294   7e-93    
ref|XP_009396568.1|  PREDICTED: spermine synthase-like isoform X3       293   1e-92    
gb|KFM27712.1|  Spermidine synthase 2                                   294   1e-92    
ref|XP_003963284.1|  PREDICTED: spermidine synthase-like                293   2e-92    
gb|AAA36633.1|  spermidine synthase                                     293   2e-92    
ref|XP_514381.2|  PREDICTED: spermidine synthase                        293   2e-92    
ref|XP_005057787.1|  PREDICTED: spermidine synthase                     293   2e-92    
ref|XP_960907.1|  spermidine synthase                                   293   2e-92    
emb|CCC13317.1|  unnamed protein product                                293   2e-92    
gb|KDD76369.1|  spermine/spermidine synthase                            293   2e-92    
gb|EEH33393.2|  spermidine synthase                                     293   3e-92    
ref|NP_003123.2|  spermidine synthase                                   292   4e-92    
tpg|DAA60339.1|  TPA: hypothetical protein ZEAMMB73_606346              288   4e-92    
pdb|2O05|A  Chain A, Human Spermidine Synthase                          292   5e-92    
pdb|3RW9|A  Chain A, Crystal Structure Of Human Spermidine Syntha...    292   5e-92    
gb|EPY51674.1|  spermidine synthase                                     292   6e-92    
ref|XP_006642046.1|  PREDICTED: spermidine synthase-like                291   7e-92    
ref|XP_002128514.1|  PREDICTED: spermidine synthase                     292   7e-92    
ref|NP_957328.2|  spermidine synthase                                   291   8e-92    
gb|EAW71676.1|  spermidine synthase, isoform CRA_b                      292   9e-92    
ref|XP_001420452.1|  Spermidine synthase                                292   1e-91    
gb|EWM29611.1|  spermidine synthase                                     292   1e-91    
ref|XP_008120090.1|  PREDICTED: spermidine synthase                     291   1e-91    
ref|XP_002939455.1|  PREDICTED: spermidine synthase isoform X1          291   1e-91    
gb|EFX79208.1|  hypothetical protein DAPPUDRAFT_304917                  291   1e-91    
ref|NP_596015.1|  spermidine synthase (predicted)                       290   2e-91    
ref|XP_004347506.1|  spermidine synthase                                292   2e-91    
ref|XP_009060504.1|  hypothetical protein LOTGIDRAFT_218994             290   2e-91    
ref|XP_796573.2|  PREDICTED: spermidine synthase-like                   290   3e-91    
ref|XP_007978768.1|  PREDICTED: spermidine synthase                     292   3e-91    
gb|KEQ60044.1|  spermidine synthase                                     290   3e-91    
emb|CEJ93041.1|  Putative Spermidine synthase                           291   4e-91    
ref|XP_004863645.1|  PREDICTED: spermidine synthase                     290   4e-91    
ref|XP_004916086.1|  PREDICTED: spermidine synthase isoform X2          290   4e-91    
ref|XP_009190342.1|  PREDICTED: spermidine synthase                     290   4e-91    
ref|XP_005292892.1|  PREDICTED: LOW QUALITY PROTEIN: spermidine s...    289   5e-91    
ref|XP_004426144.1|  PREDICTED: spermidine synthase                     290   5e-91    
gb|KEQ79273.1|  spermidine synthase                                     289   5e-91    
ref|NP_001084875.1|  spermidine synthase                                289   5e-91    
emb|CDQ62050.1|  unnamed protein product                                290   5e-91    
ref|XP_006866454.1|  PREDICTED: spermidine synthase                     289   6e-91    
gb|KEQ75399.1|  putative spermidine synthase                            289   6e-91    
ref|XP_004657706.1|  PREDICTED: spermidine synthase                     289   6e-91    
ref|XP_010351835.1|  PREDICTED: spermidine synthase                     292   7e-91    
ref|XP_004411196.1|  PREDICTED: spermidine synthase                     289   7e-91    
ref|XP_009516678.1|  hypothetical protein PHYSODRAFT_477587             289   7e-91    
gb|ETS01789.1|  spermine synthase                                       288   9e-91    
emb|CAK45626.1|  unnamed protein product                                288   1e-90    
ref|XP_009218693.1|  spermidine synthase                                288   1e-90    
ref|XP_005079382.1|  PREDICTED: spermidine synthase                     288   1e-90    
ref|XP_004385219.1|  PREDICTED: spermidine synthase                     288   1e-90    
ref|XP_002185179.1|  spermine/spermidine synthase                       288   2e-90    
emb|CCX07718.1|  Similar to Spermidine synthase; acc. no. Q9Y8H7        288   2e-90    
gb|EPX70517.1|  spermidine synthase                                     288   2e-90    
gb|KFY05455.1|  hypothetical protein V492_08540                         288   2e-90    
ref|XP_006735583.1|  PREDICTED: spermidine synthase                     288   2e-90    
gb|KFY52656.1|  hypothetical protein V496_08297                         288   2e-90    
ref|XP_006076793.1|  PREDICTED: spermidine synthase                     288   2e-90    
ref|XP_008149991.1|  PREDICTED: spermidine synthase                     288   2e-90    
ref|XP_002146174.1|  spermidine synthase                                289   2e-90    
gb|AAH55159.1|  Zgc:63600                                               288   2e-90    
ref|XP_007940855.1|  PREDICTED: spermidine synthase                     290   2e-90    
ref|XP_003793315.1|  PREDICTED: spermidine synthase                     288   2e-90    
emb|CEF99586.1|  Spermidine/spermine synthases family                   288   3e-90    
ref|XP_003413520.1|  PREDICTED: spermidine synthase                     288   3e-90    
ref|XP_010890092.1|  PREDICTED: spermidine synthase                     287   3e-90    
ref|XP_001539532.1|  spermidine synthase                                287   3e-90    
ref|NP_033298.1|  spermidine synthase                                   287   3e-90    
gb|EHK40692.1|  hypothetical protein TRIATDRAFT_301493                  287   4e-90    
ref|NP_445916.1|  spermidine synthase                                   287   4e-90    
ref|NP_001290552.1|  spermidine synthase                                287   4e-90    
ref|XP_003346139.1|  hypothetical protein SMAC_06606                    287   4e-90    
gb|EEH22021.1|  spermidine synthase                                     287   5e-90    
ref|XP_002294888.1|  spermine synthase                                  287   5e-90    
ref|XP_003712083.1|  spermidine synthase                                286   6e-90    
ref|XP_005353774.1|  PREDICTED: spermidine synthase                     287   6e-90    
gb|EPE05503.1|  spermidine synthase                                     286   6e-90    
gb|EYE92342.1|  spermidine synthase                                     286   6e-90    
ref|XP_005317504.1|  PREDICTED: spermidine synthase                     286   7e-90    
ref|XP_002478468.1|  spermidine synthase                                286   7e-90    
gb|EFQ29044.1|  spermidine synthase                                     286   8e-90    
gb|EHK16562.1|  hypothetical protein TRIVIDRAFT_187417                  286   9e-90    
gb|KFY13179.1|  hypothetical protein V491_06485                         286   1e-89    
ref|XP_006259362.1|  PREDICTED: spermidine synthase                     286   1e-89    
gb|EQL30227.1|  spermidine synthase, variant                            287   1e-89    
ref|XP_004057284.1|  PREDICTED: spermidine synthase-like                286   1e-89    
ref|XP_010999127.1|  PREDICTED: spermidine synthase                     286   1e-89    
ref|XP_007895972.1|  PREDICTED: spermidine synthase                     285   2e-89    
ref|XP_004596174.1|  PREDICTED: spermidine synthase                     288   2e-89    
ref|XP_003481998.1|  PREDICTED: spermidine synthase                     286   2e-89    
gb|EMG47201.1|  Spermidine synthase, putative                           285   2e-89    
gb|KGQ11555.1|  Spermidine synthase                                     285   2e-89    
ref|XP_001264409.1|  spermidine synthase                                285   2e-89    
ref|XP_006577862.1|  PREDICTED: uncharacterized protein LOC100816...    286   2e-89    
ref|XP_008829884.1|  PREDICTED: spermidine synthase                     285   3e-89    
ref|XP_008599355.1|  spermidine synthase                                285   3e-89    
ref|XP_002554660.1|  KLTH0F10560p                                       285   3e-89    
ref|XP_009757481.1|  PREDICTED: LOW QUALITY PROTEIN: spermine syn...    287   3e-89    
gb|EGE81050.1|  spermidine synthase                                     288   4e-89    
gb|KFY90937.1|  hypothetical protein V500_04875                         284   4e-89    
gb|KFZ08192.1|  hypothetical protein V502_09502                         284   4e-89    
ref|XP_004272432.1|  PREDICTED: spermidine synthase                     285   4e-89    
dbj|BAC25903.1|  unnamed protein product                                285   4e-89    
gb|EWG40654.1|  spermidine synthase                                     286   5e-89    
gb|EXM01945.1|  spermidine synthase                                     286   5e-89    
ref|XP_003989535.1|  PREDICTED: spermidine synthase                     285   5e-89    
ref|XP_007463216.1|  PREDICTED: spermidine synthase                     284   7e-89    
dbj|GAA88591.1|  spermidine synthase                                    283   8e-89    
gb|KFX44928.1|  Spermidine synthase                                     283   8e-89    
ref|XP_658291.1|  SPEE_NEUCR Spermidine synthase (Putrescine amin...    283   1e-88    
gb|ERS98640.1|  spermidine synthase                                     283   1e-88    
ref|XP_004024689.1|  PREDICTED: spermidine synthase                     283   1e-88    
ref|XP_001607780.1|  PREDICTED: spermidine synthase                     283   1e-88    
gb|ELR09380.1|  spermidine synthase                                     283   1e-88    
ref|XP_003050741.1|  predicted protein                                  283   1e-88    
ref|XP_003662189.1|  hypothetical protein MYCTH_2302498                 283   2e-88    
ref|XP_003292987.1|  spermidine synthase                                282   2e-88    
gb|EXM33039.1|  spermidine synthase                                     286   2e-88    
ref|XP_001210637.1|  spermidine synthase                                283   2e-88    
gb|EWZ37050.1|  spermidine synthase                                     286   2e-88    
ref|XP_001392771.2|  spermidine synthase                                283   2e-88    
gb|EWY90443.1|  spermidine synthase                                     286   2e-88    
gb|EJK62755.1|  hypothetical protein THAOC_16622                        283   2e-88    
ref|XP_006963193.1|  spermidine synthase                                282   2e-88    
gb|KFY18462.1|  hypothetical protein V493_08607                         282   2e-88    
gb|EXA44622.1|  spermidine synthase                                     286   2e-88    
gb|EFX01250.1|  spermidine synthase                                     282   3e-88    
gb|KFX87787.1|  hypothetical protein O988_09289                         282   4e-88    



>emb|CAJ46252.1| putrescine N-methyltransferase [Calystegia sepium]
Length=344

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/349 (87%), Positives = 315/349 (90%), Gaps = 12/349 (3%)
 Frame = +2

Query  104   MEVIAAHNNG------GVVTNHQNGTAS-HHNGtashhngtanhhngtahENAGNDFGCI  262
             MEV+AAHNNG      G  TNHQNGT + HHNGTA+H NG    H     E+ G DFGCI
Sbjct  1     MEVMAAHNNGFTNHQNGTTTNHQNGTTTNHHNGTANHQNGNGTAH-----EDGGKDFGCI  55

Query  263   KPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGG  442
             KPGWFSEFSQMWPGEAFSLKIEKLLF+GKSDYQDVMLFESATYGKVLTLD AIQHTENGG
Sbjct  56    KPGWFSEFSQMWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDRAIQHTENGG  115

Query  443   FPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQF  622
             FPYTEMIVHLPLGSIPNPKKVLI+GGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQF
Sbjct  116   FPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQF  175

Query  623   FPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGK  802
             FPYL AGFEDPRVTLHIGDG AFV  A+KGYYDA+IVDSSDPIGPAK+LFE PFFEAV K
Sbjct  176   FPYLGAGFEDPRVTLHIGDGAAFVKDAQKGYYDAVIVDSSDPIGPAKDLFEMPFFEAVAK  235

Query  803   ALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTE  982
             ALR GGVVCTQAESIWLHMH IKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTE
Sbjct  236   ALRPGGVVCTQAESIWLHMHFIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTE  295

Query  983   GPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             GP VDFKNPVNPIDKDT+HVKSK PLKFYN+EIHKAAFTLPSF QKLLE
Sbjct  296   GPDVDFKNPVNPIDKDTSHVKSKGPLKFYNAEIHKAAFTLPSFVQKLLE  344



>dbj|BAA82262.1| putrescine N-methyltransferase 2 [Atropa belladonna]
Length=340

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/295 (87%), Positives = 278/295 (94%), Gaps = 0/295 (0%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             N+FGCIKPGWFSEFSQ+WPGEAFSLKIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQ
Sbjct  42    NEFGCIKPGWFSEFSQLWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQ  101

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
             HTENGGFPYTEMIVHLPLGSIP+PKKVLI+GGGIGFTL EV RYPTIE IDIVEID +VV
Sbjct  102   HTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVFRYPTIENIDIVEIDNVVV  161

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             DVSR+FFPYLAAGF+DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPF
Sbjct  162   DVSRKFFPYLAAGFDDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPF  221

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             FEAV KALR GGVVCTQAESIWLHMH+IKQII +CRQVFKGSVNYAWTTVPTYP+GVIGY
Sbjct  222   FEAVAKALRPGGVVCTQAESIWLHMHIIKQIIDNCRQVFKGSVNYAWTTVPTYPTGVIGY  281

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             MLCST+GP VDF+NPVNPIDK T+H+KSK PLKFYNS+IHKAAF LPSFA+ L+E
Sbjct  282   MLCSTKGPQVDFRNPVNPIDKKTSHIKSKGPLKFYNSDIHKAAFILPSFARNLME  336



>dbj|BAA82263.1| putrescine N-methyltransferase [Hyoscyamus niger]
Length=338

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/343 (78%), Positives = 295/343 (86%), Gaps = 7/343 (2%)
 Frame = +2

Query  104   MEVIAAHNNGGVVTN-HQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFS  280
             MEVI+ HNNG       +NG+  + N   + H+     +      N+      IKPGWFS
Sbjct  1     MEVISNHNNGSTTKIILKNGSICNGNVNGNSHSNEKTENKLVECTNS------IKPGWFS  54

Query  281   EFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEM  460
             EFS +WPGEAFSLKIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEM
Sbjct  55    EFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEM  114

Query  461   IVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAA  640
             IVHLPLGSIP+PKKVLI+GGGIGFTL EVSRY TIEKIDIVEID +V+DVSR++FPYLAA
Sbjct  115   IVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAA  174

Query  641   GFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGG  820
             GF+DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR GG
Sbjct  175   GFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVTKALRPGG  234

Query  821   VVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDF  1000
             VVCTQAESIWLHMHLIKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP V+F
Sbjct  235   VVCTQAESIWLHMHLIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVNF  294

Query  1001  KNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             KNPVN IDKDTTHVKSK PLKFYNS+IHKAAF LPSFA+ L+E
Sbjct  295   KNPVNSIDKDTTHVKSKGPLKFYNSDIHKAAFILPSFARDLVE  337



>gb|ACF21006.1| putrescine N-methyltransferase 2 [Anisodus acutangulus]
Length=347

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/295 (86%), Positives = 278/295 (94%), Gaps = 0/295 (0%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             ++FGCIKPGWFSEFS++WPGEAFSLKIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQ
Sbjct  49    HEFGCIKPGWFSEFSELWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQ  108

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
             HTENGGFPYTEMIVHLPLGSIP+PKKVLI+GGGIGFTL EV RYPTIEKIDIVEID +VV
Sbjct  109   HTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVLRYPTIEKIDIVEIDNVVV  168

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             DVSR+FFPYLAAGF+DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPF
Sbjct  169   DVSRKFFPYLAAGFDDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPF  228

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             FEAV KALR GGVVCTQAESIWLHMH+IKQII +CRQVFKGSVNYAWTTVPTYP+GVIGY
Sbjct  229   FEAVAKALRPGGVVCTQAESIWLHMHIIKQIITNCRQVFKGSVNYAWTTVPTYPTGVIGY  288

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             MLCSTEGP VDF+NPVNPIDK  +H+KSK PLKF+N++IHKAAF LPSFA+ L+E
Sbjct  289   MLCSTEGPQVDFRNPVNPIDKKPSHIKSKAPLKFHNADIHKAAFILPSFARNLME  343



>ref|XP_004244762.1| PREDICTED: putrescine N-methyltransferase 2 isoform X2 [Solanum 
lycopersicum]
Length=340

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/343 (78%), Positives = 291/343 (85%), Gaps = 5/343 (1%)
 Frame = +2

Query  104   MEVIAAHNNGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSE  283
             MEVI  H N   +T   NG   HHN +   +  +  +H        GN    IKPGWFSE
Sbjct  1     MEVIYTHTNSSAITITTNG---HHNNSKPDNRNSRTNHENGNKLLLGNS-NSIKPGWFSE  56

Query  284   FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI  463
             FS +WPGEAFS+KIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI
Sbjct  57    FSALWPGEAFSIKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI  116

Query  464   VHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAG  643
             VHLPLGSIP+PKKVLI+GGGIGFTL EV RYPTIEKIDIVEID +VVDVSR+ FPYLAA 
Sbjct  117   VHLPLGSIPSPKKVLIIGGGIGFTLFEVLRYPTIEKIDIVEIDNVVVDVSRKIFPYLAAN  176

Query  644   FEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGV  823
             F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFE+V KALR GGV
Sbjct  177   FNDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFESVAKALRPGGV  236

Query  824   VCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFK  1003
             VCTQAESIWLHMH+I+QIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP VDFK
Sbjct  237   VCTQAESIWLHMHIIEQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFK  296

Query  1004  NPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             NPVN IDKDTTHVKSK  PLKFYN++IHKAAF LPSFA+ L+E
Sbjct  297   NPVNSIDKDTTHVKSKLQPLKFYNTDIHKAAFVLPSFARSLIE  339



>ref|XP_009606202.1| PREDICTED: putrescine N-methyltransferase 1 [Nicotiana tomentosiformis]
 ref|XP_009626754.1| PREDICTED: putrescine N-methyltransferase 1 [Nicotiana tomentosiformis]
Length=375

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/343 (78%), Positives = 291/343 (85%), Gaps = 13/343 (4%)
 Frame = +2

Query  116   AAHNNGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDF----GCIKPGWFSE  283
             + H NG     HQNGT  H NG  +  +   N        + GN+       IKPGWFSE
Sbjct  40    SKHQNG-----HQNGTFEHRNGHQNGTSEQQNGTIS---HDNGNELLGSSNSIKPGWFSE  91

Query  284   FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI  463
             FS +WPGEAFSLK+EKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI
Sbjct  92    FSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI  151

Query  464   VHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAG  643
             VHLPLGSIPNPKKVLI+GGGIGFTL E+ RYP+IEKIDIVEID +VVD+SR+FFPYLAA 
Sbjct  152   VHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPSIEKIDIVEIDDVVVDISRKFFPYLAAN  211

Query  644   FEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGV  823
             F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR GGV
Sbjct  212   FNDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGV  271

Query  824   VCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFK  1003
             VCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP VDFK
Sbjct  272   VCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFK  331

Query  1004  NPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             NPVNPIDK+TT VKSK  PLKFYNS+IHKAAF LPSFA+ ++E
Sbjct  332   NPVNPIDKETTQVKSKLGPLKFYNSDIHKAAFILPSFARSMIE  374



>ref|XP_009771961.1| PREDICTED: putrescine N-methyltransferase 2 [Nicotiana sylvestris]
 dbj|BAA74542.1| putrescine N-methyltransferase [Nicotiana sylvestris]
Length=353

 Score =   520 bits (1338),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 270/353 (76%), Positives = 296/353 (84%), Gaps = 12/353 (3%)
 Frame = +2

Query  104   MEVIAAHNNGGVV--------TNHQNGTASHHNGtashhngtanhhngtahENA--GNDF  253
             MEVI+ + NG  +          HQNGT+ H NG  +  +   N      + N   GN  
Sbjct  1     MEVISTNTNGSTIFKSGAIPMNGHQNGTSKHQNGHKNGTSEEQNGTISHDNGNELLGNS-  59

Query  254   GCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTE  433
              CIKPGWFSEFS +WPGEAFSLK+EKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTE
Sbjct  60    NCIKPGWFSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTE  119

Query  434   NGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVS  613
             NGGFPYTEMIVHLPLGSIPNPKKVLI+GGGIGFTL E+ RYPTIEKIDIVEID +VVDVS
Sbjct  120   NGGFPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVS  179

Query  614   RQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEA  793
             R+FFPYLAA F DPRVTL +GDG AFV  A+  YYDAIIVDSSDPIGPAK+LFERPFFEA
Sbjct  180   RKFFPYLAANFNDPRVTLVLGDGAAFVKAAQAEYYDAIIVDSSDPIGPAKDLFERPFFEA  239

Query  794   VGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLC  973
             V KALR GGVVCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLC
Sbjct  240   VAKALRPGGVVCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLC  299

Query  974   STEGPPVDFKNPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             STEGP +DFKNPVNPIDK+T  VKSK  PLKFYNS+IHKAAF LPSFA+ ++E
Sbjct  300   STEGPEIDFKNPVNPIDKETAQVKSKLAPLKFYNSDIHKAAFILPSFARSMIE  352



>sp|Q9SEH7.1|PMT2_TOBAC RecName: Full=Putrescine N-methyltransferase 2; Short=PMT 2 [Nicotiana 
tabacum]
 gb|AAF14878.1|AF126809_1 putrescine N-methyltransferase [Nicotiana tabacum]
Length=353

 Score =   518 bits (1334),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 269/353 (76%), Positives = 295/353 (84%), Gaps = 12/353 (3%)
 Frame = +2

Query  104   MEVIAAHNNGGVV--------TNHQNGTASHHNGtashhngtanhhngtahENA--GNDF  253
             MEVI+ + NG  +          H NGT+ H NG  +  +   N      + N   GN  
Sbjct  1     MEVISTNTNGSTIFKSGAIPMNGHHNGTSKHQNGHKNGTSEQQNGTISLDNGNELLGNS-  59

Query  254   GCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTE  433
              CIKPGWFSEFS +WPGEAFSLK+EKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTE
Sbjct  60    NCIKPGWFSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTE  119

Query  434   NGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVS  613
             NGGFPYTEMIVHLPLGSIPNPKKVLI+GGGIGFTL E+ RYPTIEKIDIVEID +VVDVS
Sbjct  120   NGGFPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVS  179

Query  614   RQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEA  793
             R+FFPYLAA F DPRVTL +GDG AFV  A+  YYDAIIVDSSDPIGPAK+LFERPFFEA
Sbjct  180   RKFFPYLAANFNDPRVTLVLGDGAAFVKAAQAEYYDAIIVDSSDPIGPAKDLFERPFFEA  239

Query  794   VGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLC  973
             V KALR GGVVCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLC
Sbjct  240   VAKALRPGGVVCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLC  299

Query  974   STEGPPVDFKNPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             STEGP +DFKNPVNPIDK+T  VKSK  PLKFYNS+IHKAAF LPSFA+ ++E
Sbjct  300   STEGPEIDFKNPVNPIDKETAQVKSKLAPLKFYNSDIHKAAFILPSFARSMIE  352



>emb|CAE53633.1| putrescine N-methyltransferase [Solanum tuberosum]
Length=340

 Score =   517 bits (1331),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 272/348 (78%), Positives = 293/348 (84%), Gaps = 15/348 (4%)
 Frame = +2

Query  104   MEVIAAHNNGGVVT-----NHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKP  268
             MEVI+ H NG  +T     +H NG + H NG   H NG             GN    IKP
Sbjct  1     MEVISTHTNGSTITITTNGHHNNGKSDHRNGGTIHDNGNKLLL--------GNS-NSIKP  51

Query  269   GWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFP  448
             GWFSEFS +WPGEAFS+KIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFP
Sbjct  52    GWFSEFSALWPGEAFSVKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFP  111

Query  449   YTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFP  628
             YTEMIVHLPLGSIP PKKVLI+GGGIGFTL EV RY TIEKIDIVEID +VVDVSR+FFP
Sbjct  112   YTEMIVHLPLGSIPTPKKVLIIGGGIGFTLFEVLRYSTIEKIDIVEIDDVVVDVSRKFFP  171

Query  629   YLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKAL  808
             YLAA F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KAL
Sbjct  172   YLAANFNDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKAL  231

Query  809   RAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGP  988
             R GGV+CTQAESIWLHMH+IKQIIA+CR VFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP
Sbjct  232   RPGGVICTQAESIWLHMHIIKQIIANCRLVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGP  291

Query  989   PVDFKNPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
              VDFKNPVNPIDKDTTHVKSK  PLKFYN++IHKAAF LPSFA+ L+E
Sbjct  292   EVDFKNPVNPIDKDTTHVKSKLEPLKFYNTDIHKAAFILPSFARSLIE  339



>gb|AGL76988.1| putrescine N-methyltransferase [Anisodus luridus]
Length=338

 Score =   516 bits (1330),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 270/343 (79%), Positives = 295/343 (86%), Gaps = 7/343 (2%)
 Frame = +2

Query  104   MEVIAAHNNGGVVTN-HQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFS  280
             MEVI+ HNNG       +NG+  + N   + H+     +      N+      IKPGWFS
Sbjct  1     MEVISNHNNGSTTKIILKNGSICNGNVNGNSHSHEKIENKLVECTNS------IKPGWFS  54

Query  281   EFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEM  460
             EFS +WPGEAFSLKIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEM
Sbjct  55    EFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEM  114

Query  461   IVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAA  640
             IVHLPLGSIP+PKKVLI+GGGIGFTL EVSRYPTIE IDIVEID +VVDVSR++FPYLAA
Sbjct  115   IVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYPTIETIDIVEIDDVVVDVSRKYFPYLAA  174

Query  641   GFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGG  820
             GF+DPRVTL IGDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR GG
Sbjct  175   GFDDPRVTLIIGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGG  234

Query  821   VVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDF  1000
             VVCTQAESIWLHMHLIKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP V+F
Sbjct  235   VVCTQAESIWLHMHLIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVNF  294

Query  1001  KNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             KNPVN IDKDT+HVKSK PLKFYNS+IHKAAF LPSFA+ L+E
Sbjct  295   KNPVNSIDKDTSHVKSKGPLKFYNSDIHKAAFILPSFARDLVE  337



>gb|AAT99576.1| putrescine N-methyltransferase [Anisodus tanguticus]
Length=338

 Score =   516 bits (1330),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 270/343 (79%), Positives = 295/343 (86%), Gaps = 7/343 (2%)
 Frame = +2

Query  104   MEVIAAHNNGGVVTN-HQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFS  280
             MEVI+ HNNG       +NG+  + N   + H+     +      N+      IKPGWFS
Sbjct  1     MEVISNHNNGSTTKIILKNGSICNGNVNGNSHSHEKIENKLVECTNS------IKPGWFS  54

Query  281   EFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEM  460
             EFS +WPGEAFSLKIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEM
Sbjct  55    EFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEM  114

Query  461   IVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAA  640
             IVHLPLGSIP+PKKVLI+GGGIGFTL EVSRYPTIE IDIVEID +VVDVSR+FFPYLAA
Sbjct  115   IVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYPTIETIDIVEIDDVVVDVSRKFFPYLAA  174

Query  641   GFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGG  820
             GF+DPRVTL IGDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEA+ KALR GG
Sbjct  175   GFDDPRVTLIIGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEALAKALRPGG  234

Query  821   VVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDF  1000
             VVCTQAESIWLHMHLIKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP V+F
Sbjct  235   VVCTQAESIWLHMHLIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVNF  294

Query  1001  KNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             KNPVN IDKDT+HVKSK PLKFYNS+IHKAAF LPSFA+ L+E
Sbjct  295   KNPVNSIDKDTSHVKSKGPLKFYNSDIHKAAFILPSFARDLVE  337



>emb|CAQ19733.1| putrescine N-methyltransferase [Solanum dulcamara]
Length=340

 Score =   516 bits (1328),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 269/352 (76%), Positives = 293/352 (83%), Gaps = 23/352 (7%)
 Frame = +2

Query  104   MEVIAAHNNGGVVT----NHQNGTASHHNGtashhngtanhhngtahENAGN-----DFG  256
             MEVI+ H NG V+T    +H NG + H NG  +               + GN      + 
Sbjct  1     MEVISNHTNGSVITINGHHHTNGKSDHRNGGVTA-------------HDNGNKLSLGSYN  47

Query  257   CIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTEN  436
              IKPGWFSEFS +WPGEAFS+KIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTEN
Sbjct  48    SIKPGWFSEFSALWPGEAFSVKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTEN  107

Query  437   GGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSR  616
             GGF YTEMIVHLPLGSIP PKKVLI+GGGIGFTL EV RY TIEKIDIVEID +VVDVSR
Sbjct  108   GGFSYTEMIVHLPLGSIPTPKKVLIIGGGIGFTLFEVLRYSTIEKIDIVEIDDVVVDVSR  167

Query  617   QFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAV  796
             +FFPYLAA F DPRVTL + DG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV
Sbjct  168   KFFPYLAANFNDPRVTLVLDDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAV  227

Query  797   GKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCS  976
              KALR GGVVCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCS
Sbjct  228   AKALRPGGVVCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCS  287

Query  977   TEGPPVDFKNPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             TEGP VDFKNP+NPIDKD+THVKSK  PLKFYNS+IHKAAF LPSFA+ L+E
Sbjct  288   TEGPEVDFKNPINPIDKDSTHVKSKLGPLKFYNSDIHKAAFILPSFARSLIE  339



>ref|XP_009771962.1| PREDICTED: putrescine N-methyltransferase 3 [Nicotiana sylvestris]
 sp|Q9SEH5.1|PMT3_TOBAC RecName: Full=Putrescine N-methyltransferase 3; Short=PMT 3 [Nicotiana 
tabacum]
 gb|AAF14880.1|AF126811_1 putrescine N-methyltransferase [Nicotiana tabacum]
Length=381

 Score =   517 bits (1332),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 268/346 (77%), Positives = 291/346 (84%), Gaps = 22/346 (6%)
 Frame = +2

Query  113   IAAHNNGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDF------GCIKPGW  274
             I+ H NG     HQNGT+ H NG  +               + GN+         IKPGW
Sbjct  50    ISEHQNG-----HQNGTSEHQNGHQNGTIS----------HDNGNELQLLGSSNSIKPGW  94

Query  275   FSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT  454
             FSEFS +WPGEAFSLK+EKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT
Sbjct  95    FSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT  154

Query  455   EMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYL  634
             EMIVHLPLGSIPNPKKVLI+GGGIGFTL E+ RYPTIEKIDIVEID +VVDVSR+FFPYL
Sbjct  155   EMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVSRKFFPYL  214

Query  635   AAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRA  814
             AA F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR 
Sbjct  215   AANFSDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRP  274

Query  815   GGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPV  994
             GGVVCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP V
Sbjct  275   GGVVCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEV  334

Query  995   DFKNPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             DFKNPVNPIDK+TT VKSK  PLKFYNS+IHKAAF LPSFA+ ++E
Sbjct  335   DFKNPVNPIDKETTQVKSKLAPLKFYNSDIHKAAFILPSFARSMIE  380



>gb|ACF21005.1| putrescine N-methyltransferase 1 [Anisodus acutangulus]
Length=338

 Score =   514 bits (1325),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 269/343 (78%), Positives = 295/343 (86%), Gaps = 7/343 (2%)
 Frame = +2

Query  104   MEVIAAHNNGGVVTN-HQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFS  280
             MEVI+ HNNG       +NG+  + N   + H+     +      N+      IKPGWFS
Sbjct  1     MEVISNHNNGSTTKIILKNGSIRNGNVNGNSHSHEKIENKLVECTNS------IKPGWFS  54

Query  281   EFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEM  460
             EFS +WPGEAFSLKIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTE+
Sbjct  55    EFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEV  114

Query  461   IVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAA  640
             IVHLPLGSIP+PKKVLI+GGGIGFTL EVSRYPTIE IDIVEID +VVDVSR++FPYLAA
Sbjct  115   IVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYPTIETIDIVEIDDVVVDVSRKYFPYLAA  174

Query  641   GFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGG  820
             GF+DPRVTL IGDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR GG
Sbjct  175   GFDDPRVTLIIGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGG  234

Query  821   VVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDF  1000
             VVCTQAESIWLHMHLIKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP V+F
Sbjct  235   VVCTQAESIWLHMHLIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVNF  294

Query  1001  KNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             KNPVN IDKDT+HVKSK PLKFYNS+IHKAAF LPSFA+ L+E
Sbjct  295   KNPVNSIDKDTSHVKSKGPLKFYNSDIHKAAFILPSFARDLVE  337



>dbj|BAA74544.1| putrescine N-methyltransferase [Nicotiana sylvestris]
Length=430

 Score =   517 bits (1331),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 268/342 (78%), Positives = 292/342 (85%), Gaps = 9/342 (3%)
 Frame = +2

Query  113   IAAHNNGGVVTNHQNGTASHHNGtashhngtanhhngtahENA--GNDFGCIKPGWFSEF  286
             I+ H NG     HQNGT+ H NG  +  +   N      + N   GN    IK GWFSEF
Sbjct  94    ISEHQNG-----HQNGTSEHQNGHQNGTSEQQNGTISHDNGNELLGNS-NSIKLGWFSEF  147

Query  287   SQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIV  466
             S +WPGEAFSLK+EKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIV
Sbjct  148   SALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIV  207

Query  467   HLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGF  646
             HLPLGSIPNPKKVLI+GGGIGFTL E+ RYPTIEKIDIVEID +VVDVSR+FFPYLAA F
Sbjct  208   HLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVSRKFFPYLAANF  267

Query  647   EDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVV  826
              DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR GGVV
Sbjct  268   NDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVV  327

Query  827   CTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKN  1006
             CTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP VDFKN
Sbjct  328   CTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKN  387

Query  1007  PVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             P+NPIDK+TT VKSK  PLKFYNS+IHKAAF LPSFA+ ++E
Sbjct  388   PINPIDKETTQVKSKLAPLKFYNSDIHKAAFILPSFARSMIE  429



>emb|CAE47481.1| putrescine N-methyltransferase [Datura stramonium]
Length=344

 Score =   513 bits (1322),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 272/355 (77%), Positives = 295/355 (83%), Gaps = 25/355 (7%)
 Frame = +2

Query  104   MEVIAA-HNNG------GVVT--NHQNGTASHHNGtashhngtanhhngtahENAGNDFG  256
             MEV+++ H NG      GV+T   H NG + H NG  + H            EN     G
Sbjct  1     MEVLSSTHTNGSSLLKNGVITMNGHHNGNSDHRNGGTTVH------------ENGRKLLG  48

Query  257   ---CIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQH  427
                 IKPGWFSEFS +WPGEAFSLKIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQH
Sbjct  49    NSNSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQH  108

Query  428   TENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVD  607
             TENGGFPYTEMIVHLPLGSIPNPKKVLI+GGGIGFTL EV RYPT+EKIDIVEID +VVD
Sbjct  109   TENGGFPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEVLRYPTVEKIDIVEIDDVVVD  168

Query  608   VSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFF  787
             VSR+FFPYLAA F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFF
Sbjct  169   VSRKFFPYLAANFNDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFF  228

Query  788   EAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYM  967
             EAV KALR GGVVCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYM
Sbjct  229   EAVAKALRPGGVVCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYM  288

Query  968   LCSTEGPPVDFKNPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             LCSTEGP VDFKNPVNPIDKD TH  SK  PLKFYN++IHKAAF LPSFA+ ++E
Sbjct  289   LCSTEGPEVDFKNPVNPIDKDETHANSKLGPLKFYNTDIHKAAFILPSFARSMIE  343



>gb|AAY53933.1| tropane alkaloid biosynthesis protein [Scopolia parviflora]
Length=359

 Score =   514 bits (1323),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 266/351 (76%), Positives = 294/351 (84%), Gaps = 14/351 (4%)
 Frame = +2

Query  119   AHNNGGVVT--NHQNG------------TASHHNGtashhngtanhhngtahENAGNDFG  256
             A  NG   T  NH NG            T +H NG ++      N         + ++FG
Sbjct  2     AFRNGSTNTTINHLNGASTIPKNGSTTTTINHLNGASTIPKNGNNITTTLLKNGSPHEFG  61

Query  257   CIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTEN  436
             CIKPGWFSEFS++WPGEAFSLKIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTEN
Sbjct  62    CIKPGWFSEFSELWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTEN  121

Query  437   GGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSR  616
             GGF + EMIVHLPLGSIP+PKKVLI+GGGIGFTL EV RYPTIEKIDIVEID +VVDVSR
Sbjct  122   GGFLHIEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVLRYPTIEKIDIVEIDDVVVDVSR  181

Query  617   QFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAV  796
             +FFPYLAAGF+DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV
Sbjct  182   KFFPYLAAGFDDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAV  241

Query  797   GKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCS  976
              KALR GGVVCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCS
Sbjct  242   AKALRPGGVVCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCS  301

Query  977   TEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             TEGP VDF+NPVNPIDK  +H+KSK PLKFYN++IHKAAF LPSFA+ L+E
Sbjct  302   TEGPQVDFRNPVNPIDKKPSHIKSKGPLKFYNADIHKAAFILPSFARNLME  352



>gb|AAK49871.1|AF280403_1 putrescine N-methyltransferase 2 [Nicotiana attenuata]
Length=371

 Score =   513 bits (1322),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 264/330 (80%), Positives = 287/330 (87%), Gaps = 4/330 (1%)
 Frame = +2

Query  149   HQNGTASHHNGtashhngtanhhngtahEN--AGNDFGCIKPGWFSEFSQMWPGEAFSLK  322
             HQNGT+ H NG  +  +   N      + N   GN   CIKPGWFSEFS +WPGEAFSLK
Sbjct  42    HQNGTSEHQNGHQNGTSEQQNGTISHDNGNKLVGNS-NCIKPGWFSEFSALWPGEAFSLK  100

Query  323   IEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKK  502
             +EKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKK
Sbjct  101   VEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKK  160

Query  503   VLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDG  682
             VLI+GGGIGFTL E+ RYP+IEKIDIVEID +VVDVSR+FFPYLAA F DPRVTL +GDG
Sbjct  161   VLIIGGGIGFTLFEMLRYPSIEKIDIVEIDDVVVDVSRKFFPYLAANFNDPRVTLVLGDG  220

Query  683   GAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMH  862
              AFV  A+  YYDAIIVDSSDPIGPAK+LFERPFFEAV KALR GGVVCTQAESIWLHMH
Sbjct  221   AAFVKAAQAEYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCTQAESIWLHMH  280

Query  863   LIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHV  1042
             +IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP VDFKNPVNPIDK+TT V
Sbjct  281   IIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKNPVNPIDKETTQV  340

Query  1043  KSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             K K  PLKFYNS+IHKAAF LPSFA+ ++E
Sbjct  341   KPKLAPLKFYNSDIHKAAFILPSFARSMIE  370



>sp|Q9SEH4.1|PMT4_TOBAC RecName: Full=Putrescine N-methyltransferase 4; Short=PMT 4 [Nicotiana 
tabacum]
 gb|AAF14881.1|AF126812_1 putrescine N-methyltransferase [Nicotiana tabacum]
Length=419

 Score =   514 bits (1323),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 267/342 (78%), Positives = 291/342 (85%), Gaps = 9/342 (3%)
 Frame = +2

Query  113   IAAHNNGGVVTNHQNGTASHHNGtashhngtanhhngtahENA--GNDFGCIKPGWFSEF  286
             I+ H NG     HQNGT+ H NG  +  +   N      + N   GN    IK GWFSEF
Sbjct  83    ISEHQNG-----HQNGTSEHQNGHQNGTSEQQNGTISHDNGNELLGNS-NSIKLGWFSEF  136

Query  287   SQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIV  466
             S +WPGEAFSLK+EKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIV
Sbjct  137   SALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIV  196

Query  467   HLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGF  646
             HLPLGSIPNPKKVLI+GGGIGFTL E+ RYPTIEKIDIVEID +VVDVSR+ FPYLAA F
Sbjct  197   HLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVSRKSFPYLAANF  256

Query  647   EDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVV  826
              DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR GGVV
Sbjct  257   NDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVV  316

Query  827   CTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKN  1006
             CTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP VDFKN
Sbjct  317   CTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKN  376

Query  1007  PVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             P+NPIDK+TT VKSK  PLKFYNS+IHKAAF LPSFA+ ++E
Sbjct  377   PINPIDKETTQVKSKLAPLKFYNSDIHKAAFILPSFARSMIE  418



>gb|AAK49870.1|AF280402_1 putrescine N-methyltransferase 1 [Nicotiana attenuata]
Length=388

 Score =   513 bits (1320),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 265/343 (77%), Positives = 291/343 (85%), Gaps = 9/343 (3%)
 Frame = +2

Query  113   IAAHNNGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGC---IKPGWFSE  283
             I+ H NG     H+NGT+ H NG  +  +   N      + N     G    IKPGWFSE
Sbjct  50    ISEHQNG-----HKNGTSEHQNGHQNGTSEQQNGTISHDNGNELQLLGSSNSIKPGWFSE  104

Query  284   FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI  463
             FS +WPGEAFSLK+EKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI
Sbjct  105   FSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI  164

Query  464   VHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAG  643
             VHLPLGSIPNPKKVLI+GGGIGFTL E+ RYP+IEKIDIVEID +VVDVSR+FFPYLAA 
Sbjct  165   VHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPSIEKIDIVEIDDVVVDVSRKFFPYLAAN  224

Query  644   FEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGV  823
             F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR GGV
Sbjct  225   FNDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGV  284

Query  824   VCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFK  1003
             VCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP VDFK
Sbjct  285   VCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFK  344

Query  1004  NPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             NP+NPIDK+TT VKSK  PLKFYN +IHKAAF LPSFA+ ++E
Sbjct  345   NPINPIDKETTQVKSKLAPLKFYNFDIHKAAFILPSFARSMIE  387



>gb|AAF14879.1|AF126810_1 putrescine N-methyltransferase [Nicotiana tabacum]
Length=375

 Score =   512 bits (1318),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 267/343 (78%), Positives = 291/343 (85%), Gaps = 13/343 (4%)
 Frame = +2

Query  116   AAHNNGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDF----GCIKPGWFSE  283
             + H NG     HQNGT  H NG  +  +   N        + GN+       IKPGWFSE
Sbjct  40    SKHQNG-----HQNGTFEHRNGHQNGTSEQQNGTIS---HDNGNELLGSSDSIKPGWFSE  91

Query  284   FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI  463
             FS +WPGEAFSLK+EKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI
Sbjct  92    FSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI  151

Query  464   VHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAG  643
             VHLPLGSIPNPKKVLI+GGGIGFTL E+ RYP+IEKIDIVEID +VVDVSR+FFPYLAA 
Sbjct  152   VHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPSIEKIDIVEIDDVVVDVSRKFFPYLAAN  211

Query  644   FEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGV  823
             F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR GGV
Sbjct  212   FNDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGV  271

Query  824   VCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFK  1003
             VCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP VDFK
Sbjct  272   VCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFK  331

Query  1004  NPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             NPVNPIDK+TT VKSK  PLKFYNS+IHKAAF LPSFA+ ++E
Sbjct  332   NPVNPIDKETTQVKSKLGPLKFYNSDIHKAAFILPSFARSMIE  374



>emb|CAJ46253.1| putrescine N-methyltransferase 1 [Datura inoxia]
Length=340

 Score =   510 bits (1314),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 267/346 (77%), Positives = 290/346 (84%), Gaps = 11/346 (3%)
 Frame = +2

Query  104   MEVIAAHNNGGVVT---NHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGW  274
             MEVI+   NG  +    +H NG + H NG A+ H+              GN    IKPGW
Sbjct  1     MEVISTQTNGSAIIMNYSHHNGNSDHRNGGATAHDHDNGRKLL------GNS-NSIKPGW  53

Query  275   FSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT  454
             FSEFS +WPGEAFSLKIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT
Sbjct  54    FSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT  113

Query  455   EMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYL  634
             EMIVHLPLGSIP PKKVLI+GGGIGFTL EV RY T+EKIDIVEID +VVDVSR+FFPYL
Sbjct  114   EMIVHLPLGSIPKPKKVLIIGGGIGFTLFEVLRYSTVEKIDIVEIDDVVVDVSRKFFPYL  173

Query  635   AAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRA  814
             AA F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR 
Sbjct  174   AANFNDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRP  233

Query  815   GGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPV  994
             GGVVCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP V
Sbjct  234   GGVVCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEV  293

Query  995   DFKNPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             DFKNPVNPIDKD TH  SK  PLKFYN++IHKAAF LPSFA+ ++E
Sbjct  294   DFKNPVNPIDKDETHANSKLGPLKFYNTDIHKAAFILPSFARSMIE  339



>gb|ABY25273.1| putrescine N-methyltransferase [Nicotiana benthamiana]
Length=388

 Score =   511 bits (1317),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 272/344 (79%), Positives = 296/344 (86%), Gaps = 11/344 (3%)
 Frame = +2

Query  113   IAAHNNGGVVTNHQNGTASH----HNGtashhngtanhhngtahENAGNDFGCIKPGWFS  280
             I+ H N     +HQNGT+ H    HNG +   NGT +H NG   +  G+    IKPGWFS
Sbjct  50    ISEHQN-----DHQNGTSEHQNDHHNGRSEQQNGTISHDNGNELQLLGSS-NSIKPGWFS  103

Query  281   EFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEM  460
             EFS +WPGEAFSLKIEKLLFKGKS YQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEM
Sbjct  104   EFSALWPGEAFSLKIEKLLFKGKSHYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEM  163

Query  461   IVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAA  640
             IVHLPL SIPNPKKVLI+GGGIGFTL E+ RYP+IEKIDIVEID +VVDVSR+FFPYLAA
Sbjct  164   IVHLPLSSIPNPKKVLIIGGGIGFTLFEMLRYPSIEKIDIVEIDDVVVDVSRKFFPYLAA  223

Query  641   GFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGG  820
              F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR GG
Sbjct  224   NFNDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGG  283

Query  821   VVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDF  1000
             VVCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP VDF
Sbjct  284   VVCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPQVDF  343

Query  1001  KNPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             KNPVNPIDK+TT VKSK  PLKFYNS+IHKAAF LPSFA+ ++E
Sbjct  344   KNPVNPIDKETTQVKSKLAPLKFYNSDIHKAAFILPSFARSMIE  387



>ref|XP_009786666.1| PREDICTED: putrescine N-methyltransferase 4 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009786667.1| PREDICTED: putrescine N-methyltransferase 4 isoform X3 [Nicotiana 
sylvestris]
Length=386

 Score =   511 bits (1316),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 267/342 (78%), Positives = 288/342 (84%), Gaps = 20/342 (6%)
 Frame = +2

Query  113   IAAHNNG--GVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSEF  286
             I+ H NG     +  QNGT SH NG                 E  GN    IK GWFSEF
Sbjct  61    ISEHQNGHQNGTSEQQNGTISHDNGN----------------ELLGNS-NSIKLGWFSEF  103

Query  287   SQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIV  466
             S +WPGEAFSLK+EKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIV
Sbjct  104   SALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIV  163

Query  467   HLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGF  646
             HLPLGSIPNPKKVLI+GGGIGFTL E+ RYPTIEKIDIVEID +VVDVSR+FFPYLAA F
Sbjct  164   HLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVSRKFFPYLAANF  223

Query  647   EDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVV  826
              DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR GGVV
Sbjct  224   NDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVV  283

Query  827   CTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKN  1006
             CTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP VDFKN
Sbjct  284   CTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKN  343

Query  1007  PVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             P+NPIDK+TT VKSK  PLKFYNS+IHKAAF LPSFA+ ++E
Sbjct  344   PINPIDKETTQVKSKLAPLKFYNSDIHKAAFILPSFARSMIE  385



>sp|Q42963.1|PMT1_TOBAC RecName: Full=Putrescine N-methyltransferase 1; Short=PMT 1; 
AltName: Full=A411 [Nicotiana tabacum]
 dbj|BAA05867.1| putrescine N-Methyltransferase [Nicotiana tabacum]
Length=375

 Score =   511 bits (1315),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 266/343 (78%), Positives = 290/343 (85%), Gaps = 13/343 (4%)
 Frame = +2

Query  116   AAHNNGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDF----GCIKPGWFSE  283
             + H NG     HQNGT  H NG  +  +   N        + GN+       IKPGWFSE
Sbjct  40    SKHQNG-----HQNGTFEHRNGHQNGTSEQQNGTIS---HDNGNELLGSSDSIKPGWFSE  91

Query  284   FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI  463
             FS +WPGEAFSLK+EKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI
Sbjct  92    FSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI  151

Query  464   VHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAG  643
             VHLPLGSIPNPKKVLI+GGGIGFTL E+ RYP+IEKIDIVEID +VVDVSR+FFPYLAA 
Sbjct  152   VHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPSIEKIDIVEIDDVVVDVSRKFFPYLAAN  211

Query  644   FEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGV  823
             F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR GGV
Sbjct  212   FNDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGV  271

Query  824   VCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFK  1003
             VCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTT PTYP+GVIGYMLCSTEGP VDFK
Sbjct  272   VCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTAPTYPTGVIGYMLCSTEGPEVDFK  331

Query  1004  NPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             NPVNPIDK+TT VKSK  PLKFYNS+IHKAAF LPSFA+ ++E
Sbjct  332   NPVNPIDKETTQVKSKLGPLKFYNSDIHKAAFILPSFARSMIE  374



>ref|XP_009786665.1| PREDICTED: putrescine N-methyltransferase 4 isoform X1 [Nicotiana 
sylvestris]
Length=419

 Score =   513 bits (1320),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 268/351 (76%), Positives = 293/351 (83%), Gaps = 18/351 (5%)
 Frame = +2

Query  116   AAHNNGGVVTNHQNGTASHHNGtashhngtanhhngtahE--------NAGNDF----GC  259
             + H NG     HQNGT+ H NG  +  +   N H     E        + GN+       
Sbjct  73    SEHRNG-----HQNGTSEHRNGHQNGISEHQNGHQNGTSEQQNGTISHDNGNELLGNSNS  127

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             IK GWFSEFS +WPGEAFSLK+EKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENG
Sbjct  128   IKLGWFSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  187

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
             GFPYTEMIVHLPLGSIPNPKKVLI+GGGIGFTL E+ RYPTIEKIDIVEID +VVDVSR+
Sbjct  188   GFPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVSRK  247

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFPYLAA F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV 
Sbjct  248   FFPYLAANFNDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVA  307

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGVVCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCST
Sbjct  308   KALRPGGVVCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCST  367

Query  980   EGPPVDFKNPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFKNP+NPIDK+TT VKSK  PLKFYNS+IHKAAF LPSFA+ ++E
Sbjct  368   EGPEVDFKNPINPIDKETTQVKSKLAPLKFYNSDIHKAAFILPSFARSMIE  418



>ref|XP_006351049.1| PREDICTED: putrescine N-methyltransferase 2-like [Solanum tuberosum]
Length=340

 Score =   509 bits (1311),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 267/355 (75%), Positives = 289/355 (81%), Gaps = 29/355 (8%)
 Frame = +2

Query  104   MEVIAAHNNGGVVT------------NHQNGTASHHNGtashhngtanhhngtahENAGN  247
             MEVI+ H N  V+T            NH+NG  +H NG                    GN
Sbjct  1     MEVISTHTNSFVITITINDHHNNSKSNHRNGGTTHDNGNKLLL---------------GN  45

Query  248   DFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQH  427
                 IKPGWFSEFS +WPGEAFS+KIE LLF+GKSDYQDVMLFESATYGKVLTLDGAIQH
Sbjct  46    S-NSIKPGWFSEFSALWPGEAFSVKIENLLFQGKSDYQDVMLFESATYGKVLTLDGAIQH  104

Query  428   TENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVD  607
             TENGGFPYTEMIVHLPLGSIP+PKKVLI+G GIGFTL EV RYPTIEKIDIVEID +VVD
Sbjct  105   TENGGFPYTEMIVHLPLGSIPSPKKVLIIGVGIGFTLFEVLRYPTIEKIDIVEIDDVVVD  164

Query  608   VSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFF  787
             VSR+FFPYLAA F DPR TL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFF
Sbjct  165   VSRKFFPYLAANFNDPRATLVLGDGTAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFF  224

Query  788   EAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYM  967
             EAV KALR GGVVCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYM
Sbjct  225   EAVAKALRPGGVVCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYM  284

Query  968   LCSTEGPPVDFKNPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             LCSTEGP VDFKNPVNPIDKD THVKS   PLKFYN++IHK+AF LPSFA+ L+E
Sbjct  285   LCSTEGPEVDFKNPVNPIDKDITHVKSNLEPLKFYNTDIHKSAFILPSFARSLIE  339



>dbj|BAA82261.1| putrescine N-methyltransferase 1 [Atropa belladonna]
 dbj|BAA82264.1| putrescine N-methyltransferase 1 [Atropa belladonna]
Length=336

 Score =   509 bits (1310),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 256/290 (88%), Positives = 274/290 (94%), Gaps = 0/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             IKPGWFSEFS +WPGEAFSLKIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENG
Sbjct  46    IKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  105

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
             GFPYTEMIVHLPLGSIP+PKKVLI+GGGIGFTL EVSRYPTI+ IDIVEID +VVDVSR+
Sbjct  106   GFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYPTIDTIDIVEIDDVVVDVSRK  165

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             +FPYLAAGF+DPRVTL IGDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV 
Sbjct  166   YFPYLAAGFDDPRVTLIIGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVA  225

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGVVCTQAESIWLHMHLIKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCST
Sbjct  226   KALRPGGVVCTQAESIWLHMHLIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCST  285

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP V+FKNPVN IDKDT+HVKSK PLKFYNS+IHKAAF LPSFA+ L+E
Sbjct  286   EGPEVNFKNPVNSIDKDTSHVKSKGPLKFYNSDIHKAAFILPSFARDLVE  335



>gb|AGC24706.1| PMT, partial [Nicotiana tabacum]
Length=375

 Score =   509 bits (1312),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 266/341 (78%), Positives = 286/341 (84%), Gaps = 22/341 (6%)
 Frame = +2

Query  113   IAAHNNGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDF------GCIKPGW  274
             I+ H NG     HQNGT+ H NG  +               + GN+         IKPGW
Sbjct  50    ISEHQNG-----HQNGTSEHQNGHQNGTIS----------HDNGNELQLLGSSNSIKPGW  94

Query  275   FSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT  454
             FSEFS +WPGEA SLK+EKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT
Sbjct  95    FSEFSALWPGEASSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT  154

Query  455   EMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYL  634
             EMIVHLPLGSIPNPKKVLI+GGGIGFTL E+ RYPTIEKIDIVEID +VVDVSR+FFPYL
Sbjct  155   EMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVSRKFFPYL  214

Query  635   AAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRA  814
             AA F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR 
Sbjct  215   AANFSDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRP  274

Query  815   GGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPV  994
             GGVVCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP V
Sbjct  275   GGVVCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEV  334

Query  995   DFKNPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFA  1114
             DFKNPVNPIDK+TT VKSK  PLKFYNS+IHKAAF LPSFA
Sbjct  335   DFKNPVNPIDKETTQVKSKLAPLKFYNSDIHKAAFILPSFA  375



>gb|AAQ94738.1| putrescine methyl transferase [Datura metel]
Length=343

 Score =   504 bits (1298),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 266/351 (76%), Positives = 293/351 (83%), Gaps = 18/351 (5%)
 Frame = +2

Query  104   MEVIAAHNNG------GVVT--NHQNGTASHHNGtashhngtanhhngtahENAGNDFGC  259
             MEVI+ + NG      GV+T   H NG + H NG  + H+              GN    
Sbjct  1     MEVISTNTNGSSLLKNGVITMNGHHNGNSDHRNGGTTAHDNGRKLL--------GNS-NS  51

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             IKPGWFSEFS +WPGEAFSLKIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTE+G
Sbjct  52    IKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTEDG  111

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
             GFPYTEMIVHLPLGSIPNPKKVLI+GGGIGFTL EV RY T+EKIDIVEID +VVDVSR+
Sbjct  112   GFPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEVLRYSTVEKIDIVEIDDVVVDVSRK  171

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFPYLAA F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV 
Sbjct  172   FFPYLAANFNDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVA  231

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALRAGGVVCTQAESIWLHMH+IK IIA+CRQVFKGSV+YAWTTVPTYP+GVIGYMLCST
Sbjct  232   KALRAGGVVCTQAESIWLHMHIIKPIIANCRQVFKGSVDYAWTTVPTYPTGVIGYMLCST  291

Query  980   EGPPVDFKNPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFKNPV+PIDKD TH  S+  PLKFYN++IHKAAF LPSFA+ ++E
Sbjct  292   EGPDVDFKNPVDPIDKDETHANSELGPLKFYNADIHKAAFILPSFARSMIE  342



>emb|CAJ46254.1| putrescine N-methyltransferase 2 [Datura inoxia]
Length=341

 Score =   504 bits (1298),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 267/347 (77%), Positives = 289/347 (83%), Gaps = 12/347 (3%)
 Frame = +2

Query  104   MEVIAAHNNGGVVT---NHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGW  274
             MEVI+   NG  +    +H NG + H NG A+ H+              GN    IKPGW
Sbjct  1     MEVISTQTNGSAIIMNYSHHNGNSDHRNGGATAHDHDNGRKLL------GNS-NSIKPGW  53

Query  275   FSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT  454
             FSEFS +WPGEAFSLKIE LLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT
Sbjct  54    FSEFSALWPGEAFSLKIENLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT  113

Query  455   EMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYL  634
             EMIVHLPLGSIP PKKVLI+GGGIGFTL EV RYPT+EKIDIVEID +VVDVSR+FFPYL
Sbjct  114   EMIVHLPLGSIPKPKKVLIIGGGIGFTLFEVLRYPTVEKIDIVEIDDVVVDVSRKFFPYL  173

Query  635   AAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRA  814
             AA F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR 
Sbjct  174   AANFNDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRP  233

Query  815   GGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPV  994
             GGVVCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP V
Sbjct  234   GGVVCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEV  293

Query  995   DFKNPVNPIDK-DTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             DFKNPVN IDK D THV SK  PLKFYN++IHK+AF LPSFA+ L E
Sbjct  294   DFKNPVNAIDKLDETHVNSKLGPLKFYNTDIHKSAFILPSFAKNLTE  340



>emb|CAJ46255.1| putrescine N-methyltransferase [Physalis divaricata]
Length=344

 Score =   501 bits (1291),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 260/337 (77%), Positives = 285/337 (85%), Gaps = 19/337 (6%)
 Frame = +2

Query  122   HNNGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSEFSQMWP  301
             ++NG   +NH+ G  +H NG                 E + N    ++PGWFSEFS +WP
Sbjct  25    YHNGN--SNHRKGVTAHDNGRKLL-------------EGSSNS---LEPGWFSEFSPLWP  66

Query  302   GEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLG  481
             GEAFSLKIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLG
Sbjct  67    GEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLG  126

Query  482   SIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRV  661
             SIP+PKKVLI+GGGIGFTL EV RYPTIE IDIVEID +VVDVSR+FFPYLAA F DPRV
Sbjct  127   SIPSPKKVLIIGGGIGFTLFEVLRYPTIENIDIVEIDDVVVDVSRKFFPYLAANFNDPRV  186

Query  662   TLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAE  841
             T+ +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR GGVVCTQAE
Sbjct  187   TMVLGDGAAFVKAAKAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCTQAE  246

Query  842   SIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPI  1021
             SIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEGP VDFKNPVNPI
Sbjct  247   SIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKNPVNPI  306

Query  1022  DKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             DK T H+KS+  PLKFYNS+IHKAAF LPSFA  L+E
Sbjct  307   DKATAHIKSELGPLKFYNSDIHKAAFILPSFAASLIE  343



>ref|NP_001233790.1| putrescine N-methyltransferase [Solanum lycopersicum]
 emb|CAJ46251.1| putrescine N-methyltransferase [Solanum lycopersicum]
Length=340

 Score =   501 bits (1290),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 268/348 (77%), Positives = 296/348 (85%), Gaps = 15/348 (4%)
 Frame = +2

Query  104   MEVIAA-HNNGGVVTN----HQNGTASHHNGtashhngtanhhngtahENAGNDF-GCIK  265
             MEVI   HNNG + TN    H+NG+        + +     + +   +EN   +F   IK
Sbjct  1     MEVIMNNHNNGTINTNTKIIHKNGSIC------NGNGNVNGNSHTHNNENKLVEFTNSIK  54

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGWFSEFS +WPGEAFSLKIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF
Sbjct  55    PGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  114

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
             PYTEMIVHLPLGSIP+PKKVLI+GGGIGFTL EVSRYP+IEKIDIVEID +VVDVSR+FF
Sbjct  115   PYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYPSIEKIDIVEIDDVVVDVSRKFF  174

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             PYLAAGF+DPRV+L IGDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KA
Sbjct  175   PYLAAGFDDPRVSLIIGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKA  234

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGVVCTQAESIWLHMHLIK+IIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCSTEG
Sbjct  235   LRPGGVVCTQAESIWLHMHLIKKIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEG  294

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             P V+FKNPVN IDK   +VKSK PLKFYNS+IHK+AF LPSFA+ L E
Sbjct  295   PEVNFKNPVNSIDK---YVKSKGPLKFYNSDIHKSAFILPSFARDLFE  339



>ref|XP_006350699.1| PREDICTED: putrescine N-methyltransferase 3-like [Solanum tuberosum]
Length=339

 Score =   498 bits (1281),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 253/290 (87%), Positives = 271/290 (93%), Gaps = 3/290 (1%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             IKPGWFSEFS +WPGEAFSLKIEKLLF+GKSDYQDVMLFES TYGKVLTLDGAIQHTENG
Sbjct  52    IKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESTTYGKVLTLDGAIQHTENG  111

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
             GFPYTEMIVHLPLGSIP+PKKVLI+GGGIGFTL EVSRYPTIEKIDIVEID +VVDVSR+
Sbjct  112   GFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYPTIEKIDIVEIDDVVVDVSRK  171

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFPYLAAGF+DPRVTL IGDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV 
Sbjct  172   FFPYLAAGFDDPRVTLIIGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVA  231

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGVVCTQAESIWLHMHLIK+IIA+CRQVFKGSVNYAWTTVPTYP+GVIGYMLCST
Sbjct  232   KALRPGGVVCTQAESIWLHMHLIKKIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCST  291

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP V+FKNPVN IDK   +VKSK PLKFYNS+IHK+AF LPSFA+ L+E
Sbjct  292   EGPEVNFKNPVNSIDK---YVKSKGPLKFYNSDIHKSAFILPSFARDLIE  338



>ref|XP_007044553.1| Spermidine synthase 1 [Theobroma cacao]
 gb|EOY00385.1| Spermidine synthase 1 [Theobroma cacao]
Length=346

 Score =   464 bits (1194),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 215/288 (75%), Positives = 251/288 (87%), Gaps = 0/288 (0%)
 Frame = +2

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGWFSE +QMWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE    
Sbjct  56    PGWFSEINQMWPGEAHSLKVEKVLFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERDEC  115

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVVDVS++FF
Sbjct  116   AYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVDVSKEFF  175

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P +A G+EDPRVTLHIGDG AF+    +G YDAIIVDSSDPIGPA+ELFE+PFFE+V KA
Sbjct  176   PDVAVGYEDPRVTLHIGDGVAFLKAVPEGTYDAIIVDSSDPIGPAQELFEKPFFESVAKA  235

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSGVIG+MLCSTEG
Sbjct  236   LRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEG  295

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             PPVDFK+PVNPID D +  KSK PL+FYNSEIH AAF LPSFA+K+++
Sbjct  296   PPVDFKHPVNPIDSDDSCCKSKRPLRFYNSEIHSAAFCLPSFAKKVID  343



>gb|AGW82430.1| spermidine synthase [Camellia sinensis]
Length=329

 Score =   462 bits (1190),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 214/288 (74%), Positives = 251/288 (87%), Gaps = 0/288 (0%)
 Frame = +2

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+SATYGKVL LDG IQ TE    
Sbjct  38    PGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSATYGKVLVLDGVIQLTERDEC  97

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMV+DVS+QFF
Sbjct  98    SYQEMIAHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVIDVSKQFF  157

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P++A G+EDPRV LH+GDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFFE+V KA
Sbjct  158   PHVAIGYEDPRVKLHVGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQELFEKPFFESVAKA  217

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSGVIG+MLCSTEG
Sbjct  218   LRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEG  277

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             PPVDFK+PVNPID D +H KSK PLKFYNSEIH A+F LPSFA+K+++
Sbjct  278   PPVDFKHPVNPIDADDSHCKSKGPLKFYNSEIHAASFCLPSFAKKVID  325



>ref|XP_011086544.1| PREDICTED: spermidine synthase [Sesamum indicum]
Length=311

 Score =   461 bits (1186),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 214/293 (73%), Positives = 252/293 (86%), Gaps = 0/293 (0%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+V++F+S+TYGKVL LDG IQ T
Sbjct  15    FSSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVIVFQSSTYGKVLVLDGVIQLT  74

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SI NPKKVL++GGG G  L EVSR+ ++EKIDI EIDKMVVDV
Sbjct  75    ERDECAYQEMITHLPLCSISNPKKVLVIGGGDGGVLREVSRHASVEKIDICEIDKMVVDV  134

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             ++++FP +A GFEDPRVTLHIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFF+
Sbjct  135   AKEYFPSVAVGFEDPRVTLHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQELFEKPFFQ  194

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V KALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSGVIG+ML
Sbjct  195   SVAKALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGVIGFML  254

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGPPVDFK P+NPID D +HVK+K PLKFYNSEIH AAF LPSFA+K++E
Sbjct  255   CSTEGPPVDFKKPINPIDADDSHVKTKGPLKFYNSEIHSAAFCLPSFARKVIE  307



>ref|XP_010552638.1| PREDICTED: spermidine synthase 1 [Tarenaya hassleriana]
Length=347

 Score =   461 bits (1186),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 213/288 (74%), Positives = 250/288 (87%), Gaps = 0/288 (0%)
 Frame = +2

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ VM+F+SATYGKVL LDG IQ TE    
Sbjct  56    PGWFSEMSPMWPGEAHSLKVEKILFEGKSDYQQVMVFQSATYGKVLVLDGVIQLTERDEC  115

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVVDVS++FF
Sbjct  116   AYQEMISHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVDVSKEFF  175

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P++A G+EDPRV LH+GDG AF+  A +G YDAIIVDSSDPIGPAKELFE+PFFE V +A
Sbjct  176   PHVAVGYEDPRVNLHVGDGVAFLKNAAEGSYDAIIVDSSDPIGPAKELFEKPFFETVARA  235

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGVVCTQAES+WLHMH+I+ I+++CR++FKGSVNYAWTTVPTYPSGVIG+MLCSTEG
Sbjct  236   LRPGGVVCTQAESMWLHMHIIEDIVSNCREIFKGSVNYAWTTVPTYPSGVIGFMLCSTEG  295

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             P VDFK+PVNPID D TH+KSK PLKFYNSE+H AAF LPSFA+K+++
Sbjct  296   PHVDFKHPVNPIDADETHLKSKGPLKFYNSELHSAAFCLPSFAKKVID  343



>ref|XP_011071079.1| PREDICTED: spermidine synthase 1-like [Sesamum indicum]
Length=313

 Score =   459 bits (1180),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 210/293 (72%), Positives = 254/293 (87%), Gaps = 0/293 (0%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKS+YQ+V++F+S+TYGKVL LDG IQ T
Sbjct  17    FSSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSEYQNVIVFQSSTYGKVLVLDGVIQLT  76

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVVDV
Sbjct  77    ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVERIDICEIDKMVVDV  136

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A GF DPRVTLHIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFF+
Sbjct  137   SKQFFPRVAVGFNDPRVTLHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQELFEKPFFQ  196

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V KALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKG+VNYAWT+VPTYPSGVIG+ML
Sbjct  197   SVAKALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGAVNYAWTSVPTYPSGVIGFML  256

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             C+TEGPPVDFK+P+NPID D +H+K+K PLKFYNSE+H AAF+LPSFA+K++E
Sbjct  257   CTTEGPPVDFKHPINPIDLDDSHIKTKGPLKFYNSEMHSAAFSLPSFARKVIE  309



>ref|XP_006438425.1| hypothetical protein CICLE_v10031988mg [Citrus clementina]
 ref|XP_006483825.1| PREDICTED: spermidine synthase-like [Citrus sinensis]
 gb|ESR51665.1| hypothetical protein CICLE_v10031988mg [Citrus clementina]
Length=345

 Score =   458 bits (1179),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 217/289 (75%), Positives = 249/289 (86%), Gaps = 1/289 (0%)
 Frame = +2

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE    
Sbjct  51    PGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLILDGVIQLTERDEC  110

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++EKIDI EIDKMVVDVS+QFF
Sbjct  111   AYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEKIDICEIDKMVVDVSKQFF  170

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P +A GFEDPRVTLHIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFFE+V KA
Sbjct  171   PDVAVGFEDPRVTLHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQELFEKPFFESVAKA  230

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGVV TQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSGVIG+MLCSTEG
Sbjct  231   LRPGGVVSTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEG  290

Query  986   PPVDFKNPVNPIDKDTTHVK-SKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             PPVDFK+PVNPID D +H   SK PLKFYNSEIH AAF LP+FA+K++E
Sbjct  291   PPVDFKHPVNPIDADDSHCNSSKGPLKFYNSEIHTAAFCLPTFAKKVIE  339



>ref|XP_010271957.1| PREDICTED: spermidine synthase 1 [Nelumbo nucifera]
Length=383

 Score =   459 bits (1181),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 218/298 (73%), Positives = 254/298 (85%), Gaps = 3/298 (1%)
 Frame = +2

Query  242   GNDFGCIK---PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLD  412
             G +  CI    PGWFSE S MWPGEA SLK+EK+LF+GKS+YQ+VM+F+S+TYGKVL LD
Sbjct  81    GKEPRCISSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSEYQNVMVFQSSTYGKVLVLD  140

Query  413   GAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEID  592
             G IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EID
Sbjct  141   GVIQLTERDECAYQEMIAHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEID  200

Query  593   KMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELF  772
             KMVVDVS+QFFP LA G++DPRVTLHIGDG AF+  A +G YDAIIVDSSDPIGPAKELF
Sbjct  201   KMVVDVSKQFFPNLAVGYDDPRVTLHIGDGVAFLKTAAEGAYDAIIVDSSDPIGPAKELF  260

Query  773   ERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSG  952
             E+PFFE+V +ALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSG
Sbjct  261   EKPFFESVARALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSG  320

Query  953   VIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             VIG+MLCSTEGPPVDFK+PVNPID +  +V +K PLKFYNSEIH AAF LPSFA+K++
Sbjct  321   VIGFMLCSTEGPPVDFKHPVNPIDVNGENVGTKGPLKFYNSEIHSAAFCLPSFAKKVI  378



>ref|XP_004237263.1| PREDICTED: spermidine synthase 1 [Solanum lycopersicum]
Length=309

 Score =   455 bits (1171),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 207/290 (71%), Positives = 251/290 (87%), Gaps = 0/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             I PGWFSE S +WPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL+LDG IQ TE  
Sbjct  16    ILPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLSLDGVIQLTERD  75

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNP+KVL++GGG G  L EVSR+ ++E+IDI EIDKMV+DVS+Q
Sbjct  76    ECAYQEMITHLPLCSIPNPRKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVIDVSKQ  135

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRV LH+GDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFFE+V 
Sbjct  136   FFPNVAIGYEDPRVKLHVGDGVAFLKNVPEGTYDAVIVDSSDPIGPAQELFEKPFFESVA  195

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSGVIG+M+CST
Sbjct  196   RALRRGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMVCST  255

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFKNP+NPID D +H K++ PLKFYNSEIH A+F LPSFA++++E
Sbjct  256   EGPAVDFKNPINPIDVDDSHTKTRGPLKFYNSEIHSASFCLPSFAKRVIE  305



>sp|Q96556.1|SPD1_DATST RecName: Full=Spermidine synthase 1; Short=SPDSY 1; AltName: 
Full=Putrescine aminopropyltransferase 1 [Datura stramonium]
 emb|CAA69420.1| spermidine synthase 1 [Datura stramonium]
Length=308

 Score =   454 bits (1169),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 208/290 (72%), Positives = 250/290 (86%), Gaps = 0/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             I PGWFSE S +WPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  15    ILPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLILDGVIQLTERD  74

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMV+DVS+Q
Sbjct  75    ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVIDVSKQ  134

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRV LH+GDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFFE+V 
Sbjct  135   FFPNVAIGYEDPRVKLHVGDGVAFLKFVAEGTYDAVIVDSSDPIGPAQELFEKPFFESVA  194

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  195   RALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCST  254

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFKNP+NP+D D +H K++ PLKFYNSEIH A+F LPSFA++++E
Sbjct  255   EGPAVDFKNPINPVDADDSHTKTRGPLKFYNSEIHSASFCLPSFAKRVIE  304



>gb|KDO82498.1| hypothetical protein CISIN_1g019187mg [Citrus sinensis]
Length=345

 Score =   456 bits (1173),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 216/289 (75%), Positives = 249/289 (86%), Gaps = 1/289 (0%)
 Frame = +2

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE    
Sbjct  51    PGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLILDGVIQLTERDEC  110

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++EKIDI EIDKMVVDVS+QFF
Sbjct  111   AYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEKIDICEIDKMVVDVSKQFF  170

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P +A GFEDPRVTLHIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFFE+V KA
Sbjct  171   PDVAVGFEDPRVTLHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQELFEKPFFESVAKA  230

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGVV TQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSGVIG+MLCSTEG
Sbjct  231   LRPGGVVSTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEG  290

Query  986   PPVDFKNPVNPIDKDTTHVK-SKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             PPVDFK+PVNPID D ++   SK PLKFYNSEIH AAF LP+FA+K++E
Sbjct  291   PPVDFKHPVNPIDADDSNCNSSKGPLKFYNSEIHTAAFCLPTFAKKVIE  339



>ref|XP_010251305.1| PREDICTED: spermidine synthase 1 [Nelumbo nucifera]
Length=341

 Score =   455 bits (1170),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 213/295 (72%), Positives = 250/295 (85%), Gaps = 0/295 (0%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             +    + PGWFSE S MWPGEA SLK+EK+LF+GKS+YQ+VM+F+S+TYGKVL LDG IQ
Sbjct  44    DSISSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSEYQNVMIFQSSTYGKVLVLDGVIQ  103

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
              TE     Y EMI HLPL SI NPKKVL++GGG G  L EVSR+ ++E+IDI EID+MVV
Sbjct  104   LTERDECAYQEMITHLPLCSISNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDQMVV  163

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             DVS+QFFP LA G+EDPRVTLHIGDG AF+    +G YDAIIVDSSDPIGPA+ELFE+PF
Sbjct  164   DVSKQFFPDLAVGYEDPRVTLHIGDGVAFLNAVPEGTYDAIIVDSSDPIGPAQELFEKPF  223

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             FE+V +ALR GGVVCTQAESIWLHMH+I+ I+A+CRQVFKGSVNYAWTTVPTYPSGVIG+
Sbjct  224   FESVARALRPGGVVCTQAESIWLHMHIIEDIVANCRQVFKGSVNYAWTTVPTYPSGVIGF  283

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             MLCSTEGP VDF++PVNPID    HVK+K PLKFYNSEIH AAF LPSFA+K+++
Sbjct  284   MLCSTEGPAVDFRHPVNPIDVCGDHVKTKGPLKFYNSEIHSAAFCLPSFARKVID  338



>gb|EYU31283.1| hypothetical protein MIMGU_mgv1a010658mg [Erythranthe guttata]
Length=306

 Score =   452 bits (1164),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 209/287 (73%), Positives = 247/287 (86%), Gaps = 0/287 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+V++F+S+TYGKVL LDG IQ TE  
Sbjct  18    VLPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVIVFQSSTYGKVLVLDGVIQLTERD  77

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++EKIDI EIDKMVVDVS++
Sbjct  78    ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHASVEKIDICEIDKMVVDVSKE  137

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRVTLHIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFF++V 
Sbjct  138   FFPKVAVGYEDPRVTLHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQELFEKPFFQSVA  197

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGV+CTQAESIWLHMH+I+ I+++CRQ+FKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  198   KALRPGGVICTQAESIWLHMHIIEDIVSNCRQIFKGSVNYAWTTVPTYPSGVIGFMLCST  257

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             EGP VDFKNP+N ID D +HVK+  PLKFYNSEIH AAF LPSFA++
Sbjct  258   EGPAVDFKNPINRIDDDESHVKTNGPLKFYNSEIHSAAFCLPSFARR  304



>sp|O82147.1|SPDE_COFAR RecName: Full=Spermidine synthase; Short=SPDSY; AltName: Full=Putrescine 
aminopropyltransferase [Coffea arabica]
 dbj|BAA29033.1| spermidine synthase [Coffea arabica]
Length=316

 Score =   452 bits (1162),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 211/290 (73%), Positives = 248/290 (86%), Gaps = 0/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  23    VIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERD  82

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIP+PKKVL++GGG G  L EV+R+ ++E+IDI EIDKMVVDVS+Q
Sbjct  83    ECAYQEMIAHLPLCSIPSPKKVLVIGGGDGGVLREVARHLSVEQIDICEIDKMVVDVSKQ  142

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A GFEDPRV LHIGDG AF+    +G YDAIIVDSSDPIGPA+ELFE+PFFE+V 
Sbjct  143   FFPDVAVGFEDPRVVLHIGDGVAFLKAVPEGTYDAIIVDSSDPIGPAQELFEKPFFESVA  202

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  203   KALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCST  262

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGPPVDFK+P+NPID +    K+  PLKFYNSEIH AAF LPSFA+K+++
Sbjct  263   EGPPVDFKHPINPIDANDGRSKTMKPLKFYNSEIHSAAFCLPSFAKKVID  312



>sp|O48659.1|SPD2_HYONI RecName: Full=Spermidine synthase 2; Short=SPDSY 2; AltName: 
Full=Putrescine aminopropyltransferase 2 [Hyoscyamus niger]
 dbj|BAA24534.1| spermidine synthase 2 [Hyoscyamus niger]
Length=308

 Score =   451 bits (1161),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 209/303 (69%), Positives = 253/303 (83%), Gaps = 4/303 (1%)
 Frame = +2

Query  233   ENAGND----FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKV  400
             E  GN+       I PGWFSE S +WPGEA SLK+EK+LF+GKSDYQ+V++F+S+TYGKV
Sbjct  2     EEQGNNESAYISSILPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVVVFQSSTYGKV  61

Query  401   LTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDI  580
             L LDG IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI
Sbjct  62    LVLDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDI  121

Query  581   VEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPA  760
              EIDKMV+DVS+QFFP +A G+EDPRV LH+GDG AF+    +G YDA+IVDSSDPIGPA
Sbjct  122   CEIDKMVIDVSKQFFPNVAIGYEDPRVKLHVGDGVAFLKNVPEGTYDAVIVDSSDPIGPA  181

Query  761   KELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPT  940
             +ELFE+PFFE+V +AL  GGVVCTQAESIWLHMH+I+ I+++CRQ+FKGSVNYAWTTVPT
Sbjct  182   QELFEKPFFESVARALCPGGVVCTQAESIWLHMHIIEDIVSNCRQIFKGSVNYAWTTVPT  241

Query  941   YPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             YPSGVIG+MLCSTEGP VDFKNP+NPID D +H K++ PLKFYNSEIH A+F LPSFA++
Sbjct  242   YPSGVIGFMLCSTEGPAVDFKNPINPIDADDSHTKTRGPLKFYNSEIHSASFCLPSFAKR  301

Query  1121  LLE  1129
             ++E
Sbjct  302   VIE  304



>ref|XP_009385312.1| PREDICTED: spermidine synthase 2-like [Musa acuminata subsp. 
malaccensis]
Length=351

 Score =   452 bits (1164),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 211/289 (73%), Positives = 249/289 (86%), Gaps = 0/289 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S +WPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYG+VL LDG IQ TE  
Sbjct  58    VIPGWFSEISPLWPGEAHSLKVEKVLFQGKSDYQNVMVFQSSTYGRVLVLDGVIQVTERD  117

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EVSRY ++E+IDI EIDKMVVDVS+Q
Sbjct  118   ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRYSSVEQIDICEIDKMVVDVSKQ  177

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP+LA G+EDPRVTLHIGDG AF+ G  +G YDA+IVDSSDPIGPA+ELFE+PFFE++ 
Sbjct  178   FFPHLAVGYEDPRVTLHIGDGVAFIKGVPEGTYDAVIVDSSDPIGPAQELFEKPFFESIA  237

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             K LR GGV+CTQAESIWLHM LI+ I+++CRQVFKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  238   KVLRPGGVLCTQAESIWLHMQLIEGILSACRQVFKGSVNYAWTTVPTYPSGVIGFMLCST  297

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             EGPPVDF++PVN ID+D    KSK PLKFYNSEIH AAF LPSFA++++
Sbjct  298   EGPPVDFQHPVNHIDEDEVSKKSKGPLKFYNSEIHSAAFCLPSFAKRII  346



>ref|XP_010023584.1| PREDICTED: spermidine synthase 1 [Eucalyptus grandis]
 gb|KCW59895.1| hypothetical protein EUGRSUZ_H02622 [Eucalyptus grandis]
Length=341

 Score =   452 bits (1162),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 210/297 (71%), Positives = 250/297 (84%), Gaps = 0/297 (0%)
 Frame = +2

Query  239   AGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGA  418
             +G     + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG 
Sbjct  41    SGGAMPSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGV  100

Query  419   IQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKM  598
             IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E IDI EIDKM
Sbjct  101   IQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEHIDICEIDKM  160

Query  599   VVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFER  778
             VVDVS+QFFP +A G++DPRV LHIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+
Sbjct  161   VVDVSKQFFPDVAVGYDDPRVNLHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQELFEK  220

Query  779   PFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVI  958
             PFF++V +ALR GGVVCTQAESIWLHMH+I+ I+++CRQ+FKGSVNYAWTTVPTYPSGVI
Sbjct  221   PFFQSVARALRPGGVVCTQAESIWLHMHIIEDIVSNCRQIFKGSVNYAWTTVPTYPSGVI  280

Query  959   GYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             G+MLCSTEGPPVDFK+PVNPID D    K++ PLKFYNSEIH AAF LPSFA+K+++
Sbjct  281   GFMLCSTEGPPVDFKHPVNPIDADGALSKTRRPLKFYNSEIHTAAFCLPSFAKKVID  337



>ref|XP_006340116.1| PREDICTED: spermidine synthase 1-like [Solanum tuberosum]
Length=309

 Score =   450 bits (1158),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 205/290 (71%), Positives = 249/290 (86%), Gaps = 0/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             I PGWFSE S +WPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  16    ILPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLILDGVIQLTERD  75

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SI NP+KVL++GGG G  L EVSR+ ++E+IDI EIDKMV+DVS+Q
Sbjct  76    ECAYQEMITHLPLCSILNPRKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVIDVSKQ  135

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRV LH+GDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFFE+V 
Sbjct  136   FFPNVAIGYEDPRVKLHVGDGVAFLKNVPEGTYDAVIVDSSDPIGPAQELFEKPFFESVA  195

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGS+NYAWTTVPTYPSGVIG+M+CST
Sbjct  196   RALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSINYAWTTVPTYPSGVIGFMVCST  255

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFKNP+NPID D +H K++ PLKFYNSEIH A+F LPSFA++++E
Sbjct  256   EGPAVDFKNPINPIDADDSHTKTRGPLKFYNSEIHSASFCLPSFAKRVIE  305



>gb|AHL84162.1| spermidine synthase [Nicotiana tabacum]
Length=345

 Score =   452 bits (1162),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 209/307 (68%), Positives = 254/307 (83%), Gaps = 9/307 (3%)
 Frame = +2

Query  236   NAGNDFGC---------IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESAT  388
             N  ND GC         + PGWFSE S +WPGEA SLK+EK+LF+GKSDYQ+VM+F+S+T
Sbjct  35    NHNNDNGCTNESPYISSVLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSST  94

Query  389   YGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIE  568
             YGKVL LDG IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E
Sbjct  95    YGKVLVLDGVIQLTERDECAYQEMIAHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVE  154

Query  569   KIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDP  748
             +IDI EIDKMVV+VS+QFFP +A G+EDPRV LHIGDG AF+     G YDA+IVDSSDP
Sbjct  155   QIDICEIDKMVVEVSKQFFPDVAVGYEDPRVNLHIGDGVAFLKNVAAGTYDAVIVDSSDP  214

Query  749   IGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWT  928
             IGPA+ELFE+PFF+++ +ALR GGVV TQAESIWLHMH+I++I+A+CRQ+FKGSVNYAWT
Sbjct  215   IGPAQELFEKPFFDSIARALRPGGVVSTQAESIWLHMHIIEEIVANCRQIFKGSVNYAWT  274

Query  929   TVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPS  1108
             TVPTYPSG+IG+MLCSTEGP VDFKNP+NPID D +H K+  P+KFYNSE+HKA+F LPS
Sbjct  275   TVPTYPSGMIGFMLCSTEGPAVDFKNPINPIDADASHNKTLGPMKFYNSELHKASFCLPS  334

Query  1109  FAQKLLE  1129
             FA++++E
Sbjct  335   FAKRVIE  341



>gb|EYU22481.1| hypothetical protein MIMGU_mgv1a010375mg [Erythranthe guttata]
Length=314

 Score =   450 bits (1158),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 209/295 (71%), Positives = 248/295 (84%), Gaps = 0/295 (0%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             +    + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+SATYGKVL LDG IQ
Sbjct  17    DSISSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSATYGKVLVLDGVIQ  76

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
              TE     Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ ++EKID+ EIDKMVV
Sbjct  77    LTERDECAYQEMITHLPLCSILNPKKVLVIGGGDGGVLREVARHSSVEKIDMCEIDKMVV  136

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             DVS++ FP +A GF DPRVTLHIGDG AF+   E+G YDA+IVDSSDPIGPA+ELFE+PF
Sbjct  137   DVSKEHFPSVAVGFNDPRVTLHIGDGVAFLKAVEEGTYDAVIVDSSDPIGPAQELFEKPF  196

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             FE+V KALR GGV+CTQAESIWLHMH+I+ I+++CRQ+FKGSVNYAWTTVPTYPSGVIG+
Sbjct  197   FESVAKALRPGGVMCTQAESIWLHMHIIEDIVSNCRQIFKGSVNYAWTTVPTYPSGVIGF  256

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             MLCSTEGP VDFK PVNPID D +  ++K PL+FYNSEIH AAF LPSFA+K++E
Sbjct  257   MLCSTEGPDVDFKRPVNPIDADDSLAQAKGPLRFYNSEIHSAAFCLPSFARKVIE  311



>ref|XP_003613246.1| Spermidine synthase [Medicago truncatula]
 gb|AES96204.1| spermidine synthase [Medicago truncatula]
Length=343

 Score =   451 bits (1160),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 213/294 (72%), Positives = 248/294 (84%), Gaps = 1/294 (0%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             N    + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+SATYGKVL LDG IQ
Sbjct  46    NGLSSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSATYGKVLVLDGVIQ  105

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
              TE     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++EKIDI EIDKMVV
Sbjct  106   LTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHASVEKIDICEIDKMVV  165

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             DVS+QFFP +A GFEDPRVTLHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+PF
Sbjct  166   DVSKQFFPDIAVGFEDPRVTLHIGDGVAFLKAAPEGTYDAVIVDSSDPIGPAQELFEKPF  225

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             FE+V +ALR GGVVCTQAESIWLHMH+I+ I+ +CRQVFKGSVNYAWTTVPTYPSG+IG+
Sbjct  226   FESVARALRPGGVVCTQAESIWLHMHIIEDIVVNCRQVFKGSVNYAWTTVPTYPSGMIGF  285

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             MLCSTEGP VDFK+PVNPID++ +    + PLKFYNSEIH AAF LPSFA++ +
Sbjct  286   MLCSTEGPSVDFKHPVNPIDENDSQHAGR-PLKFYNSEIHSAAFCLPSFAKRAI  338



>ref|XP_008221787.1| PREDICTED: spermidine synthase [Prunus mume]
Length=338

 Score =   450 bits (1158),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 213/298 (71%), Positives = 248/298 (83%), Gaps = 2/298 (1%)
 Frame = +2

Query  236   NAGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDG  415
              A +    + PGWFSE S MWPGEA SLKIEK+LF+GKSDYQDVM+F+S+TYGKVL LDG
Sbjct  39    KAADGVSAVIPGWFSEISPMWPGEAHSLKIEKILFQGKSDYQDVMVFQSSTYGKVLVLDG  98

Query  416   AIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDK  595
              IQ TE     Y EMI HLPL SIPNP KVL++GGG G  L EV+RY +IE+IDI EIDK
Sbjct  99    VIQLTERDECAYQEMITHLPLCSIPNPTKVLVIGGGDGGVLREVARYSSIEQIDICEIDK  158

Query  596   MVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFE  775
             MVVDVS+QFFP +A G+EDPRVTLH+GDG AF+     G YDA+IVDSSDPIGPA+ELFE
Sbjct  159   MVVDVSKQFFPAVAVGYEDPRVTLHVGDGVAFLKAVPAGTYDAVIVDSSDPIGPAQELFE  218

Query  776   RPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGV  955
             +PFF+ V  ALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSGV
Sbjct  219   KPFFQTVANALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGV  278

Query  956   IGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             IG+MLCSTEGP VDFK+PVNPID + +  KS+ PLKFYNSEIH AAF LPSFA+K+++
Sbjct  279   IGFMLCSTEGPAVDFKHPVNPIDANDSQ-KSR-PLKFYNSEIHTAAFCLPSFAKKVID  334



>ref|NP_001289514.1| spermidine synthase [Nicotiana sylvestris]
 sp|O48660.1|SPDE_NICSY RecName: Full=Spermidine synthase; AltName: Full=Putrescine aminopropyltransferase; 
Short=Aminopropyltransferase [Nicotiana 
sylvestris]
 dbj|BAA24535.1| spermidine synthase [Nicotiana sylvestris]
Length=314

 Score =   449 bits (1155),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 208/304 (68%), Positives = 253/304 (83%), Gaps = 9/304 (3%)
 Frame = +2

Query  245   NDFGC---------IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGK  397
             N+ GC         + PGWFSE S +WPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGK
Sbjct  7     NNNGCTNESPYISSVLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGK  66

Query  398   VLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKID  577
             VL LDG IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+ID
Sbjct  67    VLVLDGVIQLTERDECAYQEMIAHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQID  126

Query  578   IVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGP  757
             I EIDKMVV+VS+QFFP +A G+EDPRV LHIGDG AF+     G YDA+IVDSSDPIGP
Sbjct  127   ICEIDKMVVEVSKQFFPDVAVGYEDPRVNLHIGDGVAFLKNVAAGTYDAVIVDSSDPIGP  186

Query  758   AKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVP  937
             A+ELFE+PFFE++ +ALR GGVV TQAESIWLHMH+I++I+A+CRQ+FKGSVNYAWTTVP
Sbjct  187   AQELFEKPFFESIARALRPGGVVSTQAESIWLHMHIIEEIVANCRQIFKGSVNYAWTTVP  246

Query  938   TYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQ  1117
             TYPSG+IG+MLCSTEGP VDFKNP+NPID D +H K+  P+KFYNSE+HKA+F LPSFA+
Sbjct  247   TYPSGMIGFMLCSTEGPAVDFKNPINPIDDDASHNKTLGPMKFYNSELHKASFCLPSFAK  306

Query  1118  KLLE  1129
             +++E
Sbjct  307   RVIE  310



>gb|AEX20346.1| spermidine synthase [Medicago sativa]
Length=344

 Score =   450 bits (1157),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 213/294 (72%), Positives = 248/294 (84%), Gaps = 1/294 (0%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             N    + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDVM+F+SATYGKVL LDG IQ
Sbjct  47    NGLSSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVMVFQSATYGKVLVLDGVIQ  106

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
              TE     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++EKIDI EIDKMVV
Sbjct  107   LTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEKIDICEIDKMVV  166

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             DVS+QFFP +A GFEDPRVTL+IGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+PF
Sbjct  167   DVSKQFFPDIAVGFEDPRVTLNIGDGVAFLKAAPEGTYDAVIVDSSDPIGPAQELFEKPF  226

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             FE+V +ALR GGVVCTQAESIWLHMH+I+ I+ +CRQVFKGSVNYAWTTVPTYPSG+IG+
Sbjct  227   FESVARALRPGGVVCTQAESIWLHMHIIEDIVVNCRQVFKGSVNYAWTTVPTYPSGMIGF  286

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             MLCSTEGP VDFK+PVNPID++ +    + PLKFYNSEIH AAF LPSFA++ +
Sbjct  287   MLCSTEGPSVDFKHPVNPIDENDSQHAGR-PLKFYNSEIHSAAFCLPSFAKRAI  339



>ref|XP_010551561.1| PREDICTED: spermidine synthase 1-like [Tarenaya hassleriana]
Length=348

 Score =   450 bits (1157),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 207/291 (71%), Positives = 249/291 (86%), Gaps = 1/291 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ VM+F+SATYGKVL LDG IQ TE  
Sbjct  54    VIPGWFSEISSMWPGEAHSLKVEKILFEGKSDYQQVMVFQSATYGKVLVLDGVIQLTERD  113

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMV+DVS++
Sbjct  114   ECAYQEMIAHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVIDVSKE  173

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP++A G+EDPRV LHIGDG AF+  A +G YDAIIVDSSDPIGPAKELFE+PFFE V 
Sbjct  174   FFPHVAVGYEDPRVNLHIGDGVAFLKSAAEGTYDAIIVDSSDPIGPAKELFEKPFFETVA  233

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAES+WLHMH+I+ I+++C ++FKGSVNYAWT+VPTYPSGVIG+MLC+T
Sbjct  234   RALRPGGVVCTQAESMWLHMHIIEDIVSNCHEIFKGSVNYAWTSVPTYPSGVIGFMLCAT  293

Query  980   EGPPVDFKNPVNPIDKDTTHVKSK-PPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFK+PVNPID D +HV SK  PLKFYN+++H AAF LPSFA+K+++
Sbjct  294   EGPHVDFKHPVNPIDADESHVDSKGGPLKFYNTQLHSAAFCLPSFAKKVID  344



>emb|CAM35497.1| spermidine synthase [Lotus japonicus]
Length=328

 Score =   448 bits (1152),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 209/292 (72%), Positives = 247/292 (85%), Gaps = 1/292 (0%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
                + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ T
Sbjct  33    LSAVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLT  92

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++EKIDI EIDKMVVDV
Sbjct  93    ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEKIDICEIDKMVVDV  152

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S++FFP +A GFEDPRV+LHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+PFF 
Sbjct  153   SKEFFPDIAVGFEDPRVSLHIGDGVAFLKAAPEGSYDAVIVDSSDPIGPAQELFEKPFFS  212

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSG+IG+ML
Sbjct  213   SVARALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGMIGFML  272

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             CSTEGP VDFK+PVNPID+D +  +S  PLKFYN EIH AAF LPSFA++ +
Sbjct  273   CSTEGPSVDFKHPVNPIDEDDSQ-QSARPLKFYNREIHSAAFCLPSFAKRAI  323



>gb|ACT21542.1| spermidine synthase [Panax ginseng]
Length=333

 Score =   448 bits (1152),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 211/295 (72%), Positives = 249/295 (84%), Gaps = 2/295 (1%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             N+   + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+FES+TYGKVL LDG IQ
Sbjct  37    NNISAVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFESSTYGKVLVLDGVIQ  96

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
              TE     Y EMI HLPL SI NPKKVL++GGG G  L EVSR+ +I++IDI EIDKMV+
Sbjct  97    LTERDECAYQEMITHLPLCSILNPKKVLVIGGGDGGVLREVSRHSSIDQIDICEIDKMVI  156

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             DVS+QFFP +A G++DPRV LHIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PF
Sbjct  157   DVSKQFFPDVAVGYDDPRVKLHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQELFEKPF  216

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             F++V KALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSGVIG+
Sbjct  217   FQSVSKALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGVIGF  276

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             MLCSTEGPPVDFK+PVN ID D +  KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  277   MLCSTEGPPVDFKHPVNAIDADDS--KSNRPLKFYNAEIHVAAFCLPSFAKKVIE  329



>ref|XP_009785991.1| PREDICTED: spermidine synthase 1 [Nicotiana sylvestris]
Length=309

 Score =   447 bits (1149),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 205/290 (71%), Positives = 246/290 (85%), Gaps = 0/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S +WPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  16    VLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERD  75

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMV+DV++Q
Sbjct  76    ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVIDVAKQ  135

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRV LH+GDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFFE V 
Sbjct  136   FFPNVAIGYEDPRVKLHVGDGVAFLKNVPEGTYDAVIVDSSDPIGPAQELFEKPFFETVA  195

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAESIWLHM +I+ I+A+C Q+FKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  196   RALRPGGVVCTQAESIWLHMDIIEHIVANCCQIFKGSVNYAWTTVPTYPSGVIGFMLCST  255

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFKNP NPID D +H K++ PLKFYNSEIH A+F LPSFA++++E
Sbjct  256   EGPAVDFKNPTNPIDADDSHTKTRGPLKFYNSEIHSASFCLPSFAKRVIE  305



>ref|XP_004489856.1| PREDICTED: spermidine synthase 1-like [Cicer arietinum]
Length=340

 Score =   447 bits (1150),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 209/292 (72%), Positives = 247/292 (85%), Gaps = 1/292 (0%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
                + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDVM+F+S+TYGKVL LDG IQ T
Sbjct  45    LSSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVMVFQSSTYGKVLILDGVIQLT  104

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++EKIDI EIDKMVVDV
Sbjct  105   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEKIDICEIDKMVVDV  164

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A GFEDPRV+LHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+PFF 
Sbjct  165   SKQFFPDIAVGFEDPRVSLHIGDGVAFLKAATEGTYDAVIVDSSDPIGPAQELFEKPFFA  224

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSG+IG+ML
Sbjct  225   SVARALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGMIGFML  284

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             CSTEGP VDFK+PVNPID++     ++ PLKFYNSE+H AAF LPSFA++ +
Sbjct  285   CSTEGPSVDFKHPVNPIDENDGQQATR-PLKFYNSELHSAAFCLPSFAKRAI  335



>gb|AIL49302.1| spermidine synthase [Capsicum annuum]
Length=341

 Score =   447 bits (1149),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 207/290 (71%), Positives = 249/290 (86%), Gaps = 1/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S +WPGEA SLK+EK+LFKGKSDYQ+V++F+S+TYGKVL LDG IQ TE  
Sbjct  49    VLPGWFSEISPLWPGEAHSLKVEKVLFKGKSDYQNVLVFQSSTYGKVLVLDGVIQLTERD  108

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVV+V++Q
Sbjct  109   ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHASVEQIDICEIDKMVVEVAKQ  168

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRV LHIGDG AF+     G YDA+IVDSSDPIGPA+ELFE+PFFE++ 
Sbjct  169   FFPDVAVGYEDPRVNLHIGDGVAFLKNVPAGTYDAVIVDSSDPIGPAQELFEKPFFESIA  228

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGVV TQAESIWLHMH+I++I+A+CRQ+FKGSVNYAWTTVPTYPSG+IG+MLCST
Sbjct  229   KALRPGGVVSTQAESIWLHMHIIEEIVANCRQIFKGSVNYAWTTVPTYPSGMIGFMLCST  288

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFKNPVNPID D +H K+  PLKFYNSEIH+A+F LPSFA++++E
Sbjct  289   EGPAVDFKNPVNPID-DESHAKTLGPLKFYNSEIHQASFCLPSFAKRVIE  337



>gb|ABF66657.1| spermidine synthase [Ammopiptanthus mongolicus]
Length=340

 Score =   447 bits (1149),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 210/296 (71%), Positives = 249/296 (84%), Gaps = 1/296 (0%)
 Frame = +2

Query  233   ENAGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLD  412
             ++  N    + PGWFSE S MWPGEA SLK+EK+LF+GKS+YQ+V++F+S+TYGKVL LD
Sbjct  39    DSVHNGISSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSEYQNVLVFQSSTYGKVLVLD  98

Query  413   GAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEID  592
             G IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++EKIDI EID
Sbjct  99    GVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEKIDICEID  158

Query  593   KMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELF  772
             KMVVDVS+QFFP++A GFEDPRV LHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELF
Sbjct  159   KMVVDVSKQFFPHVAVGFEDPRVNLHIGDGVAFLKAAPEGTYDAVIVDSSDPIGPAQELF  218

Query  773   ERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSG  952
             E+PFFE+V +ALR GGVVCTQAESIWLHM +I+ I+A+CRQ+FKGSVNYAWTTVPTYPSG
Sbjct  219   EKPFFESVARALRPGGVVCTQAESIWLHMDIIEDIVANCRQIFKGSVNYAWTTVPTYPSG  278

Query  953   VIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             +IG+MLCSTEGPPVDFK+ VNPID++    KS  PLKFYNSEIH AAF LPSFA++
Sbjct  279   MIGFMLCSTEGPPVDFKHSVNPIDENECQ-KSVRPLKFYNSEIHTAAFCLPSFAKR  333



>ref|XP_010942212.1| PREDICTED: spermidine synthase 1 [Elaeis guineensis]
Length=346

 Score =   447 bits (1149),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 210/288 (73%), Positives = 245/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGWFSE S MWPGEA SLK+EK+LF+GKS+YQ+VM+F+S+TYGKVL LDG IQ TE    
Sbjct  55    PGWFSEISPMWPGEAHSLKVEKILFQGKSEYQNVMVFQSSTYGKVLVLDGVIQVTERDEC  114

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SIPNPKKVL++GGG G  L EVSRY  +E+IDI EIDKMVVDVS+QFF
Sbjct  115   AYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRYSFMEQIDICEIDKMVVDVSKQFF  174

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P+LA GFEDPRV LHIGDG AF+ G  +G YDAIIVDSSDPIGPA+ELFE+PFFE+V +A
Sbjct  175   PHLAVGFEDPRVNLHIGDGVAFLKGVAEGTYDAIIVDSSDPIGPAQELFEKPFFESVARA  234

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGVVCTQAESIWLHMH+I+ I+  CRQ+FKGSVNYAWTTVPTYPSGVIG+MLCSTEG
Sbjct  235   LRPGGVVCTQAESIWLHMHIIEDIVNICRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEG  294

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             PPVDF++PV  ID+D    K++ PLKFYN EIH AAF LPSFA+++++
Sbjct  295   PPVDFQHPVYNIDEDEKSDKTERPLKFYNKEIHSAAFCLPSFAKRVID  342



>ref|XP_002534321.1| spermidine synthase 1, putative [Ricinus communis]
 gb|EEF28057.1| spermidine synthase 1, putative [Ricinus communis]
Length=346

 Score =   446 bits (1148),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 210/291 (72%), Positives = 249/291 (86%), Gaps = 4/291 (1%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  55    VIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERD  114

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNP+KVL++GGG G  L EV+R+ +I+ IDI EIDKMV+DVS++
Sbjct  115   ECAYQEMITHLPLCSIPNPQKVLVIGGGDGGVLREVARHSSIDHIDICEIDKMVIDVSKE  174

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRVTLH+GDG AF+  +  G YDAIIVDSSDPIGPA+ELFE+PFFE+V 
Sbjct  175   FFPDIAVGYEDPRVTLHVGDGVAFLKNSPAGTYDAIIVDSSDPIGPAQELFEKPFFESVA  234

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  235   RALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCST  294

Query  980   EGPPVDFKNPVNPID-KDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFK+PVNPID KD+   KS  PLKFYNSEIH AAF LPSFA+K+++
Sbjct  295   EGPSVDFKHPVNPIDAKDS---KSTRPLKFYNSEIHSAAFCLPSFAKKVID  342



>ref|XP_006302420.1| hypothetical protein CARUB_v10020501mg, partial [Capsella rubella]
 gb|EOA35318.1| hypothetical protein CARUB_v10020501mg, partial [Capsella rubella]
Length=368

 Score =   447 bits (1150),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 209/305 (69%), Positives = 251/305 (82%), Gaps = 6/305 (2%)
 Frame = +2

Query  233   ENAGNDF---GCIK---PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYG  394
             EN G D     C+    PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYG
Sbjct  59    ENGGGDIKEPACMSSVIPGWFSEMSPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYG  118

Query  395   KVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKI  574
             KVL LDG IQ TE     Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ ++E+I
Sbjct  119   KVLVLDGVIQLTERDECAYQEMITHLPLCSISNPKKVLVIGGGDGGVLREVARHSSVEQI  178

Query  575   DIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIG  754
             DI EIDKMVVDVS+Q+FP +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIG
Sbjct  179   DICEIDKMVVDVSKQYFPKVAVGYEDPRVNLLIGDGVAFLKNAAEGTYDAVIVDSSDPIG  238

Query  755   PAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTV  934
             PAKELFE+PFFE+V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+V
Sbjct  239   PAKELFEKPFFESVNRALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSV  298

Query  935   PTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFA  1114
             PTYPSGVIG+MLCSTEGP VDFK PVNPID D + +KS  PL+FYN+EIH AAF LPSFA
Sbjct  299   PTYPSGVIGFMLCSTEGPQVDFKKPVNPIDADESSIKSHGPLRFYNAEIHSAAFCLPSFA  358

Query  1115  QKLLE  1129
             +K+++
Sbjct  359   KKVID  363



>ref|XP_007222503.1| hypothetical protein PRUPE_ppa008283mg [Prunus persica]
 gb|EMJ23702.1| hypothetical protein PRUPE_ppa008283mg [Prunus persica]
Length=338

 Score =   446 bits (1146),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 211/290 (73%), Positives = 245/290 (84%), Gaps = 2/290 (1%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLKIEK+LF+GKSDYQDVM+F+S+TYGKVL LDG IQ TE  
Sbjct  47    VIPGWFSEISPMWPGEAHSLKIEKILFQGKSDYQDVMVFQSSTYGKVLVLDGVIQLTERD  106

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNP KVL++GGG G  L EV+RY +IE+IDI EIDKMVVDVS+Q
Sbjct  107   ECAYQEMITHLPLCSIPNPVKVLVIGGGDGGVLREVARYSSIEQIDICEIDKMVVDVSKQ  166

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRV LH+GDG AF+     G YDA+IVDSSDPIGPA+ELFE+PFF+ V 
Sbjct  167   FFPAVAVGYEDPRVKLHVGDGVAFLKAVPAGTYDAVIVDSSDPIGPAQELFEKPFFQTVA  226

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
              ALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  227   NALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCST  286

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFK+PVNPID + +  KS+ PLKFYNSEIH AAF LPSFA+K+++
Sbjct  287   EGPAVDFKHPVNPIDANDSQ-KSR-PLKFYNSEIHTAAFCLPSFAKKVID  334



>gb|KDP26563.1| hypothetical protein JCGZ_17721 [Jatropha curcas]
Length=340

 Score =   446 bits (1146),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 220/341 (65%), Positives = 263/341 (77%), Gaps = 13/341 (4%)
 Frame = +2

Query  125   NNGGVVTNH----QNGTASHHNGtashhngtanhhngtahENAGNDF-GCIKPGWFSEFS  289
              +GGVV+N+    +       NG +               EN  ND+   + PGWFSE S
Sbjct  3     QDGGVVSNNDLPVKRAREEEENGVSDTTVAMET-------ENTNNDYISSVIPGWFSEIS  55

Query  290   QMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVH  469
              +WPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE     Y EMI H
Sbjct  56    PLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERDECAYQEMITH  115

Query  470   LPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFE  649
             LPL SIPNPKKVL++GGG G  L EV+R+ ++E+IDI EIDKMVVDVS+ FFP +A  FE
Sbjct  116   LPLCSIPNPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDKMVVDVSKDFFPDIAVSFE  175

Query  650   DPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVC  829
             DPRVTL IGDG AF+     G YDA+IVDSSDPIGPA+ELFE+PFFE+V KALR GGVVC
Sbjct  176   DPRVTLKIGDGVAFLKDVPAGTYDAVIVDSSDPIGPAQELFEKPFFESVAKALRPGGVVC  235

Query  830   TQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNP  1009
             TQAESIWLHMH+I+ I+A+CRQ+FKGSV+YAWTTVPTYPSGVIG+MLCSTEGPPVDFK+P
Sbjct  236   TQAESIWLHMHIIEDIVANCRQIFKGSVHYAWTTVPTYPSGVIGFMLCSTEGPPVDFKHP  295

Query  1010  VNPID-KDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             VNPID  ++T   +  PLKFYNSEIH AAF LPSFA+K++E
Sbjct  296   VNPIDTNESTSSTTTRPLKFYNSEIHTAAFCLPSFAKKVIE  336



>gb|AFH96952.1| spermidine synthase [Eleutherococcus senticosus]
Length=333

 Score =   445 bits (1144),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 210/295 (71%), Positives = 245/295 (83%), Gaps = 2/295 (1%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             N+   + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S++YGKVL LDG IQ
Sbjct  37    NNISAVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSSYGKVLVLDGVIQ  96

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
              TE     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ +IE IDI EIDKMV+
Sbjct  97    LTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSIEHIDICEIDKMVI  156

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             DVS+QFFP +A G+EDPRV +HIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PF
Sbjct  157   DVSKQFFPDVAVGYEDPRVKVHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQELFEKPF  216

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             F  V KALR GGVVCTQAESIWLHMH+I+ I+++CRQ+FKGSVNYAWTTVPTYPSGVIG+
Sbjct  217   FSLVSKALRPGGVVCTQAESIWLHMHIIEDIVSNCRQIFKGSVNYAWTTVPTYPSGVIGF  276

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             MLCSTEGPPVDFK+PVN I  D    KS  PLKFYNSEIH AAF LPSFA+K++E
Sbjct  277   MLCSTEGPPVDFKHPVNAI--DAADCKSNRPLKFYNSEIHAAAFCLPSFAKKVIE  329



>ref|XP_009115499.1| PREDICTED: spermidine synthase 1 [Brassica rapa]
Length=335

 Score =   445 bits (1144),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 208/293 (71%), Positives = 247/293 (84%), Gaps = 2/293 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  41    FSSVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  100

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+ID+ EIDKMVVDV
Sbjct  101   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASVEQIDMCEIDKMVVDV  160

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A GFEDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  161   SKQFFPNVAIGFEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  220

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+ML
Sbjct  221   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFML  280

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGP VDFKNPVNPID  ++  KS  PLKFYN+EIH AAF LPSFA K++E
Sbjct  281   CSTEGPDVDFKNPVNPIDDSSS--KSDAPLKFYNAEIHSAAFCLPSFAMKVIE  331



>sp|Q9ZTR1.1|SPD1_PEA RecName: Full=Spermidine synthase 1; Short=SPDSY 1; AltName: 
Full=Putrescine aminopropyltransferase 1 [Pisum sativum]
 gb|AAD02231.1| spermidine synthase 1 [Pisum sativum]
Length=334

 Score =   444 bits (1143),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 208/294 (71%), Positives = 247/294 (84%), Gaps = 1/294 (0%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             N    + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDVM+F+SATYGKVL LDG IQ
Sbjct  37    NGLSSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVMVFQSATYGKVLILDGVIQ  96

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
              TE     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++EKIDI EIDKMVV
Sbjct  97    LTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSVEKIDICEIDKMVV  156

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             DVS+++FP +A GF DPRVTL+IGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+PF
Sbjct  157   DVSKEYFPDIAVGFADPRVTLNIGDGVAFLKAAPEGTYDAVIVDSSDPIGPAQELFEKPF  216

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             FE+V +ALR GGVVCTQAESIWLHMH+I+ I+ +CRQVFKGSVNYAWTTVPTYPSG+IG+
Sbjct  217   FESVARALRPGGVVCTQAESIWLHMHIIEDIVVNCRQVFKGSVNYAWTTVPTYPSGMIGF  276

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             MLCSTEGP VDFK+PVNPID++ +   ++ PLKFYN EIH AAF LPSFA++ +
Sbjct  277   MLCSTEGPSVDFKHPVNPIDENDSQQAAR-PLKFYNREIHSAAFCLPSFAKRAI  329



>ref|XP_010471027.1| PREDICTED: spermidine synthase 2-like [Camelina sativa]
Length=343

 Score =   444 bits (1143),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 205/288 (71%), Positives = 246/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ TE    
Sbjct  52    PGWFSEMSPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDEC  111

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+IDI EIDKMVVDVS+Q+F
Sbjct  112   AYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDKMVVDVSKQYF  171

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P +A G++DPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V +A
Sbjct  172   PKVAVGYKDPRVNLLIGDGVAFLKNAAEGTYDAVIVDSSDPIGPAKELFEKPFFESVNRA  231

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+MLCSTEG
Sbjct  232   LRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFMLCSTEG  291

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             P VDFK PVNPID D + +KS  PLKFYN+EIH AAF LPSFA+K+++
Sbjct  292   PQVDFKKPVNPIDADESSIKSFGPLKFYNAEIHSAAFCLPSFAKKVID  339



>ref|XP_009363529.1| PREDICTED: spermidine synthase [Pyrus x bretschneideri]
Length=302

 Score =   443 bits (1139),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 207/295 (70%), Positives = 245/295 (83%), Gaps = 6/295 (2%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             +    + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+SATYGKVL LDG IQ
Sbjct  10    DSVSAVIPGWFSEISSMWPGEAHSLKVEKILFQGKSDYQNVMVFQSATYGKVLVLDGVIQ  69

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
              TE     Y EMI HLPL SIPNPK+VL++GGG G  L EV+RY ++EKIDI EIDKMV+
Sbjct  70    LTERDECAYQEMITHLPLCSIPNPKRVLVIGGGDGGVLREVARYSSVEKIDICEIDKMVI  129

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             DVS+QFFP +A G+EDPRVTLH+GDG AF+     G YDA+IVDSSDPIGPAKELFE+PF
Sbjct  130   DVSKQFFPEVAIGYEDPRVTLHVGDGVAFLKAVPAGIYDAVIVDSSDPIGPAKELFEKPF  189

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             F+ V  ALR GGVVCTQAESIWLHMH+I+ I+A+CR++FKGSVNYAWTTVPTYPSGVIG+
Sbjct  190   FQTVANALRPGGVVCTQAESIWLHMHIIEDIVANCREIFKGSVNYAWTTVPTYPSGVIGF  249

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             MLCSTEGP VDFK+P+N ID      +SK PL+FYNSEIH AAF LPSFA+K+++
Sbjct  250   MLCSTEGPAVDFKHPMNSID------ESKRPLRFYNSEIHTAAFCLPSFAKKVID  298



>ref|XP_003561251.1| PREDICTED: spermidine synthase 1 [Brachypodium distachyon]
Length=382

 Score =   446 bits (1147),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 211/299 (71%), Positives = 251/299 (84%), Gaps = 2/299 (1%)
 Frame = +2

Query  233   ENAGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLD  412
             E AG     + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+V++F+S+TYGKVL LD
Sbjct  82    EQAG--ISAVIPGWFSEISPMWPGEAHSLKVEKVLFQGKSDYQNVLVFQSSTYGKVLVLD  139

Query  413   GAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEID  592
             G IQ TE     Y EMI HLPL SI +PKKVL++GGG G  L EVSRY ++E+IDI EID
Sbjct  140   GVIQVTERDECAYQEMITHLPLCSIKDPKKVLVIGGGDGGVLREVSRYSSVEQIDICEID  199

Query  593   KMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELF  772
             KMVVDVS+QFFP+LA GFED RV+LHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELF
Sbjct  200   KMVVDVSKQFFPHLALGFEDSRVSLHIGDGVAFLKNAPEGTYDAVIVDSSDPIGPAQELF  259

Query  773   ERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSG  952
             E+PFF++V +ALR GGVVCTQAESIWLHMH+I+ I+ +CRQVFKGSVNYAWTTVPTYPSG
Sbjct  260   EKPFFQSVSRALRPGGVVCTQAESIWLHMHIIEDIVTNCRQVFKGSVNYAWTTVPTYPSG  319

Query  953   VIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             VIG+MLCSTEGPPVDF++PV  I++D    KSK PLKFYNSEIH A+F LPSFA++++E
Sbjct  320   VIGFMLCSTEGPPVDFQHPVFNIEEDDYSTKSKGPLKFYNSEIHSASFCLPSFAKRVIE  378



>ref|XP_008779450.1| PREDICTED: spermidine synthase 1-like [Phoenix dactylifera]
Length=347

 Score =   444 bits (1143),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 207/295 (70%), Positives = 244/295 (83%), Gaps = 0/295 (0%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             N    + PGWFSE S MWPGEA SLK+EK+LF+GKS+YQ+VM+F+S TYGKVL LDG IQ
Sbjct  49    NGISAVIPGWFSEISPMWPGEAHSLKVEKILFQGKSEYQNVMVFQSLTYGKVLVLDGVIQ  108

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
              TE     Y EMI HLPL SIPNPKKVL++GGG G  L EVSRY  +E+IDI EIDKMVV
Sbjct  109   VTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRYSAVEQIDICEIDKMVV  168

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             D+S+QFFP+LA GF+DPRV LH+GDG AF+    +G YDAIIVDSSDPIGPA+ELFE+PF
Sbjct  169   DISKQFFPHLAVGFDDPRVNLHVGDGVAFLKSVSEGTYDAIIVDSSDPIGPAQELFEKPF  228

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             FE+V +ALR GGVVCTQAESIWLHMH+I+ I+  CRQ+FKGSVNYAWTTVPTYPSGVIG+
Sbjct  229   FESVARALRPGGVVCTQAESIWLHMHIIEDIVNICRQIFKGSVNYAWTTVPTYPSGVIGF  288

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             MLCSTEGPPVDF++PV  ID+D    K+K PLKFYN  IH AAF LPSFA+++++
Sbjct  289   MLCSTEGPPVDFQHPVYNIDEDEKSNKTKRPLKFYNKAIHSAAFCLPSFAKRVID  343



>ref|XP_010415708.1| PREDICTED: spermidine synthase 2 [Camelina sativa]
Length=340

 Score =   444 bits (1142),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 206/288 (72%), Positives = 245/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ TE    
Sbjct  49    PGWFSEMSPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDEC  108

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ ++E+IDI EIDKMVVDVS+Q+F
Sbjct  109   AYQEMITHLPLCSISNPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDKMVVDVSKQYF  168

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V +A
Sbjct  169   PKVAVGYEDPRVNLLIGDGVAFLKNAAEGTYDAVIVDSSDPIGPAKELFEKPFFESVNRA  228

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+MLCSTEG
Sbjct  229   LRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFMLCSTEG  288

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             P VDFK PVNPID D + VKS  PLKFYN+EIH AAF LPSFA+K+++
Sbjct  289   PQVDFKKPVNPIDDDESSVKSYGPLKFYNAEIHSAAFCLPSFAKKVID  336



>ref|XP_002263762.1| PREDICTED: spermidine synthase 2 [Vitis vinifera]
 emb|CAN74576.1| hypothetical protein VITISV_009109 [Vitis vinifera]
Length=313

 Score =   443 bits (1139),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 208/295 (71%), Positives = 247/295 (84%), Gaps = 3/295 (1%)
 Frame = +2

Query  254   GCIK---PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             GC+    PGWFSE S MWPGEA SLK+EK+LF+ KSDYQ+VM+F+SATYGKVL LDG IQ
Sbjct  15    GCMSSVIPGWFSEISPMWPGEAHSLKVEKILFQEKSDYQNVMVFQSATYGKVLVLDGVIQ  74

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
              TE     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+IDI EID MVV
Sbjct  75    LTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDGMVV  134

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             DVS++FFP +A G++DPRV LHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+PF
Sbjct  135   DVSKKFFPDVAIGYDDPRVNLHIGDGVAFMKNAPEGTYDAVIVDSSDPIGPAQELFEKPF  194

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             F +V +ALR GGVVCTQAESIWLHMH+I+ I+ +CRQ+FKGSVNYAWTTVPTYPSGVIG+
Sbjct  195   FASVARALRPGGVVCTQAESIWLHMHIIEDIVTNCRQIFKGSVNYAWTTVPTYPSGVIGF  254

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             MLCSTEGP VDFK+PVNPID + +  KS  PLKFYNSEIH AAF LPSFA+K+++
Sbjct  255   MLCSTEGPAVDFKHPVNPIDANESACKSSRPLKFYNSEIHAAAFCLPSFAKKVID  309



>ref|XP_009395504.1| PREDICTED: spermidine synthase 1-like [Musa acuminata subsp. 
malaccensis]
Length=332

 Score =   443 bits (1140),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 208/299 (70%), Positives = 248/299 (83%), Gaps = 0/299 (0%)
 Frame = +2

Query  233   ENAGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLD  412
             E   N    + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+V++F+S+TYGKVL LD
Sbjct  30    EKKMNGISAVIPGWFSELSPMWPGEAHSLKVEKILFQGKSDYQNVLVFQSSTYGKVLVLD  89

Query  413   GAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEID  592
             G IQ  E     Y EMI HLPL SI NPKKVL++GGG G  L EVSRY ++E+IDI EID
Sbjct  90    GVIQVAERDECAYQEMITHLPLCSISNPKKVLVIGGGDGGVLREVSRYTSVEQIDICEID  149

Query  593   KMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELF  772
             KMVVDVS+QFFP+LA G+EDPRVTLHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELF
Sbjct  150   KMVVDVSKQFFPHLAVGYEDPRVTLHIGDGVAFLKDAPEGTYDAVIVDSSDPIGPAQELF  209

Query  773   ERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSG  952
             E+PFF++V KALR GGVVCTQAESIWLHMH+I+ I+++C Q+FKGSVNYAWTTVPTYPSG
Sbjct  210   EKPFFQSVAKALRPGGVVCTQAESIWLHMHIIEGIVSACCQIFKGSVNYAWTTVPTYPSG  269

Query  953   VIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
              IG+MLCSTEGP VDF++PV  ID+D    KSK PLKFYNS+IH AAF LPSFA+++++
Sbjct  270   AIGFMLCSTEGPAVDFQHPVYQIDEDEASNKSKGPLKFYNSQIHSAAFCLPSFAKRVID  328



>emb|CBI32130.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   442 bits (1136),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 206/290 (71%), Positives = 245/290 (84%), Gaps = 0/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLK+EK+LF+ KSDYQ+VM+F+SATYGKVL LDG IQ TE  
Sbjct  4     VIPGWFSEISPMWPGEAHSLKVEKILFQEKSDYQNVMVFQSATYGKVLVLDGVIQLTERD  63

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+IDI EID MVVDVS++
Sbjct  64    ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDGMVVDVSKK  123

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G++DPRV LHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+PFF +V 
Sbjct  124   FFPDVAIGYDDPRVNLHIGDGVAFMKNAPEGTYDAVIVDSSDPIGPAQELFEKPFFASVA  183

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAESIWLHMH+I+ I+ +CRQ+FKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  184   RALRPGGVVCTQAESIWLHMHIIEDIVTNCRQIFKGSVNYAWTTVPTYPSGVIGFMLCST  243

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFK+PVNPID + +  KS  PLKFYNSEIH AAF LPSFA+K+++
Sbjct  244   EGPAVDFKHPVNPIDANESACKSSRPLKFYNSEIHAAAFCLPSFAKKVID  293



>ref|XP_002311589.1| spermidine synthase family protein [Populus trichocarpa]
 gb|EEE88956.1| spermidine synthase family protein [Populus trichocarpa]
Length=335

 Score =   443 bits (1139),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 210/300 (70%), Positives = 252/300 (84%), Gaps = 1/300 (0%)
 Frame = +2

Query  236   NAGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDG  415
             N+ +    + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG
Sbjct  35    NSSDYISSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDG  94

Query  416   AIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDK  595
              IQ TE     Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ ++E+IDI EIDK
Sbjct  95    VIQLTERDECAYQEMITHLPLCSIVNPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDK  154

Query  596   MVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFE  775
             MVVDVS++FFP +A G+EDPRVTL +GDG AF+    +G YDAIIVDSSDPIGPA+ELFE
Sbjct  155   MVVDVSKKFFPDVAIGYEDPRVTLRVGDGVAFLKAVPEGTYDAIIVDSSDPIGPAQELFE  214

Query  776   RPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGV  955
             +PFFE+V KALR GGVV TQAESIWLHM++I+ I+A+CRQ+FKGSVNYAWTTVPTYPSG+
Sbjct  215   KPFFESVAKALRPGGVVSTQAESIWLHMNIIEDIVANCRQIFKGSVNYAWTTVPTYPSGM  274

Query  956   IGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE*G  1135
             IG+MLCSTEGPPVDFK+PVNPID D +  KSK PLKFYNSE+H AAF LPSFA+K+++ G
Sbjct  275   IGFMLCSTEGPPVDFKHPVNPIDVDDSQRKSK-PLKFYNSELHTAAFCLPSFAKKVIDSG  333



>gb|EMS48579.1| Spermidine synthase 1 [Triticum urartu]
Length=324

 Score =   442 bits (1137),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 206/290 (71%), Positives = 247/290 (85%), Gaps = 0/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+V++F+S+TYGKVL LDG IQ TE  
Sbjct  31    VIPGWFSEISPMWPGEAHSLKVEKVLFQGKSDYQNVLVFQSSTYGKVLVLDGVIQVTERD  90

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SI +PKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVVDVS+Q
Sbjct  91    ECAYQEMITHLPLCSIKDPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVDVSKQ  150

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP+LA GFEDPRV+LHIGDG AF+  A +G YDA+IVDSSDP+GPA+ELFE+PFFE+V 
Sbjct  151   FFPHLALGFEDPRVSLHIGDGVAFLKNAPEGTYDAVIVDSSDPVGPAQELFEKPFFESVS  210

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAESIWLHMH+I+ I+ +CRQVFKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  211   RALRPGGVVCTQAESIWLHMHIIEDIVTNCRQVFKGSVNYAWTTVPTYPSGVIGFMLCST  270

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDF++PV  I++D    KSK PLKFYNSE H A+F LPSFA++++E
Sbjct  271   EGPSVDFQHPVFSIEEDEYSTKSKGPLKFYNSEFHTASFCLPSFARRVIE  320



>gb|ACN27352.1| unknown [Zea mays]
 tpg|DAA39421.1| TPA: spermidine synthase 1 [Zea mays]
Length=318

 Score =   442 bits (1136),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 208/299 (70%), Positives = 249/299 (83%), Gaps = 0/299 (0%)
 Frame = +2

Query  233   ENAGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLD  412
             + A      + PGWFSE S MWPGEA SLK++K+LF+GKSDYQ VM+F+S+TYGKVL LD
Sbjct  16    DAAAAGISAVIPGWFSEISPMWPGEAHSLKVDKVLFQGKSDYQSVMVFQSSTYGKVLVLD  75

Query  413   GAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEID  592
             G IQ TE     Y EMI HLPL SI +PKKVL++GGG G  L EVSR+ ++E+IDI EID
Sbjct  76    GVIQVTERDECAYQEMITHLPLCSIKDPKKVLVIGGGDGGVLREVSRHSSVEQIDICEID  135

Query  593   KMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELF  772
             KMVVDVS+QFFP+LA GFEDPRV+LHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELF
Sbjct  136   KMVVDVSKQFFPHLAVGFEDPRVSLHIGDGVAFLKNAPEGTYDAVIVDSSDPIGPAQELF  195

Query  773   ERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSG  952
             E+PFF+ V +ALR GGVVCTQAESIWLHMH+I+ I+ +CRQVFKGSVNYAWTTVPTYPSG
Sbjct  196   EKPFFQLVARALRPGGVVCTQAESIWLHMHIIEDIVVNCRQVFKGSVNYAWTTVPTYPSG  255

Query  953   VIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             VIG+MLCSTEGP VDF++PV  I++D   +KSK PLKFYNSEIH A+F LPSFA++++E
Sbjct  256   VIGFMLCSTEGPAVDFQHPVFNIEEDEHPMKSKGPLKFYNSEIHTASFCLPSFAKRVIE  314



>gb|ACZ73829.1| spermidine synthase [Olea europaea]
Length=337

 Score =   442 bits (1137),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 209/298 (70%), Positives = 249/298 (84%), Gaps = 5/298 (2%)
 Frame = +2

Query  239   AGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGA  418
             A      I PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+V++F+S+TYGKVL LDG 
Sbjct  40    AAECISTIIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVIVFQSSTYGKVLVLDGV  99

Query  419   IQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKM  598
             IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++EKIDI EIDKM
Sbjct  100   IQLTERDECAYHEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEKIDICEIDKM  159

Query  599   VVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYD-AIIVDSSDPIGPAKELFE  775
             VVDVS+QFFP +A G++DPRVTLHIGDG AF+    K   D A+IVDSSDPIGPA+ELFE
Sbjct  160   VVDVSKQFFPKVAVGYDDPRVTLHIGDGVAFL----KAVPDPAVIVDSSDPIGPAQELFE  215

Query  776   RPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGV  955
             +PFF++V K+LR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWT+VPTYPSGV
Sbjct  216   KPFFQSVAKSLRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTSVPTYPSGV  275

Query  956   IGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             IG+MLCSTEGP VDFK+P+NPID D +HV +K PLKFYNSE+H AAF LP FA++++E
Sbjct  276   IGFMLCSTEGPAVDFKHPINPIDADCSHVNTKRPLKFYNSEMHSAAFCLPLFAKRVIE  333



>ref|XP_011025698.1| PREDICTED: spermidine synthase 2 [Populus euphratica]
Length=335

 Score =   442 bits (1137),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 211/300 (70%), Positives = 251/300 (84%), Gaps = 1/300 (0%)
 Frame = +2

Query  236   NAGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDG  415
             N+      + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG
Sbjct  35    NSSGYISSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDG  94

Query  416   AIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDK  595
              IQ TE     Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ +IE+IDI EIDK
Sbjct  95    VIQLTERDECAYQEMITHLPLCSIVNPKKVLVIGGGDGGVLREVARHSSIEQIDICEIDK  154

Query  596   MVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFE  775
             MVVDVS++FFP +A G+EDPRVTL +GDG AF+    +G YDAIIVDSSDPIGPA+ELFE
Sbjct  155   MVVDVSKKFFPDVAIGYEDPRVTLRVGDGVAFLKAVPEGTYDAIIVDSSDPIGPAQELFE  214

Query  776   RPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGV  955
             +PFFE+V KALR GGVV TQAESIWLHM++I+ I+A+CRQ+FKGSVNYAWTTVPTYPSG+
Sbjct  215   KPFFESVAKALRPGGVVSTQAESIWLHMNIIEDIVANCRQIFKGSVNYAWTTVPTYPSGM  274

Query  956   IGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE*G  1135
             IG+MLCSTEGPPVDFK+PVNPID D +  KSK PLKFYNSE+H AAF LPSFA+K+++ G
Sbjct  275   IGFMLCSTEGPPVDFKHPVNPIDVDDSQRKSK-PLKFYNSELHTAAFCLPSFAKKVIDSG  333



>ref|NP_001280805.1| uncharacterized protein LOC103451952 [Malus domestica]
 dbj|BAC20170.2| spermidine synthase [Malus domestica]
Length=335

 Score =   442 bits (1136),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 209/295 (71%), Positives = 244/295 (83%), Gaps = 6/295 (2%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             +    + PGWFSE S MWPGEA SLKIEK+LF+GKSDYQ+VM+F+SATYGKVL LDG IQ
Sbjct  43    DSVSAVIPGWFSEISSMWPGEAHSLKIEKILFQGKSDYQNVMVFQSATYGKVLVLDGVIQ  102

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
              TE     Y EMI HLPL SIPNPKKVL++GGG G  L EV+RY ++EKIDI EIDKMV+
Sbjct  103   LTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARYSSVEKIDICEIDKMVI  162

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             DVS+QFFP +A G+EDPRVTLH+GDG AF+     G YDA+IVDSSDPIGPAKELFE+PF
Sbjct  163   DVSKQFFPEVAIGYEDPRVTLHVGDGVAFLKAVPAGTYDAVIVDSSDPIGPAKELFEKPF  222

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             F+ V  ALR GGVVCTQAESIWLHMH+I+ I+A+CR++FKGSVNYAWTTVPTYPSGVIG+
Sbjct  223   FQTVANALRPGGVVCTQAESIWLHMHIIEDIVANCREIFKGSVNYAWTTVPTYPSGVIGF  282

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             MLCSTEG  VDFK+PVN ID      +SK PL+FYNSEIH AAF LPSFA+K+++
Sbjct  283   MLCSTEGTAVDFKHPVNSID------ESKRPLRFYNSEIHTAAFCLPSFAKKVID  331



>ref|XP_006662051.1| PREDICTED: spermidine synthase 1-like isoform X1 [Oryza brachyantha]
Length=327

 Score =   441 bits (1135),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 208/299 (70%), Positives = 250/299 (84%), Gaps = 2/299 (1%)
 Frame = +2

Query  233   ENAGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLD  412
             E AG     + PGWFSE S MWPGEA SLK+E++LF+GKS YQ+VM+F+S+TYGKVL LD
Sbjct  27    EQAG--ISAVIPGWFSEISPMWPGEAHSLKVEEVLFQGKSGYQNVMVFKSSTYGKVLVLD  84

Query  413   GAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEID  592
             G IQ TE     Y EMI HLPL SI +PKKVL++GGG G  L EVSR+ ++E+IDI EID
Sbjct  85    GVIQVTERDECAYQEMITHLPLCSIKDPKKVLVIGGGDGGVLREVSRHSSVEQIDICEID  144

Query  593   KMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELF  772
             KMVVDVS+QFFP+LA GFEDPRV+LHIGDG AF+  A++G YDA+IVDSSDPIGPA+ELF
Sbjct  145   KMVVDVSKQFFPHLAVGFEDPRVSLHIGDGVAFLKNAQEGTYDAVIVDSSDPIGPAQELF  204

Query  773   ERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSG  952
             E+PFF++V +ALR GGVVCTQAESIWLHMH+I+ I+ +CRQVFKGSVNYAWTTVPTYPSG
Sbjct  205   EKPFFQSVARALRPGGVVCTQAESIWLHMHIIEDIVTNCRQVFKGSVNYAWTTVPTYPSG  264

Query  953   VIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             VIG+MLCSTEGP VDF++P+  I+ D    KSK PLKFYNSEIH A+F LPSFA++++E
Sbjct  265   VIGFMLCSTEGPTVDFQHPIFNIEDDEYSTKSKGPLKFYNSEIHSASFCLPSFAKRVIE  323



>ref|XP_008446225.1| PREDICTED: spermidine synthase [Cucumis melo]
Length=318

 Score =   441 bits (1134),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 206/290 (71%), Positives = 246/290 (85%), Gaps = 1/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+S+TYGKVL LDG IQ TE  
Sbjct  28    VIPGWFSEISPMWPGEAHSLKVEKVLFQGKSDYQDVLVFQSSTYGKVLVLDGVIQLTERD  87

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+IDI EIDKMVVDVS++
Sbjct  88    ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDKMVVDVSKE  147

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRVTLH+GDG AF+    +G YDAIIVDSSDPIGPA+ELFE+PFF +V 
Sbjct  148   FFPRVAIGYEDPRVTLHVGDGVAFLKAVPEGTYDAIIVDSSDPIGPAQELFEKPFFASVA  207

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGVVCTQAESIWLHMH+I+ I+ +CRQ+FKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  208   KALRPGGVVCTQAESIWLHMHIIEDIVTNCRQIFKGSVNYAWTTVPTYPSGVIGFMLCST  267

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFK+PVNP++ +     +K PLKFYNSEIH AAF LPSFA+K+++
Sbjct  268   EGPDVDFKHPVNPVEVNGID-SAKSPLKFYNSEIHAAAFCLPSFAKKIID  316



>ref|XP_004297643.1| PREDICTED: spermidine synthase 1-like [Fragaria vesca subsp. 
vesca]
Length=336

 Score =   441 bits (1135),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 212/301 (70%), Positives = 249/301 (83%), Gaps = 6/301 (2%)
 Frame = +2

Query  236   NAGNDFGCIK---PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
              +G +  CI    PGWFSE S MWPGEA SLKIEK+LF+GKSDYQ+VM+F+S+TYGKVL 
Sbjct  35    ESGKEPDCISGVIPGWFSEISPMWPGEAHSLKIEKILFQGKSDYQNVMVFQSSTYGKVLV  94

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++EKIDI E
Sbjct  95    LDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSVEKIDICE  154

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             IDKMVVDVS+QFFP +A G+EDPRVTLHIGDG AF+     G YDA+IVDSSDPIGPA+E
Sbjct  155   IDKMVVDVSKQFFPRVAIGYEDPRVTLHIGDGVAFLKAVPAGTYDAVIVDSSDPIGPAQE  214

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             LFE+PFF++V  AL  GGVVCTQAESIWLHMH+I+ I+++C Q+FKGSVNYAWTTVPTYP
Sbjct  215   LFEKPFFQSVANALCPGGVVCTQAESIWLHMHIIEDIVSNCHQIFKGSVNYAWTTVPTYP  274

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             SGVIG+MLCSTEGPPVDFK+PVNP+ ++     SK PLKFYNSEIH AAF LPSFA+K++
Sbjct  275   SGVIGFMLCSTEGPPVDFKHPVNPLSEND---GSKDPLKFYNSEIHTAAFCLPSFAKKVI  331

Query  1127  E  1129
             E
Sbjct  332   E  332



>ref|XP_010477685.1| PREDICTED: spermidine synthase 1-like [Camelina sativa]
Length=390

 Score =   444 bits (1141),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 207/293 (71%), Positives = 249/293 (85%), Gaps = 2/293 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  96    FSTVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  155

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+PT+E ID+ EIDKMVVDV
Sbjct  156   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHPTVEHIDMCEIDKMVVDV  215

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  216   SKQFFPDVAIGYEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  275

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+ML
Sbjct  276   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFML  335

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGP VDFK+P+NPID+ ++  KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  336   CSTEGPEVDFKHPLNPIDESSS--KSNGPLKFYNAEIHSAAFCLPSFAKKVIE  386



>ref|NP_001140791.1| hypothetical protein [Zea mays]
 gb|ACF84629.1| unknown [Zea mays]
 tpg|DAA60342.1| TPA: hypothetical protein ZEAMMB73_606346 [Zea mays]
Length=333

 Score =   441 bits (1135),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 208/290 (72%), Positives = 247/290 (85%), Gaps = 0/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  40    VIPGWFSEISPMWPGEAHSLKVEKVLFQGKSDYQNVMVFQSSTYGKVLVLDGVIQVTERD  99

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SI +PKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVVDVS+Q
Sbjct  100   ECAYQEMITHLPLCSIKDPKKVLVIGGGDGGVLREVSRHISVEQIDICEIDKMVVDVSKQ  159

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP+LA GFEDPRV+LHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+PFF++V 
Sbjct  160   FFPHLAVGFEDPRVSLHIGDGVAFLKNAPEGTYDAVIVDSSDPIGPAQELFEKPFFQSVA  219

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAESIWLHMH+I+ I  +CRQVFKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  220   RALRPGGVVCTQAESIWLHMHIIEDIFVNCRQVFKGSVNYAWTTVPTYPSGVIGFMLCST  279

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDF++PV  I++D    KSK PLKFYNSEIH A+F LPSFA++++E
Sbjct  280   EGPAVDFQHPVFNIEEDEHSTKSKGPLKFYNSEIHTASFCLPSFAKRVIE  329



>ref|NP_001059438.1| Os07g0408700 [Oryza sativa Japonica Group]
 sp|Q9SMB1.1|SPD1_ORYSJ RecName: Full=Spermidine synthase 1; Short=SPDSY 1; AltName: 
Full=Putrescine aminopropyltransferase 1 [Oryza sativa Japonica 
Group]
 emb|CAB61629.1| spermidine synthase 1 [Oryza sativa Japonica Group]
 dbj|BAD30581.1| spermidine synthase 1 [Oryza sativa Japonica Group]
 dbj|BAF21352.1| Os07g0408700 [Oryza sativa Japonica Group]
 dbj|BAG87616.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94220.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67009.1| hypothetical protein OsJ_23928 [Oryza sativa Japonica Group]
Length=323

 Score =   441 bits (1133),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 206/289 (71%), Positives = 247/289 (85%), Gaps = 0/289 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  30    VIPGWFSEISPMWPGEAHSLKVEKVLFQGKSDYQNVMVFQSSTYGKVLVLDGVIQVTERD  89

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SI +PKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVVDVS+Q
Sbjct  90    ECAYQEMITHLPLCSIKDPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVDVSKQ  149

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP+LA GFEDPRV+LHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+PFF++V 
Sbjct  150   FFPHLAVGFEDPRVSLHIGDGVAFLKNAPEGTYDAVIVDSSDPIGPAQELFEKPFFQSVA  209

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAESIWLHMH+I+ I+A+CRQVFKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  210   RALRPGGVVCTQAESIWLHMHIIEDIVANCRQVFKGSVNYAWTTVPTYPSGVIGFMLCST  269

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             EGP VDF++P+  I+ +    KSK PLKFYNSEIH A+F LPSFA++++
Sbjct  270   EGPTVDFQHPIFNIEDNEFSTKSKGPLKFYNSEIHSASFCLPSFAKRVI  318



>ref|XP_006416052.1| hypothetical protein EUTSA_v10007822mg [Eutrema salsugineum]
 gb|ESQ34405.1| hypothetical protein EUTSA_v10007822mg [Eutrema salsugineum]
Length=397

 Score =   443 bits (1140),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 206/293 (70%), Positives = 249/293 (85%), Gaps = 2/293 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  103   FSSVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  162

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+ID+ EIDKMVVDV
Sbjct  163   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASVEQIDMCEIDKMVVDV  222

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  223   SKQFFPNVAIGYEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  282

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+ML
Sbjct  283   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFML  342

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGP VDFK+PVNPID+ ++  KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  343   CSTEGPDVDFKHPVNPIDESSS--KSNGPLKFYNAEIHSAAFCLPSFAKKVIE  393



>ref|XP_010929093.1| PREDICTED: spermidine synthase 1-like [Elaeis guineensis]
Length=342

 Score =   441 bits (1134),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 210/290 (72%), Positives = 242/290 (83%), Gaps = 0/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             I PGWFSE S MWPGEA SLK+EK++F+GKS+YQ+V++F+S+TYG VL LDG IQ TE  
Sbjct  49    IIPGWFSEISPMWPGEAHSLKVEKIIFQGKSEYQNVLVFKSSTYGNVLVLDGVIQVTERD  108

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNP+KVL++GGG G  L EVSRY  +E+IDI EIDKMVVDVS+Q
Sbjct  109   ECAYQEMITHLPLCSIPNPRKVLVIGGGDGGVLREVSRYSFVEQIDICEIDKMVVDVSKQ  168

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP LA GFEDPRV LHIGDG AF+    +G YDAIIVDSSDPIGPA+ELFE+PFFE+V 
Sbjct  169   FFPRLAIGFEDPRVNLHIGDGVAFLKSVPEGTYDAIIVDSSDPIGPAQELFEKPFFESVA  228

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAESIWLHMH+I+ I+  CRQ FKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  229   RALRPGGVVCTQAESIWLHMHIIEDIVDVCRQTFKGSVNYAWTTVPTYPSGVIGFMLCST  288

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGPPVDFK PV  I++D    KSK PLKFYNSEIH AAF LPSFA++++E
Sbjct  289   EGPPVDFKYPVYNIEEDEKSNKSKGPLKFYNSEIHPAAFCLPSFAKRVIE  338



>ref|NP_001234493.1| spermidine synthase [Solanum lycopersicum]
 sp|Q9ZS45.1|SPDE_SOLLC RecName: Full=Spermidine synthase; Short=SPDSY; AltName: Full=Putrescine 
aminopropyltransferase [Solanum lycopersicum]
 emb|CAA07020.1| spermidine synthase [Solanum lycopersicum]
Length=342

 Score =   441 bits (1134),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 205/290 (71%), Positives = 248/290 (86%), Gaps = 1/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S +WPGEA SLK+EK+LF+GKSDYQ+V++F+S+TYGKVL LDG IQ TE  
Sbjct  50    VLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVLVFQSSTYGKVLVLDGVIQLTERD  109

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVV+V++Q
Sbjct  110   ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVEVAKQ  169

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRV LHIGDG AF+     G YDA+IVDSSDPIGPA+ELFE+PFFE++ 
Sbjct  170   FFPDVAVGYEDPRVNLHIGDGVAFLKNVPAGTYDAVIVDSSDPIGPAQELFEKPFFESIA  229

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGVV TQAESIWLHMH+I++I+A+CRQ+FKGSVNYAWTTVPTYPSG+IG+MLCST
Sbjct  230   KALRPGGVVSTQAESIWLHMHIIEEIVANCRQIFKGSVNYAWTTVPTYPSGMIGFMLCST  289

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFKNP+NPID D +  KS  PLKFYNSEIH+A+F LPSFA++++E
Sbjct  290   EGPAVDFKNPINPID-DESPAKSIEPLKFYNSEIHQASFCLPSFAKRVIE  338



>ref|XP_010498889.1| PREDICTED: spermidine synthase 1-like [Camelina sativa]
Length=400

 Score =   443 bits (1139),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 206/293 (70%), Positives = 249/293 (85%), Gaps = 2/293 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  106   FSTVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  165

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+P++E ID+ EIDKMVVDV
Sbjct  166   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHPSVEHIDMCEIDKMVVDV  225

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  226   SKQFFPDVAIGYEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  285

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+ML
Sbjct  286   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFML  345

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGP VDFK+P+NPID+ ++  KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  346   CSTEGPEVDFKHPLNPIDESSS--KSNGPLKFYNAEIHSAAFCLPSFAKKVIE  396



>ref|XP_010460158.1| PREDICTED: spermidine synthase 1 [Camelina sativa]
Length=388

 Score =   442 bits (1138),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 206/293 (70%), Positives = 249/293 (85%), Gaps = 2/293 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  94    FSTVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  153

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+P++E ID+ EIDKMVVDV
Sbjct  154   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHPSVEHIDMCEIDKMVVDV  213

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  214   SKQFFPDVAIGYEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  273

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+ML
Sbjct  274   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFML  333

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGP VDFK+P+NPID+ ++  KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  334   CSTEGPEVDFKHPLNPIDESSS--KSNGPLKFYNAEIHSAAFCLPSFARKVIE  384



>sp|Q96557.1|SPD2_DATST RecName: Full=Spermidine synthase 2; Short=SPDSY 2; AltName: 
Full=Putrescine aminopropyltransferase 2 [Datura stramonium]
 emb|CAA69421.1| spermidine synthase 2 [Datura stramonium]
Length=317

 Score =   439 bits (1130),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 204/290 (70%), Positives = 247/290 (85%), Gaps = 1/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S +WPGEA SLK+EK+LF+GKSDYQDVM+F+S TYGKVL LDG IQ TE  
Sbjct  25    VLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQDVMVFQSTTYGKVLVLDGVIQLTERD  84

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVV+V++Q
Sbjct  85    ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVEVAKQ  144

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRV LHIGDG AF+     G YDA+IVDSSDPIGPA+ELFE+PFFE + 
Sbjct  145   FFPDVAVGYEDPRVNLHIGDGVAFLKNVPAGTYDAVIVDSSDPIGPAQELFEKPFFETIA  204

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVV TQAESIWLHMH+I++I+A+CR++FKGSVNYAWTTVPTYPSG+IG+MLCST
Sbjct  205   RALRPGGVVSTQAESIWLHMHIIEEIVANCREIFKGSVNYAWTTVPTYPSGMIGFMLCST  264

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFKNP+NPID D +H ++  PLKFYNSEIH+A+F LPSFA++++E
Sbjct  265   EGPAVDFKNPINPID-DESHGQTIGPLKFYNSEIHQASFCLPSFAKRVIE  313



>ref|XP_002888767.1| hypothetical protein ARALYDRAFT_476155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65026.1| hypothetical protein ARALYDRAFT_476155 [Arabidopsis lyrata subsp. 
lyrata]
Length=340

 Score =   440 bits (1132),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 204/288 (71%), Positives = 244/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ TE    
Sbjct  49    PGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDEC  108

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ ++E+IDI EIDKMVVDV++Q+F
Sbjct  109   AYQEMITHLPLCSISNPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDKMVVDVAKQYF  168

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V +A
Sbjct  169   PNVAVGYEDPRVNLIIGDGVAFLKNAAEGTYDAVIVDSSDPIGPAKELFEKPFFESVNRA  228

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+MLCSTEG
Sbjct  229   LRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFMLCSTEG  288

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             P VDFK PVNPID D +  KS  PLKFYN+EIH AAF LPSFA+K+++
Sbjct  289   PHVDFKKPVNPIDADESSSKSHGPLKFYNAEIHSAAFCLPSFAKKVID  336



>sp|Q9ZUB3.1|SPD1_ARATH RecName: Full=Spermidine synthase 1; Short=SPDSY 1; AltName: 
Full=Putrescine aminopropyltransferase 1 [Arabidopsis thaliana]
 gb|AAC98040.1| Strong similarity to gb|AB006693 spermidine synthase from Arabidopsis 
thaliana. ESTs gb|AA389822, gb|T41794, gb|N38455, gb|AI100106, 
gb|F14442 and gb|F14256 come from this gene [Arabidopsis 
thaliana]
 emb|CAB61614.1| spermidine synthase 1 [Arabidopsis thaliana]
 emb|CAB64644.1| spermidine synthase [Arabidopsis thaliana]
 gb|AAL32671.1| Strong similarity to spermidine synthase [Arabidopsis thaliana]
 gb|AAM13359.1| strong similarity to spermidine synthase [Arabidopsis thaliana]
Length=334

 Score =   440 bits (1131),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 206/293 (70%), Positives = 249/293 (85%), Gaps = 2/293 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  40    FSTVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  99

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ +IE+ID+ EIDKMVVDV
Sbjct  100   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASIEQIDMCEIDKMVVDV  159

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  160   SKQFFPDVAIGYEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  219

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+ML
Sbjct  220   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFML  279

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGP VDFK+P+NPID+ ++  KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  280   CSTEGPDVDFKHPLNPIDESSS--KSNGPLKFYNAEIHSAAFCLPSFAKKVIE  330



>ref|XP_002890597.1| hypothetical protein ARALYDRAFT_889925 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66856.1| hypothetical protein ARALYDRAFT_889925 [Arabidopsis lyrata subsp. 
lyrata]
Length=378

 Score =   442 bits (1136),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 206/293 (70%), Positives = 249/293 (85%), Gaps = 2/293 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  84    FSTVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  143

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+ID+ EIDKMVVDV
Sbjct  144   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASVEQIDMCEIDKMVVDV  203

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  204   SKQFFPDVAIGYEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  263

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLHM +I+ I+A+CR++FKGSVNYAWT+VPTYPSGVIG+ML
Sbjct  264   SVARALRPGGVVCTQAESLWLHMDIIEDIVANCREIFKGSVNYAWTSVPTYPSGVIGFML  323

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGP VDFK+P+NPID+ ++  KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  324   CSTEGPDVDFKHPLNPIDESSS--KSNGPLKFYNAEIHSAAFCLPSFAKKVIE  374



>gb|EPS71978.1| spermidine synthase 1, partial [Genlisea aurea]
Length=301

 Score =   438 bits (1127),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 210/287 (73%), Positives = 242/287 (84%), Gaps = 1/287 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S +WPGEA SLK+EK+LF+G SDYQ VM+F+S+TYGKVL LDG IQ TE  
Sbjct  15    VIPGWFSEISPLWPGEAHSLKVEKILFQGTSDYQKVMVFQSSTYGKVLVLDGVIQLTERD  74

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SI NPKKVL++GGG G  L EVSR+ ++EKIDI EIDKMVVDVS+Q
Sbjct  75    ECAYQEMITHLPLCSISNPKKVLVIGGGDGGVLREVSRHSSVEKIDICEIDKMVVDVSKQ  134

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A GF DPRVTL+IGDG AF+    +G YDA+IVDSSDPIGPAKELFE+PFFE+V 
Sbjct  135   FFPSVAVGFADPRVTLNIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAKELFEKPFFESVA  194

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGVVCTQAESIWLHM +I+ II +CRQVFKGSVNYAWTTVPTYPSGVIG+M+CST
Sbjct  195   KALRPGGVVCTQAESIWLHMDIIEDIIENCRQVFKGSVNYAWTTVPTYPSGVIGFMVCST  254

Query  980   E-GPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQ  1117
             E GP VDFK+PVNPID D +HV++K PL+FYNSEIH AAF LPSFA+
Sbjct  255   EGGPAVDFKHPVNPIDDDDSHVETKGPLRFYNSEIHSAAFCLPSFAR  301



>ref|NP_001149286.1| LOC100282908 [Zea mays]
 gb|ACG34862.1| spermidine synthase 1 [Zea mays]
Length=361

 Score =   441 bits (1133),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 207/288 (72%), Positives = 247/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE    
Sbjct  70    PGWFSEISPMWPGEAHSLKVEKVLFQGKSDYQNVMVFQSSTYGKVLVLDGVIQVTERDEC  129

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SI +PKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVVDVS+QFF
Sbjct  130   AYQEMITHLPLCSIKDPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVDVSKQFF  189

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P+LA GFEDPRV+LHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+PFF+ V +A
Sbjct  190   PHLAVGFEDPRVSLHIGDGVAFLKNAPEGTYDAVIVDSSDPIGPAQELFEKPFFQLVARA  249

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGVVCTQAESIWLH+H+I+ I+ +CRQVFKGSVNYAWTTVPTYPSGVIG+MLCSTEG
Sbjct  250   LRPGGVVCTQAESIWLHIHIIEDIVVNCRQVFKGSVNYAWTTVPTYPSGVIGFMLCSTEG  309

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             P VDF++PV  I++D   +KSK PLKFYNSEIH A+F LPSFA++++E
Sbjct  310   PAVDFQHPVFNIEEDEHPMKSKGPLKFYNSEIHTASFCLPSFAKRVIE  357



>ref|XP_002315806.1| spermidine synthase family protein [Populus trichocarpa]
 gb|EEF01977.1| spermidine synthase family protein [Populus trichocarpa]
Length=335

 Score =   439 bits (1130),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 251/300 (84%), Gaps = 2/300 (1%)
 Frame = +2

Query  233   ENAGNDF-GCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTL  409
             E   ND+   +  GWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL L
Sbjct  33    ETNNNDYISSVITGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVL  92

Query  410   DGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEI  589
             DG IQ TE     Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ ++E+IDI EI
Sbjct  93    DGVIQLTERDECAYQEMITHLPLCSIANPKKVLVIGGGDGGVLREVARHSSVEQIDICEI  152

Query  590   DKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKEL  769
             DKMVVDVS++FFP ++ G+EDPRV+LHIGDG AF+    +G YDA+IVDSSDPIGPA+EL
Sbjct  153   DKMVVDVSKKFFPDVSVGYEDPRVSLHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQEL  212

Query  770   FERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPS  949
             FE+PFFE+V KALR GGVV TQAESIWLHM++I+ I+A+CRQ+FKGSVNYAWTTVPTYPS
Sbjct  213   FEKPFFESVAKALRPGGVVSTQAESIWLHMNIIEDIVANCRQIFKGSVNYAWTTVPTYPS  272

Query  950   GVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             G+IG+MLCSTEGP VDFK+PVNPID + +  KSK PLKFYNSE+H AAF LPSFA+K+++
Sbjct  273   GMIGFMLCSTEGPAVDFKHPVNPIDSNDSQSKSK-PLKFYNSELHTAAFCLPSFAKKVID  331



>gb|KFK44455.1| hypothetical protein AALP_AA1G259000 [Arabis alpina]
Length=336

 Score =   439 bits (1130),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 206/293 (70%), Positives = 247/293 (84%), Gaps = 2/293 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  42    FSSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  101

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E ID+ EIDKMVVDV
Sbjct  102   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASVEHIDMCEIDKMVVDV  161

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A GFEDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  162   SKQFFPSVAIGFEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  221

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+ML
Sbjct  222   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFML  281

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGP VDFKNPVNPID+ ++  KS  PLK YN+EIH A+F LPSFA+K++E
Sbjct  282   CSTEGPHVDFKNPVNPIDESSS--KSNGPLKVYNAEIHSASFCLPSFAKKVIE  332



>gb|KGN51816.1| hypothetical protein Csa_5G602150 [Cucumis sativus]
Length=317

 Score =   439 bits (1128),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 208/300 (69%), Positives = 249/300 (83%), Gaps = 2/300 (1%)
 Frame = +2

Query  233   ENAGND-FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTL  409
             EN  +D    + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+S+TYGKVL L
Sbjct  17    ENGVSDSISSVIPGWFSEISPMWPGEAHSLKVEKVLFQGKSDYQDVLVFQSSTYGKVLVL  76

Query  410   DGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEI  589
             DG IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+IDI EI
Sbjct  77    DGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHLSVEQIDICEI  136

Query  590   DKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKEL  769
             DKMVVDVS++FFP +A G+EDPRVTLH+GDG AF+    +G YDAIIVDSSDPIGPA+EL
Sbjct  137   DKMVVDVSKEFFPRVAIGYEDPRVTLHVGDGVAFLKAVPEGTYDAIIVDSSDPIGPAQEL  196

Query  770   FERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPS  949
             FE+PFF +V KALR GGVVCTQAESIWLHMH+I+ I+ +CRQ+FKGSVNYAWTTVPTYPS
Sbjct  197   FEKPFFASVAKALRPGGVVCTQAESIWLHMHIIEDIVTNCRQIFKGSVNYAWTTVPTYPS  256

Query  950   GVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             GVIG+MLCSTEGP VDFK+PVN ++ +     +K PLKFYNSEIH AAF LPSFA+K+++
Sbjct  257   GVIGFMLCSTEGPTVDFKHPVNSVEVNGIDT-AKSPLKFYNSEIHAAAFCLPSFAKKIID  315



>emb|CAO02391.1| spermidine synthase [Cochlearia officinalis]
Length=328

 Score =   439 bits (1129),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 206/293 (70%), Positives = 247/293 (84%), Gaps = 2/293 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  34    FSSVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFKSATYGKVLVLDGVIQLT  93

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E ID+ EIDKMVVDV
Sbjct  94    ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASVEHIDMCEIDKMVVDV  153

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  154   SKQFFPDVAIGYEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  213

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+ML
Sbjct  214   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFML  273

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGP VDFKNPVN ID+ ++  KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  274   CSTEGPDVDFKNPVNSIDESSS--KSNGPLKFYNAEIHSAAFCLPSFAKKVIE  324



>sp|O48658.1|SPD1_HYONI RecName: Full=Spermidine synthase 1; Short=SPDSY 1; AltName: 
Full=Putrescine aminopropyltransferase 1 [Hyoscyamus niger]
 dbj|BAA24533.1| spermidine synthase 1 [Hyoscyamus niger]
Length=315

 Score =   438 bits (1127),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 203/290 (70%), Positives = 248/290 (86%), Gaps = 1/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S +WPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  23    VLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERD  82

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVV+V+++
Sbjct  83    ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVEVAKE  142

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRV LHIGDG AF+     G YDA+IVDSSDPIGPA+ELFE+PFFE++ 
Sbjct  143   FFPDVAVGYEDPRVNLHIGDGVAFLKNVPAGTYDAVIVDSSDPIGPAQELFEKPFFESIA  202

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVV TQAESIWLHMH+I++I+A+CRQ+FKGSVNYAWTTVPTYPSG+IG+MLCST
Sbjct  203   RALRPGGVVSTQAESIWLHMHIIEEIVANCRQIFKGSVNYAWTTVPTYPSGMIGFMLCST  262

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFKNP+NPID D +  K+  PLKFYNSEIH+A+F LPSFA++++E
Sbjct  263   EGPAVDFKNPINPID-DESGPKTIAPLKFYNSEIHQASFCLPSFAKRVIE  311



>ref|XP_006305089.1| hypothetical protein CARUB_v10009456mg [Capsella rubella]
 gb|EOA37987.1| hypothetical protein CARUB_v10009456mg [Capsella rubella]
Length=378

 Score =   441 bits (1133),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 205/293 (70%), Positives = 249/293 (85%), Gaps = 2/293 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  84    FSTVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  143

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+P++E ID+ EIDKMVVDV
Sbjct  144   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHPSVEHIDMCEIDKMVVDV  203

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  204   SKQFFPDVAIGYEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  263

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+ML
Sbjct  264   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFML  323

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGP VDFK+P+NPID+ ++  KS  PLKFYN+EIH AAF LPSFA+K+++
Sbjct  324   CSTEGPDVDFKHPLNPIDESSS--KSNLPLKFYNAEIHSAAFCLPSFAKKVID  374



>ref|XP_004956020.1| PREDICTED: spermidine synthase 1-like [Setaria italica]
Length=333

 Score =   439 bits (1129),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 206/290 (71%), Positives = 247/290 (85%), Gaps = 0/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  40    VIPGWFSEISPMWPGEAHSLKVEKVLFQGKSDYQNVMVFQSSTYGKVLVLDGVIQVTERD  99

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HL L SI +PKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVVDVS+Q
Sbjct  100   ECAYQEMITHLSLCSIKDPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVDVSKQ  159

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP+LA GFEDPRV+L+IGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFF++V 
Sbjct  160   FFPHLAVGFEDPRVSLNIGDGVAFLKNVPEGTYDAVIVDSSDPIGPAQELFEKPFFQSVA  219

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAESIWLHMH+I+ I+A+CRQVFKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  220   RALRPGGVVCTQAESIWLHMHIIEDIVANCRQVFKGSVNYAWTTVPTYPSGVIGFMLCST  279

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDF++PV  I++D    KSK PLKFYNSEIH A+F LPSFA++++E
Sbjct  280   EGPTVDFQHPVFNIEEDEYSTKSKGPLKFYNSEIHTASFCLPSFAKRVIE  329



>ref|NP_173794.2| spermidine synthase 1 [Arabidopsis thaliana]
 gb|AEE30436.1| spermidine synthase 1 [Arabidopsis thaliana]
Length=378

 Score =   440 bits (1132),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 206/293 (70%), Positives = 249/293 (85%), Gaps = 2/293 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  84    FSTVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  143

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ +IE+ID+ EIDKMVVDV
Sbjct  144   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASIEQIDMCEIDKMVVDV  203

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  204   SKQFFPDVAIGYEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  263

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+ML
Sbjct  264   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFML  323

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGP VDFK+P+NPID+ ++  KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  324   CSTEGPDVDFKHPLNPIDESSS--KSNGPLKFYNAEIHSAAFCLPSFAKKVIE  374



>ref|XP_010427802.1| PREDICTED: spermidine synthase 2 [Camelina sativa]
Length=346

 Score =   439 bits (1128),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 204/288 (71%), Positives = 244/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ TE    
Sbjct  55    PGWFSEMSPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDEC  114

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ ++E+IDI EIDKMVVDVS+Q+F
Sbjct  115   AYQEMITHLPLCSISNPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDKMVVDVSKQYF  174

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V  A
Sbjct  175   PKVAVGYEDPRVNLLIGDGVAFLKNAAEGTYDAVIVDSSDPIGPAKELFEKPFFESVNGA  234

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+MLCS+EG
Sbjct  235   LRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFMLCSSEG  294

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             P VDFK PVNPI+ D + VKS  PLKFYN+EIH AAF LPSFA+K+++
Sbjct  295   PQVDFKKPVNPIEADESSVKSFGPLKFYNAEIHSAAFCLPSFAKKVID  342



>ref|NP_001275022.1| spermidine synthase-like [Solanum tuberosum]
 emb|CAC51027.1| spermidine synthase [Solanum tuberosum]
Length=347

 Score =   439 bits (1128),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 204/290 (70%), Positives = 248/290 (86%), Gaps = 1/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S +WPGEA SLK+EK+LF+GKSDYQ+V++F+S+TYGKVL LDG IQ TE  
Sbjct  55    VLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVLVFQSSTYGKVLVLDGVIQLTERD  114

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVV+V++Q
Sbjct  115   ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVEVAKQ  174

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRV L IGDG AF+     G YDA+IVDSSDPIGPA+ELFE+PFFE++ 
Sbjct  175   FFPDVAVGYEDPRVNLRIGDGVAFLKNVPAGTYDAVIVDSSDPIGPAQELFEKPFFESIA  234

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGVV TQAESIWLHMH+I++I+A+CRQ+FKGSVNYAWTTVPTYPSG+IG+MLCST
Sbjct  235   KALRPGGVVATQAESIWLHMHIIEEIVANCRQIFKGSVNYAWTTVPTYPSGMIGFMLCST  294

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFKNP+NPID D + VK+  PLKFYNSEIH+A+F LPSFA++++E
Sbjct  295   EGPAVDFKNPINPID-DESPVKTIEPLKFYNSEIHQASFCLPSFAKRVIE  343



>dbj|BAC55523.1| spermidine synthase [Petunia x hybrida]
Length=316

 Score =   437 bits (1124),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 205/290 (71%), Positives = 242/290 (83%), Gaps = 0/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S +WPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  23    VLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERD  82

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ +IE+IDI EIDKMVV+VS+Q
Sbjct  83    ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSIEQIDICEIDKMVVEVSKQ  142

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRV LHIGDG AF+     G YDA+IVDSSDPIGPA+ELFE+PFFE V 
Sbjct  143   FFPDVAVGYEDPRVNLHIGDGVAFLKAVPAGTYDAVIVDSSDPIGPAQELFEKPFFETVA  202

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVV TQAESIWLHM +I+ I+ +CRQ+FKGSVNYAWTTVPTYPSG+IG+MLCST
Sbjct  203   RALRPGGVVSTQAESIWLHMDIIENIVTNCRQIFKGSVNYAWTTVPTYPSGMIGFMLCST  262

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EG  VDFKNPVN I+ D  H K+ PPLKFYN EIHKA+F LPSFA++++E
Sbjct  263   EGLEVDFKNPVNLIENDEIHSKTLPPLKFYNFEIHKASFALPSFAKRVIE  312



>ref|XP_008340017.1| PREDICTED: spermidine synthase 1-like isoform X1 [Malus domestica]
 ref|XP_008340018.1| PREDICTED: spermidine synthase 1-like isoform X2 [Malus domestica]
 dbj|BAC20171.1| spermidine synthase [Malus domestica]
Length=335

 Score =   438 bits (1126),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 209/295 (71%), Positives = 242/295 (82%), Gaps = 6/295 (2%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             +    + PGWFSE S MWPGEA SLKIEK+LF+GKSDYQ+VM+F+SATYGKVL LDG IQ
Sbjct  43    DSVSAVIPGWFSEISPMWPGEAHSLKIEKILFQGKSDYQNVMVFQSATYGKVLVLDGVIQ  102

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
              TE     Y EMI HLPL SIPNPKKVL++GGG G  L EV+RY ++EKIDI EIDKMVV
Sbjct  103   LTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARYASVEKIDICEIDKMVV  162

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             DVS+QFFP +A G++DPRV+LH+GDG AF+     G YDA+IVDSSDPIGPAKELFE+PF
Sbjct  163   DVSKQFFPDVAIGYDDPRVSLHVGDGVAFLKAVPAGTYDAVIVDSSDPIGPAKELFEKPF  222

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             F+ V  ALR GGVVCTQAESIWLHM +I+ I+ +CR+VFKGSVNYAWTTVPTYPSGVIG+
Sbjct  223   FQTVANALRPGGVVCTQAESIWLHMDIIEDIVENCREVFKGSVNYAWTTVPTYPSGVIGF  282

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             MLCSTEGP VDFK+PVN ID       SK PLKFYNSEIH AAF LPSFA+K+++
Sbjct  283   MLCSTEGPAVDFKHPVNSID------ASKRPLKFYNSEIHTAAFCLPSFAKKVID  331



>gb|AET79382.1| spermidine synthase [Populus tomentosa]
Length=335

 Score =   437 bits (1123),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 203/298 (68%), Positives = 249/298 (84%), Gaps = 1/298 (0%)
 Frame = +2

Query  236   NAGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDG  415
             N+ +    + PGWFSE S MWPGEA SLK+EK+LF+G+SDYQ+VM+F+S+TYGKVL LDG
Sbjct  35    NSNDCISSVIPGWFSEISPMWPGEAHSLKVEKILFQGRSDYQNVMVFQSSTYGKVLVLDG  94

Query  416   AIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDK  595
              IQ TE     Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ ++ +IDI EIDK
Sbjct  95    VIQLTERDECAYQEMITHLPLCSIANPKKVLVIGGGDGGVLREVARHASVVQIDICEIDK  154

Query  596   MVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFE  775
             MVVDVS++FFP ++ G+EDPRVTLHIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE
Sbjct  155   MVVDVSKKFFPDVSVGYEDPRVTLHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQELFE  214

Query  776   RPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGV  955
             +PFFE++ KALR GGVV TQAESIWLHM++I+ I+A+C Q+FKGSVNYAWTTVPTYPSG+
Sbjct  215   KPFFESIAKALRPGGVVSTQAESIWLHMNIIEDIVANCHQIFKGSVNYAWTTVPTYPSGM  274

Query  956   IGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             IG+MLCSTEGP VDFK+PVNPID + +  KSK PLKFYNSE+H AAF LPSFA+K+++
Sbjct  275   IGFMLCSTEGPAVDFKHPVNPIDSNDSQSKSK-PLKFYNSELHTAAFCLPSFAKKVID  331



>ref|XP_010324709.1| PREDICTED: putrescine N-methyltransferase 2 isoform X1 [Solanum 
lycopersicum]
Length=289

 Score =   435 bits (1118),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 216/282 (77%), Positives = 236/282 (84%), Gaps = 4/282 (1%)
 Frame = +2

Query  104  MEVIAAHNNGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSE  283
            MEVI  H N   +T   NG   HHN +   +  +  +H        GN    IKPGWFSE
Sbjct  1    MEVIYTHTNSSAITITTNG---HHNNSKPDNRNSRTNHENGNKLLLGNS-NSIKPGWFSE  56

Query  284  FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI  463
            FS +WPGEAFS+KIEKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI
Sbjct  57   FSALWPGEAFSIKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI  116

Query  464  VHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAG  643
            VHLPLGSIP+PKKVLI+GGGIGFTL EV RYPTIEKIDIVEID +VVDVSR+ FPYLAA 
Sbjct  117  VHLPLGSIPSPKKVLIIGGGIGFTLFEVLRYPTIEKIDIVEIDNVVVDVSRKIFPYLAAN  176

Query  644  FEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGV  823
            F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFE+V KALR GGV
Sbjct  177  FNDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFESVAKALRPGGV  236

Query  824  VCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPS  949
            VCTQAESIWLHMH+I+QIIA+CRQVFKGSVNYAWTTVPTYP+
Sbjct  237  VCTQAESIWLHMHIIEQIIANCRQVFKGSVNYAWTTVPTYPT  278



>gb|EEC81895.1| hypothetical protein OsI_25717 [Oryza sativa Indica Group]
Length=457

 Score =   441 bits (1134),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 206/289 (71%), Positives = 247/289 (85%), Gaps = 0/289 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  164   VIPGWFSEISPMWPGEAHSLKVEKVLFQGKSDYQNVMVFQSSTYGKVLVLDGVIQVTERD  223

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SI +PKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVVDVS+Q
Sbjct  224   ECAYQEMITHLPLCSIKDPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVDVSKQ  283

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP+LA GFEDPRV+LHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+PFF++V 
Sbjct  284   FFPHLAVGFEDPRVSLHIGDGVAFLKNAPEGTYDAVIVDSSDPIGPAQELFEKPFFQSVA  343

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAESIWLHMH+I+ I+A+CRQVFKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  344   RALRPGGVVCTQAESIWLHMHIIEDIVANCRQVFKGSVNYAWTTVPTYPSGVIGFMLCST  403

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             EGP VDF++P+  I+ +    KSK PLKFYNSEIH A+F LPSFA++++
Sbjct  404   EGPTVDFQHPIFNIEDNEFSTKSKGPLKFYNSEIHSASFCLPSFAKRVI  452



>ref|XP_010682580.1| PREDICTED: spermidine synthase 1 [Beta vulgaris subsp. vulgaris]
Length=342

 Score =   436 bits (1121),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 204/299 (68%), Positives = 244/299 (82%), Gaps = 0/299 (0%)
 Frame = +2

Query  233   ENAGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLD  412
             E   N    I PGWFSE S MWPGEA SLK+EK+LF+GKS YQDV++F+S+TYGKVL LD
Sbjct  40    EEKPNSMSSIIPGWFSEISPMWPGEAHSLKVEKILFQGKSKYQDVIVFQSSTYGKVLVLD  99

Query  413   GAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEID  592
             G IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E IDI EID
Sbjct  100   GVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSVEHIDICEID  159

Query  593   KMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELF  772
             +MVV VS+ +FP +A G++D RV LHIGDG AF+  A++G YDAIIVDSSDPIGPAKELF
Sbjct  160   EMVVTVSKDYFPEVAVGYDDSRVKLHIGDGVAFLKEAQEGTYDAIIVDSSDPIGPAKELF  219

Query  773   ERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSG  952
             E+PFF+++ +ALR GGVVCTQAESIWLHMH+I+ I+++CR++FKGSVNYAWTTVPTYPSG
Sbjct  220   EKPFFQSIARALRPGGVVCTQAESIWLHMHIIEDIVSNCREIFKGSVNYAWTTVPTYPSG  279

Query  953   VIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             VIG+MLCSTEGP VDFK+PVNPIDK         PLKFYNSE+H AAF LPSFA+K++E
Sbjct  280   VIGFMLCSTEGPQVDFKHPVNPIDKIENTENEARPLKFYNSELHSAAFCLPSFAKKVIE  338



>ref|NP_001267711.1| spermidine synthase-like [Cucumis sativus]
 gb|AAT66041.1| spermidine synthase [Cucumis sativus]
Length=317

 Score =   435 bits (1119),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 247/300 (82%), Gaps = 2/300 (1%)
 Frame = +2

Query  233   ENAGND-FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTL  409
             EN  +D    + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+S+TYGKVL L
Sbjct  17    ENGVSDSISSVIPGWFSEISPMWPGEAHSLKVEKVLFQGKSDYQDVLVFQSSTYGKVLVL  76

Query  410   DGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEI  589
             DG IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+IDI EI
Sbjct  77    DGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHLSVEQIDICEI  136

Query  590   DKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKEL  769
             DKMVVDVS++FFP +A G+EDPRVTLH+GDG AF+    +G YDAIIVDSSDPIGPA+EL
Sbjct  137   DKMVVDVSKEFFPRVAIGYEDPRVTLHVGDGVAFLKAVPEGTYDAIIVDSSDPIGPAQEL  196

Query  770   FERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPS  949
             FE+PFF +V KALR GGVVCTQAE IWLHMH+I+ I+ +CRQ+FKGSVNYAWTTVPTYPS
Sbjct  197   FEKPFFASVAKALRPGGVVCTQAEGIWLHMHIIEDIVTNCRQIFKGSVNYAWTTVPTYPS  256

Query  950   GVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             GVIG+MLCSTEGP VDFK+PVN  + +     +K PLKFYNSEIH AAF LPSFA+K+++
Sbjct  257   GVIGFMLCSTEGPTVDFKHPVNSAEVNGIDT-AKSPLKFYNSEIHAAAFCLPSFAKKIID  315



>gb|KHN00346.1| Spermidine synthase 1 [Glycine soja]
Length=342

 Score =   436 bits (1120),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 205/287 (71%), Positives = 243/287 (85%), Gaps = 2/287 (1%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  51    VIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERD  110

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ ++EKIDI EIDKMVVDVS+Q
Sbjct  111   ECAYQEMITHLPLCSISNPKKVLVIGGGDGGVLREVARHASVEKIDICEIDKMVVDVSKQ  170

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A GFEDPRVTL +GDG AF+    KG YDA+IVDSSDPIGPA+ELFE+PFF +V 
Sbjct  171   FFPDIAVGFEDPRVTLTVGDGVAFLKNVPKGTYDAVIVDSSDPIGPAQELFEKPFFASVA  230

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGS+NYAWTTVPTYPSG+IG+MLCST
Sbjct  231   KALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSINYAWTTVPTYPSGMIGFMLCST  290

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             EGP VDFK+PVNPI+++ +  +   PLKFYNSEIH AAF LPSFA++
Sbjct  291   EGPLVDFKHPVNPINENDS--QQSRPLKFYNSEIHTAAFCLPSFAKR  335



>emb|CDY59080.1| BnaA09g54560D [Brassica napus]
Length=344

 Score =   436 bits (1120),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 207/302 (69%), Positives = 247/302 (82%), Gaps = 11/302 (4%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  41    FSSVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  100

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+ID+ EIDKMVVDV
Sbjct  101   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASVEQIDMCEIDKMVVDV  160

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A GFEDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  161   SKQFFPNVAIGFEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  220

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPS-------  949
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYP        
Sbjct  221   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPRHVSLPFN  280

Query  950   --GVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKL  1123
               GVIG+MLCSTEGP VDFKNPVNPID  ++  KS  PLKFYN+EIH AAF LPSFA+K+
Sbjct  281   IHGVIGFMLCSTEGPDVDFKNPVNPIDDSSS--KSNAPLKFYNAEIHSAAFCLPSFAKKV  338

Query  1124  LE  1129
             +E
Sbjct  339   IE  340



>ref|XP_011021626.1| PREDICTED: spermidine synthase 1-like [Populus euphratica]
Length=335

 Score =   435 bits (1119),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 206/300 (69%), Positives = 249/300 (83%), Gaps = 2/300 (1%)
 Frame = +2

Query  233   ENAGNDF-GCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTL  409
             E   ND+   +  GWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL L
Sbjct  33    ETNSNDYISSVIAGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVL  92

Query  410   DGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEI  589
             DG IQ TE     Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ ++ +IDI EI
Sbjct  93    DGVIQLTERDECAYQEMITHLPLCSIANPKKVLVIGGGDGGVLREVARHSSVVQIDICEI  152

Query  590   DKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKEL  769
             DKMVVDVS++FFP ++ G+EDPRVTLHIGDG AF+    +G YDA+IVDSSDPIGPA+EL
Sbjct  153   DKMVVDVSKKFFPDVSVGYEDPRVTLHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQEL  212

Query  770   FERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPS  949
             FE+PFFE+V KALR GGVV TQAESIWLHM++I+ I+A+C Q+FKGSVNYAWTTVPTYPS
Sbjct  213   FEKPFFESVAKALRPGGVVSTQAESIWLHMNIIEDIVANCHQIFKGSVNYAWTTVPTYPS  272

Query  950   GVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             G+IG+MLCSTEGP VDFK+PVNPID + +  KSK PLKFYNSE+H AAF LPSFA+K+++
Sbjct  273   GMIGFMLCSTEGPAVDFKHPVNPIDSNDSQSKSK-PLKFYNSELHTAAFCLPSFAKKVID  331



>ref|XP_009412314.1| PREDICTED: spermidine synthase 2-like [Musa acuminata subsp. 
malaccensis]
Length=326

 Score =   435 bits (1118),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 205/296 (69%), Positives = 247/296 (83%), Gaps = 1/296 (0%)
 Frame = +2

Query  245   ND-FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAI  421
             ND    I PGWFSE + MWPGEA SLK+EK+LF+GKSD+Q+V++F+S+TYGKVL LDG I
Sbjct  30    NDGLSAIMPGWFSEINPMWPGEAHSLKVEKVLFQGKSDFQNVVVFQSSTYGKVLVLDGVI  89

Query  422   QHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMV  601
             Q TE     Y EMI H+PL SI NPKKVL++GGG G  L EVSRY ++E+IDI EIDKMV
Sbjct  90    QLTERDECAYQEMITHIPLCSILNPKKVLVIGGGDGGVLREVSRYSSVEQIDICEIDKMV  149

Query  602   VDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERP  781
             +DVS++FFP +A G+EDPRVTLH+GDG AF+    +G YDAIIVDSSDPIGPAKELFE+P
Sbjct  150   IDVSKEFFPNMAVGYEDPRVTLHVGDGVAFLKNVPEGTYDAIIVDSSDPIGPAKELFEKP  209

Query  782   FFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIG  961
             FFE+V  ALR GGVVCTQAESIWLHMH+I+ I+++CRQVFKGSV+YAWTTVPTYPSGVIG
Sbjct  210   FFESVANALRPGGVVCTQAESIWLHMHIIEDIVSNCRQVFKGSVSYAWTTVPTYPSGVIG  269

Query  962   YMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             +MLCSTEGPPVDF++PV  +D+     KS  PLKFYNSEIH AAF LPSFA+++++
Sbjct  270   FMLCSTEGPPVDFQHPVYNMDEAENSNKSVGPLKFYNSEIHSAAFCLPSFARRVID  325



>ref|NP_001241525.1| uncharacterized protein LOC100790506 [Glycine max]
 gb|ACU18320.1| unknown [Glycine max]
 gb|KHN12099.1| Spermidine synthase 1 [Glycine soja]
Length=338

 Score =   435 bits (1118),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 205/287 (71%), Positives = 243/287 (85%), Gaps = 2/287 (1%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  47    VIPGWFSEISPMWPGEAHSLKMEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERD  106

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++EKIDI EIDKMVVDVS+Q
Sbjct  107   ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASVEKIDICEIDKMVVDVSKQ  166

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A GFEDPRVTL +GDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFF +V 
Sbjct  167   FFPDIAVGFEDPRVTLTVGDGVAFLKDVPEGTYDAVIVDSSDPIGPAQELFEKPFFASVA  226

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYPSG+IG+MLCST
Sbjct  227   KALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGMIGFMLCST  286

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             EGP VDFK+PVNP+ ++ +  +   PLKFYNSEIH AAF LPSFA++
Sbjct  287   EGPLVDFKHPVNPLSENDS--QQSRPLKFYNSEIHTAAFCLPSFAKR  331



>emb|CDY47635.1| BnaC05g18910D [Brassica napus]
Length=346

 Score =   435 bits (1118),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 207/304 (68%), Positives = 247/304 (81%), Gaps = 13/304 (4%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  41    FSSVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  100

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+ID+ EIDKMVVDV
Sbjct  101   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASVEQIDMCEIDKMVVDV  160

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A GFEDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  161   SKQFFPNVAIGFEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  220

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPS-------  949
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYP        
Sbjct  221   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPRHVSLPLN  280

Query  950   ----GVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQ  1117
                 GVIG+MLCSTEGP VDFKNPVNPID  ++  KS  PLKFYN+EIH AAF LPSFA+
Sbjct  281   IQSHGVIGFMLCSTEGPDVDFKNPVNPIDDSSS--KSNGPLKFYNAEIHSAAFCLPSFAK  338

Query  1118  KLLE  1129
             K++E
Sbjct  339   KVIE  342



>ref|NP_177188.1| Spermidine synthase 2 [Arabidopsis thaliana]
 sp|O48661.2|SPD2_ARATH RecName: Full=Spermidine synthase 2; Short=SPDSY 2; AltName: 
Full=Putrescine aminopropyltransferase 2 [Arabidopsis thaliana]
 gb|AAK52993.1|AF375409_1 At1g70310/F17O7_16 [Arabidopsis thaliana]
 gb|AAC18808.1| Strong similarity to spermidine synthase 1, gb|Y08252 and possibly 
closer similarity to spermidine synthase 2 gb|Y08253 from 
Datura stramonium. ESTs gb|N38155, gb|T41738, gb|AA597626, 
gb|AA712967 and gb|AA712346 come from this gene [Arabidopsis 
thaliana]
 emb|CAB61615.1| spermidine synthase 2 [Arabidopsis thaliana]
 gb|AAV85715.1| At1g70310 [Arabidopsis thaliana]
 gb|AEE35044.1| Spermidine synthase 2 [Arabidopsis thaliana]
Length=340

 Score =   434 bits (1117),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 201/290 (69%), Positives = 244/290 (84%), Gaps = 0/290 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             I PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ TE  
Sbjct  47    IIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERD  106

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ ++E+IDI EIDKMVVDV++Q
Sbjct  107   ECAYQEMITHLPLCSISNPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDKMVVDVAKQ  166

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             +FP +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V 
Sbjct  167   YFPNVAVGYEDPRVNLIIGDGVAFLKNAAEGTYDAVIVDSSDPIGPAKELFEKPFFESVN  226

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAES+WLHM +I+ I+++CR +FKGSVNYAWT+VPTYPSGVIG+MLCS+
Sbjct  227   RALRPGGVVCTQAESLWLHMDIIEDIVSNCRDIFKGSVNYAWTSVPTYPSGVIGFMLCSS  286

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP VDFK PV+ ID D + +KS  PLK+YN+EIH AAF LPSFA+K+++
Sbjct  287   EGPQVDFKKPVSLIDTDESSIKSHCPLKYYNAEIHSAAFCLPSFAKKVID  336



>ref|XP_007157469.1| hypothetical protein PHAVU_002G072200g [Phaseolus vulgaris]
 gb|ESW29463.1| hypothetical protein PHAVU_002G072200g [Phaseolus vulgaris]
Length=338

 Score =   434 bits (1117),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 205/292 (70%), Positives = 244/292 (84%), Gaps = 2/292 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
                + PGWFSE S MWPGEA SLK+EK+LF+GKS+YQ+VM+F+S+TYGKVL LDG IQ T
Sbjct  44    LSAVIPGWFSEISPMWPGEAHSLKVEKILFEGKSEYQNVMVFQSSTYGKVLVLDGVIQLT  103

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++EKIDI EIDKMVVDV
Sbjct  104   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSVEKIDICEIDKMVVDV  163

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP ++ GFEDPRVTL+IGDG AF+   E+G YDA+IVDSSDPIGPA+ELFE+PFF 
Sbjct  164   SKQFFPDVSVGFEDPRVTLNIGDGVAFLKAVEEGTYDAVIVDSSDPIGPAQELFEKPFFN  223

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGV+CTQAESIWLHM +I+ I+A+CRQ+FKGSVNYAWTTVPTYPSG+IG+ML
Sbjct  224   SVARALRPGGVMCTQAESIWLHMDIIEGIVANCRQIFKGSVNYAWTTVPTYPSGMIGFML  283

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             CSTEGP VDFKNPV  ID+D    +S  PLKFYNSEIH AAF LPSFA++ +
Sbjct  284   CSTEGPTVDFKNPVYSIDEDDK--QSTRPLKFYNSEIHSAAFCLPSFAKRAI  333



>ref|XP_004509836.1| PREDICTED: spermidine synthase 2-like [Cicer arietinum]
Length=329

 Score =   434 bits (1115),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 205/293 (70%), Positives = 242/293 (83%), Gaps = 1/293 (0%)
 Frame = +2

Query  242   GNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAI  421
             GN    + PGWFSE S MWPGEA SLKIEK+LF+GKS+YQ VM+F+S+TYGKVL LDG I
Sbjct  31    GNGISSVIPGWFSEISPMWPGEAHSLKIEKILFQGKSEYQKVMVFQSSTYGKVLVLDGVI  90

Query  422   QHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMV  601
             Q TE     Y EMI HLPL SI NPKKVL++GGG G  L EVSR+ +IEKIDI EID MV
Sbjct  91    QLTERDECAYQEMITHLPLCSIANPKKVLVIGGGDGGVLREVSRHSSIEKIDICEIDNMV  150

Query  602   VDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERP  781
             V+VS+Q+FP +A GF DPRVTL IGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+P
Sbjct  151   VEVSKQYFPEVAVGFNDPRVTLRIGDGVAFLKAAAEGTYDAVIVDSSDPIGPAQELFEKP  210

Query  782   FFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIG  961
             FF++V +ALR GGV+CTQAESIWLHM +I+ I+++CRQ+F GSVNYAWTTVPTYPSG+IG
Sbjct  211   FFQSVARALRPGGVMCTQAESIWLHMDIIEDIVSNCRQIFNGSVNYAWTTVPTYPSGMIG  270

Query  962   YMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             +MLCSTEGP VDFK+PVNPID+  +  KS  PLKFYNSEIH AAF LPSFA++
Sbjct  271   FMLCSTEGPTVDFKHPVNPIDEKESQ-KSVRPLKFYNSEIHTAAFCLPSFAKR  322



>ref|NP_001239861.1| uncharacterized protein LOC100792107 [Glycine max]
 gb|ACU21202.1| unknown [Glycine max]
Length=340

 Score =   434 bits (1117),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 204/287 (71%), Positives = 243/287 (85%), Gaps = 2/287 (1%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  49    VIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERD  108

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ ++EKIDI EIDKMVVDVS+Q
Sbjct  109   ECAYQEMITHLPLCSISNPKKVLVIGGGDGGVLREVARHASVEKIDICEIDKMVVDVSKQ  168

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A GFEDPRVTL +GDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFF +V 
Sbjct  169   FFPDIAVGFEDPRVTLTVGDGVAFLKNVPEGTYDAVIVDSSDPIGPAQELFEKPFFASVA  228

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGS+NYAWTTVPTYPSG+IG+MLCST
Sbjct  229   KALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSINYAWTTVPTYPSGMIGFMLCST  288

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             EGP VDFK+PVNPI+++ +  +   PLKFYNSEIH AAF LPSFA++
Sbjct  289   EGPLVDFKHPVNPINENDS--QQSRPLKFYNSEIHTAAFCLPSFAKR  333



>ref|XP_009110079.1| PREDICTED: spermidine synthase 1-like [Brassica rapa]
Length=330

 Score =   434 bits (1115),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 205/293 (70%), Positives = 244/293 (83%), Gaps = 4/293 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S M PGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  38    FSSVIPGWFSEMSPMCPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  97

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+ID+ EIDKMVVDV
Sbjct  98    ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSVEQIDMCEIDKMVVDV  157

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A GFEDPRV L IGDG A++  A  G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  158   SKQFFPNVAIGFEDPRVNLVIGDGVAYLKNAAGGSYDAVIVDSSDPIGPAKELFEKPFFQ  217

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+ML
Sbjct  218   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFML  277

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGP VDFK+PVNPID      KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  278   CSTEGPDVDFKHPVNPIDDS----KSSGPLKFYNAEIHSAAFCLPSFAKKVIE  326



>sp|Q9ZTR0.1|SPD2_PEA RecName: Full=Spermidine synthase 2; Short=SPDSY 2; AltName: 
Full=Putrescine aminopropyltransferase 2 [Pisum sativum]
 gb|AAD02232.1| spermidine synthase 2 [Pisum sativum]
Length=342

 Score =   434 bits (1116),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 206/294 (70%), Positives = 243/294 (83%), Gaps = 1/294 (0%)
 Frame = +2

Query  239   AGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGA  418
             +GN    + PGWFSE S MWPGEA SLKIEK+LF+GKS+YQ VM+F+S+TYGKVL LDG 
Sbjct  43    SGNGVSSVIPGWFSEISPMWPGEAHSLKIEKILFQGKSEYQKVMVFQSSTYGKVLVLDGV  102

Query  419   IQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKM  598
             IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ +IEKIDI EID M
Sbjct  103   IQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSIEKIDICEIDNM  162

Query  599   VVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFER  778
             VV+VS+QFFP +A GF DPRVTL IGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+
Sbjct  163   VVEVSKQFFPEVAVGFNDPRVTLRIGDGVAFLKAAPEGTYDAVIVDSSDPIGPAQELFEK  222

Query  779   PFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVI  958
             PFF++V +ALR GGV+CTQAESIWLHM +I+ I+++CR +FKGSVNYAWTTVPTYPSG+I
Sbjct  223   PFFQSVARALRPGGVMCTQAESIWLHMDIIEDIVSNCRHIFKGSVNYAWTTVPTYPSGMI  282

Query  959   GYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             G+MLCSTEGP VDFK+PVNPID+     KS  PLKFYNSEIH AAF LPSFA++
Sbjct  283   GFMLCSTEGPLVDFKHPVNPIDQKDCQ-KSVRPLKFYNSEIHTAAFCLPSFAKR  335



>ref|XP_007153640.1| hypothetical protein PHAVU_003G052600g [Phaseolus vulgaris]
 gb|ESW25634.1| hypothetical protein PHAVU_003G052600g [Phaseolus vulgaris]
Length=334

 Score =   433 bits (1113),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 202/293 (69%), Positives = 243/293 (83%), Gaps = 1/293 (0%)
 Frame = +2

Query  242   GNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAI  421
             GN    + PGWFSE S MWPGEA SLK+EK+LF+GKS+YQ++M+F+S+TYGKVL LDG I
Sbjct  36    GNGLSSVIPGWFSEISSMWPGEAHSLKVEKILFQGKSEYQNIMVFQSSTYGKVLVLDGVI  95

Query  422   QHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMV  601
             Q TE     Y EMI HLPL SIPNPKKVL++GGG G  L E++R+ ++EKIDI EID MV
Sbjct  96    QLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREIARHSSVEKIDICEIDGMV  155

Query  602   VDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERP  781
             VDVS+Q+FP +A G+EDPRVTL +GDG AF+    +G YDA+IVDSSDPIGPA+ELFE+P
Sbjct  156   VDVSKQYFPDVAVGYEDPRVTLTVGDGVAFLKNVPEGTYDAVIVDSSDPIGPAQELFEKP  215

Query  782   FFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIG  961
             FF +V KALR GGVVCTQAESIWLHM +I+ I+++CR +FKGSVNYAWTTVPTYPSG+IG
Sbjct  216   FFGSVAKALRPGGVVCTQAESIWLHMDIIEDIVSNCRHIFKGSVNYAWTTVPTYPSGMIG  275

Query  962   YMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             +MLCSTEGPP+DFK+PVNPID+     KS  PLKFYNSEIH AAF LPSFA++
Sbjct  276   FMLCSTEGPPIDFKHPVNPIDEKECQ-KSARPLKFYNSEIHTAAFCLPSFAKR  327



>ref|XP_003552013.1| PREDICTED: spermidine synthase 2 [Glycine max]
Length=335

 Score =   432 bits (1112),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 206/293 (70%), Positives = 246/293 (84%), Gaps = 1/293 (0%)
 Frame = +2

Query  242   GNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAI  421
              N    + PGWFSE S MWPGEA SLK+EK+LF+GKS+YQ+VM+F+S+TYGKVL LDG I
Sbjct  37    SNGLSSVIPGWFSEISSMWPGEAHSLKVEKILFQGKSEYQNVMVFQSSTYGKVLVLDGVI  96

Query  422   QHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMV  601
             Q TE     Y EMI HLPL SIPNPKKVL++GGG G  + EV+ + ++EKIDI EIDKMV
Sbjct  97    QLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVIREVAHHSSVEKIDICEIDKMV  156

Query  602   VDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERP  781
             VDVS+Q+FP +A G++DPRVTLHIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+P
Sbjct  157   VDVSKQYFPDVAVGYDDPRVTLHIGDGVAFLKEVPEGTYDAVIVDSSDPIGPAQELFEKP  216

Query  782   FFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIG  961
             FF +V KALR GGVVCTQAESIWLHM +I+ I+A+CRQ+FKGSVNYAWTTVPTYPSG+IG
Sbjct  217   FFSSVAKALRPGGVVCTQAESIWLHMDIIEDIVANCRQIFKGSVNYAWTTVPTYPSGMIG  276

Query  962   YMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             +MLCSTEGPPVDFK+PVNPID++ +  KS  PLKFYNSEIH AAF LPSFA++
Sbjct  277   FMLCSTEGPPVDFKHPVNPIDENESQ-KSVRPLKFYNSEIHTAAFCLPSFAKR  328



>ref|XP_006857635.1| hypothetical protein AMTR_s00061p00133330 [Amborella trichopoda]
 gb|ERN19102.1| hypothetical protein AMTR_s00061p00133330 [Amborella trichopoda]
Length=333

 Score =   432 bits (1111),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 205/294 (70%), Positives = 241/294 (82%), Gaps = 2/294 (1%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWFSEFS MWPGEA SLK+EK+LF+ KS YQDVM+F+S+TYGKVL LDG IQ TE  
Sbjct  39    VLPGWFSEFSSMWPGEAHSLKVEKILFQDKSQYQDVMVFQSSTYGKVLVLDGVIQCTERD  98

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ +IE+IDI EID MVVDVS+Q
Sbjct  99    ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSIEQIDICEIDAMVVDVSKQ  158

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP +A G+EDPRV LHIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFFEAV 
Sbjct  159   FFPDMAVGYEDPRVKLHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQELFEKPFFEAVA  218

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGVVCTQAESIWLHMH+I+ I+  CRQVFKGSVNYAWT+VPTYPSGVIG+MLCST
Sbjct  219   KALRPGGVVCTQAESIWLHMHIIEDIVDVCRQVFKGSVNYAWTSVPTYPSGVIGFMLCST  278

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE*GLK  1141
             EGP VDF++PVN +D      K+K  LKFYNS+IH AAF LP+FA++ +   +K
Sbjct  279   EGPAVDFRHPVNILDD--CDGKAKQSLKFYNSDIHSAAFCLPTFAKRAISAKIK  330



>gb|KEH27761.1| spermidine synthase [Medicago truncatula]
Length=349

 Score =   432 bits (1112),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 207/293 (71%), Positives = 241/293 (82%), Gaps = 1/293 (0%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQ  424
             N    + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+SATYGKVL LDG IQ
Sbjct  46    NGLSSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSATYGKVLVLDGVIQ  105

Query  425   HTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVV  604
              TE     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++EKIDI EIDKMVV
Sbjct  106   LTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHASVEKIDICEIDKMVV  165

Query  605   DVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPF  784
             DVS+QFFP +A GFEDPRVTLHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+PF
Sbjct  166   DVSKQFFPDIAVGFEDPRVTLHIGDGVAFLKAAPEGTYDAVIVDSSDPIGPAQELFEKPF  225

Query  785   FEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGY  964
             FE+V +ALR GGVVCTQAESIWLHMH+I+ I+ +CRQVFKGSVNYAWTTVPTYPSG+IG+
Sbjct  226   FESVARALRPGGVVCTQAESIWLHMHIIEDIVVNCRQVFKGSVNYAWTTVPTYPSGMIGF  285

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKL  1123
             MLCSTEGP VDFK+PVNPID++ +    + PLKFYNSE+  +   L S   KL
Sbjct  286   MLCSTEGPSVDFKHPVNPIDENDSQHAGR-PLKFYNSEVGCSNTCLLSLTPKL  337



>ref|XP_009103153.1| PREDICTED: spermidine synthase 1-like [Brassica rapa]
Length=329

 Score =   431 bits (1108),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 208/293 (71%), Positives = 245/293 (84%), Gaps = 2/293 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  35    FSSVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  94

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+ID+ EIDKMVVDV
Sbjct  95    ERDECAYQEMITHLPLCSIPNPKKVLVIGGGGGGVLPEVARHASVEQIDMCEIDKMVVDV  154

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A  FEDPRV L IGDG AF+  A  G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  155   SKQFFPNVAIRFEDPRVNLVIGDGVAFLKNAVDGSYDAVIVDSSDPIGPAKELFEKPFFQ  214

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR VFKGSVNYAWT+VPTYPSGVIG+ML
Sbjct  215   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCRDVFKGSVNYAWTSVPTYPSGVIGFML  274

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGP VDFKNPVNPID  ++  KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  275   CSTEGPHVDFKNPVNPIDDSSS--KSNGPLKFYNAEIHSAAFCLPSFAKKVIE  325



>emb|CDX91725.1| BnaC08g06440D [Brassica napus]
Length=344

 Score =   431 bits (1109),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 204/296 (69%), Positives = 245/296 (83%), Gaps = 7/296 (2%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQD+++F+SATYGKVL LDG IQ T
Sbjct  49    FSSVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDIIVFQSATYGKVLVLDGVIQLT  108

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+ID+ EIDKMVVDV
Sbjct  109   ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSVEQIDMCEIDKMVVDV  168

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A GFEDPRV L IGDG A++  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  169   SKQFFPNVAIGFEDPRVNLVIGDGVAYLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  228

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPS---GVIG  961
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYP    GVIG
Sbjct  229   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPRHVFGVIG  288

Query  962   YMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             +MLCSTEGP VDFK+PVNPID      KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  289   FMLCSTEGPDVDFKHPVNPIDDS----KSSGPLKFYNAEIHSAAFCLPSFAKKVIE  340



>ref|XP_003532012.1| PREDICTED: spermidine synthase 2 isoform 1 [Glycine max]
Length=335

 Score =   431 bits (1108),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 206/293 (70%), Positives = 246/293 (84%), Gaps = 1/293 (0%)
 Frame = +2

Query  242   GNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAI  421
              N    + PGWFSE S MWPGEA SLK+EK+LF+GKS+YQ+VM+F+S+TYGKVL LDG I
Sbjct  37    SNGLSSVIPGWFSEISAMWPGEAHSLKVEKILFQGKSEYQNVMVFQSSTYGKVLVLDGVI  96

Query  422   QHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMV  601
             Q TE     Y EMI HLPL SIPNPKKVL++GGG G  + EV+R+ ++EKIDI EIDKMV
Sbjct  97    QLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVIREVARHSSVEKIDICEIDKMV  156

Query  602   VDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERP  781
             VDVS+Q+FP +A G++DPRVTLHIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+P
Sbjct  157   VDVSKQYFPDVAVGYDDPRVTLHIGDGVAFLKEVPEGTYDAVIVDSSDPIGPAQELFEKP  216

Query  782   FFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIG  961
             FF +V KAL  GGVVCTQAESIWLHM +I+ I+A+CRQ+FKGSVNYAWTTVPTYPSG+IG
Sbjct  217   FFASVAKALCPGGVVCTQAESIWLHMDIIEDIVANCRQIFKGSVNYAWTTVPTYPSGMIG  276

Query  962   YMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             +MLCSTEGPPVDFK+PVNPID++ +  KS  PLKFYNSEIH AAF LPSFA++
Sbjct  277   FMLCSTEGPPVDFKHPVNPIDENESQ-KSVRPLKFYNSEIHTAAFCLPSFAKR  328



>emb|CDY57319.1| BnaA08g20290D [Brassica napus]
Length=333

 Score =   431 bits (1107),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 205/296 (69%), Positives = 244/296 (82%), Gaps = 7/296 (2%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  38    FSSVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  97

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+ID+ EIDKMVVDV
Sbjct  98    ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSVEQIDMCEIDKMVVDV  157

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A GFEDPRV L IGDG A++  A  G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  158   SKQFFPNVAIGFEDPRVNLVIGDGVAYLKNAAGGSYDAVIVDSSDPIGPAKELFEKPFFQ  217

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPS---GVIG  961
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR++FKGSVNYAWT+VPTYP    GVIG
Sbjct  218   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPRHVFGVIG  277

Query  962   YMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             +MLCSTEGP VDFK+PVNPID      KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  278   FMLCSTEGPDVDFKHPVNPIDDS----KSSGPLKFYNAEIHSAAFCLPSFAKKVIE  329



>gb|KHN10600.1| Spermidine synthase 2 [Glycine soja]
Length=335

 Score =   430 bits (1105),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 205/293 (70%), Positives = 246/293 (84%), Gaps = 1/293 (0%)
 Frame = +2

Query  242   GNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAI  421
              N    + PGWFSE S MWPGEA SLK+EK+LF+GKS+YQ+VM+F+S+TYGKVL LDG I
Sbjct  37    SNGLSSVIPGWFSEISAMWPGEAHSLKVEKILFQGKSEYQNVMVFQSSTYGKVLVLDGVI  96

Query  422   QHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMV  601
             Q TE     Y EMI HLPL SIPNPKKVL++GGG G  + EV+R+ ++EKIDI EIDKMV
Sbjct  97    QLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVIREVARHSSVEKIDICEIDKMV  156

Query  602   VDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERP  781
             VDVS+Q+FP +A G++DPRVTLHIGDG A++    +G YDA+IVDSSDPIGPA+ELFE+P
Sbjct  157   VDVSKQYFPDVAVGYDDPRVTLHIGDGVAYLKEVPEGTYDAVIVDSSDPIGPAQELFEKP  216

Query  782   FFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIG  961
             FF +V KAL  GGVVCTQAESIWLHM +I+ I+A+CRQ+FKGSVNYAWTTVPTYPSG+IG
Sbjct  217   FFASVAKALCPGGVVCTQAESIWLHMDIIEDIVANCRQIFKGSVNYAWTTVPTYPSGMIG  276

Query  962   YMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             +MLCSTEGPPVDFK+PVNPID++ +  KS  PLKFYNSEIH AAF LPSFA++
Sbjct  277   FMLCSTEGPPVDFKHPVNPIDENESQ-KSVRPLKFYNSEIHTAAFCLPSFAKR  328



>dbj|BAA24536.1| spermidine synthase [Arabidopsis thaliana]
Length=293

 Score =   428 bits (1100),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 198/286 (69%), Positives = 241/286 (84%), Gaps = 0/286 (0%)
 Frame = +2

Query  272   WFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPY  451
             WFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ TE     Y
Sbjct  4     WFSEISPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAY  63

Query  452   TEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPY  631
              EMI HLPL SI NPKKVL++GGG G  L EV+R+ ++E+IDI EIDKMVVDV++Q+FP 
Sbjct  64    QEMITHLPLCSISNPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDKMVVDVAKQYFPN  123

Query  632   LAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALR  811
             +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V +ALR
Sbjct  124   VAVGYEDPRVNLIIGDGVAFLKNAAEGTYDAVIVDSSDPIGPAKELFEKPFFESVNRALR  183

Query  812   AGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPP  991
              GGVVCTQAES+WLHM +I+ I+++CR +FKGSVNYAWT+VPTYPSGVIG+MLCS+EGP 
Sbjct  184   PGGVVCTQAESLWLHMDIIEDIVSNCRDIFKGSVNYAWTSVPTYPSGVIGFMLCSSEGPQ  243

Query  992   VDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             VDFK PV+ ID D + +KS  PLK+YN+EIH AAF LPSFA+K+++
Sbjct  244   VDFKKPVSLIDTDESSIKSHCPLKYYNAEIHSAAFCLPSFAKKVID  289



>gb|KEH19965.1| spermidine synthase [Medicago truncatula]
Length=342

 Score =   429 bits (1104),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 203/293 (69%), Positives = 241/293 (82%), Gaps = 1/293 (0%)
 Frame = +2

Query  242   GNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAI  421
             GN    + PGWFSE S MWPGEA SLKIEK+LF+G SDYQ VM+F+S+TYGKVL LDG I
Sbjct  44    GNGVSSVIPGWFSEISPMWPGEAHSLKIEKILFQGNSDYQKVMVFQSSTYGKVLVLDGVI  103

Query  422   QHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMV  601
             Q TE     Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ +IEKIDI EID MV
Sbjct  104   QLTERDECAYQEMITHLPLCSISNPKKVLVIGGGDGGVLREVARHSSIEKIDICEIDNMV  163

Query  602   VDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERP  781
             V+VS+QFFP +A GF DPRVTL IGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+P
Sbjct  164   VEVSKQFFPEVAVGFNDPRVTLRIGDGVAFLKAAPEGTYDAVIVDSSDPIGPAQELFEKP  223

Query  782   FFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIG  961
             FF++V +ALR GGV+CTQAESIWLHM +I+ I+++CR++FKGSVNYAWTTVPTYPSG+IG
Sbjct  224   FFQSVARALRPGGVMCTQAESIWLHMDIIENIVSNCREIFKGSVNYAWTTVPTYPSGMIG  283

Query  962   YMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             +MLCSTEG  VDFK+PVNP+D++    KS  PLKFYNSEIH AAF LPSFA++
Sbjct  284   FMLCSTEGALVDFKHPVNPMDENECQ-KSVRPLKFYNSEIHTAAFCLPSFAKR  335



>ref|XP_010100485.1| Spermidine synthase [Morus notabilis]
 gb|EXB82619.1| Spermidine synthase [Morus notabilis]
Length=334

 Score =   429 bits (1102),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 208/311 (67%), Positives = 245/311 (79%), Gaps = 19/311 (6%)
 Frame = +2

Query  245   NDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFE---------------  379
             N    + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDVM+F+               
Sbjct  24    NSISTVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVMVFQASDDSPNDVAETFLS  83

Query  380   -SATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRY  556
              S+TYGKVL LDG IQ TE     Y EMI HLPL SI NPKKVL++GGG G  L EV+R+
Sbjct  84    ISSTYGKVLVLDGVIQLTERDECAYQEMITHLPLCSILNPKKVLVIGGGDGGVLREVARH  143

Query  557   PTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVD  736
              +IE+IDI EIDKMVVDVS++FFP +A G+ED RV LHIGDG AF+    +G YDA+IVD
Sbjct  144   TSIEQIDICEIDKMVVDVSKEFFPNVAIGYEDHRVNLHIGDGVAFLKAVPEGTYDAVIVD  203

Query  737   SSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVN  916
             SSDPIGPA+ELF++PFFE V +ALR GGVVCTQAESIWLHMH+I+ I+A+CR +FKGSVN
Sbjct  204   SSDPIGPAEELFKKPFFETVARALRPGGVVCTQAESIWLHMHIIEDIVANCRHIFKGSVN  263

Query  917   YAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAF  1096
             YAWTTVPTYPSGVIG+MLCSTEGP VDFK+PVNPID +    KSK PLKFYNSEIH AAF
Sbjct  264   YAWTTVPTYPSGVIGFMLCSTEGPHVDFKHPVNPIDAND---KSKRPLKFYNSEIHTAAF  320

Query  1097  TLPSFAQKLLE  1129
              LPSFA+++++
Sbjct  321   CLPSFAKRVID  331



>ref|XP_009631179.1| PREDICTED: spermidine synthase 1-like, partial [Nicotiana tomentosiformis]
Length=301

 Score =   427 bits (1098),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 196/279 (70%), Positives = 238/279 (85%), Gaps = 0/279 (0%)
 Frame = +2

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             ++ GEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE     Y EMI HL
Sbjct  19    LYLGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERDECAYQEMITHL  78

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMV+DV++QFFP +A G+ED
Sbjct  79    PLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVIDVAKQFFPNVAIGYED  138

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LH+GDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFFE V +ALR GGV+CT
Sbjct  139   PRVKLHVGDGVAFLKNVPEGTYDAVIVDSSDPIGPAQELFEKPFFETVARALRPGGVICT  198

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
             QAESIWLHM +I+ I+A+CRQ+FKGSVNYAWTTVPTYPSGVIG+MLCSTEGP VDFKNP 
Sbjct  199   QAESIWLHMDIIEHILANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKNPT  258

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             NPID D +H K++ PLKFYNSEIH A+F LPSFA++++E
Sbjct  259   NPIDTDDSHTKTRGPLKFYNSEIHSASFCLPSFAKRVIE  297



>emb|CDY28474.1| BnaC07g13020D [Brassica napus]
Length=322

 Score =   427 bits (1097),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 205/296 (69%), Positives = 242/296 (82%), Gaps = 5/296 (2%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  25    FSSVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  84

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E ID+ EIDKMVVDV
Sbjct  85    ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASVEHIDMCEIDKMVVDV  144

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A GFEDPRV L IGDG AF+  A  G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  145   SKQFFPNVAIGFEDPRVNLVIGDGVAFLNNAAVGSYDAVIVDSSDPIGPAKELFEKPFFQ  204

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPS---GVIG  961
             +V +ALR GGVVCTQAES+WLHM +I+ I ++CR +FKGSVNYAWT+VPTYP    GVIG
Sbjct  205   SVARALRPGGVVCTQAESLWLHMDIIEDIASNCRDIFKGSVNYAWTSVPTYPRHVYGVIG  264

Query  962   YMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             +MLCSTEGP VDFK PVNP+D  ++  KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  265   FMLCSTEGPHVDFKVPVNPLDDSSS--KSNGPLKFYNAEIHSAAFCLPSFAKKVIE  318



>ref|XP_009623577.1| PREDICTED: spermidine synthase [Nicotiana tomentosiformis]
Length=340

 Score =   427 bits (1098),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 205/308 (67%), Positives = 248/308 (81%), Gaps = 10/308 (3%)
 Frame = +2

Query  236   NAGNDFGC---------IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESAT  388
             N  ND GC         + PGWFSE S +WPGEA SLK+EK+LF+GKSDYQ+VM+F+S+T
Sbjct  29    NHNNDNGCTNESPYISSVLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSST  88

Query  389   YGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIE  568
             YGKVL LDG IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E
Sbjct  89    YGKVLVLDGVIQLTERDECAYQEMIAHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVE  148

Query  569   KIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDP  748
             +IDI EIDKMVV+VS+QFFP +A G+EDPRV LHIGDG AF+     G YDA+IVDSSDP
Sbjct  149   QIDICEIDKMVVEVSKQFFPDVAVGYEDPRVNLHIGDGVAFLKNVAAGTYDAVIVDSSDP  208

Query  749   IGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWT  928
             IGPA+ELFE+PFF+++ +ALR GGVV TQAESIWLHMH+I++I+A+CRQ+FKGSVNYAWT
Sbjct  209   IGPAQELFEKPFFDSIARALRPGGVVSTQAESIWLHMHIIEEIVANCRQIFKGSVNYAWT  268

Query  929   TVPTYPSGVIGYMLCSTEGPPVDFK-NPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLP  1105
             TVPTYPSG+IG+MLCSTEGP VDFK       D D +H K+  PLKFYNSE+HKA+F LP
Sbjct  269   TVPTYPSGMIGFMLCSTEGPAVDFKNPINPIDDDDDSHTKTLGPLKFYNSELHKASFCLP  328

Query  1106  SFAQKLLE  1129
             SFA++++E
Sbjct  329   SFAKRVIE  336



>pdb|1XJ5|A Chain A, X-Ray Structure Of Spermidine Synthase From Arabidopsis 
Thaliana Gene At1g23820
 pdb|1XJ5|B Chain B, X-Ray Structure Of Spermidine Synthase From Arabidopsis 
Thaliana Gene At1g23820
 pdb|1XJ5|C Chain C, X-Ray Structure Of Spermidine Synthase From Arabidopsis 
Thaliana Gene At1g23820
 pdb|1XJ5|D Chain D, X-Ray Structure Of Spermidine Synthase From Arabidopsis 
Thaliana Gene At1g23820
 pdb|2Q41|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820
 pdb|2Q41|D Chain D, Ensemble Refinement Of The Protein Crystal Structure 
Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820
 pdb|2Q41|B Chain B, Ensemble Refinement Of The Protein Crystal Structure 
Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820
 pdb|2Q41|C Chain C, Ensemble Refinement Of The Protein Crystal Structure 
Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820
Length=334

 Score =   426 bits (1095),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 201/293 (69%), Positives = 243/293 (83%), Gaps = 2/293 (1%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S  WPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  40    FSTVIPGWFSEXSPXWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  99

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y E I HLPL SIPNPKKVL++GGG G  L EV+R+ +IE+ID  EIDK VVDV
Sbjct  100   ERDECAYQEXITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASIEQIDXCEIDKXVVDV  159

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A G+EDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  160   SKQFFPDVAIGYEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQ  219

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLH  +I+ I+++CR++FKGSVNYAWT+VPTYPSGVIG+ L
Sbjct  220   SVARALRPGGVVCTQAESLWLHXDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFXL  279

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             CSTEGP VDFK+P+NPID+ ++  KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  280   CSTEGPDVDFKHPLNPIDESSS--KSNGPLKFYNAEIHSAAFCLPSFAKKVIE  330



>ref|XP_006655571.1| PREDICTED: spermidine synthase 1-like [Oryza brachyantha]
Length=294

 Score =   422 bits (1086),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 196/276 (71%), Positives = 238/276 (86%), Gaps = 0/276 (0%)
 Frame = +2

Query  302   GEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLG  481
             GEA SLK+E++LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE     Y EMI HLPL 
Sbjct  15    GEAHSLKVEEVLFQGKSDYQNVMVFQSSTYGKVLVLDGVIQVTERDECAYQEMITHLPLC  74

Query  482   SIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRV  661
             SI +PKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVVDVS+QFFP+LA GFEDPRV
Sbjct  75    SIKDPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVDVSKQFFPHLAVGFEDPRV  134

Query  662   TLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAE  841
             +LHIGDG AF+  A++G YDA+IVDSSDPIGPA+ELFE+PFF++V +ALR GGVVCTQAE
Sbjct  135   SLHIGDGVAFLKNAQEGTYDAVIVDSSDPIGPAQELFEKPFFQSVARALRPGGVVCTQAE  194

Query  842   SIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPI  1021
             SIWLHMH+I+ I+ +CRQVFKGSVNYAWTTVPTYPSGVIG+MLCSTEGP VDF++P++ I
Sbjct  195   SIWLHMHIIEDIVTNCRQVFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPTVDFQHPISNI  254

Query  1022  DKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             + D    KSK PLKFYNSEIH A+F LPSFA++++E
Sbjct  255   ENDEFSTKSKGPLKFYNSEIHSASFCLPSFAKRVIE  290



>dbj|BAF91875.1| spermidine synthase [Nicotiana benthamiana]
Length=279

 Score =   421 bits (1083),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 198/279 (71%), Positives = 236/279 (85%), Gaps = 1/279 (0%)
 Frame = +2

Query  281   EFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEM  460
             E S +WPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE     Y EM
Sbjct  1     EISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERDECAYQEM  60

Query  461   IVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAA  640
             I HLPL SI NPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVV+VS+QFFP +A 
Sbjct  61    IAHLPLCSILNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVEVSKQFFPDVAV  120

Query  641   GFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGG  820
             G+EDPRV LHIGDG AF+     G YDA+IVDSSDPIGPA+ELFE+PFFE++ +ALR GG
Sbjct  121   GYEDPRVNLHIGDGVAFLKNVAAGTYDAVIVDSSDPIGPAQELFEKPFFESIARALRPGG  180

Query  821   VVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDF  1000
             VV TQAESIWLHMH+I++I+ +CRQ+FKGSVNYAWTTVPTYPSG+IG+MLCSTEGP VDF
Sbjct  181   VVSTQAESIWLHMHIIEEIVVNCRQIFKGSVNYAWTTVPTYPSGMIGFMLCSTEGPAVDF  240

Query  1001  KNPVNPI-DKDTTHVKSKPPLKFYNSEIHKAAFTLPSFA  1114
             KNP+NPI D D +H K+  PLKFYNSE+HKA+F LPSFA
Sbjct  241   KNPINPIDDDDVSHNKTLGPLKFYNSELHKASFCLPSFA  279



>gb|ADK89558.1| spermidine synthase [Marsilea vestita]
 gb|AFN42817.1| spermidine synthase [Marsilea vestita]
Length=387

 Score =   425 bits (1093),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 194/298 (65%), Positives = 244/298 (82%), Gaps = 4/298 (1%)
 Frame = +2

Query  248   DFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQH  427
             +   I PGWFSE S+MWPGEA SL++EK+LF+GKSD+QDV++F+SATYGKVL LDG IQ 
Sbjct  83    NISTIVPGWFSEVSEMWPGEAHSLQVEKILFEGKSDFQDVLVFQSATYGKVLVLDGVIQL  142

Query  428   TENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVD  607
             TE     Y EMI HLPL SIPNPK+VL++GGG G  L EV+R+ ++E+IDI EIDKMV+D
Sbjct  143   TERDECAYQEMISHLPLCSIPNPKRVLVIGGGDGGVLREVARHKSVEQIDICEIDKMVID  202

Query  608   VSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFF  787
             V++QFFP +A G++DPRV L +GDG AF+    +G+YDA+IVDSSDP+GPA++LFE+PFF
Sbjct  203   VAKQFFPDVAVGYDDPRVKLFVGDGAAFLRDVPEGFYDAVIVDSSDPVGPAQQLFEKPFF  262

Query  788   EAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYM  967
             E++ +ALR GGVVCTQAESIWLHMH+I+ I A+C+Q FKGSVNYAWT+VPTYPSGVIG+M
Sbjct  263   ESLARALRPGGVVCTQAESIWLHMHIIQDIFAACKQTFKGSVNYAWTSVPTYPSGVIGFM  322

Query  968   LCSTEGPPVDFKNPVNPI----DKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             LCSTEGP V+F  PVNPI    D ++   K   PLK+YNS++HKAAF LP FA+K L+
Sbjct  323   LCSTEGPEVNFLEPVNPIEIVEDSNSEEDKKSRPLKYYNSQMHKAAFCLPQFARKALD  380



>gb|ADQ37303.1| putative spermidine synthase [Pinus sylvestris]
Length=345

 Score =   421 bits (1083),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 242/289 (84%), Gaps = 0/289 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWF+E S MWPGEA SLK+EK+LF+GKS YQ+VM+F+S TYGKVL LDG IQ TE  
Sbjct  48    VIPGWFAEISPMWPGEAHSLKVEKVLFQGKSKYQNVMVFQSLTYGKVLVLDGVIQLTERD  107

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL S+PNPKKVL++GGG G  L EVSR+ ++E+IDI EID MV+DVS+Q
Sbjct  108   ECAYQEMITHLPLCSVPNPKKVLVIGGGDGGVLREVSRHMSVEQIDICEIDGMVIDVSKQ  167

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             +FP +A GF+DPRV +++GDG AF+  + +G YD +IVDSSDPIGPA+ELF++PFFE V 
Sbjct  168   YFPEIAVGFDDPRVRVNVGDGVAFLRESPEGLYDVVIVDSSDPIGPAEELFKKPFFELVA  227

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGVVCTQAESIWLHM +I+ I+++CRQ FKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  228   RALRPGGVVCTQAESIWLHMPIIEDIVSACRQTFKGSVNYAWTTVPTYPSGVIGFMLCST  287

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             EGP VDF+ P+NPI+K  ++V+SK PLKFYNSE+H A+F LP+FA++ +
Sbjct  288   EGPAVDFQRPINPIEKQESNVESKRPLKFYNSEMHTASFCLPAFARRAI  336



>emb|CDY28473.1| BnaC07g13010D [Brassica napus]
Length=332

 Score =   421 bits (1082),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 205/296 (69%), Positives = 245/296 (83%), Gaps = 5/296 (2%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  35    FSSVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  94

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SI NPKKVL++GGG G  L EV+R+ ++E+ID+ EIDKMVVDV
Sbjct  95    ERDECAYQEMITHLPLCSILNPKKVLVIGGGGGGVLPEVARHASVEQIDMCEIDKMVVDV  154

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A  F+DPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  155   SKQFFPNVAIRFDDPRVNLVIGDGVAFLKNAVEGSYDAVIVDSSDPIGPAKELFEKPFFQ  214

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP---SGVIG  961
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR +FKGSVNYAWT+VPTYP   SGVIG
Sbjct  215   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCRDIFKGSVNYAWTSVPTYPRHVSGVIG  274

Query  962   YMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             +MLCSTEGP VDFKNPVNPID  ++  KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  275   FMLCSTEGPHVDFKNPVNPIDDSSS--KSNGPLKFYNAEIHSAAFCLPSFAKKVIE  328



>tpg|DAA60340.1| TPA: hypothetical protein ZEAMMB73_606346 [Zea mays]
Length=282

 Score =   419 bits (1076),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 198/276 (72%), Positives = 236/276 (86%), Gaps = 0/276 (0%)
 Frame = +2

Query  302   GEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLG  481
             GEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE     Y EMI HLPL 
Sbjct  3     GEAHSLKVEKVLFQGKSDYQNVMVFQSSTYGKVLVLDGVIQVTERDECAYQEMITHLPLC  62

Query  482   SIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRV  661
             SI +PKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVVDVS+QFFP+LA GFEDPRV
Sbjct  63    SIKDPKKVLVIGGGDGGVLREVSRHISVEQIDICEIDKMVVDVSKQFFPHLAVGFEDPRV  122

Query  662   TLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAE  841
             +LHIGDG AF+  A +G YDA+IVDSSDPIGPA+ELFE+PFF++V +ALR GGVVCTQAE
Sbjct  123   SLHIGDGVAFLKNAPEGTYDAVIVDSSDPIGPAQELFEKPFFQSVARALRPGGVVCTQAE  182

Query  842   SIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPI  1021
             SIWLHMH+I+ I  +CRQVFKGSVNYAWTTVPTYPSGVIG+MLCSTEGP VDF++PV  I
Sbjct  183   SIWLHMHIIEDIFVNCRQVFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFQHPVFNI  242

Query  1022  DKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             ++D    KSK PLKFYNSEIH A+F LPSFA++++E
Sbjct  243   EEDEHSTKSKGPLKFYNSEIHTASFCLPSFAKRVIE  278



>gb|AFJ11561.1| putrescine N-methyltransferase, partial [Nicotiana tabacum]
Length=244

 Score =   417 bits (1072),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 215/244 (88%), Positives = 227/244 (93%), Gaps = 1/244 (0%)
 Frame = +2

Query  368   MLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEV  547
             MLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLI+GGGIGFTL E+
Sbjct  1     MLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEM  60

Query  548   SRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAI  727
              RYPTIEKIDIVEID +VVDVSR+FFPYLAA F DPRVTL +GDG AFV  A  GYYDAI
Sbjct  61    LRYPTIEKIDIVEIDDVVVDVSRKFFPYLAANFSDPRVTLVLGDGAAFVKAAHAGYYDAI  120

Query  728   IVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKG  907
             IVDSSDPIGPAK+LFERPFFEAV KALR GGVVCTQAESIWLHMH+IKQIIA+CRQVFKG
Sbjct  121   IVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCTQAESIWLHMHIIKQIIANCRQVFKG  180

Query  908   SVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSK-PPLKFYNSEIH  1084
             SVNYAWTTVPTYP+GVIGYMLCSTEGP VDFKNPVNPIDK+TT V+SK  PLKFYNS+IH
Sbjct  181   SVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKNPVNPIDKETTQVESKLAPLKFYNSDIH  240

Query  1085  KAAF  1096
             KAAF
Sbjct  241   KAAF  244



>gb|ABK23753.1| unknown [Picea sitchensis]
 gb|ABK27063.1| unknown [Picea sitchensis]
Length=338

 Score =   420 bits (1080),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 243/289 (84%), Gaps = 0/289 (0%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             + PGWF+E S MWPGEA SLK+EK+LF+GKS YQDVM+F+S TYGKVL LDG IQ TE  
Sbjct  41    VIPGWFAEISPMWPGEAHSLKVEKVLFQGKSKYQDVMVFQSLTYGKVLVLDGVIQLTERD  100

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL S+PNP+KVL++GGG G  L EVSR+ ++E+IDI EID MV+DVS+Q
Sbjct  101   ECAYQEMITHLPLCSVPNPRKVLVIGGGDGGVLREVSRHMSVEQIDICEIDGMVIDVSKQ  160

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             +FP +A GF+DPRVT+++GDG AF+  + +G YD +IVDSSDPIGPA+ELF++PFFE V 
Sbjct  161   YFPEIAVGFDDPRVTVNVGDGVAFLRESPEGVYDVVIVDSSDPIGPAEELFKKPFFELVA  220

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +ALR GGV+CTQAESIWLHM +I+ I+++CRQ FKGSVNYAWTTVPTYPSGVIG+MLCST
Sbjct  221   RALRPGGVMCTQAESIWLHMPIIEDIVSACRQTFKGSVNYAWTTVPTYPSGVIGFMLCST  280

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             EGP VDF++P+NPI+K  ++V+ + PLKFYNSE+H A+F LP+FA++ +
Sbjct  281   EGPAVDFQHPINPIEKQESNVELQRPLKFYNSEMHTASFCLPAFARRAI  329



>dbj|BAA74543.1| putrescine N-methyltransferase [Nicotiana sylvestris]
Length=319

 Score =   416 bits (1068),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 218/285 (76%), Positives = 236/285 (83%), Gaps = 21/285 (7%)
 Frame = +2

Query  113  IAAHNNGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDF------GCIKPGW  274
            I+ H NG     HQNGT+ H NG  +               + GN+         IKPGW
Sbjct  50   ISEHQNG-----HQNGTSEHQNGHQNGTIS----------HDNGNELQLLGSSNSIKPGW  94

Query  275  FSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT  454
            FSEFS +WPGEAFSLK+EKLLF+GKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT
Sbjct  95   FSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYT  154

Query  455  EMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYL  634
            EMIVHLPLGSIPNPKKVLI+GGGIGFTL E+ RYPTIEKIDIVEID +VVDVSR+FFPYL
Sbjct  155  EMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVSRKFFPYL  214

Query  635  AAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRA  814
            AA F DPRVTL +GDG AFV  A+ GYYDAIIVDSSDPIGPAK+LFERPFFEAV KALR 
Sbjct  215  AANFSDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRP  274

Query  815  GGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPS  949
            GGVVCTQAESIWLHMH+IKQIIA+CRQVFKGSVNYAWTTVPTYP+
Sbjct  275  GGVVCTQAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPT  319



>gb|AAW30410.1| spermidine synthase X [Silene latifolia]
Length=278

 Score =   414 bits (1064),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 195/275 (71%), Positives = 232/275 (84%), Gaps = 3/275 (1%)
 Frame = +2

Query  305   EAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGS  484
             EA SLK+EK+LF+GKS YQDVM+F+S+TYGKVL LDG IQ TE     Y EMI HLPL S
Sbjct  1     EAHSLKVEKILFQGKSKYQDVMVFQSSTYGKVLILDGVIQLTERDECAYQEMISHLPLCS  60

Query  485   IPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVT  664
             IPNPKKVL++GGG G  L EV+R+ ++E IDI EID+MVV VS++FFP +A G++DPRV 
Sbjct  61    IPNPKKVLVIGGGDGGVLREVARHSSVEHIDICEIDEMVVTVSKEFFPEVAVGYDDPRVN  120

Query  665   LHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAES  844
             LHIGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V KALR GGVVCTQAES
Sbjct  121   LHIGDGVAFLKAATEGSYDAVIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAES  180

Query  845   IWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPID  1024
             IWLHMH+I+ I+++CR++FKGSVNYAWTTVPTYPSGVIG+M+CSTEGP VDFKNPVNPID
Sbjct  181   IWLHMHIIEDIVSNCREIFKGSVNYAWTTVPTYPSGVIGFMVCSTEGPAVDFKNPVNPID  240

Query  1025  KDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             K       K PLKFYN+EIH AAF LPSFA++++E
Sbjct  241   KTE---DEKRPLKFYNAEIHSAAFCLPSFAKRIIE  272



>ref|NP_001281060.1| uncharacterized protein LOC103403001 [Malus domestica]
 dbj|BAC20172.1| spermidine synthase [Malus domestica]
Length=292

 Score =   414 bits (1064),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 199/276 (72%), Positives = 230/276 (83%), Gaps = 6/276 (2%)
 Frame = +2

Query  302   GEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLG  481
             GEA SLKIEK+LF+GKSDYQ+VM+F+SATYGKVL LDG IQ TE     Y EMI HLPL 
Sbjct  19    GEAHSLKIEKILFQGKSDYQNVMVFQSATYGKVLVLDGVIQLTERDECAYQEMITHLPLC  78

Query  482   SIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRV  661
             SIPNPKKVL++GGG G  L EV+RY ++EKIDI EIDKMVVDVS+QFFP +A G++DPRV
Sbjct  79    SIPNPKKVLVIGGGDGGVLREVARYASVEKIDICEIDKMVVDVSKQFFPDVAIGYDDPRV  138

Query  662   TLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAE  841
             +LH+GDG AF+     G YDA+IVDSSDPIGPAKELFE+PFF+ V  ALR GGVVCTQAE
Sbjct  139   SLHVGDGVAFLKAVPAGTYDAVIVDSSDPIGPAKELFEKPFFQTVANALRPGGVVCTQAE  198

Query  842   SIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPI  1021
             SIWLHM +I+ I+ +CR+VFKGSVNYAWTTVPTYPSGVIG+MLCSTEGP VDFK+PVN I
Sbjct  199   SIWLHMDIIEDIVENCREVFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPVNSI  258

Query  1022  DKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             D       SK PLKFYNSEIH AAF LPSFA+K+++
Sbjct  259   D------ASKRPLKFYNSEIHTAAFCLPSFAKKVID  288



>gb|KHG11978.1| Spermidine synthase [Gossypium arboreum]
Length=330

 Score =   413 bits (1061),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 198/288 (69%), Positives = 232/288 (81%), Gaps = 17/288 (6%)
 Frame = +2

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE    
Sbjct  57    PGWFSEISPMWPGEAHSLKVEKVLFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERDEC  116

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E+IDI EIDKMVVDVS+Q+F
Sbjct  117   AYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVDVSKQYF  176

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P +A G++DPRV LHIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFFE+V KA
Sbjct  177   PDVAVGYDDPRVKLHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQELFEKPFFESVAKA  236

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGVVCTQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTT                 G
Sbjct  237   LRPGGVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTT-----------------G  279

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             P VDFK+PVNPIDKD +  KSK PLKFYNSEIH AAF LPSFA+K++E
Sbjct  280   PLVDFKHPVNPIDKDESCCKSKRPLKFYNSEIHSAAFCLPSFAKKVIE  327



>gb|AAW30409.1| spermidine synthase [Silene vulgaris]
Length=278

 Score =   409 bits (1052),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 193/275 (70%), Positives = 231/275 (84%), Gaps = 3/275 (1%)
 Frame = +2

Query  305   EAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGS  484
             EA SLK+EK+LF+GKS  QDVM+F+S+TYGKVL LDG IQ TE     Y EMI HLPL S
Sbjct  1     EAHSLKVEKILFQGKSKLQDVMVFQSSTYGKVLILDGVIQLTERDECAYQEMISHLPLCS  60

Query  485   IPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVT  664
             IPNPKKVL++GGG G  L EV+R+ ++E IDI EID+MVV VS++FFP +A G++DPRV 
Sbjct  61    IPNPKKVLVIGGGDGGVLREVARHSSVEHIDICEIDEMVVTVSKEFFPEVAVGYDDPRVN  120

Query  665   LHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAES  844
             LHIGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V KALR GGVVCTQAES
Sbjct  121   LHIGDGVAFLKAATEGSYDAVIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAES  180

Query  845   IWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPID  1024
             IWLHMH+I+ I+++CR++FKGSVNYAWTTVPTYPSGVIG+M+CSTEGP VDF+NPVNPID
Sbjct  181   IWLHMHIIEDIVSNCREIFKGSVNYAWTTVPTYPSGVIGFMVCSTEGPAVDFRNPVNPID  240

Query  1025  KDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             K       K PLKFYN+EIH AAF LPSFA++++E
Sbjct  241   KME---DEKRPLKFYNAEIHSAAFCLPSFAKRIIE  272



>gb|AAW30411.1| spermidine synthase Y [Silene latifolia]
Length=278

 Score =   406 bits (1043),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 193/275 (70%), Positives = 230/275 (84%), Gaps = 3/275 (1%)
 Frame = +2

Query  305   EAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGS  484
             EA SLK+EK+LF+GKS YQDV++F+S+TYGKVL LDG IQ TE     Y EMI HLPL S
Sbjct  1     EAHSLKVEKILFQGKSKYQDVIVFQSSTYGKVLILDGVIQLTERDECAYQEMISHLPLCS  60

Query  485   IPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVT  664
             IPNPKKVL++GGG G  L EV+R+ ++E IDI EID+MVV VS++FFP +A G++DPRV 
Sbjct  61    IPNPKKVLVIGGGDGGVLREVARHSSVEHIDICEIDEMVVTVSKEFFPEVAVGYDDPRVN  120

Query  665   LHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAES  844
             LHIGDG AF+  A +G YD +IVDSS PIGPAKELFE+PFFE+V KALR GGVVCTQAES
Sbjct  121   LHIGDGVAFLKVAPEGSYDTVIVDSSGPIGPAKELFEKPFFESVAKALRPGGVVCTQAES  180

Query  845   IWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPID  1024
             IWLHMH+I+ I++SCR++FKGSVNYAWTTVPTYPSGVIG+M+CSTEGP VDFKNPVNPID
Sbjct  181   IWLHMHIIENIVSSCREIFKGSVNYAWTTVPTYPSGVIGFMVCSTEGPAVDFKNPVNPID  240

Query  1025  KDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             K       K PLKFYN+EIH AAF LPSFA++++E
Sbjct  241   KTE---DEKRPLKFYNAEIHSAAFCLPSFAKRVIE  272



>ref|XP_008778867.1| PREDICTED: spermidine synthase 1-like, partial [Phoenix dactylifera]
Length=286

 Score =   402 bits (1032),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 190/278 (68%), Positives = 231/278 (83%), Gaps = 0/278 (0%)
 Frame = +2

Query  296   WPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLP  475
             + G+A+SLK+E++LF+GKS+YQ+VM+F+S+TYG VL LDG IQ TE       EMI HLP
Sbjct  5     FAGKAYSLKVEEILFQGKSEYQNVMVFQSSTYGNVLVLDGVIQVTERDECACQEMITHLP  64

Query  476   LGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDP  655
             L SIPNP+KVL++GGG G  L EVSRY  +E+IDI EID +VVDVS++FFP+LA GFEDP
Sbjct  65    LCSIPNPRKVLVIGGGDGGVLHEVSRYSFVEQIDICEIDDLVVDVSKKFFPHLAIGFEDP  124

Query  656   RVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQ  835
             RV LHIGDG AF+    +G YDAIIVDSSD I PA+ELFE+PFFE+V ++LR GGVVCTQ
Sbjct  125   RVNLHIGDGVAFLKSVPEGTYDAIIVDSSDLIDPAQELFEKPFFESVARSLRPGGVVCTQ  184

Query  836   AESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVN  1015
             AESIWLHMH+I+ I+   RQ+FKGSVNYAWTTVPTYPSGVIG+MLCSTEGPP+DF+NPV 
Sbjct  185   AESIWLHMHIIEDIVNVRRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPPIDFQNPVY  244

Query  1016  PIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
              ID+D    +SK PLKFYNSEIH AAF LPSFA++++E
Sbjct  245   NIDEDEKSNESKGPLKFYNSEIHSAAFCLPSFAKRVIE  282



>gb|ACB86615.1| putative spermidine synthase [Silene diclinis]
Length=266

 Score =   399 bits (1024),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 187/269 (70%), Positives = 227/269 (84%), Gaps = 3/269 (1%)
 Frame = +2

Query  320   KIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPK  499
             K+EK+LF+GKS YQDV++F+S+ YGKVL LDG IQ TE     Y EMI HLPL SIPNPK
Sbjct  1     KVEKILFQGKSKYQDVIVFQSSPYGKVLILDGVIQLTERDECAYQEMISHLPLCSIPNPK  60

Query  500   KVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGD  679
             KVL++GGG G  L EV+R+ ++E+IDI EID+MVV VS++FFP +A G++DPRV LHIGD
Sbjct  61    KVLVIGGGDGGVLQEVARHSSVEQIDICEIDEMVVTVSKEFFPEVAVGYDDPRVNLHIGD  120

Query  680   GGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHM  859
             G AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V KALR GGVVCTQAESIWLHM
Sbjct  121   GVAFLKAAPEGSYDAVIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAESIWLHM  180

Query  860   HLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTH  1039
             H+I+ I+++CR++FKGSVNYAWTTVPTYPSGVIG+M+CST+GP VDFKNPVNPIDK    
Sbjct  181   HIIEDIVSNCREIFKGSVNYAWTTVPTYPSGVIGFMVCSTDGPAVDFKNPVNPIDKTEDE  240

Query  1040  VKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
                K PLKFYN+EIH AAF LPSFA++++
Sbjct  241   ---KRPLKFYNAEIHSAAFCLPSFAKRII  266



>ref|XP_001752964.1| predicted protein [Physcomitrella patens]
 gb|EDQ82005.1| predicted protein [Physcomitrella patens]
Length=341

 Score =   401 bits (1030),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 197/300 (66%), Positives = 240/300 (80%), Gaps = 3/300 (1%)
 Frame = +2

Query  236   NAGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDG  415
              A  +   I PGWFSE S MWPGEA SLK+EK LF+GKSDYQDV++FESATYG+VL LDG
Sbjct  34    TARANLSSIMPGWFSEISPMWPGEAHSLKVEKFLFEGKSDYQDVVVFESATYGRVLVLDG  93

Query  416   AIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDK  595
              IQ T+     Y EMI HLPL SIPNPKKVL+VGGG G  L E++R+ ++E+IDI EIDK
Sbjct  94    VIQLTQRDECAYQEMITHLPLCSIPNPKKVLVVGGGDGGVLREIARHKSVEQIDICEIDK  153

Query  596   MVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFE  775
             +VVDV+++FFP +A GFEDPRV LHIGDG AF+    +G YDAIIVDSSDP+GPA+ LFE
Sbjct  154   LVVDVAKEFFPDVAVGFEDPRVNLHIGDGVAFLKAVPEGTYDAIIVDSSDPVGPAQALFE  213

Query  776   RPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGV  955
             RPF++ + +ALR GGV+CTQAES+WLHM +IK I+ +CR  FKGS+NYAWT+VPTYPSGV
Sbjct  214   RPFYKTLDRALRPGGVICTQAESLWLHMPIIKDIVGACRHTFKGSINYAWTSVPTYPSGV  273

Query  956   IGYMLCSTEGPPVDFKNPVNPIDK--DTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             IG+MLCST GP V+F+ P NPID+  D  H  SK PLKFYNS +H+AAF+LP FA++ LE
Sbjct  274   IGFMLCSTAGPAVNFRKPCNPIDQAVDPNHY-SKRPLKFYNSAMHEAAFSLPQFAREELE  332



>gb|ACB86613.1| putative spermidine synthase [Silene conica]
 gb|ACB86616.1| putative spermidine synthase [Silene dioica]
Length=260

 Score =   396 bits (1017),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 188/263 (71%), Positives = 221/263 (84%), Gaps = 3/263 (1%)
 Frame = +2

Query  320   KIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPK  499
             K+EK+LF+GKS YQDVM+F+S+TYGKVL LDG IQ TE     Y EMI HLPL SIPNPK
Sbjct  1     KVEKILFQGKSKYQDVMVFQSSTYGKVLILDGVIQLTERDECAYQEMISHLPLCSIPNPK  60

Query  500   KVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGD  679
             KVL++GGG G  L EV+R+ ++E IDI EID+MVV VS++FFP +A G++DPRV LHIGD
Sbjct  61    KVLVIGGGDGGVLREVARHSSVEHIDICEIDEMVVTVSKEFFPEVAVGYDDPRVNLHIGD  120

Query  680   GGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHM  859
             G AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V KALR GGVVCTQAESIWLHM
Sbjct  121   GVAFLKAAPEGSYDAVIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAESIWLHM  180

Query  860   HLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTH  1039
             H+I+ I+++CR++FKGSVNYAWTTVPTYPSGVIG+M+CSTEGP VDFKNPVNPIDK    
Sbjct  181   HIIEDIVSNCREIFKGSVNYAWTTVPTYPSGVIGFMVCSTEGPAVDFKNPVNPIDKTE--  238

Query  1040  VKSKPPLKFYNSEIHKAAFTLPS  1108
                K PLKFYN+EIH AAF LPS
Sbjct  239   -DEKRPLKFYNAEIHSAAFCLPS  260



>gb|ACB86612.1| putative spermidine synthase [Silene noctiflora]
Length=260

 Score =   393 bits (1010),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 187/263 (71%), Positives = 220/263 (84%), Gaps = 3/263 (1%)
 Frame = +2

Query  320   KIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPK  499
             K+EK+LF+GKS YQDVM+F+S+TYGKVL LDG IQ TE     Y EMI HLPL SIPNPK
Sbjct  1     KVEKILFQGKSKYQDVMVFQSSTYGKVLILDGVIQLTERDECAYQEMISHLPLCSIPNPK  60

Query  500   KVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGD  679
             KVL++GGG G  L EV+R+ ++E IDI EI +MVV VS++FFP +A G++DPRV LHIGD
Sbjct  61    KVLVIGGGDGGVLREVARHSSVEHIDICEIXEMVVTVSKEFFPEVAVGYDDPRVNLHIGD  120

Query  680   GGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHM  859
             G AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V KALR GGVVCTQAESIWLHM
Sbjct  121   GVAFLKAAPEGSYDAVIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAESIWLHM  180

Query  860   HLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTH  1039
             H+I+ I+++CR++FKGSVNYAWTTVPTYPSGVIG+M+CSTEGP VDFKNPVNPIDK    
Sbjct  181   HIIEDIVSNCREIFKGSVNYAWTTVPTYPSGVIGFMVCSTEGPAVDFKNPVNPIDKTE--  238

Query  1040  VKSKPPLKFYNSEIHKAAFTLPS  1108
                K PLKFYN+EIH AAF LPS
Sbjct  239   -DEKRPLKFYNAEIHSAAFCLPS  260



>gb|ACB86614.1| putative spermidine synthase [Silene diclinis]
Length=260

 Score =   392 bits (1006),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/263 (71%), Positives = 220/263 (84%), Gaps = 3/263 (1%)
 Frame = +2

Query  320   KIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPK  499
             K+EK+LF+GKS YQDVM+F+S+TYGKVL LDG IQ TE     Y EMI HLPL SIPNPK
Sbjct  1     KVEKILFQGKSKYQDVMVFQSSTYGKVLILDGVIQLTERDECAYQEMISHLPLCSIPNPK  60

Query  500   KVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGD  679
             KVL++GGG G  L EV+R+ ++E IDI EID+MVV VS++FFP +A G++DPRV LHIGD
Sbjct  61    KVLVIGGGDGGVLREVARHSSVEHIDICEIDEMVVTVSKEFFPEVAVGYDDPRVNLHIGD  120

Query  680   GGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHM  859
             G AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V KALR GGVVCTQAESIWLHM
Sbjct  121   GVAFLKAAPEGSYDAVIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAESIWLHM  180

Query  860   HLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTH  1039
             H+I+ I+++CR++ KGSVNYAWTTVPTYPSGVIG+M+CST+GP VDFKNPVNPIDK    
Sbjct  181   HIIEDIVSNCREISKGSVNYAWTTVPTYPSGVIGFMVCSTDGPAVDFKNPVNPIDKTEDE  240

Query  1040  VKSKPPLKFYNSEIHKAAFTLPS  1108
                K PLKFYN+EIH AAF LPS
Sbjct  241   ---KRPLKFYNAEIHSAAFCLPS  260



>gb|ACB86617.1| putative spermidine synthase [Silene dioica]
Length=260

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 186/263 (71%), Positives = 220/263 (84%), Gaps = 3/263 (1%)
 Frame = +2

Query  320   KIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPK  499
             K+EK+LF+GKS YQDV++F+S+TYGKVL LDG IQ TE     Y EMI HLPL SIPNPK
Sbjct  1     KVEKILFQGKSKYQDVIVFQSSTYGKVLILDGVIQLTERDECAYQEMISHLPLCSIPNPK  60

Query  500   KVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGD  679
             KVL++GGG G  L EV+R+ ++E IDI EID+MVV VS++FFP +A G++DPRV LHIGD
Sbjct  61    KVLVIGGGDGGVLREVARHSSVEHIDICEIDEMVVTVSKEFFPEVAVGYDDPRVNLHIGD  120

Query  680   GGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHM  859
             G AF+  A +G YD +IVDSSDPIGPAKELFE+PFFE+V KALR GGVVCTQAESIWLHM
Sbjct  121   GVAFLKVAPEGSYDTVIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAESIWLHM  180

Query  860   HLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTH  1039
             H+I+ I+++CR++FKGSVNYAWTTVPTYPSGVIG+M+CSTEGP VDFKNPVNPIDK    
Sbjct  181   HIIEDIVSNCREIFKGSVNYAWTTVPTYPSGVIGFMVCSTEGPAVDFKNPVNPIDKTE--  238

Query  1040  VKSKPPLKFYNSEIHKAAFTLPS  1108
                K PLKFYN+EIH AAF LPS
Sbjct  239   -DEKRPLKFYNAEIHSAAFCLPS  260



>ref|XP_001757204.1| predicted protein [Physcomitrella patens]
 gb|EDQ78063.1| predicted protein [Physcomitrella patens]
Length=350

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 191/299 (64%), Positives = 236/299 (79%), Gaps = 1/299 (0%)
 Frame = +2

Query  236   NAGNDFGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDG  415
              A  +   I PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++FESATYG+VL LDG
Sbjct  43    TARANLSSIVPGWFSEISAMWPGEAHSLKVEKVLFEGKSDYQDVVVFESATYGRVLVLDG  102

Query  416   AIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDK  595
              IQ T+     Y EMI HLPL SIPNPKKVL+VGGG G  L E++R+ ++++IDI EIDK
Sbjct  103   VIQLTQRDECAYQEMITHLPLCSIPNPKKVLVVGGGDGGVLREIARHKSVDQIDICEIDK  162

Query  596   MVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFE  775
             MVVDV+++FFP +A GFEDPRV LHIGDG AF+    +G YDAIIVDSSDP+GPA+ LFE
Sbjct  163   MVVDVAKEFFPDVAVGFEDPRVNLHIGDGVAFLREVPEGTYDAIIVDSSDPVGPAQALFE  222

Query  776   RPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGV  955
             RPF+  + +ALR GGV+CTQAES+W+HM +IK I+++CR  FKGS+NYAWT+VPTYPSG+
Sbjct  223   RPFYRTLDQALRPGGVICTQAESLWVHMPIIKNIVSACRHTFKGSINYAWTSVPTYPSGL  282

Query  956   IGYMLCSTEGPPVDFKNPVNPIDKDTTHVK-SKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
             IG+MLCS  GP V+F  P NPID+     K S+ P+KFYNS +H AAF+LP FA+  LE
Sbjct  283   IGFMLCSKAGPAVNFLEPCNPIDQAIDPEKSSRRPMKFYNSAMHAAAFSLPQFAKVELE  341



>gb|ABZ01527.1| spermidine synthase X [Silene latifolia]
Length=255

 Score =   387 bits (994),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 184/258 (71%), Positives = 217/258 (84%), Gaps = 3/258 (1%)
 Frame = +2

Query  305   EAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGS  484
             EA SLK+EK+LF+GKS YQDVM+F+S+TYGKVL LDG IQ TE     Y EMI HLPL S
Sbjct  1     EAHSLKVEKILFRGKSKYQDVMVFQSSTYGKVLILDGVIQLTERDECAYQEMISHLPLCS  60

Query  485   IPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVT  664
             IPNPKKVL++GGG G  L EV+R+ ++E IDI EID+MVV VS++FFP +A G++DPRV 
Sbjct  61    IPNPKKVLVIGGGDGGVLREVARHSSVEHIDICEIDEMVVTVSKEFFPEVAVGYDDPRVN  120

Query  665   LHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAES  844
             LHIGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V KALR GGVVCTQAES
Sbjct  121   LHIGDGVAFLKAATEGSYDAVIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAES  180

Query  845   IWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPID  1024
             IWLHMH+I+ I+++CR++FKGSVNYAWTTVPTYPSGVIG+M+CSTEGP VDFKNPVNPID
Sbjct  181   IWLHMHIIEDIVSNCREIFKGSVNYAWTTVPTYPSGVIGFMVCSTEGPAVDFKNPVNPID  240

Query  1025  KDTTHVKSKPPLKFYNSE  1078
             K       K PLKFYN+E
Sbjct  241   KTE---DEKRPLKFYNAE  255



>gb|ABZ01524.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01525.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01526.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01529.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01530.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01531.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01532.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01533.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01534.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01535.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01536.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01537.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01538.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01539.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01540.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01541.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01542.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01543.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01544.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01545.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01546.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01547.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01550.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01551.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01552.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01553.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01554.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01555.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01556.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01557.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01558.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01559.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01560.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01561.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01562.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01563.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01564.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01565.1| spermidine synthase X [Silene latifolia]
Length=255

 Score =   387 bits (993),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/258 (71%), Positives = 217/258 (84%), Gaps = 3/258 (1%)
 Frame = +2

Query  305   EAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGS  484
             EA SLK+EK+LF+GKS YQDVM+F+S+TYGKVL LDG IQ TE     Y EMI HLPL S
Sbjct  1     EAHSLKVEKILFQGKSKYQDVMVFQSSTYGKVLILDGVIQLTERDECAYQEMISHLPLCS  60

Query  485   IPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVT  664
             IPNPKKVL++GGG G  L EV+R+ ++E IDI EID+MVV VS++FFP +A G++DPRV 
Sbjct  61    IPNPKKVLVIGGGDGGVLREVARHSSVEHIDICEIDEMVVTVSKEFFPEVAVGYDDPRVN  120

Query  665   LHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAES  844
             LHIGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V KALR GGVVCTQAES
Sbjct  121   LHIGDGVAFLKAATEGSYDAVIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAES  180

Query  845   IWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPID  1024
             IWLHMH+I+ I+++CR++FKGSVNYAWTTVPTYPSGVIG+M+CSTEGP VDFKNPVNPID
Sbjct  181   IWLHMHIIEDIVSNCREIFKGSVNYAWTTVPTYPSGVIGFMVCSTEGPAVDFKNPVNPID  240

Query  1025  KDTTHVKSKPPLKFYNSE  1078
             K       K PLKFYN+E
Sbjct  241   KTE---DEKRPLKFYNAE  255



>gb|ABZ01528.1| spermidine synthase X [Silene latifolia]
Length=255

 Score =   386 bits (992),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/258 (71%), Positives = 217/258 (84%), Gaps = 3/258 (1%)
 Frame = +2

Query  305   EAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGS  484
             EA SLK+EK+LF+GKS YQDVM+F+S+TYGKVL LDG IQ TE     Y EMI HLPL S
Sbjct  1     EAHSLKVEKILFRGKSKYQDVMVFQSSTYGKVLILDGVIQLTERDECAYQEMISHLPLCS  60

Query  485   IPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVT  664
             IPNPKKVL++GGG G  L EV+R+ ++E IDI EID+MVV VS++FFP +A G++DPRV 
Sbjct  61    IPNPKKVLVIGGGDGGVLREVARHSSVEHIDICEIDEMVVTVSKEFFPEVAVGYDDPRVN  120

Query  665   LHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAES  844
             LHIGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V KALR GGVVCTQAES
Sbjct  121   LHIGDGVAFLKAATEGSYDAVIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAES  180

Query  845   IWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPID  1024
             IWLHMH+I+ I+++CR++FKGSVNYAWTTVPTYPSGVIG+M+CSTEGP VDFKNPVNPID
Sbjct  181   IWLHMHIIEDIVSNCREIFKGSVNYAWTTVPTYPSGVIGFMVCSTEGPAVDFKNPVNPID  240

Query  1025  KDTTHVKSKPPLKFYNSE  1078
             K       K PLKFYN+E
Sbjct  241   KME---DEKRPLKFYNAE  255



>gb|ABZ01548.1| spermidine synthase X [Silene latifolia]
 gb|ABZ01549.1| spermidine synthase X [Silene latifolia]
Length=255

 Score =   386 bits (991),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/258 (71%), Positives = 217/258 (84%), Gaps = 3/258 (1%)
 Frame = +2

Query  305   EAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGS  484
             EA SLK+EK+LF+GKS YQDVM+F+S+TYGKVL LDG IQ TE     Y EMI HLPL S
Sbjct  1     EAHSLKVEKILFQGKSKYQDVMVFQSSTYGKVLILDGVIQLTERDECAYQEMISHLPLCS  60

Query  485   IPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVT  664
             IPNPKKVL++GGG G  L EV+R+ ++E IDI EID+MVV VS++FFP +A G++DPRV 
Sbjct  61    IPNPKKVLVIGGGDGGVLREVARHSSVEHIDICEIDEMVVTVSKEFFPEVAVGYDDPRVN  120

Query  665   LHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAES  844
             LHIGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V KALR GGVVCTQAES
Sbjct  121   LHIGDGVAFLKAATEGSYDAVIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAES  180

Query  845   IWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPID  1024
             IWLHMH+I+ I+++CR++FKGSVNYAWTTVPTYPSGVIG+M+CSTEGP VDFKNPVNPID
Sbjct  181   IWLHMHIIEDIVSNCREIFKGSVNYAWTTVPTYPSGVIGFMVCSTEGPAVDFKNPVNPID  240

Query  1025  KDTTHVKSKPPLKFYNSE  1078
             K       K PLKFYN+E
Sbjct  241   KME---DEKRPLKFYNAE  255



>ref|XP_008776841.1| PREDICTED: spermine synthase-like isoform X1 [Phoenix dactylifera]
Length=391

 Score =   389 bits (999),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/287 (61%), Positives = 230/287 (80%), Gaps = 1/287 (0%)
 Frame = +2

Query  269   GWFSEFSQ-MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             G FS ++  MWPGEA SLK+E++L++GKS+YQ++++FES+ YGKVL LDG +Q T+    
Sbjct  68    GNFSYYNNPMWPGEAHSLKVEQVLYQGKSEYQEILVFESSVYGKVLVLDGIVQLTDKDEC  127

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SIP+PK VL++GGG G  L E+SR+ ++E+IDI EID++V+DV ++FF
Sbjct  128   AYQEMIAHLPLCSIPSPKTVLVIGGGDGGVLREISRHSSVERIDICEIDQLVIDVCKKFF  187

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P L+ GFEDPRV LHIGD   F+    +G YDA+IVDSSDPIGPA+EL E+PFFE + +A
Sbjct  188   PDLSVGFEDPRVQLHIGDAVEFLRNVPEGMYDAVIVDSSDPIGPAQELVEKPFFETIARA  247

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGV+C QAES+WLH HLI+ +++ CR  FKGSV+YAWT+VPTYPSGVIG++LCST+G
Sbjct  248   LRPGGVLCNQAESMWLHTHLIQDMLSICRATFKGSVHYAWTSVPTYPSGVIGFLLCSTDG  307

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             PPV+F NP+NPI+K     K K  ++FYNSEIHKAAF LPSFA++ L
Sbjct  308   PPVNFLNPINPIEKQEEAFKGKRKIRFYNSEIHKAAFVLPSFAKREL  354



>ref|XP_006850528.1| hypothetical protein AMTR_s00159p00023000 [Amborella trichopoda]
 gb|ERN12109.1| hypothetical protein AMTR_s00159p00023000 [Amborella trichopoda]
Length=349

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 192/310 (62%), Positives = 237/310 (76%), Gaps = 13/310 (4%)
 Frame = +2

Query  233   ENAGNDFGCIKPGWFSE---FS---------QMWPGEAFSLKIEKLLFKGKSDYQDVMLF  376
             E+       +  GWFSE   FS          MWPGEA SLK+EK+LFKGKSDYQ++++F
Sbjct  29    ESESKCINTVVTGWFSEPQSFSGESCKYFNNPMWPGEAHSLKVEKILFKGKSDYQEILVF  88

Query  377   ESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRY  556
             ES +YGKVL LDG +Q TE     Y EMI HLPL S+P+PK VL+VGGG G  L E+SR+
Sbjct  89    ESTSYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSLPSPKNVLVVGGGDGGVLREISRH  148

Query  557   PTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVD  736
              ++E+IDI EIDKMV+DV  ++FPYL+ GFEDPRV+LH+GD   F+  A +G YDAIIVD
Sbjct  149   SSVERIDICEIDKMVIDVCEKYFPYLSLGFEDPRVSLHVGDAAKFLREASEGMYDAIIVD  208

Query  737   SSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVN  916
             SSDPIGPA+EL ERPFFE + +ALR GGV+CT AES+WLH HLI+ +++ CR  FKGSV+
Sbjct  209   SSDPIGPAQELVERPFFETIARALRPGGVLCTMAESMWLHTHLIQDMLSICRATFKGSVH  268

Query  917   YAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAF  1096
             YAWT+VPTYPSG IG+M+CST+GPPVDF NPVNPI+K     KS+  LKFYN+E+HKAAF
Sbjct  269   YAWTSVPTYPSGSIGFMICSTDGPPVDFLNPVNPIEKQDAR-KSQRELKFYNTEMHKAAF  327

Query  1097  TLPSFAQKLL  1126
              LPSFA+K L
Sbjct  328   ALPSFAKKEL  337



>emb|CDY25802.1| BnaA07g09800D [Brassica napus]
Length=301

 Score =   384 bits (987),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 223/295 (76%), Gaps = 24/295 (8%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  25    FSSVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  84

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+P++E ID+ EIDKMVVDV
Sbjct  85    ERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHPSVEHIDMCEIDKMVVDV  144

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A GFEDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  145   SKQFFPNVAIGFEDPRVNLVIGDGVAFLKNAAQGSYDAVIVDSSDPIGPAKELFEKPFFQ  204

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPS--GVIGY  964
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR +FKGSVNYAWT+VPTYP   G   Y
Sbjct  205   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCRDIFKGSVNYAWTSVPTYPRHWGYWIY  264

Query  965   MLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
              L S                      KS  PLKFYNSEIH AAF LPSFA K++E
Sbjct  265   ALSS----------------------KSNGPLKFYNSEIHSAAFCLPSFATKVIE  297



>gb|ABZ01566.1| spermidine synthase X [Silene vulgaris]
Length=255

 Score =   382 bits (982),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 182/258 (71%), Positives = 216/258 (84%), Gaps = 3/258 (1%)
 Frame = +2

Query  305   EAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGS  484
             EA SLK+EK+LF+GKS  QDVM+F+S+TYGKVL LDG IQ TE     Y EMI HLPL S
Sbjct  1     EAHSLKVEKILFQGKSKLQDVMVFQSSTYGKVLILDGVIQLTERDECAYQEMISHLPLCS  60

Query  485   IPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVT  664
             IPNPKKVL++GGG G  L EV+R+ ++E IDI EID+MVV VS++FFP +A G++DPRV 
Sbjct  61    IPNPKKVLVIGGGDGGVLREVARHSSVEHIDICEIDEMVVTVSKEFFPEVAVGYDDPRVN  120

Query  665   LHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAES  844
             LHIGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFFE+V KALR GGVVCTQAES
Sbjct  121   LHIGDGVAFLKAATEGSYDAVIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAES  180

Query  845   IWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPID  1024
             IWLHMH+I+ I+++CR++FKGSVNYAWTTVPTYPSGVIG+M+CSTEGP VDF+NPVNPID
Sbjct  181   IWLHMHIIEDIVSNCREIFKGSVNYAWTTVPTYPSGVIGFMVCSTEGPAVDFRNPVNPID  240

Query  1025  KDTTHVKSKPPLKFYNSE  1078
             K       K PLKFYN+E
Sbjct  241   KME---DEKRPLKFYNAE  255



>ref|XP_010913625.1| PREDICTED: spermine synthase-like isoform X1 [Elaeis guineensis]
 ref|XP_010913634.1| PREDICTED: spermine synthase-like isoform X1 [Elaeis guineensis]
Length=389

 Score =   387 bits (994),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 174/278 (63%), Positives = 225/278 (81%), Gaps = 0/278 (0%)
 Frame = +2

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGEA SLK+E++L++GKS YQ++++FES+ YGK+L LDG +Q T+     Y EMI HL
Sbjct  77    MWPGEAHSLKVEQILYQGKSVYQEILVFESSVYGKILVLDGIVQLTDKDECAYQEMIAHL  136

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SIP+PK VL++GGG G  L E+SR+ ++E+IDI EID++V+DV ++FFP L+ GFED
Sbjct  137   PLCSIPSPKTVLVIGGGDGGVLREISRHSSVERIDICEIDQLVIDVCKKFFPDLSVGFED  196

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LHIGD   F+  A +G YDA+IVDSSDPIGPA+EL E+PFFE + +ALR GGV+C 
Sbjct  197   PRVQLHIGDAVEFLRNAPEGMYDAVIVDSSDPIGPAQELVEKPFFETIARALRPGGVLCN  256

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
             QAES+WLH HLI+ +++ CR  FKGSV+YAWT+VPTYPSGVIG++LCST+GPPV+F NPV
Sbjct  257   QAESMWLHTHLIQDMLSICRATFKGSVHYAWTSVPTYPSGVIGFLLCSTDGPPVNFLNPV  316

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             NPI+K     K K  ++FYNSEIHKAAF LPSFA++ L
Sbjct  317   NPIEKQEEAFKGKRKIRFYNSEIHKAAFVLPSFAKREL  354



>ref|XP_002453195.1| hypothetical protein SORBIDRAFT_04g001510 [Sorghum bicolor]
 gb|EES06171.1| hypothetical protein SORBIDRAFT_04g001510 [Sorghum bicolor]
Length=362

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/313 (57%), Positives = 234/313 (75%), Gaps = 14/313 (4%)
 Frame = +2

Query  233   ENAGNDFGCIKPGWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVM  370
             E+       +  GWF+E               + MWPGEA SLK+EK+L++GKS YQ+V+
Sbjct  44    ESEAKCHATVVSGWFTEPRSHCGKASKVQYYNNPMWPGEAHSLKVEKILYQGKSPYQEVL  103

Query  371   LFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVS  550
             +FES+TYGKVL LDG +Q T+     Y EMI HLPL SIP+PKKVL++GGG G  L E+S
Sbjct  104   VFESSTYGKVLVLDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREIS  163

Query  551   RYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAII  730
             R+ ++E IDI EID++V+D+ + FFP+L+ GFEDPRV LH+GD   F+  A +G YDAII
Sbjct  164   RHSSVESIDICEIDQLVIDICKDFFPHLSVGFEDPRVQLHVGDAVEFLRNAPEGTYDAII  223

Query  731   VDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGS  910
             VDSSDPIGPA+EL E+PFFE + +ALR GGV+C QAES+WLH HLI+ +++ CR+ FKGS
Sbjct  224   VDSSDPIGPAQELVEKPFFETIARALRPGGVLCNQAESMWLHTHLIQDMLSICRETFKGS  283

Query  911   VNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKA  1090
             V YAWT+VPTYPSGVIG++LC+ EGPPV+F  P+NPI+K     K+   ++FYNSE+H+A
Sbjct  284   VRYAWTSVPTYPSGVIGFLLCAKEGPPVNFLTPINPIEKVEGATKAGREIRFYNSEMHRA  343

Query  1091  AFTLPSFAQKLLE  1129
             AF LP+FA++ LE
Sbjct  344   AFVLPTFAKRELE  356



>ref|XP_009378778.1| PREDICTED: spermine synthase-like [Pyrus x bretschneideri]
 ref|XP_009378779.1| PREDICTED: spermine synthase-like [Pyrus x bretschneideri]
 ref|XP_009378780.1| PREDICTED: spermine synthase-like [Pyrus x bretschneideri]
 ref|XP_009378781.1| PREDICTED: spermine synthase-like [Pyrus x bretschneideri]
Length=369

 Score =   384 bits (985),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 179/298 (60%), Positives = 223/298 (75%), Gaps = 14/298 (5%)
 Frame = +2

Query  269   GWFSEFSQ--------------MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWFSE                 MWPGEA SLK+E +L++GKS++Q++++FES+ YGKVL 
Sbjct  54    GWFSESQSRSEKACKKLYFNNPMWPGEAHSLKVENILYRGKSEFQEILVFESSIYGKVLV  113

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q +E     Y EMI HLPL SI +PK VL+VGGG G  L EVSR+P++E IDI E
Sbjct  114   LDGLVQLSEKDECAYQEMIAHLPLCSITSPKTVLVVGGGDGAVLREVSRHPSVEHIDICE  173

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             IDKMV+DVS++FFP LA GF+DPRV LHI D   F+  A +G YDA+IVDSSDP+GPA+E
Sbjct  174   IDKMVIDVSKKFFPQLAVGFQDPRVHLHIADATEFLRLAPEGKYDAVIVDSSDPVGPAQE  233

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFFE + +ALR GGV+C  AES+WLH HLI+ +I+ C Q FKGSV YAW +VPTYP
Sbjct  234   LVEKPFFETIARALRPGGVLCNMAESMWLHTHLIQDMISVCHQTFKGSVEYAWASVPTYP  293

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             SGVIG++LCST GPPVDFKNPVN I+K    +K K  LKFYNSE+H AAF LP+F ++
Sbjct  294   SGVIGFLLCSTAGPPVDFKNPVNSIEKLEGALKHKRELKFYNSEMHSAAFALPAFLRR  351



>ref|XP_002453626.1| hypothetical protein SORBIDRAFT_04g009230 [Sorghum bicolor]
 gb|EES06602.1| hypothetical protein SORBIDRAFT_04g009230 [Sorghum bicolor]
Length=386

 Score =   384 bits (985),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 176/313 (56%), Positives = 232/313 (74%), Gaps = 14/313 (4%)
 Frame = +2

Query  233   ENAGNDFGCIKPGWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVM  370
             E+       +  GWF+E               + MWPGEA SLK+EK+L++GKS YQ+V+
Sbjct  41    ESEAKCHATVVSGWFTEPRSRCGKASKVQYYNNPMWPGEAHSLKVEKILYQGKSPYQEVL  100

Query  371   LFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVS  550
             +FES+TYGKVL LDG +Q T+     Y EMI HLPL SIP+PKKVL++GGG G  L E+S
Sbjct  101   VFESSTYGKVLVLDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREIS  160

Query  551   RYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAII  730
             R+ ++E IDI EID++V+DV +  FP+L+ GFEDPRV LH+GD   F+  A +G YDAII
Sbjct  161   RHSSVESIDICEIDQLVIDVCKDLFPHLSVGFEDPRVQLHVGDAVEFLRNAPEGTYDAII  220

Query  731   VDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGS  910
             VDSSDPIGPA+EL E+PFFE + +ALR GGV+C QAES+WLH HLI+ +++ CR+ FKGS
Sbjct  221   VDSSDPIGPAQELVEKPFFETIARALRPGGVLCNQAESMWLHTHLIQDMLSICRETFKGS  280

Query  911   VNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKA  1090
             V YAWT+VPTYPSGVIG++LC+ EGP V+F  P+NPI+K     K+   ++FYNSE+H+A
Sbjct  281   VRYAWTSVPTYPSGVIGFLLCAKEGPSVNFLTPINPIEKVEGATKAGREIRFYNSEMHRA  340

Query  1091  AFTLPSFAQKLLE  1129
             AF LP+FA++ LE
Sbjct  341   AFVLPAFAKRELE  353



>ref|XP_008234722.1| PREDICTED: spermine synthase isoform X1 [Prunus mume]
 ref|XP_008234723.1| PREDICTED: spermine synthase isoform X1 [Prunus mume]
 ref|XP_008234724.1| PREDICTED: spermine synthase isoform X1 [Prunus mume]
Length=366

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 194/336 (58%), Positives = 240/336 (71%), Gaps = 14/336 (4%)
 Frame = +2

Query  155   NGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSEFSQ--------------  292
             +G AS+ NG+             +A E        +  GWFSE                 
Sbjct  16    DGKASNGNGSEKAIPSCCLKARASAPEADAKCHSTVVSGWFSESQSRSEKDSKKVYFNNP  75

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGE  SLK+EK+L+KGKS++Q++++FES+TYGKVL LDG IQ +E     Y EMI HL
Sbjct  76    MWPGEVHSLKVEKILYKGKSEFQEILVFESSTYGKVLVLDGIIQLSEKDECAYQEMIAHL  135

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SIP+PK VL+VGGG G  L EVSR+P++E IDI EIDKMVVDVS++FFP LA GF+D
Sbjct  136   PLCSIPSPKTVLVVGGGDGGVLREVSRHPSVEHIDICEIDKMVVDVSKKFFPQLAVGFQD  195

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LHIGD   F+  A KG YDA+IVDSSDP+GPA+EL E+PFFE + +ALR GGV+C 
Sbjct  196   PRVHLHIGDATEFLRHAPKGKYDAVIVDSSDPVGPAQELVEKPFFETIARALRPGGVLCN  255

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
              AES+WLH HLI+ +I+ CR+ FKGSVNYAW +VPTYPSGVIG++LCSTEGPPVDFKNPV
Sbjct  256   MAESMWLHTHLIQDMISVCRETFKGSVNYAWASVPTYPSGVIGFLLCSTEGPPVDFKNPV  315

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             N I+K    +K K  L+FYNSE+H AAF LP F ++
Sbjct  316   NSIEKLEGALKHKRELRFYNSEMHSAAFALPPFLRR  351



>ref|XP_008677069.1| PREDICTED: uncharacterized protein LOC100279222 isoform X1 [Zea 
mays]
 ref|XP_008677070.1| PREDICTED: uncharacterized protein LOC100279222 isoform X1 [Zea 
mays]
 ref|XP_008677071.1| PREDICTED: uncharacterized protein LOC100279222 isoform X1 [Zea 
mays]
 gb|AFW65894.1| spermidine synthase 1 isoform 1 [Zea mays]
 gb|AFW65895.1| spermidine synthase 1 isoform 2 [Zea mays]
Length=387

 Score =   382 bits (980),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 176/313 (56%), Positives = 233/313 (74%), Gaps = 14/313 (4%)
 Frame = +2

Query  233   ENAGNDFGCIKPGWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVM  370
             E+       +  GWF+E               + MWPGEA SLK+EK+L++GKS YQ+V+
Sbjct  42    ESEARCHATVVSGWFTEPRSRCGKASKVQYYNNPMWPGEANSLKVEKILYQGKSLYQEVL  101

Query  371   LFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVS  550
             +FES+TYGKVL LDG +Q T+     Y EMI HLPL SIP+PKKVL++GGG G  L EVS
Sbjct  102   VFESSTYGKVLVLDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREVS  161

Query  551   RYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAII  730
             R+ ++E IDI EID++V+DV + FFP+L+ GF+DPRV LH+GD   F+  A +G YDAII
Sbjct  162   RHSSVESIDICEIDQLVIDVCKDFFPHLSVGFQDPRVQLHVGDAVEFLRNAPEGTYDAII  221

Query  731   VDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGS  910
             VDSSDPIGPA+EL E+PFF+ + +ALR GGV+C QAES+WLH HLI+ +++ CR+ FKGS
Sbjct  222   VDSSDPIGPAQELVEKPFFDTIARALRPGGVLCNQAESMWLHTHLIQDMLSICRETFKGS  281

Query  911   VNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKA  1090
             V YAWT+VPTYPSGVIG++LC+ EGP V+F  P+NPI+K     K+   ++FYNSE+H+A
Sbjct  282   VRYAWTSVPTYPSGVIGFLLCAKEGPLVNFLTPINPIEKLEGATKAGREIRFYNSEMHRA  341

Query  1091  AFTLPSFAQKLLE  1129
             AF LP+FA++ LE
Sbjct  342   AFVLPTFARRELE  354



>ref|NP_001149310.1| spermidine synthase 1 [Zea mays]
 gb|ACG34974.1| spermidine synthase 1 [Zea mays]
 gb|ACR35746.1| unknown [Zea mays]
 gb|AFW69851.1| Spermidine synthase 1 isoform 1 [Zea mays]
 gb|AFW69852.1| Spermidine synthase 1 isoform 2 [Zea mays]
Length=387

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 229/301 (76%), Gaps = 14/301 (5%)
 Frame = +2

Query  269   GWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWF+E               + MWPGEA SLK+E +L++GKS YQ+V++FES+TYGKVL 
Sbjct  53    GWFTEPRSHCGKASKVQYYNNPMWPGEAHSLKVENILYQGKSPYQEVLVFESSTYGKVLV  112

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q T+     Y EMI HLPL SIP+PKKVL++GGG G  L E+SR+ ++E IDI E
Sbjct  113   LDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREISRHSSVESIDICE  172

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             ID++V+D+ ++FFP+L+ GFEDPRV LH+GD   F+  A +G YDAIIVDSSDPIGPA+E
Sbjct  173   IDQLVIDICKEFFPHLSVGFEDPRVQLHVGDAVEFLRNAPEGTYDAIIVDSSDPIGPAQE  232

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFFE + +ALR GGV+C QAES+WLH HLI+ +++ CR+ FKGSV YAW +VPTYP
Sbjct  233   LVEKPFFETIARALRPGGVLCNQAESMWLHTHLIQDMLSICRETFKGSVRYAWASVPTYP  292

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             SGVIG++LC+ +GPPV+F  PVNPI++     K+   ++FYNSE+H AAF LP+FA++ L
Sbjct  293   SGVIGFLLCAKDGPPVNFLTPVNPIEEVEGATKAGREIRFYNSEMHMAAFVLPTFAKREL  352

Query  1127  E  1129
             E
Sbjct  353   E  353



>ref|XP_004951294.1| PREDICTED: spermine synthase-like [Setaria italica]
Length=386

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 232/313 (74%), Gaps = 14/313 (4%)
 Frame = +2

Query  233   ENAGNDFGCIKPGWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVM  370
             E+       +  GWF+E               + MWPGEA SLK+EK+L++GKS YQ+V+
Sbjct  41    ESEAKCHATVVSGWFTEPRSRCGKASKVQYYNNPMWPGEAHSLKVEKILYQGKSPYQEVL  100

Query  371   LFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVS  550
             +FES TYGKVL LDG +Q T+     Y EMI HLPL SIP+PKKVL++GGG G  L E+S
Sbjct  101   VFESTTYGKVLVLDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREIS  160

Query  551   RYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAII  730
             R+ ++E IDI EID++V+DV + FFP+L+ GFEDPRV LH+GD   F+  A +G YDAII
Sbjct  161   RHSSVESIDICEIDQLVIDVCKDFFPHLSVGFEDPRVQLHVGDAVEFLRNAPEGTYDAII  220

Query  731   VDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGS  910
             VDSSDPIGPA+EL E+PFF+ + +ALR GGV+C QAES+WLH HLI+ +++ C + FKGS
Sbjct  221   VDSSDPIGPAQELVEKPFFDTIARALRPGGVLCNQAESMWLHTHLIQDMLSICHETFKGS  280

Query  911   VNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKA  1090
             V+YAWT+VPTYPSGVIG++LC+ EGPPV+F  P+NPI+K     ++   ++FYNSE+H+A
Sbjct  281   VHYAWTSVPTYPSGVIGFLLCAKEGPPVNFLTPINPIEKLEGATEAGREIRFYNSEMHRA  340

Query  1091  AFTLPSFAQKLLE  1129
             AF LP+F +K LE
Sbjct  341   AFVLPTFVKKELE  353



>gb|ACG33952.1| spermidine synthase 1 [Zea mays]
Length=387

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 233/313 (74%), Gaps = 14/313 (4%)
 Frame = +2

Query  233   ENAGNDFGCIKPGWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVM  370
             E+       +  GWF+E               + MWPGEA SLK+EK+L++GKS YQ+V+
Sbjct  42    ESEARCHATVVSGWFTEPRSRCGKASKVQYYNNPMWPGEANSLKVEKILYQGKSPYQEVL  101

Query  371   LFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVS  550
             +FES+TYGKVL LDG +Q T+     Y EMI HLPL SIP+PKKVL++GGG G  L EVS
Sbjct  102   VFESSTYGKVLVLDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREVS  161

Query  551   RYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAII  730
             R+ ++E IDI EID++V+DV + FFP+L+ GF+DPRV LH+GD   F+  A +G YDAII
Sbjct  162   RHSSVESIDICEIDQLVIDVCKDFFPHLSVGFQDPRVQLHVGDAVEFLRNAPEGTYDAII  221

Query  731   VDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGS  910
             VDSSDPIGPA+EL E+PFF+ + +ALR GGV+C QAES+WLH HL++ +++ CR+ FKGS
Sbjct  222   VDSSDPIGPAQELVEKPFFDTIARALRPGGVLCNQAESMWLHTHLVQDMLSICRETFKGS  281

Query  911   VNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKA  1090
             V YAWT+VPTYPSGVIG++LC+ EGP V+F  P+NPI+K     K+   ++FYNSE+H+A
Sbjct  282   VRYAWTSVPTYPSGVIGFLLCAKEGPLVNFLTPINPIEKLEGATKAGREIRFYNSEMHRA  341

Query  1091  AFTLPSFAQKLLE  1129
             AF LP+FA++ LE
Sbjct  342   AFVLPTFARRELE  354



>ref|XP_008234725.1| PREDICTED: spermine synthase isoform X2 [Prunus mume]
Length=313

 Score =   378 bits (970),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/276 (66%), Positives = 223/276 (81%), Gaps = 0/276 (0%)
 Frame = +2

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGE  SLK+EK+L+KGKS++Q++++FES+TYGKVL LDG IQ +E     Y EMI HL
Sbjct  23    MWPGEVHSLKVEKILYKGKSEFQEILVFESSTYGKVLVLDGIIQLSEKDECAYQEMIAHL  82

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SIP+PK VL+VGGG G  L EVSR+P++E IDI EIDKMVVDVS++FFP LA GF+D
Sbjct  83    PLCSIPSPKTVLVVGGGDGGVLREVSRHPSVEHIDICEIDKMVVDVSKKFFPQLAVGFQD  142

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LHIGD   F+  A KG YDA+IVDSSDP+GPA+EL E+PFFE + +ALR GGV+C 
Sbjct  143   PRVHLHIGDATEFLRHAPKGKYDAVIVDSSDPVGPAQELVEKPFFETIARALRPGGVLCN  202

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
              AES+WLH HLI+ +I+ CR+ FKGSVNYAW +VPTYPSGVIG++LCSTEGPPVDFKNPV
Sbjct  203   MAESMWLHTHLIQDMISVCRETFKGSVNYAWASVPTYPSGVIGFLLCSTEGPPVDFKNPV  262

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             N I+K    +K K  L+FYNSE+H AAF LP F ++
Sbjct  263   NSIEKLEGALKHKRELRFYNSEMHSAAFALPPFLRR  298



>ref|XP_002974059.1| hypothetical protein SELMODRAFT_149426 [Selaginella moellendorffii]
 gb|EFJ25014.1| hypothetical protein SELMODRAFT_149426 [Selaginella moellendorffii]
Length=364

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 236/298 (79%), Gaps = 8/298 (3%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             I PGWFSE S MW GEA S +++K++F+GKSD+QDV++F+S +YG+VL LDG IQ T+  
Sbjct  62    IMPGWFSELSPMWSGEAHSFEVKKVVFEGKSDFQDVVVFDSVSYGRVLVLDGVIQLTQRD  121

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SI NP KVL+VGGG G  L E+SR+ ++++IDI EIDKMVVDV+++
Sbjct  122   ECAYQEMIAHLPLCSIENPAKVLVVGGGDGGVLREISRHESVQQIDICEIDKMVVDVAKE  181

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             +FP LA GF +PRV LHI DG AFV  A  G YDAIIVDSSDP+GPA++LFE+PFFE++ 
Sbjct  182   YFPELAVGFSNPRVNLHIADGVAFVRDAAPGTYDAIIVDSSDPVGPAQQLFEKPFFESMV  241

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGVVCTQAES WLHM +IK I+A+CRQ FKGSVNYAWTTVP+YPSGVIG+MLCST
Sbjct  242   KALRPGGVVCTQAESPWLHMPIIKDIVAACRQTFKGSVNYAWTTVPSYPSGVIGFMLCST  301

Query  980   EGPPVDFKNPVNPIDK-------DTTHVKSKP-PLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP V+F+NPV  +DK       +    K  P PLK+YNS++HKAAF+LP FA++ LE
Sbjct  302   EGPDVNFRNPVVSLDKLEMITIGEGGSEKRVPLPLKYYNSDMHKAAFSLPMFAKRELE  359



>ref|XP_006350698.1| PREDICTED: spermidine synthase 2-like [Solanum tuberosum]
Length=309

 Score =   375 bits (964),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 185/291 (64%), Positives = 229/291 (79%), Gaps = 2/291 (1%)
 Frame = +2

Query  260   IKPGWFSEFSQMWP--GEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTE  433
             I PGW+S+ S ++P  GE  S+KIEK+LFKG+S YQD+M+F+S T+GKV+ LDG IQHTE
Sbjct  15    IIPGWYSDVSDLFPVPGEIMSIKIEKILFKGRSKYQDIMIFQSLTFGKVIVLDGIIQHTE  74

Query  434   NGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVS  613
                  Y EMIVHLPL SIPNPKKVLIVGGG+GFTL EV RYP+IEK+D+VEID MVV+ S
Sbjct  75    RDVCSYVEMIVHLPLASIPNPKKVLIVGGGMGFTLREVLRYPSIEKVDLVEIDDMVVNAS  134

Query  614   RQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEA  793
             R++FP +A G+EDPR TL++ DG AFV     G YDAIIVDSSDPIGP+K  FE+PFFEA
Sbjct  135   RKYFPDIAKGYEDPRATLYVEDGNAFVKNTAPGTYDAIIVDSSDPIGPSKFFFEKPFFEA  194

Query  794   VGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLC  973
             V KALR GGV  TQ ES W+ + +I++++  C   FKGSVNY WT VP++ SG IG+++C
Sbjct  195   VSKALRPGGVYSTQGESAWIFLDIIQKLVEDCNIFFKGSVNYGWTNVPSFLSGAIGFVIC  254

Query  974   STEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             ST+GP VDFKNPVN +D D    KS+ PLK+YNSE+H AAF LP+FAQK+L
Sbjct  255   STDGPLVDFKNPVNKVDVDIISTKSESPLKYYNSEVHTAAFALPTFAQKVL  305



>ref|XP_006647125.1| PREDICTED: spermine synthase-like [Oryza brachyantha]
Length=388

 Score =   378 bits (971),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 230/301 (76%), Gaps = 14/301 (5%)
 Frame = +2

Query  269   GWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWF+E               + MWPGEA SLK+EK+L++GKS YQ+V++FES+TYGKVL 
Sbjct  55    GWFTEPRSRGGKTSKVQYYNNPMWPGEAHSLKVEKILYQGKSPYQEVLVFESSTYGKVLV  114

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q T+     Y EMI HLPL SIP+PKKVL++GGG G  L E+ R+ ++E IDI E
Sbjct  115   LDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREICRHASVESIDICE  174

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             ID++V+DV + FFP L+ GF+DPRV LH+GD   F+  A +G YDAIIVDSSDPIGPA+E
Sbjct  175   IDQLVIDVCKDFFPDLSVGFKDPRVQLHVGDAVEFLKNAPEGTYDAIIVDSSDPIGPAQE  234

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFF+ + +ALR GGV+C QAES+WLH HLI+ +++ CR+ FKGSV+YAWT+VPTYP
Sbjct  235   LVEKPFFDTIARALRPGGVLCNQAESMWLHTHLIQDMLSICRETFKGSVHYAWTSVPTYP  294

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             SGVIG++LC+ EGPPV+F  P NPI+K    +++   ++FYNSE+HKAAF LP+FA++ L
Sbjct  295   SGVIGFLLCAKEGPPVNFLTPENPIEKLKGAMEAGRDIRFYNSEMHKAAFVLPTFARREL  354

Query  1127  E  1129
             E
Sbjct  355   E  355



>ref|XP_009396566.1| PREDICTED: spermine synthase-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=351

 Score =   377 bits (967),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/289 (61%), Positives = 227/289 (79%), Gaps = 3/289 (1%)
 Frame = +2

Query  263   KPGWFSEFSQ-MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             K G F  F+  MWPGEA SLK+EK+L++GKS++Q++++F+S+ YGKVL LDG +Q TE  
Sbjct  55    KDGKFMYFNNPMWPGEAHSLKVEKILYQGKSEFQEILVFQSSMYGKVLVLDGIVQLTERD  114

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SIP+PK VL++GGG G  L E++R+ ++E IDI EIDKMV+DV +Q
Sbjct  115   ECAYQEMIAHLPLCSIPSPKTVLVIGGGDGGVLREIARHSSVEHIDICEIDKMVIDVCKQ  174

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP L+ GF+DPRV LH+ DG  F+  A +  YD IIVDSSDPIGPA+EL E+PFFE + 
Sbjct  175   FFPDLSVGFDDPRVRLHVADGIKFLRDAPEAMYDVIIVDSSDPIGPARELVEKPFFEMIA  234

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +AL+ GGV+C QAES+WLH HLI+ +++ CR++FK SV+YAW +VPTYPSGVIG++LCST
Sbjct  235   RALKPGGVLCNQAESMWLHTHLIQDMLSICREIFK-SVHYAWASVPTYPSGVIGFLLCST  293

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
              GPPV F NP+NPIDK    +K K  L+FYNSE+HKAAF LPSFA+K L
Sbjct  294   NGPPVHFLNPINPIDKQEA-LKCKRELRFYNSEMHKAAFVLPSFAKKEL  341



>gb|ACD87085.1| spermidine synthase 3 [Oryza sativa Japonica Group]
Length=397

 Score =   378 bits (971),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 230/301 (76%), Gaps = 14/301 (5%)
 Frame = +2

Query  269   GWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWF+E               + MWPGEA SLK+EK+L++GKS YQ+V++FES+TYGKVL 
Sbjct  64    GWFTEPRSRGGKTSKVQYYNNPMWPGEAHSLKVEKILYQGKSPYQEVLVFESSTYGKVLV  123

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q T+     Y EMI HLPL SIP+PKKVL++GGG G  L E+ R+ ++E IDI E
Sbjct  124   LDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREICRHGSVESIDICE  183

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             ID++V+DV + FFP L+ GF+DPRV LH+GD   F+  A +G YDAIIVDSSDPIGPA+E
Sbjct  184   IDQLVIDVCKDFFPDLSVGFKDPRVRLHVGDAVEFLRNAPEGTYDAIIVDSSDPIGPAQE  243

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFF+ + +ALR GGV+C QAES+WLH HLI+ +++ CR+ FKGSV+YAWT+VPTYP
Sbjct  244   LVEKPFFDTIARALRPGGVLCNQAESMWLHTHLIQDMLSICRETFKGSVHYAWTSVPTYP  303

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             SGVIG++LC+ EGPPV+F  P NPI+K    +++   ++FYNSE+H+AAF LP+FA++ L
Sbjct  304   SGVIGFLLCAKEGPPVNFLTPANPIEKLEGAMEAGRDIRFYNSEMHRAAFVLPTFARREL  363

Query  1127  E  1129
             E
Sbjct  364   E  364



>ref|XP_002983431.1| hypothetical protein SELMODRAFT_271631 [Selaginella moellendorffii]
 gb|EFJ15332.1| hypothetical protein SELMODRAFT_271631 [Selaginella moellendorffii]
Length=364

 Score =   377 bits (967),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 189/298 (63%), Positives = 236/298 (79%), Gaps = 8/298 (3%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             I PGWFSE S MW GEA S +++K++F+GKSD+QDV++F+S +YG+VL LDG IQ T+  
Sbjct  62    IMPGWFSELSPMWSGEAHSFEVKKVVFEGKSDFQDVVVFDSVSYGRVLVLDGVIQLTQRD  121

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMI HLPL SI NP KVL+VGGG G  L E+SR+ ++++IDI EIDKMVVDV+++
Sbjct  122   ECAYQEMIAHLPLCSIENPAKVLVVGGGDGGVLREISRHESVQQIDICEIDKMVVDVAKE  181

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             +FP LA GF +PRV LHI DG AFV  A  G YDAIIVDSSDP+GPA++LFE+PFFE++ 
Sbjct  182   YFPELAVGFSNPRVNLHIADGVAFVRDAAPGTYDAIIVDSSDPVGPAQQLFEKPFFESMV  241

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGV+CTQAES WLHM +IK I+A+CRQ FKGSVNYAWTTVP+YPSGVIG+MLCST
Sbjct  242   KALRPGGVICTQAESPWLHMPIIKDIVAACRQTFKGSVNYAWTTVPSYPSGVIGFMLCST  301

Query  980   EGPPVDFKNPVNPIDK-------DTTHVKSKP-PLKFYNSEIHKAAFTLPSFAQKLLE  1129
             EGP V+F+NPV  +DK       +    K  P PLK+YNS++HKAAF+LP FA++ LE
Sbjct  302   EGPDVNFRNPVVSLDKLEMITIGEGGSEKRVPLPLKYYNSDMHKAAFSLPMFAKRELE  359



>gb|AAQ14853.1|AF321139_1 spermidine synthase [Nicotiana tabacum]
 gb|AIZ70319.1| spermidine synthase [Nicotiana tabacum]
Length=261

 Score =   373 bits (957),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 175/257 (68%), Positives = 210/257 (82%), Gaps = 9/257 (4%)
 Frame = +2

Query  236  NAGNDFGC---------IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESAT  388
            N  ND GC         + PGWFSE S +WPGEA SLK+EK+LF+GKSDYQ+VM+F+S+T
Sbjct  5    NHNNDNGCTNESPYISSVLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSST  64

Query  389  YGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIE  568
            YGKVL LDG IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++E
Sbjct  65   YGKVLVLDGVIQLTERDECAYQEMIAHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVE  124

Query  569  KIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDP  748
            +IDI EIDKMVV+VS+QFFP +A G+EDPRV LHIGDG AF+     G YDA+IVDSSDP
Sbjct  125  QIDICEIDKMVVEVSKQFFPDVAVGYEDPRVNLHIGDGVAFLKNVAAGTYDAVIVDSSDP  184

Query  749  IGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWT  928
            IGPA+ELFE+PFF+++ +AL  GGVV TQAESIWLHMH+I++I+A+CRQ+FKGSVNYAWT
Sbjct  185  IGPAQELFEKPFFDSIARALHPGGVVSTQAESIWLHMHIIEEIVANCRQIFKGSVNYAWT  244

Query  929  TVPTYPSGVIGYMLCST  979
            TVPTYPSG+IG+MLCST
Sbjct  245  TVPTYPSGMIGFMLCST  261



>gb|EEC72856.1| hypothetical protein OsI_06609 [Oryza sativa Indica Group]
Length=397

 Score =   378 bits (970),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 230/301 (76%), Gaps = 14/301 (5%)
 Frame = +2

Query  269   GWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWF+E               + MWPGEA SLK+EK+L++GKS YQ+V++FES+TYGKVL 
Sbjct  64    GWFTEPRSRGGKTSKVQYYNNPMWPGEAHSLKVEKILYQGKSPYQEVLVFESSTYGKVLV  123

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q T+     Y EMI HLPL SIP+PKKVL++GGG G  L E+ R+ ++E IDI E
Sbjct  124   LDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREICRHGSVESIDICE  183

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             ID++V+DV + FFP L+ GF+DPRV LH+GD   F+  A +G YDAIIVDSSDPIGPA+E
Sbjct  184   IDQLVIDVCKDFFPDLSVGFKDPRVRLHVGDAVEFLRNAPEGTYDAIIVDSSDPIGPAQE  243

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFF+ + +ALR GGV+C QAES+WLH HLI+ +++ CR+ FKGSV+YAWT+VPTYP
Sbjct  244   LVEKPFFDTIARALRPGGVLCNQAESMWLHTHLIQDMLSICRETFKGSVHYAWTSVPTYP  303

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             SGVIG++LC+ EGPPV+F  P NPI+K    +++   ++FYNSE+H+AAF LP+FA++ L
Sbjct  304   SGVIGFLLCAKEGPPVNFLTPANPIEKLEGAMEAGRDIRFYNSEMHRAAFVLPTFARREL  363

Query  1127  E  1129
             E
Sbjct  364   E  364



>dbj|BAD29687.1| putative aminopropyl transferase [Oryza sativa Japonica Group]
 dbj|BAD28219.1| putative aminopropyl transferase [Oryza sativa Japonica Group]
 gb|EAZ22449.1| hypothetical protein OsJ_06118 [Oryza sativa Japonica Group]
Length=397

 Score =   378 bits (970),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 230/301 (76%), Gaps = 14/301 (5%)
 Frame = +2

Query  269   GWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWF+E               + MWPGEA SLK+EK+L++GKS YQ+V++FES+TYGKVL 
Sbjct  64    GWFTEPRSRGGKTSKVQYYNNPMWPGEAHSLKVEKILYQGKSPYQEVLVFESSTYGKVLV  123

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q T+     Y EMI HLPL SIP+PKKVL++GGG G  L E+ R+ ++E IDI E
Sbjct  124   LDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREICRHGSVESIDICE  183

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             ID++V+DV + FFP L+ GF+DPRV LH+GD   F+  A +G YDAIIVDSSDPIGPA+E
Sbjct  184   IDQLVIDVCKDFFPDLSVGFKDPRVRLHVGDAVEFLRNAPEGTYDAIIVDSSDPIGPAQE  243

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFF+ + +ALR GGV+C QAES+WLH HLI+ +++ CR+ FKGSV+YAWT+VPTYP
Sbjct  244   LVEKPFFDTIARALRPGGVLCNQAESMWLHTHLIQDMLSICRETFKGSVHYAWTSVPTYP  303

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             SGVIG++LC+ EGPPV+F  P NPI+K    +++   ++FYNSE+H+AAF LP+FA++ L
Sbjct  304   SGVIGFLLCAKEGPPVNFLTPANPIEKLEGAMEAGRDIRFYNSEMHRAAFVLPTFARREL  363

Query  1127  E  1129
             E
Sbjct  364   E  364



>ref|XP_004241004.1| PREDICTED: spermidine synthase 2-like [Solanum lycopersicum]
Length=316

 Score =   375 bits (962),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 187/299 (63%), Positives = 230/299 (77%), Gaps = 4/299 (1%)
 Frame = +2

Query  242   GNDFGC--IKPGWFSEFSQMWP--GEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTL  409
             G +  C  I PGW+S+ S ++P  GE  S+KIEK+LFKGKS YQD+M+FES TYGKV+ L
Sbjct  14    GKEMECLSIIPGWYSDVSDLFPVPGEIMSIKIEKILFKGKSKYQDIMIFESLTYGKVIVL  73

Query  410   DGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEI  589
             DG IQHTE     Y EMIVHLPL SI NPKKVLI+GGG+GFTL EV RYP++EK+D+VEI
Sbjct  74    DGIIQHTERDVCSYVEMIVHLPLASIHNPKKVLIIGGGMGFTLREVLRYPSVEKVDLVEI  133

Query  590   DKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKEL  769
             D MVV+ SR++FP +A G++DPR TL++ DG AFV     G YDAIIVDSSDPIG +K  
Sbjct  134   DDMVVNASRKYFPDIAKGYDDPRATLYVEDGNAFVKNTAPGTYDAIIVDSSDPIGSSKFF  193

Query  770   FERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPS  949
             FE+PFFEAV KALR GGV  TQ ES W+ + +I++++  C   FKGSVNY WT VP+Y S
Sbjct  194   FEKPFFEAVSKALRPGGVYSTQGESAWIFLDIIQKLVEDCNIFFKGSVNYGWTNVPSYLS  253

Query  950   GVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             G IG+++CSTEGPPVDFKNPVN +D      KS+ PLK+YNSE+H AAF LP+FAQK+L
Sbjct  254   GAIGFVICSTEGPPVDFKNPVNKVDVHIISAKSESPLKYYNSEVHTAAFALPTFAQKVL  312



>ref|XP_004307972.1| PREDICTED: spermine synthase-like [Fragaria vesca subsp. vesca]
Length=369

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/298 (62%), Positives = 227/298 (76%), Gaps = 14/298 (5%)
 Frame = +2

Query  269   GWFSEFSQ--------------MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWFSE                 MWPGEA SLK+E +L+KGKS++Q+V++FES+TYGKVL 
Sbjct  54    GWFSESQSRADKASKKTYFNNPMWPGEAHSLKVENILYKGKSEFQEVLVFESSTYGKVLV  113

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG IQ +E     Y EMI HLPL SIP+PK VL+VGGG G  L E+SR+ ++E IDI E
Sbjct  114   LDGIIQLSEKDECAYQEMITHLPLCSIPSPKNVLVVGGGDGGVLREISRHSSVEHIDICE  173

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             ID++V+DVS++FFP LA GFEDPRV LH+GD   F+  A KG YDA+IVDSSDP+GPA+E
Sbjct  174   IDQLVIDVSKKFFPELAVGFEDPRVHLHVGDATEFLRNAPKGKYDAVIVDSSDPVGPAQE  233

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFFE V +ALR GGV+C  AES+WLH HLI+ +I+ C+  FKGSVNYAWT+VPTYP
Sbjct  234   LVEKPFFETVARALRPGGVLCNMAESMWLHTHLIEDMISVCQLTFKGSVNYAWTSVPTYP  293

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             SGVIG++LCSTEGPPVDFKNPVN I+K    V  K  L+FYNSE+H AAF LP+F ++
Sbjct  294   SGVIGFLLCSTEGPPVDFKNPVNSIEKLAGAVNHKRELRFYNSEMHSAAFALPAFLRR  351



>ref|XP_004145928.1| PREDICTED: spermine synthase-like [Cucumis sativus]
 ref|XP_004160371.1| PREDICTED: spermine synthase-like [Cucumis sativus]
 gb|KGN49872.1| hypothetical protein Csa_5G139500 [Cucumis sativus]
Length=365

 Score =   375 bits (962),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 229/298 (77%), Gaps = 14/298 (5%)
 Frame = +2

Query  269   GWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWFSE               + MWPGEA SL++E +LFKGKS++Q+V++FES TYGKVL 
Sbjct  54    GWFSEPQFAYDDGKKRVYFNNPMWPGEAHSLQVESILFKGKSEFQEVVVFESTTYGKVLV  113

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q TE     Y EMI HLPL SIP+PK VL+VGGG G  L E+SR+ +IE IDI E
Sbjct  114   LDGIVQLTEKDECAYQEMITHLPLCSIPSPKTVLVVGGGDGGVLSEISRHNSIEHIDICE  173

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             ID+MV+DVS++FFP LA GFEDPRV LH+GD   F+  A +G YDAIIVDSSDP+GPA+E
Sbjct  174   IDQMVIDVSKEFFPDLAIGFEDPRVHLHVGDAVEFLRRAPRGKYDAIIVDSSDPVGPAQE  233

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFFE + KAL+ GGV+C  AES+WLH HLI  +I+ CR+VFKGS++YAW +VPTYP
Sbjct  234   LVEKPFFETLAKALKPGGVLCNMAESMWLHTHLIDDMISICREVFKGSIHYAWASVPTYP  293

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             SGVIG++LCSTEGPPVDFKNP+NPI+K    VK K  LKFYNSE+H AAF LPSF +K
Sbjct  294   SGVIGFLLCSTEGPPVDFKNPINPIEKLEGAVKHKKDLKFYNSEMHSAAFALPSFLRK  351



>ref|XP_008343788.1| PREDICTED: spermine synthase-like [Malus domestica]
 ref|XP_008343789.1| PREDICTED: spermine synthase-like [Malus domestica]
 ref|XP_008343791.1| PREDICTED: spermine synthase-like [Malus domestica]
 dbj|BAE19758.1| spermine synthase [Malus sylvestris]
Length=369

 Score =   374 bits (961),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 188/336 (56%), Positives = 235/336 (70%), Gaps = 14/336 (4%)
 Frame = +2

Query  155   NGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSEFSQ--------------  292
             +G  S+ NG+             +  E        +  GWFSE                 
Sbjct  16    DGKGSNGNGSEKAIPSCCLKAMASTPEAEAKCHSTVVSGWFSESQSRSEKDCKKVYFNNP  75

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGEA SLK+E +L++GKS+YQ++++FES+ YGKVL LDG IQ +E     Y EMI HL
Sbjct  76    MWPGEAHSLKVENILYRGKSEYQEILVFESSIYGKVLVLDGIIQLSEKDECAYQEMIAHL  135

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SI +PK VL+VGGG G  L EVSR+P+IE IDI EIDKMV+DVS++FFP LA GF+D
Sbjct  136   PLCSISSPKTVLVVGGGDGGVLREVSRHPSIEHIDICEIDKMVIDVSKKFFPQLAVGFQD  195

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LH+GD   F+  A +G YDA+IVDSSDP+GPA+EL E+PFFE + +ALR GGV+C 
Sbjct  196   PRVHLHVGDATEFLRLAPEGKYDAVIVDSSDPVGPAQELVEKPFFETIARALRPGGVLCN  255

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
               ES+WLH HLI+ +I+ CRQ+FKGSVNYAW +VPTYPSGVIG++LCST GPPVDFKNPV
Sbjct  256   MTESMWLHTHLIQDMISVCRQIFKGSVNYAWASVPTYPSGVIGFLLCSTAGPPVDFKNPV  315

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             N I+K    +K K  LKFYNSE+H AAF LP F ++
Sbjct  316   NSIEKLERALKHKRELKFYNSEMHSAAFALPPFLRR  351



>gb|ACU18139.1| unknown [Glycine max]
Length=257

 Score =   370 bits (950),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 179/251 (71%), Positives = 213/251 (85%), Gaps = 1/251 (0%)
 Frame = +2

Query  368   MLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEV  547
             M+F+S+TYGKVL LDG IQ TE     Y EMI HLPL SIPNPKKVL++GGG G  + EV
Sbjct  1     MVFQSSTYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVIREV  60

Query  548   SRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAI  727
             +R+ ++EKIDI EIDKMVVDVS+Q+FP +A G++DPRVTLHIGDG AF+    +G YDA+
Sbjct  61    ARHSSVEKIDICEIDKMVVDVSKQYFPDVAVGYDDPRVTLHIGDGVAFLKEVPEGTYDAV  120

Query  728   IVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKG  907
             IVDSSDPIGPA+ELFE+PFF +V KAL  GGVVCTQAESIWLHM +I+ I+A+CRQ+FKG
Sbjct  121   IVDSSDPIGPAQELFEKPFFASVAKALCPGGVVCTQAESIWLHMDIIEDIVANCRQIFKG  180

Query  908   SVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHK  1087
             SVNYAWTTVPTYPSG+IG+MLCSTEGPPVDFK+PVNPID++ +  KS  PLKFYNSEIH 
Sbjct  181   SVNYAWTTVPTYPSGMIGFMLCSTEGPPVDFKHPVNPIDENESQ-KSVRPLKFYNSEIHT  239

Query  1088  AAFTLPSFAQK  1120
             AAF LPSFA++
Sbjct  240   AAFCLPSFAKR  250



>ref|XP_007038989.1| Spermidine synthase 3 isoform 3 [Theobroma cacao]
 ref|XP_007038990.1| Spermidine synthase 3 isoform 3 [Theobroma cacao]
 ref|XP_007038992.1| Spermidine synthase 3 isoform 3 [Theobroma cacao]
 ref|XP_007038993.1| Spermidine synthase 3 isoform 3 [Theobroma cacao]
 ref|XP_007038995.1| Spermidine synthase 3 isoform 3 [Theobroma cacao]
 gb|EOY23490.1| Spermidine synthase 3 isoform 3 [Theobroma cacao]
 gb|EOY23491.1| Spermidine synthase 3 isoform 3 [Theobroma cacao]
 gb|EOY23493.1| Spermidine synthase 3 isoform 3 [Theobroma cacao]
 gb|EOY23494.1| Spermidine synthase 3 isoform 3 [Theobroma cacao]
 gb|EOY23496.1| Spermidine synthase 3 isoform 3 [Theobroma cacao]
Length=369

 Score =   374 bits (959),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 181/298 (61%), Positives = 227/298 (76%), Gaps = 14/298 (5%)
 Frame = +2

Query  269   GWFSEFSQ--------------MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWFSE+                MWPGEA SLK+E +L++GKSDYQ+V++FES+TYGKVL 
Sbjct  54    GWFSEYQSSSDKAGKRVFFNNPMWPGEAHSLKVENILYRGKSDYQEVLVFESSTYGKVLV  113

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q TE     Y EMI HLPL SI +PK VL+VGGG G  L E++R+ ++E+IDI E
Sbjct  114   LDGIVQLTEKDECAYQEMIAHLPLCSIRSPKTVLVVGGGDGGVLREIARHSSVERIDICE  173

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             IDKMV+DVS++FFP LA GFEDPRV LH+GD   F+    KG YDAIIVDSSDP+GPA+E
Sbjct  174   IDKMVIDVSKKFFPELAVGFEDPRVCLHVGDAVEFLRHVPKGKYDAIIVDSSDPVGPAQE  233

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFFE + +ALR GGV+C  AES+WLH HLI+ +I+ CR+ FKGSV+YAW +VPTYP
Sbjct  234   LVEKPFFETIARALRPGGVLCNMAESMWLHTHLIEDMISICRETFKGSVHYAWASVPTYP  293

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             SGVIG+++CSTEGPPVDF NP+NPI+K       K  L+FYNSE+H+AAF LPSF ++
Sbjct  294   SGVIGFLICSTEGPPVDFVNPINPIEKLDGAYHHKRELRFYNSEMHRAAFALPSFLKR  351



>ref|XP_003572094.1| PREDICTED: spermine synthase-like [Brachypodium distachyon]
Length=386

 Score =   374 bits (960),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/301 (57%), Positives = 229/301 (76%), Gaps = 14/301 (5%)
 Frame = +2

Query  269   GWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWF+E               + MWPGEA SLK+EK+L++GKS YQ+V++FES TYGKVL 
Sbjct  53    GWFTEPRSRCGKTSKVQYYNNPMWPGEAHSLKVEKILYQGKSLYQEVLIFESLTYGKVLV  112

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q T+     Y EMI HLPL SI +PK+VL++GGG G  L E+SR+ ++E IDI E
Sbjct  113   LDGIVQLTDKDECAYQEMITHLPLCSITSPKRVLVIGGGDGGVLREISRHDSVESIDICE  172

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             ID++V+DV + +FP L+ GF+DPRV LH+GD   F+  + +G YDAIIVDSSDPIGPA+E
Sbjct  173   IDQLVIDVCKDYFPDLSVGFKDPRVRLHVGDAVEFLKNSPEGTYDAIIVDSSDPIGPAQE  232

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFFE + +ALR GGV+C QAES+WLH HLI+ +++ CR+ FKGSV+YAWT+VPTYP
Sbjct  233   LVEKPFFETIARALRPGGVLCNQAESMWLHTHLIQDMLSICRETFKGSVHYAWTSVPTYP  292

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             SG IG++LC+ EGPPV+F  P+NPI+K    +K+   ++FYNSE+H+AAF LP+FA++ L
Sbjct  293   SGAIGFLLCAKEGPPVNFLTPINPIEKLEGAMKAGRDIRFYNSEMHRAAFVLPTFAKREL  352

Query  1127  E  1129
             E
Sbjct  353   E  353



>ref|XP_007218153.1| hypothetical protein PRUPE_ppa007399mg [Prunus persica]
 gb|EMJ19352.1| hypothetical protein PRUPE_ppa007399mg [Prunus persica]
Length=369

 Score =   373 bits (957),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/339 (57%), Positives = 238/339 (70%), Gaps = 17/339 (5%)
 Frame = +2

Query  155   NGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSEFSQ--------------  292
             +G AS+ NG+             +A E        +  GWFSE                 
Sbjct  16    DGKASNGNGSEKAIPSCCLKARASAPEAEAKCHSTVVSGWFSESQSRSEKASKKVYFNNP  75

Query  293   MWPGEAF---SLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMI  463
             MWPG      SLK+EK+L+KGKS++Q++++FES+TYGKVL LDG IQ +E     Y EMI
Sbjct  76    MWPGRQLASHSLKVEKILYKGKSEFQEILVFESSTYGKVLVLDGIIQLSEKDECAYQEMI  135

Query  464   VHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAG  643
               LPL SIP+PK VL+VGGG G  L EVSR+P++E IDI EIDKMVVDVS++FFP LA G
Sbjct  136   ALLPLCSIPSPKTVLVVGGGDGGVLREVSRHPSVEHIDICEIDKMVVDVSKKFFPQLAVG  195

Query  644   FEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGV  823
             F+DPRV LHIGD   F+  A KG YDA+IVDSSDP+GPA+EL E+PFFE + +ALR GGV
Sbjct  196   FQDPRVHLHIGDATEFLRHAPKGKYDAVIVDSSDPVGPAQELVEKPFFETIARALRPGGV  255

Query  824   VCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFK  1003
             +C  AES+WLH HLI+ +I+ CR+ FKGSVNYAW +VPTYPSGVIG++LCSTEGPPVDFK
Sbjct  256   LCNMAESMWLHTHLIQDMISVCRETFKGSVNYAWASVPTYPSGVIGFLLCSTEGPPVDFK  315

Query  1004  NPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             NPVN I+K    +K K  L+FYNSE+H AAF LP F ++
Sbjct  316   NPVNSIEKLEGALKHKRELRFYNSEMHSAAFALPPFLRR  354



>gb|KHG00313.1| Spermine synthase [Gossypium arboreum]
Length=356

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 185/298 (62%), Positives = 225/298 (76%), Gaps = 14/298 (5%)
 Frame = +2

Query  269   GWFSEFSQ--------------MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWFSE                 MWPGEA SLK+E +LFK KSDYQ+V++FES+TYGKVL 
Sbjct  54    GWFSESQSSSDDAGKMVYFNNPMWPGEAHSLKVESILFKEKSDYQEVLVFESSTYGKVLV  113

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q TE     Y EMI HLPL SIP+PK VL+VGGG G  L E+SR+ ++E IDI E
Sbjct  114   LDGIVQLTEKDECAYQEMIAHLPLCSIPSPKTVLVVGGGDGGVLREISRHSSVEHIDICE  173

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             IDKMV+DVS++FFP LA GFEDPRV LH+GD   F+  A KG YDAIIVDSSDP+GPA+E
Sbjct  174   IDKMVIDVSKKFFPELAVGFEDPRVNLHVGDAIEFLRHAPKGKYDAIIVDSSDPVGPAQE  233

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFFE + +ALR GGV+C  AES+WLH HLI+ +I+ CR+ FKG V+YAW +VPTYP
Sbjct  234   LVEKPFFETIAQALRPGGVLCNMAESMWLHTHLIEDMISICRETFKGPVHYAWASVPTYP  293

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             SGVIG++LCSTEGPPVDF NP+NPI+K       K  L+FYNSE+H+AAF LPSF ++
Sbjct  294   SGVIGFLLCSTEGPPVDFLNPINPIEKLDGAYLHKRELRFYNSEMHRAAFALPSFLKR  351



>ref|XP_010049302.1| PREDICTED: spermine synthase isoform X2 [Eucalyptus grandis]
Length=364

 Score =   371 bits (953),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 182/298 (61%), Positives = 229/298 (77%), Gaps = 14/298 (5%)
 Frame = +2

Query  269   GWFSEFSQ--------------MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWFSE+                MWPGEA SLK+EK+L++GKS+YQ+V++F+S+ YGKVL 
Sbjct  54    GWFSEYKTFADEARKEVYFNNPMWPGEAHSLKVEKILYEGKSEYQEVLVFQSSAYGKVLV  113

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q TE     Y EMI HLPL SIP+PKKVL+VGGG G  L EVSR+ ++E IDI E
Sbjct  114   LDGIVQLTEKDECAYQEMITHLPLCSIPSPKKVLVVGGGDGGVLREVSRHSSVELIDICE  173

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             ID++V+DVS++FFP LA GFEDPRV LH+GD   F+  A +G YDAIIVDSSDP+GPA+E
Sbjct  174   IDQLVIDVSKKFFPELAVGFEDPRVHLHVGDAVEFLRRAPEGKYDAIIVDSSDPVGPAQE  233

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFFE + +ALR GGV+C  AES+WLH HLI+ +I+ CR+ FKGSV+YAW +VPTYP
Sbjct  234   LVEKPFFETIARALRPGGVLCNMAESMWLHTHLIEAMISICRETFKGSVHYAWASVPTYP  293

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             SGVIG++LCSTEGPPVDF +PVNPI+K     K K  L+FYNSE+H AAF LP+F ++
Sbjct  294   SGVIGFLLCSTEGPPVDFIHPVNPIEKLEGATKHKRELRFYNSEMHSAAFALPTFMKR  351



>ref|XP_007038987.1| Spermidine synthase 3 isoform 1 [Theobroma cacao]
 ref|XP_007038988.1| Spermidine synthase 3 isoform 1 [Theobroma cacao]
 ref|XP_007038991.1| Spermidine synthase 3 isoform 1 [Theobroma cacao]
 ref|XP_007038994.1| Spermidine synthase 3 isoform 1 [Theobroma cacao]
 gb|EOY23488.1| Spermidine synthase 3 isoform 1 [Theobroma cacao]
 gb|EOY23489.1| Spermidine synthase 3 isoform 1 [Theobroma cacao]
 gb|EOY23492.1| Spermidine synthase 3 isoform 1 [Theobroma cacao]
 gb|EOY23495.1| Spermidine synthase 3 isoform 1 [Theobroma cacao]
Length=373

 Score =   372 bits (954),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 181/302 (60%), Positives = 227/302 (75%), Gaps = 18/302 (6%)
 Frame = +2

Query  269   GWFSEFSQ------------------MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYG  394
             GWFSE+                    MWPGEA SLK+E +L++GKSDYQ+V++FES+TYG
Sbjct  54    GWFSEYQSSSGHYLDKAGKRVFFNNPMWPGEAHSLKVENILYRGKSDYQEVLVFESSTYG  113

Query  395   KVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKI  574
             KVL LDG +Q TE     Y EMI HLPL SI +PK VL+VGGG G  L E++R+ ++E+I
Sbjct  114   KVLVLDGIVQLTEKDECAYQEMIAHLPLCSIRSPKTVLVVGGGDGGVLREIARHSSVERI  173

Query  575   DIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIG  754
             DI EIDKMV+DVS++FFP LA GFEDPRV LH+GD   F+    KG YDAIIVDSSDP+G
Sbjct  174   DICEIDKMVIDVSKKFFPELAVGFEDPRVCLHVGDAVEFLRHVPKGKYDAIIVDSSDPVG  233

Query  755   PAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTV  934
             PA+EL E+PFFE + +ALR GGV+C  AES+WLH HLI+ +I+ CR+ FKGSV+YAW +V
Sbjct  234   PAQELVEKPFFETIARALRPGGVLCNMAESMWLHTHLIEDMISICRETFKGSVHYAWASV  293

Query  935   PTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFA  1114
             PTYPSGVIG+++CSTEGPPVDF NP+NPI+K       K  L+FYNSE+H+AAF LPSF 
Sbjct  294   PTYPSGVIGFLICSTEGPPVDFVNPINPIEKLDGAYHHKRELRFYNSEMHRAAFALPSFL  353

Query  1115  QK  1120
             ++
Sbjct  354   KR  355



>ref|XP_010049294.1| PREDICTED: spermine synthase isoform X1 [Eucalyptus grandis]
 gb|KCW89171.1| hypothetical protein EUGRSUZ_A01487 [Eucalyptus grandis]
Length=365

 Score =   371 bits (953),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 182/299 (61%), Positives = 229/299 (77%), Gaps = 15/299 (5%)
 Frame = +2

Query  269   GWFSEFSQ---------------MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVL  403
             GWFSE+                 MWPGEA SLK+EK+L++GKS+YQ+V++F+S+ YGKVL
Sbjct  54    GWFSEYKTFAADEARKEVYFNNPMWPGEAHSLKVEKILYEGKSEYQEVLVFQSSAYGKVL  113

Query  404   TLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIV  583
              LDG +Q TE     Y EMI HLPL SIP+PKKVL+VGGG G  L EVSR+ ++E IDI 
Sbjct  114   VLDGIVQLTEKDECAYQEMITHLPLCSIPSPKKVLVVGGGDGGVLREVSRHSSVELIDIC  173

Query  584   EIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAK  763
             EID++V+DVS++FFP LA GFEDPRV LH+GD   F+  A +G YDAIIVDSSDP+GPA+
Sbjct  174   EIDQLVIDVSKKFFPELAVGFEDPRVHLHVGDAVEFLRRAPEGKYDAIIVDSSDPVGPAQ  233

Query  764   ELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTY  943
             EL E+PFFE + +ALR GGV+C  AES+WLH HLI+ +I+ CR+ FKGSV+YAW +VPTY
Sbjct  234   ELVEKPFFETIARALRPGGVLCNMAESMWLHTHLIEAMISICRETFKGSVHYAWASVPTY  293

Query  944   PSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             PSGVIG++LCSTEGPPVDF +PVNPI+K     K K  L+FYNSE+H AAF LP+F ++
Sbjct  294   PSGVIGFLLCSTEGPPVDFIHPVNPIEKLEGATKHKRELRFYNSEMHSAAFALPTFMKR  352



>ref|XP_008382792.1| PREDICTED: spermine synthase-like [Malus domestica]
Length=337

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/276 (64%), Positives = 220/276 (80%), Gaps = 0/276 (0%)
 Frame = +2

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGEA SLK+E +L++GKS+YQ++++FES+ YGKVL LDG IQ +E     Y EMI HL
Sbjct  44    MWPGEAHSLKVENILYRGKSEYQEILVFESSIYGKVLVLDGIIQLSEKDECAYQEMIAHL  103

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SI +PK VL+VGGG G  L EVSR+P+IE IDI EIDKMV+DVS++FFP LA GF+D
Sbjct  104   PLCSISSPKTVLVVGGGDGGVLREVSRHPSIEHIDICEIDKMVIDVSKKFFPQLAVGFQD  163

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LH+GD   F+  A +G YDA+IVDSSDP+GPA+EL E+PFFE + +ALR GGV+C 
Sbjct  164   PRVHLHVGDATEFLRLAPEGKYDAVIVDSSDPVGPAQELVEKPFFETIARALRPGGVLCN  223

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
               ES+WLH HLI+ +I+ CRQ+FKGSVNYAW +VPTYPSGVIG++LCST GPPVDFKNPV
Sbjct  224   MTESMWLHTHLIQDMISVCRQIFKGSVNYAWASVPTYPSGVIGFLLCSTAGPPVDFKNPV  283

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             N I+K    +K K  LKFYNSE+H AAF LP F ++
Sbjct  284   NSIEKLERALKHKRELKFYNSEMHSAAFALPPFLRR  319



>ref|XP_010915659.1| PREDICTED: LOW QUALITY PROTEIN: spermine synthase-like [Elaeis 
guineensis]
Length=409

 Score =   372 bits (955),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/318 (54%), Positives = 228/318 (72%), Gaps = 34/318 (11%)
 Frame = +2

Query  269   GWFSEFSQ--------------MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWF+E                 MWPGE  SL++EK+L++G+S+YQ++++FES TYGKVL 
Sbjct  53    GWFTESRSCSDKAGKVLYYNNPMWPGEVHSLQVEKILYQGRSEYQEILVFESKTYGKVLV  112

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q T+     Y EMI HLPL SIP+PK VL++GGG G  L EVSR+ ++E IDI E
Sbjct  113   LDGIVQLTDKDECAYQEMIAHLPLCSIPSPKHVLVIGGGDGGVLREVSRHSSVEVIDICE  172

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             IDK+V+DV ++FFP+L+ GFEDPRV LH+GD   ++  A +G YDAIIVDSSDPIGPA+E
Sbjct  173   IDKLVIDVCKEFFPHLSVGFEDPRVRLHVGDAVEYIRNAPEGMYDAIIVDSSDPIGPARE  232

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L ERPFFE + +AL+ GGV+C QAES+WLH HLI+ +++ CR+ FKGSV+YAWT+VPTYP
Sbjct  233   LVERPFFETIARALKPGGVLCNQAESMWLHTHLIQDMLSICRETFKGSVHYAWTSVPTYP  292

Query  947   --------------------SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKF  1066
                                 SG IG++LC+ +GPPV+F NP+NPI+K    +K    +KF
Sbjct  293   RVPGSSXSLXYQESLLQVGHSGAIGFLLCAKDGPPVNFMNPINPIEKQEGAIKVGREVKF  352

Query  1067  YNSEIHKAAFTLPSFAQK  1120
             YNSE+HKAAF LPSFA++
Sbjct  353   YNSEMHKAAFILPSFAKR  370



>emb|CDP05080.1| unnamed protein product [Coffea canephora]
Length=366

 Score =   370 bits (950),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/278 (63%), Positives = 225/278 (81%), Gaps = 0/278 (0%)
 Frame = +2

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGEA SL++EK+LFK +S++Q+V++F+S++YGKVL LDG +Q TE     Y EMI HL
Sbjct  77    MWPGEAHSLRVEKILFKERSEFQEVLVFQSSSYGKVLVLDGIVQLTEKDECAYQEMIAHL  136

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SI +PK VL+VGGG G  L E+SR+ +++ IDI EIDKMV+DVS++FFP LA GF+D
Sbjct  137   PLCSIKSPKNVLVVGGGDGGVLREISRHSSVKLIDICEIDKMVIDVSKKFFPQLAVGFDD  196

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LH+GD   F+  A +G YDAIIVDSSDP+GPA+EL ERPFF+ + KALR GGV+C 
Sbjct  197   PRVHLHVGDAAEFLRSASEGKYDAIIVDSSDPVGPAQELVERPFFQTIAKALRPGGVLCN  256

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
              AES+WLH HLI+ +I+ CR+ FKGSV+YAWT+VPTYPSGVIG+++CSTEGPPVDF +P+
Sbjct  257   MAESMWLHTHLIQDMISICRETFKGSVHYAWTSVPTYPSGVIGFLICSTEGPPVDFLHPI  316

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             NPI+K    V+ +  LKFYNSEIHKAAF LPSF ++ L
Sbjct  317   NPIEKLEGAVQHQRELKFYNSEIHKAAFALPSFVKREL  354



>ref|XP_008441613.1| PREDICTED: spermine synthase-like [Cucumis melo]
Length=368

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 227/298 (76%), Gaps = 16/298 (5%)
 Frame = +2

Query  269   GWFSEFSQ--------------MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWFSEF                MWPGEA +L++E +LFKGKS+YQ+VM+FESA+YGKVL 
Sbjct  54    GWFSEFQSGSDKACKKLYFNNPMWPGEAHALEVENILFKGKSEYQEVMVFESASYGKVLV  113

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q TE     Y EMI HLPL SIP+PK VL+VGGG G  L E+SR+ ++E IDI E
Sbjct  114   LDGIVQLTEKDECAYQEMIAHLPLCSIPSPKSVLVVGGGDGGVLREISRHDSVEHIDICE  173

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             ID+MV+DVS++FFP LA GFEDPRV LH+GD   F+  A++G YDAIIVDSSDP+GPA+E
Sbjct  174   IDQMVIDVSKKFFPQLAVGFEDPRVHLHVGDAVEFLRNAKQGKYDAIIVDSSDPVGPAQE  233

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E PFF    +ALR GGV+C  AES+WLH HLI+ +I+ C Q FK  V+YAWT+VPTYP
Sbjct  234   LVEMPFFRMTAQALRPGGVLCNMAESMWLHTHLIQDMISICCQTFK-DVHYAWTSVPTYP  292

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             SGVIG++LCSTEGP VDF+NPVNPI+K   H+KSK  LKFYNSE+H AAF LPSF ++
Sbjct  293   SGVIGFLLCSTEGPKVDFRNPVNPIEK-LGHLKSKRELKFYNSEMHSAAFALPSFLKR  349



>ref|XP_008437587.1| PREDICTED: spermine synthase [Cucumis melo]
 ref|XP_008437588.1| PREDICTED: spermine synthase [Cucumis melo]
Length=365

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 227/298 (76%), Gaps = 14/298 (5%)
 Frame = +2

Query  269   GWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWFSE               + MWPGEA SL++E +LFKGKS++Q+V++FES TYGKVL 
Sbjct  54    GWFSEPQFAYDDGKKRVYFNNPMWPGEAHSLQVESILFKGKSEFQEVVVFESTTYGKVLV  113

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q TE     Y EMI HLPL SIP+PK VL+VGGG G  L E+SR+ ++E IDI E
Sbjct  114   LDGIVQLTEKDECAYQEMITHLPLCSIPSPKTVLVVGGGDGGVLSEISRHNSVEHIDICE  173

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             ID+MV+DVS++FFP LA GFEDPRV LH+GD   F+  A  G YDAIIVDSSDP+GPA+E
Sbjct  174   IDQMVIDVSKKFFPDLARGFEDPRVHLHVGDAVEFLRRAPSGKYDAIIVDSSDPVGPAQE  233

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFFE + KAL+ GGV+C  AES+WLH HLI  +I+ CR+VFKGS++YAW +VPTYP
Sbjct  234   LVEKPFFETLAKALKPGGVLCNMAESMWLHTHLIDDMISICREVFKGSIHYAWASVPTYP  293

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             SGVIG++LCSTEG PVDFKNP+NPI+K    VK K  LKFYNSE+H AAF LPSF +K
Sbjct  294   SGVIGFLLCSTEGKPVDFKNPINPIEKLEGGVKHKKDLKFYNSEMHSAAFALPSFLRK  351



>ref|XP_009351994.1| PREDICTED: spermine synthase-like [Pyrus x bretschneideri]
 ref|XP_009351995.1| PREDICTED: spermine synthase-like [Pyrus x bretschneideri]
 ref|XP_009351997.1| PREDICTED: spermine synthase-like [Pyrus x bretschneideri]
Length=369

 Score =   369 bits (946),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 184/336 (55%), Positives = 234/336 (70%), Gaps = 14/336 (4%)
 Frame = +2

Query  155   NGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSEFSQ--------------  292
             +G AS+ NG+             +  E        +  GWFSE                 
Sbjct  16    DGKASNGNGSEKAIPSCCVKAMASTPEAEAKCHSTVVSGWFSESQSRSEKDCKKVYFNNP  75

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGEA SLK+E +L++GKS++Q++++FES+ YGKVL LDG IQ +E     Y EMI HL
Sbjct  76    MWPGEAHSLKVENILYRGKSEFQEILVFESSIYGKVLVLDGIIQLSEKDECAYQEMIAHL  135

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SI +PK+VL+VGGG G  L EVSR+P++E IDI EIDKMV+DVS +FFP LA GF+D
Sbjct  136   PLCSISSPKRVLVVGGGDGGVLREVSRHPSVEHIDICEIDKMVIDVSEKFFPQLAVGFQD  195

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LH+ D   F+  A +G YDA+IVDSSDP+GPA+EL E+PFFE + +ALR GGV+C 
Sbjct  196   PRVHLHVADATEFLRLAPEGKYDAVIVDSSDPVGPAQELVEKPFFETIARALRPGGVLCN  255

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
               ES+WLH HLI+ +I+ C Q+FKGSVNYAW +VPTYPSGVIG++LCST GPPVDFKNPV
Sbjct  256   MTESMWLHTHLIQDMISVCCQIFKGSVNYAWASVPTYPSGVIGFLLCSTAGPPVDFKNPV  315

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             N ++K    +K K  LKFYNSE+H AAF LP F ++
Sbjct  316   NSVEKLEGALKHKRELKFYNSEMHSAAFALPPFLRR  351



>dbj|BAK01445.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=385

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/313 (55%), Positives = 228/313 (73%), Gaps = 14/313 (4%)
 Frame = +2

Query  233   ENAGNDFGCIKPGWFSEF--------------SQMWPGEAFSLKIEKLLFKGKSDYQDVM  370
             E+       +  GWF+E               + MWPGE  SLK+EK+L +GKS YQ+V+
Sbjct  41    ESEAKCHATVVSGWFTETHSRCGKASKLQYYNNPMWPGETHSLKVEKILHQGKSPYQEVL  100

Query  371   LFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVS  550
             +FES TYGKVL LDG +Q T+     Y EMI HLPL SIP+PKKVL++GGG G  L E++
Sbjct  101   IFESLTYGKVLVLDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREIA  160

Query  551   RYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAII  730
             R+ ++E IDI EID++V+DV + FFP L+ GF+DPRV LH+GD   F+    +G YDAII
Sbjct  161   RHGSVESIDICEIDQLVIDVCKDFFPDLSVGFKDPRVRLHVGDAVEFLRNTPEGTYDAII  220

Query  731   VDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGS  910
             VDSSDPIGPA+EL E+PFFE + +ALR GGV+C QAES+WLH HLI+ +++ C + FKGS
Sbjct  221   VDSSDPIGPAQELVEKPFFETIARALRPGGVLCNQAESMWLHTHLIQDMLSICCETFKGS  280

Query  911   VNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKA  1090
             V+YAWT+VPTYPSG IG++LC+ EGPPV+F  P+NPI+K    + +   ++FYN+E+HKA
Sbjct  281   VHYAWTSVPTYPSGAIGFLLCAKEGPPVNFLAPINPIEKLEGAMTAGRDIRFYNTEMHKA  340

Query  1091  AFTLPSFAQKLLE  1129
             AF LP+FA++ LE
Sbjct  341   AFVLPTFAKRELE  353



>gb|EMT24635.1| Spermidine synthase [Aegilops tauschii]
Length=384

 Score =   368 bits (945),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/301 (56%), Positives = 225/301 (75%), Gaps = 14/301 (5%)
 Frame = +2

Query  269   GWFSEFSQ--------------MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWF+E                 MWPGE  SLK+EK+L++GKS YQ+V++FES TYGKVL 
Sbjct  53    GWFTETRSRCGKANKLQYYNNPMWPGETHSLKVEKILYQGKSPYQEVLIFESLTYGKVLA  112

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q T+     Y EMI HLPL SIP+PKKVL++GGG G  L E++R+ ++E IDI E
Sbjct  113   LDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREIARHGSVESIDICE  172

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             ID++V+DV + FFP L+ GF+DPRV LH+GD   F+  + +G YDAIIVDSSDPIGPA+E
Sbjct  173   IDQLVIDVCKDFFPDLSVGFKDPRVRLHVGDAVEFLRNSPEGTYDAIIVDSSDPIGPAQE  232

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFFE + +ALR GGV+C QAES+WLH HLI+ +++ C + FKGSV+YAW +VPTYP
Sbjct  233   LVEKPFFETIARALRPGGVLCNQAESMWLHTHLIQDMLSICCETFKGSVHYAWASVPTYP  292

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             SG IG++LC+ EGPPV+F  P+NPI+K    + +   ++FYN+E+H+AAF LP+FA++ L
Sbjct  293   SGAIGFLLCAKEGPPVNFLAPINPIEKLEGAMTAGRDIRFYNTEMHRAAFVLPTFAKREL  352

Query  1127  E  1129
             E
Sbjct  353   E  353



>emb|CDY25803.1| BnaA07g09790D [Brassica napus]
Length=303

 Score =   365 bits (937),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/293 (62%), Positives = 220/293 (75%), Gaps = 28/293 (10%)
 Frame = +2

Query  251   FGCIKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHT  430
             F  + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQDV++F+SATYGKVL LDG IQ T
Sbjct  35    FSSVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT  94

Query  431   ENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDV  610
             E     Y EMI HLPL SIPNPKKVL++GGG G  L EV+R+ ++E+ID+ EIDKMVVDV
Sbjct  95    ERDECAYQEMITHLPLCSIPNPKKVLVIGGGGGGVLPEVARHASVEQIDMCEIDKMVVDV  154

Query  611   SRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFE  790
             S+QFFP +A  FEDPRV L IGDG AF+  A +G YDA+IVDSSDPIGPAKELFE+PFF+
Sbjct  155   SKQFFPNVAIRFEDPRVNLVIGDGVAFLKNAAQGSYDAVIVDSSDPIGPAKELFEKPFFQ  214

Query  791   AVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
             +V +ALR GGVVCTQAES+WLHM +I+ I+++CR +FK                      
Sbjct  215   SVARALRPGGVVCTQAESLWLHMDIIEDIVSNCRDIFK----------------------  252

Query  971   CSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLLE  1129
                 GP VDFKNPVNPID  ++  KS  PLKFYN+EIH AAF LPSFA+K++E
Sbjct  253   ----GPHVDFKNPVNPIDDSSS--KSNGPLKFYNAEIHSAAFCLPSFAKKVIE  299



>ref|XP_006401743.1| hypothetical protein EUTSA_v10013929mg [Eutrema salsugineum]
 gb|ESQ43196.1| hypothetical protein EUTSA_v10013929mg [Eutrema salsugineum]
Length=358

 Score =   367 bits (941),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 188/345 (54%), Positives = 237/345 (69%), Gaps = 15/345 (4%)
 Frame = +2

Query  128   NGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSE--------  283
              G       +G AS+ NG                 E        +  GWFSE        
Sbjct  7     KGLACQKTMDGKASNGNGLEKTVPSCCLKAMACLPEEDAKCHSTVVSGWFSEPHPRSGKR  66

Query  284   ------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
                    + MWPGEA SLK+EK+LFK KSDYQ+V++FESATYGKVL LDG +Q TE   F
Sbjct  67    GKAVYFNNPMWPGEAHSLKVEKVLFKDKSDYQEVLVFESATYGKVLVLDGIVQLTEKDEF  126

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL S P+PK VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DVS++FF
Sbjct  127   AYQEMIAHLPLCSTPSPKNVLVVGGGDGGVLREISRHSSVEVIDICEIDKMVIDVSKRFF  186

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P LA GF+DPRV LHIGD   F+  + +G YDAIIVDSSDP+GPA+ L E+PFFE + +A
Sbjct  187   PELAVGFQDPRVQLHIGDAVEFLRKSPEGKYDAIIVDSSDPVGPAQALVEKPFFETLARA  246

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             L+ GG++C  AES+WLH HLI+ +I+ CRQ FK +V YAW++VPTYPSGVIG++LCSTEG
Sbjct  247   LKPGGILCNMAESMWLHTHLIEDMISICRQTFK-NVQYAWSSVPTYPSGVIGFVLCSTEG  305

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             P VDFKNP+NPI+K    +  K  +KFYNSE+H+AAF LP+F ++
Sbjct  306   PAVDFKNPINPIEKLDGAMTHKREMKFYNSEMHRAAFALPTFLRR  350



>ref|NP_568785.1| Spermine synthase [Arabidopsis thaliana]
 ref|NP_851178.1| Spermine synthase [Arabidopsis thaliana]
 ref|NP_851179.1| Spermine synthase [Arabidopsis thaliana]
 ref|NP_001078748.1| Spermine synthase [Arabidopsis thaliana]
 ref|NP_001078749.1| Spermine synthase [Arabidopsis thaliana]
 sp|Q94BN2.1|SPSY_ARATH RecName: Full=Spermine synthase; Short=SPMSY; AltName: Full=Spermidine 
aminopropyltransferase [Arabidopsis thaliana]
 gb|AAK64170.1| putative spermidine synthase [Arabidopsis thaliana]
 gb|AAL85098.1| putative spermidine synthase [Arabidopsis thaliana]
 gb|AAN31883.1| putative spermidine synthase [Arabidopsis thaliana]
 gb|AED96305.1| Spermine synthase [Arabidopsis thaliana]
 gb|AED96306.1| Spermine synthase [Arabidopsis thaliana]
 gb|AED96307.1| Spermine synthase [Arabidopsis thaliana]
 gb|AED96308.1| Spermine synthase [Arabidopsis thaliana]
 gb|AED96309.1| Spermine synthase [Arabidopsis thaliana]
Length=359

 Score =   366 bits (940),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 190/345 (55%), Positives = 239/345 (69%), Gaps = 16/345 (5%)
 Frame = +2

Query  131   GGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSE---------  283
             G V  N  +G AS+ NG                 E+       +  GWFSE         
Sbjct  8     GLVCQNTMDGKASNGNGLEKTVPSCCLKAMACVPEDDAKCHSTVVSGWFSEPHPRSGKKG  67

Query  284   ------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
                    + MWPGEA SLK+EK+LFK KSD+Q+V++FESATYGKVL LDG +Q TE    
Sbjct  68    GKAVYFNNPMWPGEAHSLKVEKVLFKDKSDFQEVLVFESATYGKVLVLDGIVQLTEKDEC  127

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SI +PK VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DVS++FF
Sbjct  128   AYQEMIAHLPLCSISSPKNVLVVGGGDGGVLREISRHSSVEVIDICEIDKMVIDVSKKFF  187

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P LA GF+DPRV LHIGD   F+  + +G YDAIIVDSSDP+GPA  L E+PFFE + +A
Sbjct  188   PELAVGFDDPRVQLHIGDAAEFLRKSPEGKYDAIIVDSSDPVGPALALVEKPFFETLARA  247

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             L+ GGV+C  AES+WLH HLI+ +I+ CRQ FK SV+YAW++VPTYPSGVIG++LCSTEG
Sbjct  248   LKPGGVLCNMAESMWLHTHLIEDMISICRQTFK-SVHYAWSSVPTYPSGVIGFVLCSTEG  306

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             P VDFKNP+NPI+K    +  K  LKFYNS++H+AAF LP+F ++
Sbjct  307   PAVDFKNPINPIEKLDGAMTHKRELKFYNSDMHRAAFALPTFLRR  351



>ref|XP_009119852.1| PREDICTED: spermine synthase-like [Brassica rapa]
 ref|XP_009119853.1| PREDICTED: spermine synthase-like [Brassica rapa]
Length=361

 Score =   366 bits (940),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 238/346 (69%), Gaps = 16/346 (5%)
 Frame = +2

Query  128   NGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSE--------  283
              G V     +G AS+ NG                 E        +  GWFSE        
Sbjct  7     KGLVCQKIMDGNASNGNGVEKTVPSCCLKAMSCLPEEDAKCHSTVVSGWFSEPPHLRSGK  66

Query  284   -------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGG  442
                     + MWPGEA SLK+EK+LFK KSDYQ+V++FESATYGKVL LDG +Q TE   
Sbjct  67    RGKAVYFNNPMWPGEAHSLKVEKVLFKDKSDYQEVLVFESATYGKVLVLDGILQLTEKDE  126

Query  443   FPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQF  622
             F Y EMI HLPL S P+PK VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DVS++F
Sbjct  127   FAYQEMIAHLPLCSTPSPKNVLVVGGGDGGVLREISRHSSVEVIDICEIDKMVIDVSKKF  186

Query  623   FPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGK  802
             FP LA GFEDPRV LHIGD   F+  + +G YDAIIVDSSDP+GPA+ L E+PFFE + +
Sbjct  187   FPELAVGFEDPRVQLHIGDAVEFLQQSPEGKYDAIIVDSSDPVGPAQALVEKPFFETLAR  246

Query  803   ALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTE  982
             AL+ GGV+C  AES+WLH HLI+ +I+ CRQ FK +V YAW++VPTYPSGVIG++LCST+
Sbjct  247   ALKPGGVLCNMAESMWLHTHLIEDMISVCRQTFK-NVQYAWSSVPTYPSGVIGFILCSTD  305

Query  983   GPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             GP VDFKNP+NPI+K    +  K  +KFYNS++H+AAF LP+F ++
Sbjct  306   GPAVDFKNPINPIEKLDGAMTYKREMKFYNSDMHRAAFALPTFLRR  351



>dbj|BAH19534.1| AT5G53120 [Arabidopsis thaliana]
Length=359

 Score =   366 bits (940),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 190/345 (55%), Positives = 239/345 (69%), Gaps = 16/345 (5%)
 Frame = +2

Query  131   GGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSE---------  283
             G V  N  +G AS+ NG                 E+       +  GWFSE         
Sbjct  8     GLVCQNTMDGKASNGNGLEKTVPSCCLKAMACEPEDDAKCHSTVVSGWFSEPHPRSGKKG  67

Query  284   ------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
                    + MWPGEA SLK+EK+LFK KSD+Q+V++FESATYGKVL LDG +Q TE    
Sbjct  68    GKAVYFNNPMWPGEAHSLKVEKVLFKDKSDFQEVLVFESATYGKVLVLDGIVQLTEKDEC  127

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SI +PK VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DVS++FF
Sbjct  128   AYQEMIAHLPLCSISSPKNVLVVGGGDGGVLREISRHSSVEVIDICEIDKMVIDVSKKFF  187

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P LA GF+DPRV LHIGD   F+  + +G YDAIIVDSSDP+GPA  L E+PFFE + +A
Sbjct  188   PELAVGFDDPRVQLHIGDAAEFLRKSPEGKYDAIIVDSSDPVGPALALVEKPFFETLARA  247

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             L+ GGV+C  AES+WLH HLI+ +I+ CRQ FK SV+YAW++VPTYPSGVIG++LCSTEG
Sbjct  248   LKPGGVLCNMAESMWLHTHLIEDMISICRQTFK-SVHYAWSSVPTYPSGVIGFVLCSTEG  306

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             P VDFKNP+NPI+K    +  K  LKFYNS++H+AAF LP+F ++
Sbjct  307   PAVDFKNPINPIEKLDGAMTHKRELKFYNSDMHRAAFALPTFLRR  351



>gb|KDP22157.1| hypothetical protein JCGZ_25988 [Jatropha curcas]
Length=369

 Score =   366 bits (940),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 186/345 (54%), Positives = 239/345 (69%), Gaps = 14/345 (4%)
 Frame = +2

Query  128   NGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSEFSQ-----  292
             NG       +G  ++ NG+             +A E+       +  GWFSE        
Sbjct  7     NGLECQKIMDGKVNNGNGSEKAIPSCCLKARASAPEHDAKCHSTVVSGWFSESHSCSGKA  66

Query  293   ---------MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
                      MWPGEA SL+++ +L++ KS+YQ+V++FES+ YGKVL LDG +Q TE    
Sbjct  67    TKTVYFNNPMWPGEAHSLEVKNILYQSKSEYQEVLVFESSAYGKVLVLDGIVQLTEKDEC  126

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SIP+PK VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DVS++FF
Sbjct  127   AYQEMIAHLPLCSIPSPKSVLVVGGGDGGVLREISRHSSVELIDICEIDKMVIDVSKEFF  186

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P LA GFEDPRV LH+GD   F+  A +G YDAIIVDSSDP+GPA+EL E+PFF+ + +A
Sbjct  187   PELAVGFEDPRVRLHVGDAVEFLRLAPEGKYDAIIVDSSDPVGPAQELVEKPFFQTIARA  246

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGV+C  AES+WLH HLI+ +IA CR+ FKGSV+YAW +VPTYPSGVIG++LCSTEG
Sbjct  247   LRPGGVLCNMAESMWLHTHLIQDMIAICRETFKGSVHYAWASVPTYPSGVIGFLLCSTEG  306

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             PPVDF NP+NPI+K     K K  L+FYNSE+H AAF LP+F ++
Sbjct  307   PPVDFLNPINPIEKLEGATKYKRELRFYNSEMHSAAFALPTFLKE  351



>ref|XP_010103219.1| Spermine synthase [Morus notabilis]
 gb|EXB95030.1| Spermine synthase [Morus notabilis]
Length=395

 Score =   367 bits (942),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 234/362 (65%), Gaps = 40/362 (11%)
 Frame = +2

Query  155   NGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSEFSQ--------------  292
             +G AS  NG+             +A E        +  GWFSE                 
Sbjct  16    DGKASSGNGSKKAIPSCCLKARASAPELEAKCHSTVVSGWFSESKSPSDKATKSVYFNNP  75

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGEA SLK+E +LFKGKS++Q++++FES+ YGKVL LDG +Q TE     Y EMI HL
Sbjct  76    MWPGEAHSLKVENILFKGKSEFQEILVFESSAYGKVLVLDGIVQLTEKDECAYQEMIAHL  135

Query  473   PLGSIPNPKKV-LIVGGGIGFT-------------------------LMEVSRYPTIEKI  574
             PL SIP+PK   + + G   F+                         L E+SR+ +IE I
Sbjct  136   PLCSIPSPKSFFMTLHGSFCFSFDTRLKKPTKFMVQVLVVGGGDGGVLREISRHSSIEHI  195

Query  575   DIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIG  754
             DI EIDKMV+DVS++FFP LA GFEDPRV LHI D   F+    +G YDAIIVDSSDP+G
Sbjct  196   DICEIDKMVIDVSKKFFPQLAVGFEDPRVHLHIDDAIKFLRHVPEGKYDAIIVDSSDPVG  255

Query  755   PAKELFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTV  934
             PA+EL E+PFFE + +ALR GGVVC  AES+WLH HLI+ +++ CR+ FKGSV+YAW +V
Sbjct  256   PAQELVEKPFFETIARALRPGGVVCNMAESMWLHTHLIQDMMSICRETFKGSVHYAWASV  315

Query  935   PTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFA  1114
             PTYPSGVIG+++CSTEGPPVDFKNPVNPI+K    VK K  LKFYNS++H AAF LP+F 
Sbjct  316   PTYPSGVIGFLICSTEGPPVDFKNPVNPIEKVEGAVKHKRELKFYNSDVHSAAFALPTFL  375

Query  1115  QK  1120
             ++
Sbjct  376   KR  377



>emb|CDY49457.1| BnaA10g06470D [Brassica napus]
Length=361

 Score =   365 bits (938),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 238/346 (69%), Gaps = 16/346 (5%)
 Frame = +2

Query  128   NGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSE--------  283
              G       +G AS+ NG                 E        +  GWFSE        
Sbjct  7     KGLACQKTMDGNASNGNGVEKTVPSCCLKAMSCLPEEDAKCHSTVVSGWFSEPPHLRSGK  66

Query  284   -------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGG  442
                     + MWPGEA SLK+EK+LFK KSDYQ+V++FESATYGKVL LDG +Q TE   
Sbjct  67    RGKAVYFNNPMWPGEAHSLKVEKVLFKDKSDYQEVLVFESATYGKVLVLDGILQLTEKDE  126

Query  443   FPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQF  622
             F Y EMI HLPL S P+PK VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DVS++F
Sbjct  127   FAYQEMIAHLPLCSTPSPKNVLVVGGGDGGVLREISRHSSVEVIDICEIDKMVIDVSKKF  186

Query  623   FPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGK  802
             FP LA GFEDPRV LHIGD   F+  + +G YDAIIVDSSDP+GPA+ L E+PFFE + +
Sbjct  187   FPELAVGFEDPRVQLHIGDAVEFLQQSPEGKYDAIIVDSSDPVGPAQALVEKPFFETLAR  246

Query  803   ALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTE  982
             AL+ GGV+C  AES+WLH HLI+ +I+ CRQ FK +V+YAW++VPTYPSGVIG++LCST+
Sbjct  247   ALKPGGVLCNMAESMWLHTHLIEDMISVCRQTFK-TVHYAWSSVPTYPSGVIGFILCSTD  305

Query  983   GPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             GP VDFKNP+NPI+K    +  K  +KFYNS++H+AAF LP+F ++
Sbjct  306   GPAVDFKNPINPIEKLDGAMTYKREMKFYNSDMHRAAFALPTFLRR  351



>ref|XP_004150312.1| PREDICTED: spermine synthase-like [Cucumis sativus]
 ref|XP_004171735.1| PREDICTED: spermine synthase-like [Cucumis sativus]
 gb|KGN58277.1| hypothetical protein Csa_3G604620 [Cucumis sativus]
Length=368

 Score =   366 bits (939),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 227/301 (75%), Gaps = 16/301 (5%)
 Frame = +2

Query  269   GWFSEFSQ--------------MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWFSEF                MWPGEA +L++E +LFKGKS+YQ+VM+FESA+YGKVL 
Sbjct  54    GWFSEFQSGSDKACKKLYFNNPMWPGEAHALEVENILFKGKSEYQEVMVFESASYGKVLV  113

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q TE     Y EMI HLPL SIP+PK VL+VGGG G  L E+SR+ ++E IDI E
Sbjct  114   LDGIVQLTEKDECAYQEMIAHLPLCSIPSPKSVLVVGGGDGGVLREISRHDSVEHIDICE  173

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             ID+MV+DVS++ FP LA GFEDPRV LH+GD   F+   ++G YDAIIVDSSDP+GPA+E
Sbjct  174   IDQMVIDVSKKCFPQLAVGFEDPRVHLHVGDAVEFLRNGKQGKYDAIIVDSSDPVGPAQE  233

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E PFF  + +ALR GGV+C  AES+WLH HLI+ +I+ CRQ FK  V+YAWT+VPTYP
Sbjct  234   LVEMPFFRMIAQALRPGGVLCNMAESMWLHTHLIQDMISICRQTFK-DVHYAWTSVPTYP  292

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             SGVIG++LCSTEGP VDF NPVNPI+ +  H KSK  LKFYNSE+H AAF LPSF ++ +
Sbjct  293   SGVIGFLLCSTEGPKVDFSNPVNPIE-NVGHPKSKRELKFYNSEMHSAAFALPSFLKREV  351

Query  1127  E  1129
             +
Sbjct  352   Q  352



>ref|XP_006350697.1| PREDICTED: spermidine synthase 2-like [Solanum tuberosum]
Length=281

 Score =   362 bits (930),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 204/255 (80%), Gaps = 0/255 (0%)
 Frame = +2

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGW+S+ S MWPGE  S KIEK+LFKGKS YQD+M+F+S+TYGK++ LD  IQHTE    
Sbjct  18    PGWYSDVSSMWPGEMISHKIEKMLFKGKSKYQDIMVFQSSTYGKIIVLDEIIQHTERDEC  77

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EM+VHLPL SIPNPKKVLI+GGG+GFTL EV RY ++EK+D+VEID+MV+DVSR++ 
Sbjct  78    AYVEMVVHLPLASIPNPKKVLIIGGGMGFTLREVLRYSSVEKVDLVEIDEMVIDVSRKYL  137

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P +A G+EDPR TL+I DG AFV     G YD IIVDSSDP+GP++  FE+PFFEAV KA
Sbjct  138   PEIAKGYEDPRATLYIEDGNAFVKNTAPGTYDVIIVDSSDPVGPSQFFFEKPFFEAVSKA  197

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGV  TQ ES WL + +IK+++  C + FKGSVNYAWT VP++PSG IG+++CSTEG
Sbjct  198   LRPGGVYITQGESAWLFLDVIKKLVEDCNKFFKGSVNYAWTNVPSFPSGAIGFVICSTEG  257

Query  986   PPVDFKNPVNPIDKD  1030
             PPVDF NP+N +D D
Sbjct  258   PPVDFINPINKVDVD  272



>ref|XP_008776842.1| PREDICTED: spermine synthase-like isoform X2 [Phoenix dactylifera]
Length=367

 Score =   365 bits (938),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 217/273 (79%), Gaps = 1/273 (0%)
 Frame = +2

Query  269   GWFSEFSQ-MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             G FS ++  MWPGEA SLK+E++L++GKS+YQ++++FES+ YGKVL LDG +Q T+    
Sbjct  68    GNFSYYNNPMWPGEAHSLKVEQVLYQGKSEYQEILVFESSVYGKVLVLDGIVQLTDKDEC  127

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SIP+PK VL++GGG G  L E+SR+ ++E+IDI EID++V+DV ++FF
Sbjct  128   AYQEMIAHLPLCSIPSPKTVLVIGGGDGGVLREISRHSSVERIDICEIDQLVIDVCKKFF  187

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P L+ GFEDPRV LHIGD   F+    +G YDA+IVDSSDPIGPA+EL E+PFFE + +A
Sbjct  188   PDLSVGFEDPRVQLHIGDAVEFLRNVPEGMYDAVIVDSSDPIGPAQELVEKPFFETIARA  247

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             LR GGV+C QAES+WLH HLI+ +++ CR  FKGSV+YAWT+VPTYPSGVIG++LCST+G
Sbjct  248   LRPGGVLCNQAESMWLHTHLIQDMLSICRATFKGSVHYAWTSVPTYPSGVIGFLLCSTDG  307

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIH  1084
             PPV+F NP+NPI+K     K K  ++FYNSE+ 
Sbjct  308   PPVNFLNPINPIEKQEEAFKGKRKIRFYNSEVQ  340



>ref|XP_003602215.1| Spermidine synthase [Medicago truncatula]
 gb|AES72466.1| spermine/spermidine synthase [Medicago truncatula]
Length=358

 Score =   365 bits (937),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 236/335 (70%), Gaps = 14/335 (4%)
 Frame = +2

Query  155   NGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFS------EFSQ--------  292
             +G AS+ NG              +A E   N    +  GWFS      E S+        
Sbjct  16    DGKASNGNGLEKEIPSCCLKAMASAPELEANCHSTVVSGWFSASQTCSEKSEEVLYFNNP  75

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGEA S+K+EK LF+ KS YQ+V++FES TYGKVL LDG +Q TE     Y EMI HL
Sbjct  76    MWPGEAHSIKVEKKLFQEKSLYQEVLVFESLTYGKVLVLDGIVQLTEKDECAYQEMIAHL  135

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SIP+PK VL+VGGG G  L EVSR+ ++E IDI EIDKMV+DVSR+FFP LA GF+D
Sbjct  136   PLCSIPSPKNVLVVGGGDGGVLREVSRHSSVEHIDICEIDKMVIDVSRKFFPELAVGFDD  195

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LH+GD   F+  A +G YDA+IVDSSDP+GPA+EL E+PFFE + KALR GGV+C 
Sbjct  196   PRVHLHVGDAIEFLKRAPEGRYDAVIVDSSDPVGPAQELVEKPFFETISKALRPGGVLCN  255

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
              AES+WLH HLI+ +++ CR+ FKGSV+YAW +VPTYPSGVIG++LCSTEGP VDF NP+
Sbjct  256   MAESMWLHTHLIQDMLSICRETFKGSVHYAWASVPTYPSGVIGFLLCSTEGPHVDFVNPI  315

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQ  1117
             NPI+K     K +  L+FYNSEIH AAF LP+F +
Sbjct  316   NPIEKLEGADKHRRNLRFYNSEIHTAAFALPAFLK  350



>gb|AAL11565.1|AF424571_1 AT5g53120/MFH8_5 [Arabidopsis thaliana]
Length=359

 Score =   365 bits (936),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/345 (55%), Positives = 239/345 (69%), Gaps = 16/345 (5%)
 Frame = +2

Query  131   GGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSE---------  283
             G V  N  +G AS+ NG                 E+       +  GWFSE         
Sbjct  8     GLVCQNTMDGKASNGNGLEKTVPSCCLKAMACVPEDDAKCHSTVVSGWFSEPHPRSGKKG  67

Query  284   ------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
                    + MWPGEA SLK+EK+LFK KSD+Q+V++FESATYGKVL LDG +Q TE    
Sbjct  68    GKAVYFNNPMWPGEAHSLKVEKVLFKDKSDFQEVLVFESATYGKVLVLDGIVQLTEKDEC  127

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SI +PK VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DVS++FF
Sbjct  128   AYQEMIAHLPLCSISSPKNVLVVGGGDGGVLREISRHSSVEVIDICEIDKMVIDVSKKFF  187

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P LA GF+DPRV LHIGD   F+  + +G YDAIIV+SSDP+GPA  L E+PFFE + +A
Sbjct  188   PELAVGFDDPRVQLHIGDAAEFLRKSPEGKYDAIIVNSSDPVGPALALVEKPFFETLARA  247

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             L+ GGV+C  AES+WLH HLI+ +I+ CRQ FK SV+YAW++VPTYPSGVIG++LCSTEG
Sbjct  248   LKPGGVLCNMAESMWLHTHLIEDMISICRQTFK-SVHYAWSSVPTYPSGVIGFVLCSTEG  306

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             P VDFKNP+NPI+K    +  K  LKFYNS++H+AAF LP+F ++
Sbjct  307   PAVDFKNPINPIEKLDGAMTHKRELKFYNSDMHRAAFALPTFLRR  351



>ref|XP_002318386.2| hypothetical protein POPTR_0012s01730g [Populus trichocarpa]
 gb|EEE96606.2| hypothetical protein POPTR_0012s01730g [Populus trichocarpa]
Length=361

 Score =   364 bits (935),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/336 (55%), Positives = 238/336 (71%), Gaps = 14/336 (4%)
 Frame = +2

Query  155   NGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSEFSQ--------------  292
             +G A++ NG+             +A E        +  GWFSE                 
Sbjct  16    DGKANNGNGSEKAIPSCCLKARASAPELDAKCHSTVVSGWFSESHSCAGKTSKKVYFNNP  75

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGEA +L+++++L+KGKS+YQ+V++FES +YGKVL LDG +Q TE     Y EMI HL
Sbjct  76    MWPGEAHTLEVKEVLYKGKSEYQEVLVFESTSYGKVLVLDGIVQLTEKDECAYQEMIAHL  135

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SIP+PK VL+VGGG G  L E+SR+ ++E IDI EID+MV+DVS++FFP LA GFED
Sbjct  136   PLCSIPSPKTVLVVGGGDGGVLREISRHSSVEHIDICEIDQMVIDVSKKFFPQLAVGFED  195

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LH+GD   F+    +G YDAIIVDSSDP+GPA+EL E+PFFE + +ALR GGV+C 
Sbjct  196   PRVRLHVGDAVDFLRSTPEGKYDAIIVDSSDPVGPAQELVEKPFFETIARALRPGGVLCN  255

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
              AES+WLH HLI+ +I+ CR+ FKGSV+YAW +VPTYPSG+IG++LCSTEGPPV+F NPV
Sbjct  256   MAESMWLHTHLIEDMISICRETFKGSVHYAWASVPTYPSGLIGFVLCSTEGPPVEFLNPV  315

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             NPI+K     K K  LK+YNSE+H AAF LP+F +K
Sbjct  316   NPIEKLEGATKYKRELKYYNSEVHSAAFALPTFLKK  351



>gb|EMS58513.1| Spermine synthase [Triticum urartu]
Length=385

 Score =   365 bits (937),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 224/301 (74%), Gaps = 14/301 (5%)
 Frame = +2

Query  269   GWFSEFSQ--------------MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWF+E                 MWPGE  SLK+EK+L++GKS YQ+V++FES TYGKVL 
Sbjct  53    GWFTETRSRCGKASKLQYYNNPMWPGETHSLKVEKILYQGKSPYQEVLIFESLTYGKVLV  112

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q T+     Y EMI HLPL SIP+PKKVL++GGG G  L E++R+ ++E IDI E
Sbjct  113   LDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREIARHGSVESIDICE  172

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             ID++V+DV + FFP L+ GF+DPRV LH+GD   F+  + +G YDAIIVDSSDPIGPA+E
Sbjct  173   IDQLVIDVCKDFFPDLSVGFKDPRVRLHVGDAVEFLRNSPEGTYDAIIVDSSDPIGPAQE  232

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFFE + +ALR GGV+C QAES+WLH HLI+ +++ C + FKGSV+YAW +VPTYP
Sbjct  233   LVEKPFFETIARALRPGGVLCNQAESMWLHTHLIQDMLSICCETFKGSVHYAWASVPTYP  292

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKLL  1126
             SG IG++LC+ EG PV+F  P+NPI+K    + +   ++FYN+E+H+AAF LP+FA++ L
Sbjct  293   SGAIGFLLCAKEGRPVNFLAPINPIEKIEGAMTAGRDIRFYNTEMHRAAFVLPTFAKREL  352

Query  1127  E  1129
             E
Sbjct  353   E  353



>emb|CDO96633.1| spermine synthase [Ipomoea batatas]
Length=367

 Score =   364 bits (934),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 175/275 (64%), Positives = 223/275 (81%), Gaps = 0/275 (0%)
 Frame = +2

Query  296   WPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLP  475
             WPGEA S+K+EK+LFK +S+YQ+V++F+S++YGKVL LDG +Q T+     Y EMI HLP
Sbjct  78    WPGEAHSIKVEKILFKERSEYQEVLVFKSSSYGKVLVLDGIVQLTDKDECAYQEMIAHLP  137

Query  476   LGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDP  655
             L SI +PK VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DVS++FFP LA GFEDP
Sbjct  138   LCSIKSPKNVLVVGGGDGGVLREISRHNSVELIDICEIDKMVIDVSKKFFPELAVGFEDP  197

Query  656   RVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQ  835
             RV LH+GD   F+  A +G YDAIIVDSSDP+GPA+EL E+PFFE + +ALR GGV+C  
Sbjct  198   RVKLHVGDAVEFLRHAPEGKYDAIIVDSSDPVGPAQELVEKPFFETLARALRPGGVLCNM  257

Query  836   AESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVN  1015
             AES+WLH HLI+ IIA CR+ FKGSV+YAWT+VPTYPSGVIG++LCSTEGPPVDF NP+N
Sbjct  258   AESMWLHTHLIQDIIAICRETFKGSVHYAWTSVPTYPSGVIGFVLCSTEGPPVDFLNPIN  317

Query  1016  PIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             PI+K    ++ +  L+FYNSE+H+AAF LPSF ++
Sbjct  318   PIEKLDGALQYRRELRFYNSEVHRAAFALPSFVKR  352



>emb|CBI22532.3| unnamed protein product [Vitis vinifera]
Length=355

 Score =   363 bits (933),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 184/336 (55%), Positives = 235/336 (70%), Gaps = 14/336 (4%)
 Frame = +2

Query  155   NGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSE--------------FSQ  292
             +G AS+  G              +A EN       +  GWFSE               + 
Sbjct  2     DGKASNGKGLKKAIPSCCLKAKASAPENDAKCHSTVVSGWFSEPQSCSDKAGNLMYFNNP  61

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGEA SLK+E +LF+GKS++Q++++FES+ YGKVL LDG +Q +E     Y EMI HL
Sbjct  62    MWPGEAHSLKVENILFQGKSEFQEILVFESSAYGKVLVLDGIVQLSEKDECAYQEMIAHL  121

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SI +PK+VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DV ++FFP L  GFED
Sbjct  122   PLCSIESPKRVLVVGGGDGGVLREISRHSSVELIDICEIDKMVIDVCKKFFPQLYVGFED  181

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LH+GD   F+    +G YDAIIVDSSDP+GPA+EL ERPFFE   +ALR GGV+C 
Sbjct  182   PRVQLHVGDAVEFLRHVPEGKYDAIIVDSSDPVGPAQELVERPFFETTARALRPGGVLCN  241

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
              AES+WLH HLI+ +++ CR+ FKGSV+YAW +VPTYPSGVIG++LCSTEGPPVDF +PV
Sbjct  242   MAESMWLHTHLIQDMLSICRETFKGSVHYAWASVPTYPSGVIGFLLCSTEGPPVDFLHPV  301

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             NPI+K   ++K    L+FYNSEIH AAF LPSF ++
Sbjct  302   NPIEKLEGNLKCGRELRFYNSEIHSAAFALPSFVRR  337



>emb|CDY19678.1| BnaC09g29340D [Brassica napus]
Length=362

 Score =   364 bits (934),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 187/347 (54%), Positives = 236/347 (68%), Gaps = 17/347 (5%)
 Frame = +2

Query  128   NGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSE--------  283
              G       +G AS+  G                 E        +  GWFSE        
Sbjct  7     KGLACQKTMDGNASNGTGVEKTVPSCCLKAMSCLPEEDAKCHSTVVSGWFSEPPHPRSSG  66

Query  284   --------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
                      + MWPGEA SLK+EK+LFK KSDYQ+V++FESATYGKVL LDG +Q TE  
Sbjct  67    KRDKAVYFNNPMWPGEAHSLKVEKVLFKDKSDYQEVLVFESATYGKVLVLDGILQLTEKD  126

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
              F Y EMI HLPL S P+PK VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DVS++
Sbjct  127   EFAYQEMIAHLPLCSTPSPKNVLVVGGGDGGVLREISRHSSVEVIDICEIDKMVIDVSKK  186

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP LA GFEDPRV LHIGD   F+  + +G YDAIIVDSSDP+GPA+ L E+PFFE + 
Sbjct  187   FFPELAVGFEDPRVQLHIGDAVEFLRNSPEGKYDAIIVDSSDPVGPAQALVEKPFFETLA  246

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             +AL+ GGV+C  AES+WLH HLI+ +I+ CRQ FK +V YAW++VPTYPSGVIG++LCST
Sbjct  247   RALKPGGVLCNMAESMWLHTHLIEDMISVCRQTFK-TVQYAWSSVPTYPSGVIGFILCST  305

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             +GP VDFKNP+NPI+K    +  K  +KFYNS++H+AAF LP+F ++
Sbjct  306   DGPAVDFKNPINPIEKLDGAMTYKREMKFYNSDMHRAAFALPTFLRR  352



>ref|XP_006577863.1| PREDICTED: uncharacterized protein LOC100816988 isoform X2 [Glycine 
max]
Length=287

 Score =   361 bits (926),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 174/276 (63%), Positives = 219/276 (79%), Gaps = 0/276 (0%)
 Frame = +2

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGEA S+K+EK+L+K KS+YQ+V++FES+TYGKVL LDG +Q TE     Y EMI HL
Sbjct  1     MWPGEAHSIKVEKILYKEKSEYQEVLVFESSTYGKVLVLDGIVQLTEKDECAYQEMIAHL  60

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SI +PK VL+VGGG G  L EV+R+ ++E IDI EIDKMV+DVSR+FFP LA GFED
Sbjct  61    PLCSIQSPKTVLVVGGGDGGVLREVARHSSVEHIDICEIDKMVIDVSRKFFPQLAIGFED  120

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
              RV LH+GD   F+  A +G YDAIIVDSSDP+GPA+EL E+PFF+ + +ALR GGV+C 
Sbjct  121   SRVHLHVGDAVEFLKSACEGKYDAIIVDSSDPVGPAQELVEKPFFDTIARALRPGGVLCN  180

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
              AES+WLH HLI+ +I+ CR+ FKGSV YAW +VPTYPSGVIG++LC+TEGPPVDF NP+
Sbjct  181   MAESMWLHTHLIQDMISICRETFKGSVCYAWASVPTYPSGVIGFLLCATEGPPVDFVNPI  240

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             NPI+K     + K  L+FYNSE+H AAF LP+F ++
Sbjct  241   NPIEKLEGANEHKRELRFYNSEMHSAAFALPAFLKR  276



>ref|XP_006490517.1| PREDICTED: spermine synthase-like isoform X1 [Citrus sinensis]
 gb|KDO46750.1| hypothetical protein CISIN_1g016578mg [Citrus sinensis]
Length=369

 Score =   364 bits (934),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 187/336 (56%), Positives = 236/336 (70%), Gaps = 14/336 (4%)
 Frame = +2

Query  155   NGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSEFSQ--------------  292
             +G  S+ NG+A            +A E        +  GWFSE                 
Sbjct  16    DGKESNKNGSAGAIPSCCLKARASAPELDAKCHSTVVSGWFSESQSTSDKTGKTMYFNNP  75

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGEA SLK++++LFKGKS+YQ+V++FES  YGKVL LDG +Q TE     Y EMI HL
Sbjct  76    MWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQLTEKDECAYQEMIAHL  135

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SIP+PK VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DVS+++FP LA GFED
Sbjct  136   PLCSIPSPKTVLVVGGGDGGVLREISRHDSVELIDICEIDKMVIDVSKKYFPELAVGFED  195

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LHIGD   F+    +G YDAIIVDSSDP+GPA+EL E+PFF+ + KALR GGV+C 
Sbjct  196   PRVRLHIGDAVEFLRQVPRGKYDAIIVDSSDPVGPAQELVEKPFFDTIAKALRPGGVLCN  255

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
              AES+WLH HLI+ +I+ CR+ FKGSV+YAW +VPTYPSG+IG+++CSTEGP VDF NP+
Sbjct  256   MAESMWLHTHLIEDMISICRETFKGSVHYAWASVPTYPSGIIGFLICSTEGPHVDFVNPI  315

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             NPI+K     K K  L+FYNSEIH AAF LP+F ++
Sbjct  316   NPIEKLEGADKHKRELRFYNSEIHSAAFALPAFLKR  351



>dbj|BAB08415.1| spermidine synthase [Arabidopsis thaliana]
Length=343

 Score =   363 bits (931),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 187/330 (57%), Positives = 235/330 (71%), Gaps = 2/330 (1%)
 Frame = +2

Query  131   GGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSEFSQMWPGEA  310
             G V  N  +G AS+ NG                 E+       +  GWFSE      GEA
Sbjct  8     GLVCQNTMDGKASNGNGLEKTVPSCCLKAMACVPEDDAKCHSTVVSGWFSE-PHPRSGEA  66

Query  311   FSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIP  490
              SLK+EK+LFK KSD+Q+V++FESATYGKVL LDG +Q TE     Y EMI HLPL SI 
Sbjct  67    HSLKVEKVLFKDKSDFQEVLVFESATYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIS  126

Query  491   NPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFEDPRVTLH  670
             +PK VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DVS++FFP LA GF+DPRV LH
Sbjct  127   SPKNVLVVGGGDGGVLREISRHSSVEVIDICEIDKMVIDVSKKFFPELAVGFDDPRVQLH  186

Query  671   IGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCTQAESIW  850
             IGD   F+  + +G YDAIIVDSSDP+GPA  L E+PFFE + +AL+ GGV+C  AES+W
Sbjct  187   IGDAAEFLRKSPEGKYDAIIVDSSDPVGPALALVEKPFFETLARALKPGGVLCNMAESMW  246

Query  851   LHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPVNPIDKD  1030
             LH HLI+ +I+ CRQ FK SV+YAW++VPTYPSGVIG++LCSTEGP VDFKNP+NPI+K 
Sbjct  247   LHTHLIEDMISICRQTFK-SVHYAWSSVPTYPSGVIGFVLCSTEGPAVDFKNPINPIEKL  305

Query  1031  TTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
                +  K  LKFYNS++H+AAF LP+F ++
Sbjct  306   DGAMTHKRELKFYNSDMHRAAFALPTFLRR  335



>ref|XP_010913642.1| PREDICTED: spermine synthase-like isoform X2 [Elaeis guineensis]
Length=365

 Score =   363 bits (933),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 212/264 (80%), Gaps = 0/264 (0%)
 Frame = +2

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGEA SLK+E++L++GKS YQ++++FES+ YGK+L LDG +Q T+     Y EMI HL
Sbjct  77    MWPGEAHSLKVEQILYQGKSVYQEILVFESSVYGKILVLDGIVQLTDKDECAYQEMIAHL  136

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SIP+PK VL++GGG G  L E+SR+ ++E+IDI EID++V+DV ++FFP L+ GFED
Sbjct  137   PLCSIPSPKTVLVIGGGDGGVLREISRHSSVERIDICEIDQLVIDVCKKFFPDLSVGFED  196

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LHIGD   F+  A +G YDA+IVDSSDPIGPA+EL E+PFFE + +ALR GGV+C 
Sbjct  197   PRVQLHIGDAVEFLRNAPEGMYDAVIVDSSDPIGPAQELVEKPFFETIARALRPGGVLCN  256

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
             QAES+WLH HLI+ +++ CR  FKGSV+YAWT+VPTYPSGVIG++LCST+GPPV+F NPV
Sbjct  257   QAESMWLHTHLIQDMLSICRATFKGSVHYAWTSVPTYPSGVIGFLLCSTDGPPVNFLNPV  316

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIH  1084
             NPI+K     K K  ++FYNSE+ 
Sbjct  317   NPIEKQEEAFKGKRKIRFYNSEVQ  340



>ref|XP_002270790.1| PREDICTED: spermine synthase [Vitis vinifera]
 ref|XP_010662567.1| PREDICTED: spermine synthase [Vitis vinifera]
Length=369

 Score =   363 bits (933),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 184/336 (55%), Positives = 235/336 (70%), Gaps = 14/336 (4%)
 Frame = +2

Query  155   NGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSE--------------FSQ  292
             +G AS+  G              +A EN       +  GWFSE               + 
Sbjct  16    DGKASNGKGLKKAIPSCCLKAKASAPENDAKCHSTVVSGWFSEPQSCSDKAGNLMYFNNP  75

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGEA SLK+E +LF+GKS++Q++++FES+ YGKVL LDG +Q +E     Y EMI HL
Sbjct  76    MWPGEAHSLKVENILFQGKSEFQEILVFESSAYGKVLVLDGIVQLSEKDECAYQEMIAHL  135

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SI +PK+VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DV ++FFP L  GFED
Sbjct  136   PLCSIESPKRVLVVGGGDGGVLREISRHSSVELIDICEIDKMVIDVCKKFFPQLYVGFED  195

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LH+GD   F+    +G YDAIIVDSSDP+GPA+EL ERPFFE   +ALR GGV+C 
Sbjct  196   PRVQLHVGDAVEFLRHVPEGKYDAIIVDSSDPVGPAQELVERPFFETTARALRPGGVLCN  255

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
              AES+WLH HLI+ +++ CR+ FKGSV+YAW +VPTYPSGVIG++LCSTEGPPVDF +PV
Sbjct  256   MAESMWLHTHLIQDMLSICRETFKGSVHYAWASVPTYPSGVIGFLLCSTEGPPVDFLHPV  315

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             NPI+K   ++K    L+FYNSEIH AAF LPSF ++
Sbjct  316   NPIEKLEGNLKCGRELRFYNSEIHSAAFALPSFVRR  351



>ref|XP_006438426.1| hypothetical protein CICLE_v10031988mg [Citrus clementina]
 gb|ESR51666.1| hypothetical protein CICLE_v10031988mg [Citrus clementina]
Length=319

 Score =   362 bits (928),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 171/237 (72%), Positives = 198/237 (84%), Gaps = 0/237 (0%)
 Frame = +2

Query  260  IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
            + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  49   VIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLILDGVIQLTERD  108

Query  440  GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
               Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++EKIDI EIDKMVVDVS+Q
Sbjct  109  ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEKIDICEIDKMVVDVSKQ  168

Query  620  FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
            FFP +A GFEDPRVTLHIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFFE+V 
Sbjct  169  FFPDVAVGFEDPRVTLHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQELFEKPFFESVA  228

Query  800  KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYML  970
            KALR GGVV TQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYP   +   L
Sbjct  229  KALRPGGVVSTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPRTFLASCL  285



>ref|XP_007136557.1| hypothetical protein PHAVU_009G054800g [Phaseolus vulgaris]
 gb|ESW08551.1| hypothetical protein PHAVU_009G054800g [Phaseolus vulgaris]
Length=359

 Score =   363 bits (931),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/287 (62%), Positives = 227/287 (79%), Gaps = 2/287 (1%)
 Frame = +2

Query  260   IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
             +KP +F+  + MWPGEA S+K+E++L++ KSDYQ+V++FES+TYGKVL LDG +Q TE  
Sbjct  67    VKPDYFN--NPMWPGEAHSIKVEEILYREKSDYQEVLVFESSTYGKVLVLDGIVQLTEKD  124

Query  440   GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
                Y EMIVHLPL SI +PK VL+VGGG G  L EVSR+ ++E IDI EID+MV+DVSR+
Sbjct  125   ECAYQEMIVHLPLCSIQSPKTVLVVGGGDGGVLREVSRHSSVEHIDICEIDQMVIDVSRK  184

Query  620   FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
             FFP LA GFED RV LH+GD   F+  A +G YDAIIVDSSDP+GPA+EL E+PFF+ + 
Sbjct  185   FFPDLAVGFEDSRVHLHVGDAIEFLKCAPEGRYDAIIVDSSDPVGPAQELVEKPFFDTIA  244

Query  800   KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCST  979
             KALR GGV+C  AES+WLH HLI+ +I+ CR+ FKGSV+YAW +VPTYPSGVIG++LC+T
Sbjct  245   KALRPGGVLCNMAESMWLHTHLIQDMISICRETFKGSVHYAWASVPTYPSGVIGFLLCAT  304

Query  980   EGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             +GPPVDF NP+NPI+K     + K  L+FYNSE+H AAF LP F ++
Sbjct  305   KGPPVDFVNPINPIEKLEGANEHKRELRFYNSEMHSAAFALPGFVKR  351



>ref|XP_002864224.1| hypothetical protein ARALYDRAFT_495379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40483.1| hypothetical protein ARALYDRAFT_495379 [Arabidopsis lyrata subsp. 
lyrata]
Length=359

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 237/346 (68%), Gaps = 16/346 (5%)
 Frame = +2

Query  128   NGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSE--------  283
              G V     +G AS+ NG                 E+       +  GWFSE        
Sbjct  7     KGLVCPKTMDGKASNGNGLEKTVPSCCLKAMACVPEDDAKCHSTVVSGWFSEPQPRSGKR  66

Query  284   -------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGG  442
                     + MWPGEA SLK+EK+LFK  SD+Q+V++FESATYGKVL LDG +Q TE   
Sbjct  67    GGKAVFFNNPMWPGEAHSLKVEKVLFKDNSDFQEVLVFESATYGKVLVLDGIVQLTEKDE  126

Query  443   FPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQF  622
               Y EMI HLPL SI +PK VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DVS++F
Sbjct  127   CAYQEMIAHLPLCSISSPKNVLVVGGGDGGVLREISRHSSVEVIDICEIDKMVIDVSKKF  186

Query  623   FPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGK  802
             FP LA GFEDPRV LHIGD   F+  + +G YDAIIVDSSDP+GPA  L E+PFFE + +
Sbjct  187   FPELAVGFEDPRVQLHIGDAAEFLRKSPEGKYDAIIVDSSDPVGPALALVEKPFFETLAR  246

Query  803   ALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTE  982
             AL+ GG++C  AES+WLH HLI+ +I+ CRQ FK SV+YAW++VPTYPSGVIG++LCSTE
Sbjct  247   ALKPGGILCNMAESMWLHTHLIEDMISICRQTFK-SVHYAWSSVPTYPSGVIGFVLCSTE  305

Query  983   GPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             GP VDFKNP+NPI+K    +  K  LKFYNS++H+AAF LP+F ++
Sbjct  306   GPAVDFKNPINPIEKLEGAMAHKRELKFYNSDMHRAAFALPTFLRR  351



>emb|CAN73402.1| hypothetical protein VITISV_020278 [Vitis vinifera]
Length=369

 Score =   363 bits (931),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/336 (55%), Positives = 234/336 (70%), Gaps = 14/336 (4%)
 Frame = +2

Query  155   NGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSE--------------FSQ  292
             +G AS+  G              +A EN       +  GWFSE               + 
Sbjct  16    DGKASNGKGLKKAIPSCCLKAKASAPENDAKCHSTVVSGWFSEPQSCSDKAGNLMYFNNP  75

Query  293   MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHL  472
             MWPGEA SLK+E +LF+GKS++Q++++FES+ YGKVL LDG +Q +E     Y EMI HL
Sbjct  76    MWPGEAHSLKVENILFQGKSEFQEILVFESSAYGKVLVLDGIVQLSEKDECAYQEMIAHL  135

Query  473   PLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFFPYLAAGFED  652
             PL SI +PK+VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DV ++FFP L  GFED
Sbjct  136   PLCSIESPKRVLVVGGGDGGVLREISRHSSVELIDICEIDKMVIDVCKKFFPQLYVGFED  195

Query  653   PRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKALRAGGVVCT  832
             PRV LH+GD   F+    +G YDAIIVDSSDP+GPA+EL ERPFFE   +ALR GGV+C 
Sbjct  196   PRVQLHVGDAVEFLRHVPEGKYDAIIVDSSDPVGPAQELVERPFFETTARALRPGGVLCN  255

Query  833   QAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEGPPVDFKNPV  1012
              AES+WLH HLI  +++ CR+ FKGSV+YAW +VPTYPSGVIG++LCSTEGPPVDF +PV
Sbjct  256   MAESMWLHTHLIXDMLSICRETFKGSVHYAWASVPTYPSGVIGFLLCSTEGPPVDFLHPV  315

Query  1013  NPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             NPI+K   ++K    L+FYNSEIH AAF LPSF ++
Sbjct  316   NPIEKLEGNLKCGRELRFYNSEIHSAAFALPSFVRR  351



>ref|XP_008393049.1| PREDICTED: spermidine synthase 2-like [Malus domestica]
Length=351

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/286 (61%), Positives = 221/286 (77%), Gaps = 0/286 (0%)
 Frame = +2

Query  266   PGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF  445
             PGWFSE+  +WPG+A  LK+EK+LF+G+S+YQ +M+F+S+ YGKV  LDGA+Q TE   F
Sbjct  46    PGWFSEYCPIWPGQAHFLKVEKILFQGRSEYQSMMVFQSSAYGKVFILDGALQLTEKDEF  105

Query  446   PYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQFF  625
              Y EMI HLPL SIPNP KVL++GGG G  L E+SR+ +++ IDI EID M+VDV +++F
Sbjct  106   AYQEMITHLPLCSIPNPNKVLLIGGGDGGILREISRHSSVQHIDICEIDTMLVDVYKKYF  165

Query  626   PYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGKA  805
             P +A G+EDPRVTLH+ DG AF+    +G YDAIIVD+ DPI P  EL + PFFE V KA
Sbjct  166   PSVAXGYEDPRVTLHVKDGSAFLKSVPEGTYDAIIVDAFDPIRPDHELHKTPFFELVAKA  225

Query  806   LRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTEG  985
             L  GGV+C QAESIW     I+Q++  CR +FKGSV YAWT VP YPSGVIG++LCSTEG
Sbjct  226   LXPGGVMCIQAESIWFRSLDIEQLMVKCRPIFKGSVRYAWTIVPAYPSGVIGFLLCSTEG  285

Query  986   PPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQKL  1123
             P VDF+NPVNPID + ++  +K PLKFYN+E+H AAF LPSFA+K+
Sbjct  286   PLVDFRNPVNPIDPNNSYGVAKEPLKFYNTEVHMAAFCLPSFAKKV  331



>gb|KDO82499.1| hypothetical protein CISIN_1g019187mg [Citrus sinensis]
Length=319

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 196/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  260  IKPGWFSEFSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENG  439
            + PGWFSE S MWPGEA SLK+EK+LF+GKSDYQ+VM+F+S+TYGKVL LDG IQ TE  
Sbjct  49   VIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLILDGVIQLTERD  108

Query  440  GFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQ  619
               Y EMI HLPL SIPNPKKVL++GGG G  L EVSR+ ++EKIDI EIDKMVVDVS+Q
Sbjct  109  ECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEKIDICEIDKMVVDVSKQ  168

Query  620  FFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVG  799
            FFP +A GFEDPRVTLHIGDG AF+    +G YDA+IVDSSDPIGPA+ELFE+PFFE+V 
Sbjct  169  FFPDVAVGFEDPRVTLHIGDGVAFLKAVPEGTYDAVIVDSSDPIGPAQELFEKPFFESVA  228

Query  800  KALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
            KALR GGVV TQAESIWLHMH+I+ I+A+CRQ+FKGSVNYAWTTVPTYP
Sbjct  229  KALRPGGVVSTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYP  277



>ref|XP_002513571.1| spermidine synthase 1, putative [Ricinus communis]
 gb|EEF48974.1| spermidine synthase 1, putative [Ricinus communis]
Length=368

 Score =   362 bits (930),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/298 (60%), Positives = 224/298 (75%), Gaps = 14/298 (5%)
 Frame = +2

Query  269   GWFSEFSQ--------------MWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWFSE                 MWPGEA SL+++ +L+KGKS+YQ++++FES+ YGKVL 
Sbjct  53    GWFSESQSGSGTASKRVYFNNPMWPGEAHSLEVKNILYKGKSEYQEILVFESSAYGKVLV  112

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q TE     Y EMIVHLPL SIP+PK VL+VGGG G  L E+SR+ ++E IDI E
Sbjct  113   LDGIVQLTEKDECAYQEMIVHLPLCSIPSPKSVLVVGGGDGGVLREISRHSSVELIDICE  172

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             IDKMV+DV ++FFP L  GFEDPRV LH+GD   F+  A  G YDAIIVDSSDP+GPA+E
Sbjct  173   IDKMVIDVCKEFFPELYVGFEDPRVRLHVGDAVEFLRLAPVGKYDAIIVDSSDPVGPAQE  232

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFF+ + KALR GGV+C  AES+WLH HLI+ +I+ CR+ FKGSV+YAW +VPTYP
Sbjct  233   LVEKPFFQTIAKALRPGGVLCNMAESMWLHTHLIQDMISICRETFKGSVHYAWASVPTYP  292

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             SGVIG+++CSTEGPPVDF NPVNPI+K     K K  L+FYNSEIH AAF LP+F ++
Sbjct  293   SGVIGFLICSTEGPPVDFLNPVNPIEKLEGADKYKRELRFYNSEIHSAAFALPTFLKR  350



>ref|XP_006280696.1| hypothetical protein CARUB_v10026659mg [Capsella rubella]
 gb|EOA13594.1| hypothetical protein CARUB_v10026659mg [Capsella rubella]
Length=359

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 237/346 (68%), Gaps = 16/346 (5%)
 Frame = +2

Query  128   NGGVVTNHQNGTASHHNGtashhngtanhhngtahENAGNDFGCIKPGWFSE--------  283
              G V     +G AS+ NG                 E        +  GWFSE        
Sbjct  7     KGLVCPKTMDGKASNGNGLEKAVPTCCLKAMACVPEEDAKCHSTVVSGWFSEPHPRSGKR  66

Query  284   -------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLTLDGAIQHTENGG  442
                     + MWPGEA SLK+EK+LFK KSD+Q+V++FESATYGKVL LDG +Q TE   
Sbjct  67    GGKAVYFNNPMWPGEAHSLKVEKVLFKDKSDFQEVLVFESATYGKVLVLDGIVQLTEKDE  126

Query  443   FPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVEIDKMVVDVSRQF  622
               Y EMI HLPL SI +PK VL+VGGG G  L E+SR+ ++E IDI EIDKMV+DVS++F
Sbjct  127   CAYQEMIAHLPLCSISSPKNVLVVGGGDGGVLREISRHSSVEVIDICEIDKMVIDVSKKF  186

Query  623   FPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKELFERPFFEAVGK  802
             FP LA GFEDPRV LHIGD   F+  + +G YDAIIVDSSDP+GPA  L E+PFFE + +
Sbjct  187   FPELAVGFEDPRVQLHIGDAAEFLRKSPEGKYDAIIVDSSDPVGPALALVEKPFFETLAR  246

Query  803   ALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYPSGVIGYMLCSTE  982
             AL+ GG++C  AES+WLH HLI+ +I+ CRQ FK SV+YAW++VPTYPSGVIG++LCST+
Sbjct  247   ALKPGGILCNMAESMWLHTHLIEDMISICRQTFK-SVHYAWSSVPTYPSGVIGFVLCSTD  305

Query  983   GPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             GP VDFKNP+NPI+K    +  K  LKFYNS++H+AAF LP+F ++
Sbjct  306   GPAVDFKNPINPIEKLDGAMTHKRELKFYNSDMHRAAFALPTFLRR  351



>emb|CDY27025.1| BnaA02g10450D [Brassica napus]
Length=354

 Score =   361 bits (927),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 182/298 (61%), Positives = 225/298 (76%), Gaps = 15/298 (5%)
 Frame = +2

Query  269   GWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWFSE               + MWPGEA SLK+EK+LFK KSDYQ+V++FESATYGKVL 
Sbjct  50    GWFSEPHSRSGKKGEAVYFNNPMWPGEAHSLKVEKVLFKDKSDYQEVLVFESATYGKVLV  109

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q TE   F Y EMI HLPL S P+PK VL+VGGG G  L E+SR+ ++E IDI E
Sbjct  110   LDGIVQLTEKDEFAYQEMIAHLPLCSTPSPKNVLVVGGGDGGVLREISRHSSVEVIDICE  169

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             IDKMV+DVS++FFP LA GFEDPRV LHIGD   F+  +  G YDAIIVDSSDP+GPA  
Sbjct  170   IDKMVIDVSKKFFPELAVGFEDPRVQLHIGDAVEFLRKSPAGKYDAIIVDSSDPVGPALA  229

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFFE + +AL+ GGV+C  AES+WLH HLI+ +I+ CRQ FK +V YAW++VPTYP
Sbjct  230   LVEKPFFETLARALKPGGVLCNMAESMWLHTHLIEDMISICRQTFK-NVQYAWSSVPTYP  288

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             SGVIG++LCSTEGP VDFKNP+NPI+K    +  K  +KFYNS++H+AAF LP+F ++
Sbjct  289   SGVIGFVLCSTEGPDVDFKNPINPIEKLDGAMTYKREMKFYNSDMHRAAFALPTFLRR  346



>ref|XP_009127192.1| PREDICTED: spermine synthase [Brassica rapa]
Length=355

 Score =   361 bits (927),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 182/298 (61%), Positives = 225/298 (76%), Gaps = 15/298 (5%)
 Frame = +2

Query  269   GWFSE--------------FSQMWPGEAFSLKIEKLLFKGKSDYQDVMLFESATYGKVLT  406
             GWFSE               + MWPGEA SLK+EK+LFK KSDYQ+V++FESATYGKVL 
Sbjct  51    GWFSEPHSRSGKKGEAVYFNNPMWPGEAHSLKVEKVLFKDKSDYQEVLVFESATYGKVLV  110

Query  407   LDGAIQHTENGGFPYTEMIVHLPLGSIPNPKKVLIVGGGIGFTLMEVSRYPTIEKIDIVE  586
             LDG +Q TE   F Y EMI HLPL S P+PK VL+VGGG G  L E+SR+ ++E IDI E
Sbjct  111   LDGIVQLTEKDEFAYQEMIAHLPLCSTPSPKNVLVVGGGDGGVLREISRHSSVEVIDICE  170

Query  587   IDKMVVDVSRQFFPYLAAGFEDPRVTLHIGDGGAFVMGAEKGYYDAIIVDSSDPIGPAKE  766
             IDKMV+DVS++FFP LA GFEDPRV LHIGD   F+  +  G YDAIIVDSSDP+GPA  
Sbjct  171   IDKMVIDVSKKFFPELAVGFEDPRVQLHIGDAVEFLRKSPAGKYDAIIVDSSDPVGPALA  230

Query  767   LFERPFFEAVGKALRAGGVVCTQAESIWLHMHLIKQIIASCRQVFKGSVNYAWTTVPTYP  946
             L E+PFFE + +AL+ GGV+C  AES+WLH HLI+ +I+ CRQ FK +V YAW++VPTYP
Sbjct  231   LVEKPFFETLARALKPGGVLCNMAESMWLHTHLIEDMISICRQTFK-NVQYAWSSVPTYP  289

Query  947   SGVIGYMLCSTEGPPVDFKNPVNPIDKDTTHVKSKPPLKFYNSEIHKAAFTLPSFAQK  1120
             SGVIG++LCSTEGP VDFKNP+NPI+K    +  K  +KFYNS++H+AAF LP+F ++
Sbjct  290   SGVIGFVLCSTEGPDVDFKNPINPIEKLDGAMTYKREMKFYNSDMHRAAFALPTFLRR  347



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3392847999056