BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84928_g1_i1 len=278 path=[1:0-277]

Length=278
                                                                      Score     E

ref|XP_011070364.1|  PREDICTED: ORM1-like protein 2                     125   5e-34   
gb|EPS68280.1|  hypothetical protein M569_06491                         125   6e-34   
ref|XP_006444803.1|  hypothetical protein CICLE_v100226372mg            121   4e-33   
emb|CDP12207.1|  unnamed protein product                                122   6e-33   
ref|XP_006491313.1|  PREDICTED: uncharacterized protein C119.09c-...    122   6e-33   
gb|EYU45251.1|  hypothetical protein MIMGU_mgv1a015446mg                122   7e-33   
ref|XP_010054988.1|  PREDICTED: ORM1-like protein 3                     122   9e-33   
gb|AFK37242.1|  unknown                                                 122   1e-32   
ref|XP_004510647.1|  PREDICTED: ORM1-like protein 3-like                122   1e-32   
ref|XP_007051495.1|  ORMDL family protein                               121   2e-32   
ref|XP_009617119.1|  PREDICTED: ORM1-like protein 3                     121   2e-32   
ref|NP_001239812.1|  uncharacterized protein LOC100813346               121   2e-32   
ref|XP_004133804.1|  PREDICTED: uncharacterized protein C119.09c-...    120   5e-32   
ref|XP_011101008.1|  PREDICTED: ORM1-like protein 3                     120   6e-32   
ref|XP_007135277.1|  hypothetical protein PHAVU_010G115700g             120   6e-32   
gb|KHG28711.1|  ORM1-like protein 1                                     120   7e-32   
ref|XP_010522906.1|  PREDICTED: ORM1-like protein 2                     120   7e-32   
ref|XP_002266406.1|  PREDICTED: ORM1-like protein 2                     119   9e-32   Vitis vinifera
emb|CDP08650.1|  unnamed protein product                                119   1e-31   
gb|KHF97455.1|  ORM1-like protein 1                                     119   1e-31   
ref|XP_004245473.1|  PREDICTED: ORM1-like protein 3                     119   1e-31   
ref|XP_003528781.1|  PREDICTED: uncharacterized protein C119.09c-...    119   1e-31   
ref|XP_007218539.1|  hypothetical protein PRUPE_ppa012722mg             119   2e-31   
ref|XP_004230001.1|  PREDICTED: ORM1-like protein 3                     119   2e-31   
ref|XP_009760285.1|  PREDICTED: ORM1-like protein 3                     119   2e-31   
ref|XP_009607387.1|  PREDICTED: ORM1-like protein 3                     119   2e-31   
gb|AFK48443.1|  unknown                                                 119   2e-31   
ref|XP_008437865.1|  PREDICTED: ORM1-like protein 3                     118   2e-31   
ref|XP_004306644.1|  PREDICTED: ORM1-like protein 3-like                118   3e-31   
ref|XP_006360724.1|  PREDICTED: uncharacterized protein C119.09c-...    118   3e-31   
ref|XP_009375425.1|  PREDICTED: ORM1-like protein 2                     118   3e-31   
ref|XP_009766034.1|  PREDICTED: ORM1-like protein 2                     118   3e-31   
ref|XP_008353054.1|  PREDICTED: uncharacterized protein C119.09c-...    117   4e-31   
ref|XP_008376160.1|  PREDICTED: ORM1-like protein 2                     118   4e-31   
ref|XP_002523307.1|  ormdl, putative                                    118   4e-31   Ricinus communis
ref|XP_010314513.1|  PREDICTED: uncharacterized protein C119.09c-...    117   4e-31   
ref|XP_009588445.1|  PREDICTED: uncharacterized protein C119.09c-...    117   5e-31   
ref|XP_007039444.1|  ORMDL family protein                               117   5e-31   
ref|XP_010694659.1|  PREDICTED: ORM1-like protein 3                     117   5e-31   
ref|XP_009796481.1|  PREDICTED: ORM1-like protein 2                     117   6e-31   
ref|XP_011094077.1|  PREDICTED: ORM1-like protein 2                     117   7e-31   
ref|XP_002320877.1|  ORMDL family protein                               117   8e-31   Populus trichocarpa [western balsam poplar]
ref|XP_011038573.1|  PREDICTED: ORM1-like protein 3                     117   8e-31   
ref|XP_009334366.1|  PREDICTED: ORM1-like protein 2                     117   9e-31   
ref|XP_010106134.1|  Uncharacterized protein L484_003637                117   9e-31   
gb|AFK39095.1|  unknown                                                 117   1e-30   
ref|XP_006339732.1|  PREDICTED: uncharacterized protein C119.09c-...    117   1e-30   
ref|XP_010544953.1|  PREDICTED: ORM1-like protein 3                     117   1e-30   
ref|XP_002262624.1|  PREDICTED: ORM1-like protein 2                     117   1e-30   Vitis vinifera
gb|EYU32271.1|  hypothetical protein MIMGU_mgv1a015441mg                116   2e-30   
ref|XP_010100706.1|  Uncharacterized protein L484_023475                116   2e-30   
gb|KDP28459.1|  hypothetical protein JCGZ_14230                         115   3e-30   
ref|NP_001238512.1|  uncharacterized protein LOC100527600               115   4e-30   
gb|KHN15857.1|  Hypothetical protein glysoja_013073                     115   4e-30   
ref|XP_010544436.1|  PREDICTED: ORM1-like protein 3 isoform X1          115   5e-30   
ref|XP_010544437.1|  PREDICTED: uncharacterized protein C119.09c-...    114   6e-30   
gb|KFK32957.1|  hypothetical protein AALP_AA6G311700                    115   6e-30   
ref|XP_010055997.1|  PREDICTED: ORM1-like protein 3                     114   7e-30   
ref|XP_009119680.1|  PREDICTED: ORM1-like protein 3                     114   9e-30   
emb|CDY15191.1|  BnaC05g00700D                                          114   1e-29   
gb|KDP25241.1|  hypothetical protein JCGZ_20397                         114   1e-29   
ref|XP_010267515.1|  PREDICTED: ORM1-like protein 3                     113   3e-29   
gb|KHG08344.1|  Uncharacterized protein F383_35910                      113   3e-29   
ref|XP_007135276.1|  hypothetical protein PHAVU_010G115700g             113   3e-29   
gb|EPS66391.1|  hypothetical protein M569_08393                         113   3e-29   
gb|ABK22066.1|  unknown                                                 112   3e-29   Picea sitchensis
ref|XP_006418402.1|  hypothetical protein EUTSA_v10008983mg             113   4e-29   
ref|XP_003572809.1|  PREDICTED: ORM1-like protein 2                     112   4e-29   
ref|XP_010457152.1|  PREDICTED: uncharacterized protein C119.09c-...    111   4e-29   
ref|XP_002302648.1|  ORMDL family protein                               112   5e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011023143.1|  PREDICTED: ORM1-like protein 3                     112   6e-29   
ref|XP_002892079.1|  ORMDL family protein                               112   6e-29   
ref|NP_563622.1|  ORMDL family protein                                  112   6e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933840.1|  PREDICTED: ORM1-like protein 3                     112   6e-29   
ref|XP_010252767.1|  PREDICTED: ORM1-like protein 3                     112   7e-29   
ref|XP_006439265.1|  hypothetical protein CICLE_v10022658mg             110   7e-29   
ref|XP_010474712.1|  PREDICTED: ORM1-like protein 3                     112   8e-29   
ref|XP_010480516.1|  PREDICTED: ORM1-like protein 3 isoform X1          112   8e-29   
ref|XP_006439266.1|  hypothetical protein CICLE_v10022658mg             112   8e-29   
ref|XP_010940864.1|  PREDICTED: ORM1-like protein 3                     112   9e-29   
ref|XP_010919291.1|  PREDICTED: uncharacterized protein C119.09c-...    110   9e-29   
gb|AAF97341.1|AC023628_22  Unknown protein                              112   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008790519.1|  PREDICTED: ORM1-like protein 3                     112   9e-29   
ref|XP_006303379.1|  hypothetical protein CARUB_v10010529mg             112   1e-28   
gb|KFK42508.1|  hypothetical protein AALP_AA1G002900                    112   1e-28   
ref|XP_010934479.1|  PREDICTED: ORM1-like protein 3                     111   1e-28   
ref|XP_009418320.1|  PREDICTED: ORM1-like protein 3                     111   1e-28   
ref|XP_002518881.1|  ormdl, putative                                    110   1e-28   Ricinus communis
gb|EMT22363.1|  hypothetical protein F775_43827                         110   1e-28   
ref|XP_004976521.1|  PREDICTED: ORM1-like protein 3-like                111   1e-28   
ref|XP_003580344.1|  PREDICTED: ORM1-like protein 2                     111   2e-28   
emb|CDY65660.1|  BnaAnng20920D                                          111   2e-28   
ref|XP_006391597.1|  hypothetical protein EUTSA_v10023737mg             111   2e-28   
ref|XP_008806928.1|  PREDICTED: ORM1-like protein 3                     110   2e-28   
gb|EAY87043.1|  hypothetical protein OsI_08441                          110   2e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_006647676.1|  PREDICTED: uncharacterized protein C119.09c-...    110   3e-28   
dbj|BAK03210.1|  predicted protein                                      110   3e-28   
ref|NP_001047715.1|  Os02g0673600                                       110   3e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009418131.1|  PREDICTED: ORM1-like protein 3                     110   4e-28   
ref|XP_009383183.1|  PREDICTED: ORM1-like protein 3                     110   5e-28   
ref|XP_006652652.1|  PREDICTED: ORM1-like protein 3-like                110   5e-28   
ref|XP_010441380.1|  PREDICTED: uncharacterized protein C119.09c-...    108   6e-28   
ref|NP_001154758.1|  ORMDL domain-containing protein                    108   6e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006405287.1|  hypothetical protein EUTSA_v10027975mg             109   6e-28   
ref|NP_199015.1|  ORMDL domain-containing protein                       109   6e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112851.1|  PREDICTED: uncharacterized protein C119.09c-...    109   7e-28   
ref|XP_002870598.1|  ORMDL family protein                               109   7e-28   
emb|CDY61368.1|  BnaA09g53130D                                          109   8e-28   
ref|XP_006846226.1|  hypothetical protein AMTR_s00012p00233130          109   8e-28   
ref|XP_011022440.1|  PREDICTED: ORM1-like protein 1                     109   8e-28   
ref|XP_008676888.1|  PREDICTED: hypothetical protein isoform X1         109   8e-28   
ref|XP_009400445.1|  PREDICTED: ORM1-like protein 3                     109   9e-28   
dbj|BAJ97177.1|  predicted protein                                      109   9e-28   
ref|XP_006857840.1|  hypothetical protein AMTR_s00069p00050010          109   1e-27   
ref|NP_001148597.1|  ORM1-like protein 2                                109   1e-27   Zea mays [maize]
ref|XP_002446948.1|  hypothetical protein SORBIDRAFT_06g025660          109   1e-27   Sorghum bicolor [broomcorn]
ref|XP_004953426.1|  PREDICTED: ORM1-like protein 3-like                108   1e-27   
ref|XP_004300483.1|  PREDICTED: uncharacterized protein C119.09c-...    108   1e-27   
ref|NP_001053587.1|  Os04g0567700                                       108   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001142353.1|  hypothetical protein                               108   1e-27   Zea mays [maize]
emb|CAH66850.1|  OSIGBa0103M18.2                                        108   2e-27   Oryza sativa [red rice]
ref|XP_009125212.1|  PREDICTED: ORM1-like protein 3                     108   2e-27   
emb|CDY13373.1|  BnaC06g13840D                                          108   2e-27   
gb|KHG27773.1|  ORM1-like protein 2                                     108   3e-27   
gb|EMT13427.1|  hypothetical protein F775_30968                         107   3e-27   
ref|XP_002304572.1|  ORMDL family protein                               108   3e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010553574.1|  PREDICTED: ORM1-like protein 2 isoform X2          107   3e-27   
ref|XP_009420786.1|  PREDICTED: ORM1-like protein 2                     107   4e-27   
ref|XP_009358667.1|  PREDICTED: ORM1-like protein 1                     107   4e-27   
ref|XP_010676855.1|  PREDICTED: uncharacterized protein C119.09c-...    107   5e-27   
ref|XP_008390306.1|  PREDICTED: ORM1-like protein 3                     107   6e-27   
ref|XP_011026819.1|  PREDICTED: ORM1-like protein 1                     107   7e-27   
ref|XP_006665130.1|  PREDICTED: ORM1-like protein 3-like                107   8e-27   
ref|NP_001059551.1|  Os07g0452500                                       107   9e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002461937.1|  hypothetical protein SORBIDRAFT_02g010850          107   9e-27   Sorghum bicolor [broomcorn]
emb|CDY37999.1|  BnaCnng08600D                                          107   9e-27   
ref|XP_004956119.1|  PREDICTED: ORM1-like protein 3-like isoform X1     107   9e-27   
ref|NP_001241770.1|  ORMDL family protein                               107   1e-26   
ref|XP_008775080.1|  PREDICTED: ORM1-like protein 3                     106   1e-26   
gb|ACF87007.1|  unknown                                                 105   1e-26   Zea mays [maize]
ref|NP_001148636.1|  LOC100282252                                       106   2e-26   Zea mays [maize]
tpg|DAA39688.1|  TPA: hypothetical protein ZEAMMB73_441359              105   2e-26   
ref|XP_008374090.1|  PREDICTED: ORM1-like protein 1                     105   2e-26   
gb|ABK26973.1|  unknown                                                 105   5e-26   Picea sitchensis
gb|KHG01337.1|  Uncharacterized protein F383_23307                      104   8e-26   
ref|XP_002297957.1|  ORMDL family protein                               103   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_003563172.1|  PREDICTED: ORM1-like protein 3                     104   1e-25   
ref|XP_008803045.1|  PREDICTED: ORM1-like protein 3                     103   2e-25   
ref|XP_007209727.1|  hypothetical protein PRUPE_ppa012781mg             103   2e-25   
ref|XP_009389450.1|  PREDICTED: LOW QUALITY PROTEIN: ORM1-like pr...    103   2e-25   
gb|EMT26151.1|  hypothetical protein F775_18242                         101   3e-25   
gb|ACG38638.1|  ORMDL family protein                                    102   5e-25   Zea mays [maize]
ref|XP_009118800.1|  PREDICTED: ORM1-like protein 2                     102   5e-25   
emb|CDX90018.1|  BnaA10g00640D                                          102   6e-25   
ref|XP_010553573.1|  PREDICTED: ORM1-like protein 2 isoform X1          100   3e-24   
ref|XP_008782518.1|  PREDICTED: ORM1-like protein 2 isoform X3        97.8    3e-23   
ref|XP_008782511.1|  PREDICTED: ORM1-like protein 2 isoform X2        97.8    3e-23   
ref|XP_008782503.1|  PREDICTED: ORM1-like protein 2 isoform X1        98.2    3e-23   
gb|EEE67100.1|  hypothetical protein OsJ_24107                        98.2    3e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001770210.1|  predicted protein                                97.1    8e-23   
ref|XP_010936907.1|  PREDICTED: ORM1-like protein 2                   92.8    2e-21   
ref|XP_009415831.1|  PREDICTED: ORM1-like protein 3                   92.0    5e-21   
gb|AFW72765.1|  hypothetical protein ZEAMMB73_725836                  89.4    1e-20   
ref|NP_001141612.1|  hypothetical protein                             86.3    2e-19   Zea mays [maize]
ref|XP_002963972.1|  hypothetical protein SELMODRAFT_81257            87.8    2e-19   
tpg|DAA39685.1|  TPA: hypothetical protein ZEAMMB73_441359            85.5    4e-19   
ref|XP_008802460.1|  PREDICTED: ORM1-like protein 2                   86.3    7e-19   
gb|EMT29072.1|  hypothetical protein F775_42792                       68.6    5e-13   
ref|XP_002948063.1|  hypothetical protein VOLCADRAFT_73521            65.9    2e-11   
ref|XP_001703235.1|  hypothetical protein CHLREDRAFT_185995           65.1    5e-11   Chlamydomonas reinhardtii
ref|XP_005644615.1|  ORMDL-domain-containing protein                  64.7    8e-11   
ref|XP_005851151.1|  hypothetical protein CHLNCDRAFT_29488            60.5    3e-09   
gb|ABK93306.1|  unknown                                               58.5    8e-09   Populus trichocarpa [western balsam poplar]
gb|KFM25525.1|  Uncharacterized protein F751_0552                     52.4    2e-06   
ref|XP_001730127.1|  hypothetical protein MGL_2509                    50.1    1e-05   Malassezia globosa CBS 7966
ref|XP_004340266.1|  hypothetical protein ACA1_369890                 47.4    9e-05   
emb|CCG82007.1|  ORM1                                                 48.1    1e-04   
ref|XP_007411097.1|  hypothetical protein MELLADRAFT_43806            48.5    1e-04   
ref|XP_005709940.1|  unnamed protein product                          46.6    2e-04   
emb|CBJ29398.1|  conserved unknown protein                            46.6    3e-04   
ref|XP_007861670.1|  Orm1 type endoplasmic reticulum protein          45.8    8e-04   
gb|ESA18892.1|  hypothetical protein GLOINDRAFT_139068                45.1    8e-04   
gb|EKC36467.1|  ORM1-like protein 1                                   45.1    9e-04   
gb|KDR84048.1|  hypothetical protein GALMADRAFT_86882                 45.4    0.001   



>ref|XP_011070364.1| PREDICTED: ORM1-like protein 2 [Sesamum indicum]
Length=157

 Score =   125 bits (314),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYVRA  PTDLNRNTEWFTYPGVW+TYI IL FSWL+V S  GCS GIAWT+VHLSH
Sbjct  1    MANLYVRAVMPTDLNRNTEWFTYPGVWTTYILILFFSWLVVLSVFGCSPGIAWTVVHLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY FFHWKKG
Sbjct  61   FVVTYQFFHWKKG  73



>gb|EPS68280.1| hypothetical protein M569_06491 [Genlisea aurea]
Length=157

 Score =   125 bits (314),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PPTDLN+NTEWFTYPGVW+ YI ILLFSWL+V S  GCS G+AWT+VHL H
Sbjct  1    MANLYVQAVPPTDLNKNTEWFTYPGVWTAYILILLFSWLVVLSVFGCSAGVAWTVVHLFH  60

Query  40   CIVTYYFFHWKKG  2
             ++TY+FFHWKKG
Sbjct  61   SVITYHFFHWKKG  73



>ref|XP_006444803.1| hypothetical protein CICLE_v100226372mg, partial [Citrus clementina]
 gb|ESR58043.1| hypothetical protein CICLE_v100226372mg, partial [Citrus clementina]
Length=113

 Score =   121 bits (304),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  223  LMANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLS  44
            +MANLYV+A PP DLNRNTEWFTYPGVW+TYI IL F+WLIV S  GCS G+AWTIV+L+
Sbjct  1    MMANLYVKATPPADLNRNTEWFTYPGVWTTYILILFFAWLIVLSVFGCSPGMAWTIVNLA  60

Query  43   HCIVTYYFFHWKKG  2
            H ++TY+FFHWKKG
Sbjct  61   HFLITYHFFHWKKG  74



>emb|CDP12207.1| unnamed protein product [Coffea canephora]
Length=157

 Score =   122 bits (307),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PPTDLNRNTEWFTYPGVW+TYI IL FSWL+V S  GCS GIAW++VHLSH
Sbjct  1    MANLYVKAVPPTDLNRNTEWFTYPGVWTTYILILFFSWLMVLSVFGCSPGIAWSVVHLSH  60

Query  40   CIVTYYFFHWKKG  2
             ++TY+ FHWKKG
Sbjct  61   SLITYHCFHWKKG  73



>ref|XP_006491313.1| PREDICTED: uncharacterized protein C119.09c-like [Citrus sinensis]
 gb|KDO86530.1| hypothetical protein CISIN_1g031522mg [Citrus sinensis]
Length=158

 Score =   122 bits (307),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  223  LMANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLS  44
            +MANLYV+A PP DLNRNTEWFTYPGVW+TYI IL F+WLIV S  GCS G+AWTIV+L+
Sbjct  1    MMANLYVKATPPADLNRNTEWFTYPGVWTTYILILFFAWLIVLSVFGCSPGMAWTIVNLA  60

Query  43   HCIVTYYFFHWKKG  2
            H ++TY+FFHWKKG
Sbjct  61   HFLITYHFFHWKKG  74



>gb|EYU45251.1| hypothetical protein MIMGU_mgv1a015446mg [Erythranthe guttata]
Length=157

 Score =   122 bits (306),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A P TDLNRNTEWFTYPGVW+ YI IL+FSWL+  S  GCS G+AWT+VHL+H
Sbjct  1    MANLYVQAVPTTDLNRNTEWFTYPGVWTIYILILMFSWLVFVSVFGCSAGMAWTVVHLAH  60

Query  40   CIVTYYFFHWKKG  2
             IVTY+FFHWKKG
Sbjct  61   SIVTYHFFHWKKG  73



>ref|XP_010054988.1| PREDICTED: ORM1-like protein 3 [Eucalyptus grandis]
 gb|KCW71476.1| hypothetical protein EUGRSUZ_E00036 [Eucalyptus grandis]
Length=157

 Score =   122 bits (306),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWF YPGVW+TYI IL FSWL+V S T CS G+AWT+V+LSH
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSLTACSPGMAWTVVNLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>gb|AFK37242.1| unknown [Medicago truncatula]
 gb|KEH18613.1| ORMDL family protein [Medicago truncatula]
Length=157

 Score =   122 bits (305),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWFTYPGVW+TYI IL FSW++V S  GCS GIAWTIV+L+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWIMVLSVFGCSPGIAWTIVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>ref|XP_004510647.1| PREDICTED: ORM1-like protein 3-like [Cicer arietinum]
Length=157

 Score =   122 bits (305),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWFTYPGVW+TYI IL FSW++V S  GCS GIAWTIV+L+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWILVLSVFGCSPGIAWTIVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>ref|XP_007051495.1| ORMDL family protein [Theobroma cacao]
 gb|EOX95652.1| ORMDL family protein [Theobroma cacao]
Length=160

 Score =   121 bits (303),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWF YPGVW+TYI IL FSWL+V S  GCS G+AWTIV+LSH
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>ref|XP_009617119.1| PREDICTED: ORM1-like protein 3 [Nicotiana tomentosiformis]
Length=157

 Score =   121 bits (303),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV A PPTDLNRNTEWFTYPGVW+TYI IL FSWL+V S  GCS G+AWTIVHLSH
Sbjct  1    MANLYVTAVPPTDLNRNTEWFTYPGVWTTYILILFFSWLVVLSVFGCSPGMAWTIVHLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY  FHWKKG
Sbjct  61   FLVTYQCFHWKKG  73



>ref|NP_001239812.1| uncharacterized protein LOC100813346 [Glycine max]
 gb|ACU17097.1| unknown [Glycine max]
 gb|KHN15914.1| Hypothetical protein glysoja_013130 [Glycine soja]
Length=157

 Score =   121 bits (303),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWFTYPGVW+TYI IL FSW++V S  GCS GIAWTIV+L+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWILVLSVFGCSPGIAWTIVNLAH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+FFHWKKG
Sbjct  61   FAVTYHFFHWKKG  73



>ref|XP_004133804.1| PREDICTED: uncharacterized protein C119.09c-like [Cucumis sativus]
 ref|XP_004155172.1| PREDICTED: uncharacterized protein C119.09c-like [Cucumis sativus]
 gb|KGN56408.1| hypothetical protein Csa_3G119410 [Cucumis sativus]
Length=157

 Score =   120 bits (301),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PPTDLNRNTEWF YPGVW+TYI IL F+WL+V S  GCS G+AWT+V+LSH
Sbjct  1    MANLYVKAVPPTDLNRNTEWFMYPGVWTTYILILFFAWLLVLSVFGCSPGMAWTVVNLSH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+FFHWKKG
Sbjct  61   FAVTYHFFHWKKG  73



>ref|XP_011101008.1| PREDICTED: ORM1-like protein 3 [Sesamum indicum]
Length=157

 Score =   120 bits (300),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A P TDLN+NTEWFTYP  W+TYI IL FSWL+V S  GCS G+AWT+VHLSH
Sbjct  1    MANLYVQATPTTDLNKNTEWFTYPAAWTTYILILFFSWLVVLSVFGCSAGMAWTVVHLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY FFHWKKG
Sbjct  61   FVVTYQFFHWKKG  73



>ref|XP_007135277.1| hypothetical protein PHAVU_010G115700g [Phaseolus vulgaris]
 gb|ESW07271.1| hypothetical protein PHAVU_010G115700g [Phaseolus vulgaris]
Length=157

 Score =   120 bits (300),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWFTYPGVW+TYI IL FSW++V S  GCS GIAWTIV+L H
Sbjct  1    MANLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWILVLSVFGCSPGIAWTIVNLVH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+FFHWKKG
Sbjct  61   FAVTYHFFHWKKG  73



>gb|KHG28711.1| ORM1-like protein 1 [Gossypium arboreum]
Length=157

 Score =   120 bits (300),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWF YPGVW+TYI  LLFSWL+V S  GCS G+AWTIV+L+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILFLLFSWLLVLSIFGCSPGMAWTIVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>ref|XP_010522906.1| PREDICTED: ORM1-like protein 2 [Tarenaya hassleriana]
Length=156

 Score =   120 bits (300),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWF YPGVW+TYI IL F+WLIV S +GCS G+AWT+V+L+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFAWLIVLSVSGCSPGMAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+FFHWKKG
Sbjct  61   FAVTYHFFHWKKG  73



>ref|XP_002266406.1| PREDICTED: ORM1-like protein 2 [Vitis vinifera]
 emb|CAN64101.1| hypothetical protein VITISV_008727 [Vitis vinifera]
 emb|CBI40581.3| unnamed protein product [Vitis vinifera]
Length=157

 Score =   119 bits (299),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWFTYPGVW+TYI IL F+WL+V S  GCS G+AWT+V+L H
Sbjct  1    MANLYVKAEPPADLNRNTEWFTYPGVWTTYILILFFAWLLVLSIFGCSPGMAWTVVNLFH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>emb|CDP08650.1| unnamed protein product [Coffea canephora]
Length=157

 Score =   119 bits (299),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLNRNTEWFTYPGVW+TYI IL FSWL+V S  GC+ G+AWTIV+LSH
Sbjct  1    MAKLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWLLVLSIFGCTPGMAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY FFHWKKG
Sbjct  61   FVVTYQFFHWKKG  73



>gb|KHF97455.1| ORM1-like protein 1 [Gossypium arboreum]
Length=157

 Score =   119 bits (298),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWF YPGVW+TYI IL FSWL+V S  GCS G+AWT+V+L+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFLYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>ref|XP_004245473.1| PREDICTED: ORM1-like protein 3 [Solanum lycopersicum]
 ref|XP_006343801.1| PREDICTED: uncharacterized protein C119.09c-like [Solanum tuberosum]
Length=157

 Score =   119 bits (298),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MAN YV A PPTDLNRNTEWFTYPGVW+TYI IL FSWL+V S  GCS G+AWTIVHLSH
Sbjct  1    MANYYVTAVPPTDLNRNTEWFTYPGVWTTYILILFFSWLVVLSVFGCSPGMAWTIVHLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY  FHWKKG
Sbjct  61   FLVTYQCFHWKKG  73



>ref|XP_003528781.1| PREDICTED: uncharacterized protein C119.09c-like isoform 1 [Glycine 
max]
 gb|KHN06327.1| Hypothetical protein glysoja_021165 [Glycine soja]
Length=157

 Score =   119 bits (298),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLNRNTEWFTYPGVW+TYI IL FSW++V S  GCS GIAWTIV+L+H
Sbjct  1    MAKLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWILVLSVFGCSPGIAWTIVNLAH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+FFHWKKG
Sbjct  61   FAVTYHFFHWKKG  73



>ref|XP_007218539.1| hypothetical protein PRUPE_ppa012722mg [Prunus persica]
 ref|XP_008233110.1| PREDICTED: ORM1-like protein 2 [Prunus mume]
 gb|EMJ19738.1| hypothetical protein PRUPE_ppa012722mg [Prunus persica]
Length=157

 Score =   119 bits (297),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA+LYV+A PP DLNRNTEWF YPGVW+TYI IL FSWL+V S  GCS G+AWTIV+LSH
Sbjct  1    MASLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>ref|XP_004230001.1| PREDICTED: ORM1-like protein 3 [Solanum lycopersicum]
Length=156

 Score =   119 bits (297),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNT+WF YPGVW+TYI IL FSWL++++F GCS G+AWT+V+LSH
Sbjct  1    MANLYVKAVPPADLNRNTDWFMYPGVWTTYILILFFSWLVLTAF-GCSPGMAWTVVNLSH  59

Query  40   CIVTYYFFHWKKG  2
             IVTY+FFHWKKG
Sbjct  60   FIVTYHFFHWKKG  72



>ref|XP_009760285.1| PREDICTED: ORM1-like protein 3 [Nicotiana sylvestris]
Length=157

 Score =   119 bits (297),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNT+WF YPGVW+TYI IL FSWL+V S  GCS GIAWT+V+L H
Sbjct  1    MANLYVKAVPPADLNRNTDWFMYPGVWTTYILILFFSWLLVLSLFGCSPGIAWTVVNLGH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>ref|XP_009607387.1| PREDICTED: ORM1-like protein 3 [Nicotiana tomentosiformis]
Length=157

 Score =   119 bits (297),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNT+WF YPGVW+TYI IL FSWL+V S  GCS GIAWT+V+L H
Sbjct  1    MANLYVKAVPPADLNRNTDWFMYPGVWTTYILILFFSWLLVLSLFGCSPGIAWTVVNLGH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>gb|AFK48443.1| unknown [Lotus japonicus]
Length=157

 Score =   119 bits (297),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWFTYPGVW+TYI IL FSW++V S   CS GIAWTIV+L H
Sbjct  1    MANLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWILVLSVFSCSPGIAWTIVNLVH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>ref|XP_008437865.1| PREDICTED: ORM1-like protein 3 [Cucumis melo]
Length=157

 Score =   118 bits (296),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWF YPGVW+TYI IL F+WL+V S  GCS G+AWT+V+LSH
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFAWLLVLSVFGCSPGMAWTVVNLSH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+FFHWKKG
Sbjct  61   FAVTYHFFHWKKG  73



>ref|XP_004306644.1| PREDICTED: ORM1-like protein 3-like [Fragaria vesca subsp. vesca]
Length=157

 Score =   118 bits (296),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA+LYV+A PP DLNRNTEWF YPGVW+TYI IL FSWL+V S  GCS G+AWTIV+LSH
Sbjct  1    MASLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY FFHWKKG
Sbjct  61   FLVTYQFFHWKKG  73



>ref|XP_006360724.1| PREDICTED: uncharacterized protein C119.09c-like [Solanum tuberosum]
Length=157

 Score =   118 bits (296),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYVRA P TDLNRNTEWFTYPGVW+ YIFILLFSWL+V S  G S G+AWTIV+L+H
Sbjct  1    MANLYVRAAPTTDLNRNTEWFTYPGVWTIYIFILLFSWLVVMSVFGSSSGMAWTIVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHWKKG
Sbjct  61   FLVTYHCFHWKKG  73



>ref|XP_009375425.1| PREDICTED: ORM1-like protein 2 [Pyrus x bretschneideri]
Length=158

 Score =   118 bits (295),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA+LYV+A PP DLNRNTEWF YPGVW+TYI IL FSWL+V S  GCS G+AWTIV+LSH
Sbjct  1    MASLYVKAAPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_009766034.1| PREDICTED: ORM1-like protein 2 [Nicotiana sylvestris]
Length=157

 Score =   118 bits (295),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV A P TDLNRNTEWFTYPGVW+TYI IL FSWL+V S  GCS G+AWTIVHLSH
Sbjct  1    MANLYVTAVPTTDLNRNTEWFTYPGVWTTYILILFFSWLVVLSVFGCSPGMAWTIVHLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY  FHWKKG
Sbjct  61   FLVTYQCFHWKKG  73



>ref|XP_008353054.1| PREDICTED: uncharacterized protein C119.09c-like [Malus domestica]
Length=112

 Score =   117 bits (292),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA+LYV+A PP DLNRNTEWF YPGVW+TYI IL FSWL+V S  GCS G+AWTIV+LSH
Sbjct  1    MASLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_008376160.1| PREDICTED: ORM1-like protein 2 [Malus domestica]
Length=157

 Score =   118 bits (295),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA+LYV+A PP DLNRNTEWF YPGVW+TYI IL FSWL+V S  GCS G+AWTIV+LSH
Sbjct  1    MASLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+FFHWKKG
Sbjct  61   FAVTYHFFHWKKG  73



>ref|XP_002523307.1| ormdl, putative [Ricinus communis]
 gb|EEF39023.1| ormdl, putative [Ricinus communis]
Length=157

 Score =   118 bits (295),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWF YPGVW+TYI IL FSWL+V S  GCS G+AWTIV+L+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSVFGCSPGMAWTIVNLAH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FCITYHFFHWKKG  73



>ref|XP_010314513.1| PREDICTED: uncharacterized protein C119.09c-like [Solanum lycopersicum]
Length=157

 Score =   117 bits (294),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYVRA P TDLNRNTEWFTYPGVW+ YIFILLFSWL+V S  G S G+AWTIV+L+H
Sbjct  1    MANLYVRAAPTTDLNRNTEWFTYPGVWTIYIFILLFSWLVVLSVFGSSSGMAWTIVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHWKKG
Sbjct  61   FLVTYHCFHWKKG  73



>ref|XP_009588445.1| PREDICTED: uncharacterized protein C119.09c-like [Nicotiana tomentosiformis]
Length=157

 Score =   117 bits (294),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MAN YVRA P TDLNRNTEWFTYPGVW+ YIFIL FSW+ V S  G S GIAWTIV+LSH
Sbjct  1    MANYYVRAAPTTDLNRNTEWFTYPGVWTIYIFILFFSWMAVLSVFGVSPGIAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>ref|XP_007039444.1| ORMDL family protein [Theobroma cacao]
 gb|EOY23945.1| ORMDL family protein [Theobroma cacao]
Length=154

 Score =   117 bits (294),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA PPTDLNRNTEWFTYPGVW+TYI IL FSWLIV S  G S G AWTIVHLSH  V
Sbjct  1    MYVRAVPPTDLNRNTEWFTYPGVWTTYILILFFSWLIVLSLFGSSPGTAWTIVHLSHFFV  60

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  61   TYHFFHWKKG  70



>ref|XP_010694659.1| PREDICTED: ORM1-like protein 3 [Beta vulgaris subsp. vulgaris]
Length=157

 Score =   117 bits (294),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWFTYPGVW+TYI  L F+WL+V S +GC+ G+AWTIV+L H
Sbjct  1    MANLYVKASPPPDLNRNTEWFTYPGVWTTYILFLFFAWLLVLSVSGCTPGMAWTIVNLGH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+FFHWKKG
Sbjct  61   FAVTYHFFHWKKG  73



>ref|XP_009796481.1| PREDICTED: ORM1-like protein 2 [Nicotiana sylvestris]
Length=157

 Score =   117 bits (294),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MAN YVRA P TDLNRNTEWFTYPGVW+ YIFIL FSW+ V S  G S G+AWTIV+LSH
Sbjct  1    MANYYVRAAPTTDLNRNTEWFTYPGVWTIYIFILFFSWMAVLSVLGVSPGVAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>ref|XP_011094077.1| PREDICTED: ORM1-like protein 2 [Sesamum indicum]
Length=158

 Score =   117 bits (293),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  223  LMANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLS  44
            +M  LYV+  PP DLNRNTEWFTYPGVW+TYI IL FSWLIV S T C+ G+AWTI++LS
Sbjct  1    MMGKLYVKMDPPADLNRNTEWFTYPGVWTTYILILFFSWLIVLSLTNCTPGMAWTILNLS  60

Query  43   HCIVTYYFFHWKKG  2
            H  VTY+FFHWKKG
Sbjct  61   HFAVTYHFFHWKKG  74



>ref|XP_002320877.1| ORMDL family protein [Populus trichocarpa]
 gb|ABK92655.1| unknown [Populus trichocarpa]
 gb|ABK96618.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE99192.1| ORMDL family protein [Populus trichocarpa]
Length=157

 Score =   117 bits (293),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV A PP DLNRNTEWF YPGVW+TYI IL FSWLIV S   CS G+AWTIV+LSH
Sbjct  1    MANLYVTAVPPADLNRNTEWFMYPGVWTTYILILFFSWLIVLSIFACSPGMAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_011038573.1| PREDICTED: ORM1-like protein 3 [Populus euphratica]
Length=157

 Score =   117 bits (293),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV A PP DLNRNTEWF YPGVW+TYI IL FSWLIV S   CS G+AWTIV+LSH
Sbjct  1    MANLYVTAVPPADLNRNTEWFMYPGVWTTYILILFFSWLIVLSIFACSPGMAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_009334366.1| PREDICTED: ORM1-like protein 2 [Pyrus x bretschneideri]
Length=157

 Score =   117 bits (292),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLNRNTEWF YPGVW+TYI IL FSWL+V S  GCS G+AWTIV+LSH
Sbjct  1    MAGLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_010106134.1| Uncharacterized protein L484_003637 [Morus notabilis]
 gb|EXC07928.1| Uncharacterized protein L484_003637 [Morus notabilis]
Length=154

 Score =   117 bits (292),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV+A P TDLNRNTEWFTYPGVW+TYI IL FSWLIV S  GCS G+AWTIVHL+H +V
Sbjct  1    MYVKAVPTTDLNRNTEWFTYPGVWTTYILILFFSWLIVLSLFGCSSGMAWTIVHLAHFLV  60

Query  31   TYYFFHWKKG  2
            TY FFHWKKG
Sbjct  61   TYQFFHWKKG  70



>gb|AFK39095.1| unknown [Lotus japonicus]
Length=157

 Score =   117 bits (292),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWFT+PGVW+TYI IL FSW++V S   CS GIAWTIV+L H
Sbjct  1    MANLYVKAVPPADLNRNTEWFTHPGVWTTYILILFFSWILVLSVFSCSPGIAWTIVNLVH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>ref|XP_006339732.1| PREDICTED: uncharacterized protein C119.09c-like [Solanum tuberosum]
Length=156

 Score =   117 bits (292),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            M NLYV+A PP DLNRNT+WF YPGVW+TYI IL FSWL++++F GCS G+AWT+V+LSH
Sbjct  1    MPNLYVKAVPPADLNRNTDWFMYPGVWTTYILILFFSWLVLTAF-GCSPGMAWTVVNLSH  59

Query  40   CIVTYYFFHWKKG  2
             IVTY+FFHWKKG
Sbjct  60   FIVTYHFFHWKKG  72



>ref|XP_010544953.1| PREDICTED: ORM1-like protein 3 [Tarenaya hassleriana]
 ref|XP_010544961.1| PREDICTED: ORM1-like protein 3 [Tarenaya hassleriana]
 ref|XP_010544969.1| PREDICTED: ORM1-like protein 3 [Tarenaya hassleriana]
 ref|XP_010544977.1| PREDICTED: ORM1-like protein 3 [Tarenaya hassleriana]
 ref|XP_010544985.1| PREDICTED: ORM1-like protein 3 [Tarenaya hassleriana]
Length=155

 Score =   117 bits (292),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA PPTD+NRNTEWFTYPGVW+TYI IL FSWLIV S  GCS G+AWTIVHL+H +V
Sbjct  2    MYVRAVPPTDVNRNTEWFTYPGVWTTYILILFFSWLIVLSVFGCSPGMAWTIVHLAHFVV  61

Query  31   TYYFFHWKKG  2
            TY+ FHW+KG
Sbjct  62   TYHSFHWRKG  71



>ref|XP_002262624.1| PREDICTED: ORM1-like protein 2 [Vitis vinifera]
 emb|CAN68846.1| hypothetical protein VITISV_024149 [Vitis vinifera]
 emb|CBI34558.3| unnamed protein product [Vitis vinifera]
Length=157

 Score =   117 bits (292),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PPTDLNRNTEWFTYPGVW+TYI IL FSWL+V S   CS G AWTI+HLSH
Sbjct  1    MAKLYVQALPPTDLNRNTEWFTYPGVWTTYILILFFSWLLVLSLLRCSSGAAWTILHLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHWKKG
Sbjct  61   FLVTYHCFHWKKG  73



>gb|EYU32271.1| hypothetical protein MIMGU_mgv1a015441mg [Erythranthe guttata]
Length=157

 Score =   116 bits (291),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            M  LYV+  PP DLNRNTEWFTYPGVW+TYI IL F+WLIV S T C+ G+AWTIV+LSH
Sbjct  1    MGKLYVKMVPPADLNRNTEWFTYPGVWTTYILILFFAWLIVLSVTNCTPGMAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FLVTYHFFHWKKG  73



>ref|XP_010100706.1| Uncharacterized protein L484_023475 [Morus notabilis]
 gb|EXB83868.1| Uncharacterized protein L484_023475 [Morus notabilis]
Length=157

 Score =   116 bits (290),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWF YPGVW+TYI IL FSWL+V S   CS G+AWT+V+L+H
Sbjct  1    MANLYVQAFPPADLNRNTEWFMYPGVWTTYILILFFSWLVVLSVFACSPGMAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+FFHWKKG
Sbjct  61   FAVTYHFFHWKKG  73



>gb|KDP28459.1| hypothetical protein JCGZ_14230 [Jatropha curcas]
Length=157

 Score =   115 bits (289),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWF YPGVW+TYI IL F WL+V S  GCS G+AWTIV+L+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFCWLLVLSIFGCSPGMAWTIVNLAH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FCITYHFFHWKKG  73



>ref|NP_001238512.1| uncharacterized protein LOC100527600 [Glycine max]
 gb|ACU16714.1| unknown [Glycine max]
Length=157

 Score =   115 bits (288),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLNRNT+WFTYPGVW++YI IL FSW++V S  GCS GIAWTIV+L+H
Sbjct  1    MAKLYVKAVPPVDLNRNTDWFTYPGVWTSYILILFFSWILVLSVFGCSPGIAWTIVNLAH  60

Query  40   CIVTYYFFHWKKG  2
              VTY FFHWKKG
Sbjct  61   FAVTYDFFHWKKG  73



>gb|KHN15857.1| Hypothetical protein glysoja_013073 [Glycine soja]
Length=157

 Score =   115 bits (288),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLNRNT+WFTYPGVW++YI IL FSW++V S  GCS GIAWTIV+L+H
Sbjct  1    MAKLYVKAVPPADLNRNTDWFTYPGVWTSYILILFFSWILVLSVFGCSPGIAWTIVNLAH  60

Query  40   CIVTYYFFHWKKG  2
              VTY FFHWKKG
Sbjct  61   FAVTYDFFHWKKG  73



>ref|XP_010544436.1| PREDICTED: ORM1-like protein 3 isoform X1 [Tarenaya hassleriana]
Length=157

 Score =   115 bits (287),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWF YPGVW+TYI IL F+WLI  S  GCS G+AWT+V+LSH
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFAWLIFLSVFGCSPGMAWTVVNLSH  60

Query  40   CIVTYYFFHWKKG  2
              V Y+FFHWKKG
Sbjct  61   FAVIYHFFHWKKG  73



>ref|XP_010544437.1| PREDICTED: uncharacterized protein C119.09c-like isoform X2 [Tarenaya 
hassleriana]
Length=147

 Score =   114 bits (286),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWF YPGVW+TYI IL F+WLI  S  GCS G+AWT+V+LSH
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFAWLIFLSVFGCSPGMAWTVVNLSH  60

Query  40   CIVTYYFFHWKKG  2
              V Y+FFHWKKG
Sbjct  61   FAVIYHFFHWKKG  73



>gb|KFK32957.1| hypothetical protein AALP_AA6G311700 [Arabis alpina]
Length=155

 Score =   115 bits (287),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA P TD+NRNTEWFTYPGVW+TYI IL FSWLIV S   CS G+AWTIVHLSH  V
Sbjct  2    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLIVLSIFNCSSGMAWTIVHLSHFSV  61

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  62   TYHFFHWKKG  71



>ref|XP_010055997.1| PREDICTED: ORM1-like protein 3 [Eucalyptus grandis]
 gb|KCW72564.1| hypothetical protein EUGRSUZ_E01032 [Eucalyptus grandis]
Length=154

 Score =   114 bits (286),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV+A PPTDLNRNTEWFTYPGVW+TYI IL  SWLIV S   CS G+AWTIV+LSH +V
Sbjct  1    MYVKAVPPTDLNRNTEWFTYPGVWTTYILILFISWLIVLSLFNCSPGMAWTIVNLSHFLV  60

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  61   TYHFFHWKKG  70



>ref|XP_009119680.1| PREDICTED: ORM1-like protein 3 [Brassica rapa]
Length=157

 Score =   114 bits (286),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP D+NRNTEWF YPGVW+TYI IL F WL+V S +GCS G+AWT+V+L+H
Sbjct  1    MANLYVKAAPPPDMNRNTEWFMYPGVWTTYILILFFGWLVVLSLSGCSPGMAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHW KG
Sbjct  61   FVVTYHSFHWMKG  73



>emb|CDY15191.1| BnaC05g00700D [Brassica napus]
Length=157

 Score =   114 bits (285),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP D+NRNTEWF YPGVW+TYI IL F WL+V S +GCS G+AWT+V+L+H
Sbjct  1    MANLYVKAAPPPDMNRNTEWFMYPGVWTTYILILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHW KG
Sbjct  61   FVVTYHSFHWMKG  73



>gb|KDP25241.1| hypothetical protein JCGZ_20397 [Jatropha curcas]
Length=154

 Score =   114 bits (284),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV+A PPTD+NRNTEWFTYPGVW+TYI ++  SWL+V S  GCS G+AWTIVHLSH I+
Sbjct  1    MYVKAEPPTDVNRNTEWFTYPGVWTTYILMVFMSWLLVLSLFGCSPGMAWTIVHLSHFII  60

Query  31   TYYFFHWKKG  2
            TY+FFHW KG
Sbjct  61   TYHFFHWMKG  70



>ref|XP_010267515.1| PREDICTED: ORM1-like protein 3 [Nelumbo nucifera]
Length=157

 Score =   113 bits (282),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            M+ LYV A PPTDLN+NTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWTIV+L H
Sbjct  1    MSKLYVHAAPPTDLNKNTEWFMYPGVWTTYILILFFSWLLVLSLFGCTPGMAWTIVNLCH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+FFHWKKG
Sbjct  61   FAVTYHFFHWKKG  73



>gb|KHG08344.1| Uncharacterized protein F383_35910 [Gossypium arboreum]
Length=154

 Score =   113 bits (282),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA PPTDLN+NTEWFTYPGVW+ YI I+ FSWL+V S  G S GIAWTIVHL+H  V
Sbjct  1    MYVRAVPPTDLNKNTEWFTYPGVWTAYILIVFFSWLMVLSVFGTSPGIAWTIVHLTHFFV  60

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  61   TYHFFHWKKG  70



>ref|XP_007135276.1| hypothetical protein PHAVU_010G115700g [Phaseolus vulgaris]
 gb|ESW07270.1| hypothetical protein PHAVU_010G115700g [Phaseolus vulgaris]
Length=153

 Score =   113 bits (282),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 61/73 (84%), Gaps = 4/73 (5%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP DLNRNTEWFTYPGVW+TYI IL FSW++V S  GCS GIAWTIV+L  
Sbjct  1    MANLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWILVLSVFGCSPGIAWTIVNL--  58

Query  40   CIVTYYFFHWKKG  2
              VTY+FFHWKKG
Sbjct  59   --VTYHFFHWKKG  69



>gb|EPS66391.1| hypothetical protein M569_08393 [Genlisea aurea]
Length=156

 Score =   113 bits (282),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            M  LYV   PP DLNRNTEWFTYPGVW+TYI IL FSWL+V S T C+ G+AWT+V+L H
Sbjct  1    MGKLYVEMVPPQDLNRNTEWFTYPGVWTTYILILFFSWLVVLSITNCTPGMAWTVVNLCH  60

Query  40   CIVTYYFFHWKKG  2
             ++TY+FFHWKKG
Sbjct  61   FMITYHFFHWKKG  73



>gb|ABK22066.1| unknown [Picea sitchensis]
Length=128

 Score =   112 bits (280),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            M NLYV A  P DLN+NT WF YPGVW+ YIFIL FSWL+V S  GC+ G AWTIVHL+H
Sbjct  1    MRNLYVEAVQPVDLNKNTSWFQYPGVWTIYIFILFFSWLVVLSLLGCTAGTAWTIVHLAH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+FFHWKKG
Sbjct  61   FAVTYHFFHWKKG  73



>ref|XP_006418402.1| hypothetical protein EUTSA_v10008983mg [Eutrema salsugineum]
 gb|ESQ36755.1| hypothetical protein EUTSA_v10008983mg [Eutrema salsugineum]
Length=157

 Score =   113 bits (282),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP D+NRNTEWF YPGVW+TYI IL F WL+V S +GCS G+AWT+V+L+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYILILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHW KG
Sbjct  61   FVVTYHCFHWMKG  73



>ref|XP_003572809.1| PREDICTED: ORM1-like protein 2 [Brachypodium distachyon]
Length=157

 Score =   112 bits (281),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLN+NTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWT+V+L H
Sbjct  1    MAKLYVQAVPPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTAGMAWTVVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_010457152.1| PREDICTED: uncharacterized protein C119.09c-like [Camelina sativa]
Length=112

 Score =   111 bits (278),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP D+NRNTEWF YPGVW+TY+ IL F WL+V S +GCS G+AWT+V+L+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHW KG
Sbjct  61   FVVTYHCFHWMKG  73



>ref|XP_002302648.1| ORMDL family protein [Populus trichocarpa]
 gb|EEE81921.1| ORMDL family protein [Populus trichocarpa]
Length=157

 Score =   112 bits (281),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV A P  DLNRNTEWF YPGVW+TYI IL F WLIV +  GCS G+AWTIV+LSH
Sbjct  1    MANLYVTAVPTADLNRNTEWFMYPGVWTTYILILFFFWLIVLAIFGCSPGLAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_011023143.1| PREDICTED: ORM1-like protein 3 [Populus euphratica]
Length=157

 Score =   112 bits (280),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV A P  DLNRNTEWF YPGVW+TYI IL F WL+V S  GCS G+AWTIV+LSH
Sbjct  1    MANLYVTAVPTADLNRNTEWFMYPGVWTTYILILFFFWLLVLSIFGCSPGMAWTIVNLSH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_002892079.1| ORMDL family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68338.1| ORMDL family protein [Arabidopsis lyrata subsp. lyrata]
Length=157

 Score =   112 bits (280),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP D+NRNTEWF YPGVW+TY+ IL F WL+V S +GCS G+AWT+V+L+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHW KG
Sbjct  61   FVVTYHSFHWMKG  73



>ref|NP_563622.1| ORMDL family protein [Arabidopsis thaliana]
 gb|AAK25947.1|AF360237_1 unknown protein [Arabidopsis thaliana]
 gb|AAK64094.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27257.1| ORMDL family protein [Arabidopsis thaliana]
Length=157

 Score =   112 bits (280),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP D+NRNTEWF YPGVW+TY+ IL F WL+V S +GCS G+AWT+V+L+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHW KG
Sbjct  61   FVVTYHSFHWMKG  73



>ref|XP_010933840.1| PREDICTED: ORM1-like protein 3 [Elaeis guineensis]
Length=157

 Score =   112 bits (280),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLN+NTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWTIV+L H
Sbjct  1    MAKLYVQAVPPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTPGMAWTIVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_010252767.1| PREDICTED: ORM1-like protein 3 [Nelumbo nucifera]
Length=157

 Score =   112 bits (280),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            M+ LYV A PP DLN+NTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWTIV+L H
Sbjct  1    MSKLYVHAVPPPDLNKNTEWFMYPGVWTTYILILFFSWLVVLSLFGCTPGMAWTIVNLCH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+FFHWKKG
Sbjct  61   FVVTYHFFHWKKG  73



>ref|XP_006439265.1| hypothetical protein CICLE_v10022658mg [Citrus clementina]
 gb|ESR52505.1| hypothetical protein CICLE_v10022658mg [Citrus clementina]
 gb|KDO76665.1| hypothetical protein CISIN_1g0317191mg [Citrus sinensis]
 gb|KDO76666.1| hypothetical protein CISIN_1g0317191mg, partial [Citrus sinensis]
Length=109

 Score =   110 bits (276),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVR  PPTDLNRNTEWFTYPGVW+TY+ IL  SWL+V S   CS G+AWT+VHLSH  V
Sbjct  1    MYVRTVPPTDLNRNTEWFTYPGVWTTYLSILFISWLLVLSLFNCSSGMAWTLVHLSHFFV  60

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  61   TYHFFHWKKG  70



>ref|XP_010474712.1| PREDICTED: ORM1-like protein 3 [Camelina sativa]
Length=158

 Score =   112 bits (280),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP D+NRNTEWF YPGVW+TY+ IL F WL+V S +GCS G+AWT+V+L+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSISGCSPGMAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHW KG
Sbjct  61   FVVTYHCFHWMKG  73



>ref|XP_010480516.1| PREDICTED: ORM1-like protein 3 isoform X1 [Camelina sativa]
 ref|XP_010480523.1| PREDICTED: ORM1-like protein 3 isoform X2 [Camelina sativa]
Length=158

 Score =   112 bits (279),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP D+NRNTEWF YPGVW+TY+ IL F WL+V S +GCS G+AWT+V+L+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSISGCSPGMAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHW KG
Sbjct  61   FVVTYHCFHWMKG  73



>ref|XP_006439266.1| hypothetical protein CICLE_v10022658mg [Citrus clementina]
 ref|XP_006476322.1| PREDICTED: uncharacterized protein C119.09c-like [Citrus sinensis]
 gb|ESR52506.1| hypothetical protein CICLE_v10022658mg [Citrus clementina]
Length=154

 Score =   112 bits (279),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVR  PPTDLNRNTEWFTYPGVW+TY+ IL  SWL+V S   CS G+AWT+VHLSH  V
Sbjct  1    MYVRTVPPTDLNRNTEWFTYPGVWTTYLSILFISWLLVLSLFNCSSGMAWTLVHLSHFFV  60

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  61   TYHFFHWKKG  70



>ref|XP_010940864.1| PREDICTED: ORM1-like protein 3 [Elaeis guineensis]
Length=157

 Score =   112 bits (279),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+  PP DLN+NTEWF YPGVW+TYI IL FSWL+V S  GCS G+AWT+V+L H
Sbjct  1    MAKLYVQTVPPVDLNKNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTVVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+FFHWKKG
Sbjct  61   FAVTYHFFHWKKG  73



>ref|XP_010919291.1| PREDICTED: uncharacterized protein C119.09c-like [Elaeis guineensis]
Length=112

 Score =   110 bits (276),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLN+NTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWT+V+L H
Sbjct  1    MAKLYVQAVPPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSIFGCTPGMAWTMVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>gb|AAF97341.1|AC023628_22 Unknown protein [Arabidopsis thaliana]
Length=193

 Score =   112 bits (281),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP D+NRNTEWF YPGVW+TY+ IL F WL+V S +GCS G+AWT+V+L+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHW KG
Sbjct  61   FVVTYHSFHWMKG  73



>ref|XP_008790519.1| PREDICTED: ORM1-like protein 3 [Phoenix dactylifera]
Length=157

 Score =   112 bits (279),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLN+NTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWT+V+L H
Sbjct  1    MAKLYVQAVPPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTPGMAWTVVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_006303379.1| hypothetical protein CARUB_v10010529mg [Capsella rubella]
 gb|EOA36277.1| hypothetical protein CARUB_v10010529mg [Capsella rubella]
Length=157

 Score =   112 bits (279),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP D+NRNTEWF YPGVW+TY+ IL F WL+V S +GCS G+AWT+V+L+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHW KG
Sbjct  61   FVVTYHCFHWMKG  73



>gb|KFK42508.1| hypothetical protein AALP_AA1G002900 [Arabis alpina]
Length=157

 Score =   112 bits (279),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP D+NRNTEWF YPGVW+TY+ IL F WL+V S +GCS G+AWT+V+L+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMIILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHW KG
Sbjct  61   FVVTYHCFHWMKG  73



>ref|XP_010934479.1| PREDICTED: ORM1-like protein 3 [Elaeis guineensis]
Length=157

 Score =   111 bits (278),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLN+NTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWT+V+L H
Sbjct  1    MAKLYVQAVPPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTPGMAWTVVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              VTY FFHWKKG
Sbjct  61   FAVTYLFFHWKKG  73



>ref|XP_009418320.1| PREDICTED: ORM1-like protein 3 [Musa acuminata subsp. malaccensis]
Length=155

 Score =   111 bits (278),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV   PP DLN+NTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWT+V+L H
Sbjct  1    MAKLYVHTVPPPDLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTAGMAWTVVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              VTYYFFHWKKG
Sbjct  61   FAVTYYFFHWKKG  73



>ref|XP_002518881.1| ormdl, putative [Ricinus communis]
 gb|EEF43414.1| ormdl, putative [Ricinus communis]
Length=108

 Score =   110 bits (274),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV+A P TD+NRNTEWFTYPGVW+TYI ++  SWLIV S  GCS G+AWTIVHLSH ++
Sbjct  1    MYVKAVPTTDVNRNTEWFTYPGVWTTYILMVFISWLIVLSLFGCSPGMAWTIVHLSHFVI  60

Query  31   TYYFFHWKKG  2
            TY FFHWKKG
Sbjct  61   TYQFFHWKKG  70



>gb|EMT22363.1| hypothetical protein F775_43827 [Aegilops tauschii]
Length=112

 Score =   110 bits (274),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLN+NTEWF YPGVW+TYIFIL  SWL++ S  GC+ G+AWT+V+L H
Sbjct  1    MAKLYVQAVPPPDLNKNTEWFMYPGVWTTYIFILFVSWLLILSIFGCTPGMAWTLVNLGH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_004976521.1| PREDICTED: ORM1-like protein 3-like [Setaria italica]
Length=157

 Score =   111 bits (278),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLNRNTEWF YPGVW+TYI IL FSW++V S  GC+ G AWT+V+L H
Sbjct  1    MAKLYVQAVPPPDLNRNTEWFMYPGVWTTYILILFFSWILVLSVFGCAPGTAWTLVNLGH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_003580344.1| PREDICTED: ORM1-like protein 2 [Brachypodium distachyon]
Length=157

 Score =   111 bits (277),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLN+NTEWF YPGVW+TYIFIL  SWL+V S  GC+ G+AWT+V+L H
Sbjct  1    MAKLYVQAVPPPDLNKNTEWFMYPGVWTTYIFILFVSWLLVLSVFGCTPGMAWTLVNLGH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>emb|CDY65660.1| BnaAnng20920D [Brassica napus]
Length=155

 Score =   111 bits (277),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA P TD+NRNTEWFTYPGVW+TYI IL FSWL+V S   CS G+AWTIVHL+H  V
Sbjct  2    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSIFNCSPGMAWTIVHLAHFAV  61

Query  31   TYYFFHWKKG  2
            TY+ FHWKKG
Sbjct  62   TYHLFHWKKG  71



>ref|XP_006391597.1| hypothetical protein EUTSA_v10023737mg [Eutrema salsugineum]
 gb|ESQ28883.1| hypothetical protein EUTSA_v10023737mg [Eutrema salsugineum]
Length=155

 Score =   111 bits (277),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA P TD+NRNTEWFTYPGVW+TYI IL F WL+V S   CS G+AWTIVHL+H  V
Sbjct  2    MYVRAVPTTDVNRNTEWFTYPGVWTTYILILFFGWLLVLSIFNCSPGMAWTIVHLAHFSV  61

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  62   TYHFFHWKKG  71



>ref|XP_008806928.1| PREDICTED: ORM1-like protein 3 [Phoenix dactylifera]
Length=157

 Score =   110 bits (276),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A  P DLN+NTEWFTYPGVW+TYI IL FSWL+V S  GC+ G+AWTIV+L H
Sbjct  1    MAKLYVQAVQPVDLNKNTEWFTYPGVWTTYILILFFSWLLVLSIFGCTPGMAWTIVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              +TY FFHWKKG
Sbjct  61   FAITYQFFHWKKG  73



>gb|EAY87043.1| hypothetical protein OsI_08441 [Oryza sativa Indica Group]
Length=157

 Score =   110 bits (276),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLNRNTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWT+V+L H
Sbjct  1    MAKLYVQAVPPPDLNRNTEWFMYPGVWTTYICILFFSWLLVLSVFGCTPGMAWTVVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_006647676.1| PREDICTED: uncharacterized protein C119.09c-like [Oryza brachyantha]
Length=157

 Score =   110 bits (276),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLNRNTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWT+V+L H
Sbjct  1    MAKLYVQAVPPPDLNRNTEWFMYPGVWTTYICILFFSWLLVLSVFGCTPGMAWTVVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>dbj|BAK03210.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=157

 Score =   110 bits (276),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLN+NTEWF YPGVW+TYIFIL  SWL++ S  GC+ G+AWT+V+L H
Sbjct  1    MAKLYVQAVPPPDLNKNTEWFMYPGVWTTYIFILFVSWLLILSIFGCTPGMAWTLVNLGH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|NP_001047715.1| Os02g0673600 [Oryza sativa Japonica Group]
 dbj|BAD29457.1| ORMDL family protein-like [Oryza sativa Japonica Group]
 dbj|BAF09629.1| Os02g0673600 [Oryza sativa Japonica Group]
 gb|EAZ24158.1| hypothetical protein OsJ_07903 [Oryza sativa Japonica Group]
Length=157

 Score =   110 bits (276),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLNRNTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWT+V+L H
Sbjct  1    MAKLYVQAVPPPDLNRNTEWFMYPGVWTTYICILFFSWLLVLSVFGCTPGMAWTVVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_009418131.1| PREDICTED: ORM1-like protein 3 [Musa acuminata subsp. malaccensis]
Length=164

 Score =   110 bits (275),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV A PP DLN+NTEWF YPGVW+TYI IL FSWL+V S  GC+ G AWT+V+L H
Sbjct  1    MAKLYVEAVPPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCNPGTAWTVVNLVH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_009383183.1| PREDICTED: ORM1-like protein 3 [Musa acuminata subsp. malaccensis]
Length=155

 Score =   110 bits (274),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+  PP DLN+NTEWF YPGVWSTYI IL FSWL+V S   C+ G+AWT+V+L H
Sbjct  1    MAKLYVQTVPPPDLNKNTEWFMYPGVWSTYILILFFSWLLVLSVFRCTPGMAWTVVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              +TYYFFHWKKG
Sbjct  61   FAITYYFFHWKKG  73



>ref|XP_006652652.1| PREDICTED: ORM1-like protein 3-like [Oryza brachyantha]
Length=157

 Score =   110 bits (274),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A  P DLN+NTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWT+V+L+H
Sbjct  1    MAKLYVQAVQPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTPGMAWTLVNLAH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_010441380.1| PREDICTED: uncharacterized protein C119.09c-like [Camelina sativa]
Length=109

 Score =   108 bits (270),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA P TD+NRNTEWFTYPGVW+TYI IL FSWL+V S   CS GIAWTIVHL+H  V
Sbjct  1    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSVFHCSPGIAWTIVHLAHFTV  60

Query  31   TYYFFHWKKG  2
            TY+ FHWKKG
Sbjct  61   TYHSFHWKKG  70



>ref|NP_001154758.1| ORMDL domain-containing protein [Arabidopsis thaliana]
 gb|AED94753.1| ORMDL domain-containing protein [Arabidopsis thaliana]
Length=109

 Score =   108 bits (270),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA P TD+NRNTEWFTYPGVW+TYI IL FSWL+V S   CS GIAWTIVHL+H  V
Sbjct  1    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSVFHCSPGIAWTIVHLAHFTV  60

Query  31   TYYFFHWKKG  2
            TY+ FHWKKG
Sbjct  61   TYHSFHWKKG  70



>ref|XP_006405287.1| hypothetical protein EUTSA_v10027975mg [Eutrema salsugineum]
 gb|ESQ46740.1| hypothetical protein EUTSA_v10027975mg [Eutrema salsugineum]
Length=154

 Score =   109 bits (273),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA P TD+NRNTEWFTYPGVW+TYI IL FSWL+V S   CS GIAWT+VHL+H  V
Sbjct  1    MYVRAVPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSVFHCSPGIAWTVVHLAHFTV  60

Query  31   TYYFFHWKKG  2
            TY+ FHWKKG
Sbjct  61   TYHSFHWKKG  70



>ref|NP_199015.1| ORMDL domain-containing protein [Arabidopsis thaliana]
 ref|XP_010436149.1| PREDICTED: ORM1-like protein 3 [Camelina sativa]
 dbj|BAB08433.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAS47671.1| At5g42000 [Arabidopsis thaliana]
 dbj|BAD94546.1| putative protein [Arabidopsis thaliana]
 gb|AED94752.1| ORMDL domain-containing protein [Arabidopsis thaliana]
Length=154

 Score =   109 bits (273),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA P TD+NRNTEWFTYPGVW+TYI IL FSWL+V S   CS GIAWTIVHL+H  V
Sbjct  1    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSVFHCSPGIAWTIVHLAHFTV  60

Query  31   TYYFFHWKKG  2
            TY+ FHWKKG
Sbjct  61   TYHSFHWKKG  70



>ref|XP_009112851.1| PREDICTED: uncharacterized protein C119.09c-like [Brassica rapa]
Length=155

 Score =   109 bits (273),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA P TD+NRNTEWFTYPGVW+TYI IL FSWL+V S   CS G+AWTIVHL+H   
Sbjct  2    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSIFNCSPGMAWTIVHLAHFAA  61

Query  31   TYYFFHWKKG  2
            TY+ FHWKKG
Sbjct  62   TYHLFHWKKG  71



>ref|XP_002870598.1| ORMDL family protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006284679.1| hypothetical protein CARUB_v10005937mg [Capsella rubella]
 ref|XP_010446938.1| PREDICTED: ORM1-like protein 3 [Camelina sativa]
 ref|XP_010441381.1| PREDICTED: ORM1-like protein 3 [Camelina sativa]
 gb|EFH46857.1| ORMDL family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EOA17577.1| hypothetical protein CARUB_v10005937mg [Capsella rubella]
Length=154

 Score =   109 bits (273),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA P TD+NRNTEWFTYPGVW+TYI IL FSWL+V S   CS GIAWTIVHL+H  V
Sbjct  1    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSVFHCSPGIAWTIVHLAHFTV  60

Query  31   TYYFFHWKKG  2
            TY+ FHWKKG
Sbjct  61   TYHSFHWKKG  70



>emb|CDY61368.1| BnaA09g53130D [Brassica napus]
Length=154

 Score =   109 bits (273),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA P TD+NRNTEWFTYPGVW+TYI IL FSWL+V S   CS G+AWTIVHL+H   
Sbjct  1    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSIFNCSPGMAWTIVHLAHFAA  60

Query  31   TYYFFHWKKG  2
            TY+ FHWKKG
Sbjct  61   TYHLFHWKKG  70



>ref|XP_006846226.1| hypothetical protein AMTR_s00012p00233130 [Amborella trichopoda]
 gb|ERN07901.1| hypothetical protein AMTR_s00012p00233130 [Amborella trichopoda]
Length=166

 Score =   109 bits (273),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            M NLYV+  PP DLN+NTEWF YPGVW+TYI I+ FSWL+V S  GCS G+AWTIV+L H
Sbjct  11   MGNLYVQTVPPPDLNKNTEWFMYPGVWTTYILIIFFSWLVVLSVFGCSPGMAWTIVNLGH  70

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHWKKG
Sbjct  71   FMVTYHCFHWKKG  83



>ref|XP_011022440.1| PREDICTED: ORM1-like protein 1 [Populus euphratica]
Length=154

 Score =   109 bits (272),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV+A P TD+NRNTEWFTYPGVW+TY+ I+  SWL+V S  GCS G+AWTIVHL H  V
Sbjct  1    MYVKAEPTTDVNRNTEWFTYPGVWTTYMLIVFMSWLLVLSIFGCSPGMAWTIVHLCHFAV  60

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  61   TYHFFHWKKG  70



>ref|XP_008676888.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF80575.1| unknown [Zea mays]
 gb|ACG40463.1| ORM1-like protein 2 [Zea mays]
 gb|AFW63355.1| ORM1-like protein 2 [Zea mays]
Length=157

 Score =   109 bits (272),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLN+NTEWF YPGVW+TYI I+ FSWL+V S  GC+ G AWT+V+L H
Sbjct  1    MAKLYVQAFPPADLNKNTEWFMYPGVWTTYILIVFFSWLLVLSVFGCTPGTAWTVVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_009400445.1| PREDICTED: ORM1-like protein 3 [Musa acuminata subsp. malaccensis]
Length=157

 Score =   109 bits (272),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP D+N+NTEWF YPGVW+TYI IL FSWL+  S  GC+ G AWTIV+L H
Sbjct  1    MAKLYVQAVPPVDMNKNTEWFMYPGVWTTYILILFFSWLVFLSIFGCNPGTAWTIVNLVH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>dbj|BAJ97177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=157

 Score =   109 bits (272),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLN+NTEWF YPG W+TYIFIL  SWL++ S  GC+ G+AWT+V+L H
Sbjct  1    MAKLYVQAVPPPDLNKNTEWFMYPGAWTTYIFILFVSWLLILSIFGCTPGMAWTLVNLGH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_006857840.1| hypothetical protein AMTR_s00069p00050010 [Amborella trichopoda]
 gb|ERN19307.1| hypothetical protein AMTR_s00069p00050010 [Amborella trichopoda]
Length=165

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            M NLYV+A PP DLN+NTEWF YPGVW+ YI IL F+WLIV S  GCS G+AWTIV+LSH
Sbjct  10   MGNLYVQAVPPPDLNKNTEWFMYPGVWTIYILILFFAWLIVLSVFGCSAGMAWTIVNLSH  69

Query  40   CIVTYYFFHWKKG  2
              VTY  FHW+KG
Sbjct  70   FAVTYRCFHWQKG  82



>ref|NP_001148597.1| ORM1-like protein 2 [Zea mays]
 gb|ACG32169.1| ORM1-like protein 2 [Zea mays]
 gb|ACN37001.1| unknown [Zea mays]
 gb|AFW72764.1| ORM1-like protein 2 [Zea mays]
Length=157

 Score =   109 bits (272),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLN+NTEWF YPGVW+TYI I+ FSWL+V S  GC+ G AWT+V+L H
Sbjct  1    MAKLYVQAFPPADLNKNTEWFMYPGVWTTYIIIVFFSWLLVLSVFGCTPGTAWTVVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_002446948.1| hypothetical protein SORBIDRAFT_06g025660 [Sorghum bicolor]
 gb|EES11276.1| hypothetical protein SORBIDRAFT_06g025660 [Sorghum bicolor]
Length=157

 Score =   109 bits (272),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLNRNTEWF YPGVW+TYI IL F W++V S  GC+ G AWT+V+L H
Sbjct  1    MAKLYVQAVPPPDLNRNTEWFMYPGVWTTYILILFFCWILVLSVFGCAPGTAWTLVNLGH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_004953426.1| PREDICTED: ORM1-like protein 3-like [Setaria italica]
Length=157

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+  PP DLN+NTEWF YPGVW+TYI IL FSWL+V S  GC+ G AWT+V+L H
Sbjct  1    MAKLYVQTFPPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTPGTAWTVVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_004300483.1| PREDICTED: uncharacterized protein C119.09c-like [Fragaria vesca 
subsp. vesca]
Length=154

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV A  PTDLNRNTEWFTYPGVW+TYI I+ FSWLIV     CS G+AWT+VHL+H +V
Sbjct  1    MYVTAVRPTDLNRNTEWFTYPGVWTTYILIVFFSWLIVLCLFSCSPGMAWTVVHLAHFLV  60

Query  31   TYYFFHWKKG  2
            TY FFHWKKG
Sbjct  61   TYQFFHWKKG  70



>ref|NP_001053587.1| Os04g0567700 [Oryza sativa Japonica Group]
 emb|CAD41291.2| OSJNBa0005N02.9 [Oryza sativa Japonica Group]
 dbj|BAF15501.1| Os04g0567700 [Oryza sativa Japonica Group]
 gb|EAZ31669.1| hypothetical protein OsJ_15817 [Oryza sativa Japonica Group]
 dbj|BAG89314.1| unnamed protein product [Oryza sativa Japonica Group]
Length=157

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A  P DLN+NTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWT V+L+H
Sbjct  1    MAKLYVQAVQPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTPGMAWTFVNLAH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAMTYHFFHWKKG  73



>ref|NP_001142353.1| hypothetical protein [Zea mays]
 gb|ACF88268.1| unknown [Zea mays]
 gb|AFW63354.1| hypothetical protein ZEAMMB73_030085 [Zea mays]
Length=127

 Score =   108 bits (269),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLN+NTEWF YPGVW+TYI I+ FSWL+V S  GC+ G AWT+V+L H
Sbjct  1    MAKLYVQAFPPADLNKNTEWFMYPGVWTTYILIVFFSWLLVLSVFGCTPGTAWTVVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>emb|CAH66850.1| OSIGBa0103M18.2 [Oryza sativa Indica Group]
 gb|EAY95199.1| hypothetical protein OsI_17019 [Oryza sativa Indica Group]
Length=157

 Score =   108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A  P DLN+NTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWT V+L+H
Sbjct  1    MAKLYVQAVQPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTPGMAWTFVNLAH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAMTYHFFHWKKG  73



>ref|XP_009125212.1| PREDICTED: ORM1-like protein 3 [Brassica rapa]
 emb|CDX67521.1| BnaA07g15610D [Brassica napus]
Length=154

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA P TD+NRNTEWFTYPGVW+TYI IL FSWL+V S   CS G+AWTIVHL+H  V
Sbjct  1    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSVFHCSPGMAWTIVHLAHFTV  60

Query  31   TYYFFHWKKG  2
            TY+ FHWKKG
Sbjct  61   TYHSFHWKKG  70



>emb|CDY13373.1| BnaC06g13840D [Brassica napus]
Length=154

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA P TD+NRNTEWFTYPGVW+TYI IL FSWL+V S   CS G+AWTIVHL+H  V
Sbjct  1    MYVRALPTTDVNRNTEWFTYPGVWTTYIIILFFSWLLVLSVFHCSPGMAWTIVHLAHFTV  60

Query  31   TYYFFHWKKG  2
            TY+ FHWKKG
Sbjct  61   TYHSFHWKKG  70



>gb|KHG27773.1| ORM1-like protein 2 [Gossypium arboreum]
Length=154

 Score =   108 bits (269),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YVRA P TDLN+NTEWFTYPGVW+TYI ++  SWL+V S  G S G AWTIVHL+H  V
Sbjct  1    MYVRAVPTTDLNKNTEWFTYPGVWTTYILMVFISWLLVLSLFGTSAGTAWTIVHLAHFFV  60

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  61   TYHFFHWKKG  70



>gb|EMT13427.1| hypothetical protein F775_30968 [Aegilops tauschii]
Length=113

 Score =   107 bits (266),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLN+NTEWF Y GVW+TYIFIL  SWL++ S  GC+ G+AWT+V+L H
Sbjct  1    MAKLYVQAVPPPDLNKNTEWFMYLGVWTTYIFILFVSWLLILSIFGCTPGMAWTLVNLGH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>ref|XP_002304572.1| ORMDL family protein [Populus trichocarpa]
 gb|EEE79551.1| ORMDL family protein [Populus trichocarpa]
Length=154

 Score =   108 bits (269),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV+A P TD+NRNTEWFTYPGVW+TY+ I+  SWL+V S  GCS G+AWTIVH  H  V
Sbjct  1    MYVKAEPTTDVNRNTEWFTYPGVWTTYMLIVFMSWLLVLSIFGCSPGMAWTIVHFCHFAV  60

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  61   TYHFFHWKKG  70



>ref|XP_010553574.1| PREDICTED: ORM1-like protein 2 isoform X2 [Tarenaya hassleriana]
Length=155

 Score =   107 bits (268),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV   P TD+NRNTEWFTYPGVW+TYI IL FSWLI  S  GCS G+AWTIVHL+H I 
Sbjct  2    VYVSTAPTTDVNRNTEWFTYPGVWTTYISILFFSWLIFLSVFGCSPGMAWTIVHLAHFIA  61

Query  31   TYYFFHWKKG  2
            TY FFHWKKG
Sbjct  62   TYNFFHWKKG  71



>ref|XP_009420786.1| PREDICTED: ORM1-like protein 2 [Musa acuminata subsp. malaccensis]
Length=155

 Score =   107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            M  LYV+  PP DLN+NTEWF YPGVW+TYI IL F WL+V S  GC+ G+AWT V+L H
Sbjct  1    MVKLYVKTVPPPDLNKNTEWFMYPGVWTTYILILFFCWLLVLSVVGCTPGMAWTAVNLLH  60

Query  40   CIVTYYFFHWKKG  2
              VTYYFFHWKKG
Sbjct  61   FAVTYYFFHWKKG  73



>ref|XP_009358667.1| PREDICTED: ORM1-like protein 1 [Pyrus x bretschneideri]
 ref|XP_009359574.1| PREDICTED: ORM1-like protein 1 [Pyrus x bretschneideri]
Length=154

 Score =   107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV A  PTDLNRNTEWFTYPGVW+TYI ++ FSWL V     CS G+AWT+VHLSH +V
Sbjct  1    MYVTAVRPTDLNRNTEWFTYPGVWTTYILMVFFSWLTVLCLFSCSPGMAWTVVHLSHFLV  60

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  61   TYHFFHWKKG  70



>ref|XP_010676855.1| PREDICTED: uncharacterized protein C119.09c-like [Beta vulgaris 
subsp. vulgaris]
Length=159

 Score =   107 bits (268),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV A PP D+N+NTEW TYPGVW+ YIFI+ F+WL+V S  GCS G+AWTIVHLSH  V
Sbjct  6    MYVMAEPPKDVNKNTEWVTYPGVWTIYIFIVFFAWLLVLSLLGCSPGMAWTIVHLSHFFV  65

Query  31   TYYFFHWKKG  2
            TY+ FHWKKG
Sbjct  66   TYHCFHWKKG  75



>ref|XP_008390306.1| PREDICTED: ORM1-like protein 3 [Malus domestica]
Length=154

 Score =   107 bits (267),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV A  PTDLNRNTEWFTYPGVW+TYI ++ FSWL V     CS G+AWT+VHLSH  V
Sbjct  1    MYVTAVRPTDLNRNTEWFTYPGVWTTYILVVFFSWLTVLCLFSCSPGMAWTVVHLSHFFV  60

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  61   TYHFFHWKKG  70



>ref|XP_011026819.1| PREDICTED: ORM1-like protein 1 [Populus euphratica]
Length=154

 Score =   107 bits (266),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV+A P TD+NRNTEWFTYPGVW+TY+ I+  S L+V S  GCS G+AWTIVHL H  V
Sbjct  1    MYVKAEPATDVNRNTEWFTYPGVWTTYMLIVFMSLLLVLSIFGCSAGMAWTIVHLCHFAV  60

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  61   TYHFFHWKKG  70



>ref|XP_006665130.1| PREDICTED: ORM1-like protein 3-like [Oryza brachyantha]
Length=162

 Score =   107 bits (266),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  YVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVT  29
            YV A PP D+N+NTEWF YPGVW+TYI +L F+WL+V S + CS GIAWT+V+L+H  +T
Sbjct  9    YVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSACSPGIAWTVVNLAHFAIT  68

Query  28   YYFFHWKKG  2
            Y+FFHWKKG
Sbjct  69   YHFFHWKKG  77



>ref|NP_001059551.1| Os07g0452500 [Oryza sativa Japonica Group]
 dbj|BAC84413.1| putative ORMDL2 [Oryza sativa Japonica Group]
 dbj|BAF21465.1| Os07g0452500 [Oryza sativa Japonica Group]
 dbj|BAG88161.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93891.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81963.1| hypothetical protein OsI_25857 [Oryza sativa Indica Group]
Length=164

 Score =   107 bits (266),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  YVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVT  29
            YV A PP D+N+NTEWF YPGVW+TYI +L F+WL+V S + CS GIAWT+V+L+H  +T
Sbjct  11   YVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSACSPGIAWTVVNLAHFAIT  70

Query  28   YYFFHWKKG  2
            Y+FFHWKKG
Sbjct  71   YHFFHWKKG  79



>ref|XP_002461937.1| hypothetical protein SORBIDRAFT_02g010850 [Sorghum bicolor]
 gb|EER98458.1| hypothetical protein SORBIDRAFT_02g010850 [Sorghum bicolor]
Length=162

 Score =   107 bits (266),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  YVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVT  29
            YV A PP D+N+NTEWF YPGVW+TYI +L F+WL+V S +GCS G AWT+V+L+H  +T
Sbjct  9    YVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSGCSPGAAWTVVNLAHFAIT  68

Query  28   YYFFHWKKG  2
            Y+FFHWKKG
Sbjct  69   YHFFHWKKG  77



>emb|CDY37999.1| BnaCnng08600D [Brassica napus]
Length=157

 Score =   107 bits (266),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A  P D+NRNTEWF YPGVW+TYI I+ F WL V S +GCS G+AWT+V+LSH
Sbjct  1    MAKLYVKAVAPPDMNRNTEWFMYPGVWTTYILIIFFGWLAVLSVSGCSPGMAWTVVNLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHW KG
Sbjct  61   FLVTYHSFHWMKG  73



>ref|XP_004956119.1| PREDICTED: ORM1-like protein 3-like isoform X1 [Setaria italica]
Length=162

 Score =   107 bits (266),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  YVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVT  29
            YV A PP D+N+NTEWF YPGVW+TYI +L F+WL+V S +GCS G AWT+V+L+H  +T
Sbjct  9    YVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSGCSPGAAWTVVNLAHFAIT  68

Query  28   YYFFHWKKG  2
            Y+FFHWKKG
Sbjct  69   YHFFHWKKG  77



>ref|NP_001241770.1| ORMDL family protein [Zea mays]
 gb|ACG36887.1| ORMDL family protein [Zea mays]
 gb|ACN26605.1| unknown [Zea mays]
 tpg|DAA60487.1| TPA: ORMDL family [Zea mays]
Length=162

 Score =   107 bits (266),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  YVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVT  29
            YV A PP D+N+NTEWF YPGVW+TYI +L F+WL+V S +GCS G AWT+V+L+H  +T
Sbjct  9    YVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSGCSPGAAWTVVNLAHFAIT  68

Query  28   YYFFHWKKG  2
            Y+FFHWKKG
Sbjct  69   YHFFHWKKG  77



>ref|XP_008775080.1| PREDICTED: ORM1-like protein 3 [Phoenix dactylifera]
Length=157

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+  PP DLN+NTEWF YPGVW+TYIFIL FSWL+  S   C+ G+AWT V+L H
Sbjct  1    MAKLYVQTVPPADLNKNTEWFVYPGVWTTYIFILFFSWLLALSVFCCTPGMAWTAVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+FFHWKKG
Sbjct  61   FAVTYHFFHWKKG  73



>gb|ACF87007.1| unknown [Zea mays]
 tpg|DAA39686.1| TPA: hypothetical protein ZEAMMB73_441359 [Zea mays]
Length=117

 Score =   105 bits (261),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  YVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVT  29
            YV A PP D+N+NTEWF YPGVW+TYI +L F+WL+V S +GCS G AWT+V+L+H  +T
Sbjct  9    YVEAVPPVDVNKNTEWFMYPGVWTTYILMLFFAWLLVLSVSGCSPGAAWTVVNLAHFAIT  68

Query  28   YYFFHWKKG  2
            Y+FFHWKKG
Sbjct  69   YHFFHWKKG  77



>ref|NP_001148636.1| LOC100282252 [Zea mays]
 gb|ACF87508.1| unknown [Zea mays]
 gb|ACG24622.1| ORMDL family protein [Zea mays]
 gb|ACG32325.1| ORMDL family protein [Zea mays]
 tpg|DAA39687.1| TPA: ORMDL family protein [Zea mays]
Length=162

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  YVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVT  29
            YV A PP D+N+NTEWF YPGVW+TYI +L F+WL+V S +GCS G AWT+V+L+H  +T
Sbjct  9    YVEAVPPVDVNKNTEWFMYPGVWTTYILMLFFAWLLVLSVSGCSPGAAWTVVNLAHFAIT  68

Query  28   YYFFHWKKG  2
            Y+FFHWKKG
Sbjct  69   YHFFHWKKG  77



>tpg|DAA39688.1| TPA: hypothetical protein ZEAMMB73_441359 [Zea mays]
Length=134

 Score =   105 bits (262),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  YVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVT  29
            YV A PP D+N+NTEWF YPGVW+TYI +L F+WL+V S +GCS G AWT+V+L+H  +T
Sbjct  9    YVEAVPPVDVNKNTEWFMYPGVWTTYILMLFFAWLLVLSVSGCSPGAAWTVVNLAHFAIT  68

Query  28   YYFFHWKKG  2
            Y+FFHWKKG
Sbjct  69   YHFFHWKKG  77



>ref|XP_008374090.1| PREDICTED: ORM1-like protein 1 [Malus domestica]
Length=154

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV A  PTDLNRNTEWFTYPGVW+TY  ++ FSWL V     CS G+AWT+VHLSH +V
Sbjct  1    MYVTAVRPTDLNRNTEWFTYPGVWTTYXLMVFFSWLTVLCLFSCSPGMAWTVVHLSHFLV  60

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  61   TYHFFHWKKG  70



>gb|ABK26973.1| unknown [Picea sitchensis]
Length=171

 Score =   105 bits (262),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 61/83 (73%), Gaps = 4/83 (5%)
 Frame = -2

Query  238  HGGLNL----MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLG  71
             GGL+     + NLYV+A PP DLN+NT WF YPGVW+TYI IL F+W+IV S   C+ G
Sbjct  3    EGGLSFPNIGIGNLYVQAVPPPDLNKNTSWFMYPGVWTTYILILFFTWIIVLSLFRCTAG  62

Query  70   IAWTIVHLSHCIVTYYFFHWKKG  2
             AWTIV+L H  VTY+FFHWKKG
Sbjct  63   TAWTIVNLFHFAVTYHFFHWKKG  85



>gb|KHG01337.1| Uncharacterized protein F383_23307 [Gossypium arboreum]
Length=157

 Score =   104 bits (259),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA+LYV A  P +LNRNT+WF YPGVW+ YI IL F+WL+V S  GCS G+AWTI++LSH
Sbjct  1    MASLYVNAESPVNLNRNTDWFMYPGVWTIYILILFFAWLLVLSIFGCSPGMAWTIINLSH  60

Query  40   CIVTYYFFHWKKG  2
             ++T +FFHWKKG
Sbjct  61   FLITCHFFHWKKG  73



>ref|XP_002297957.1| ORMDL family protein [Populus trichocarpa]
 gb|EEE82762.1| ORMDL family protein [Populus trichocarpa]
Length=154

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV+A P TD+NRNTEWFTYPGVW+ Y+ I+  S L+V S  GCS G+AWTIVHL H  V
Sbjct  1    MYVKAEPATDVNRNTEWFTYPGVWTIYMLIVCMSLLLVLSIFGCSAGMAWTIVHLCHFAV  60

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  61   TYHFFHWKKG  70



>ref|XP_003563172.1| PREDICTED: ORM1-like protein 3 [Brachypodium distachyon]
Length=162

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            +A+ YV A PP D+N+NTEWF YPGVW+TYI +L F+WL+V S + CS G AWT V+L H
Sbjct  5    VASYYVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSACSPGAAWTAVNLGH  64

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  65   FAITYHFFHWKKG  77



>ref|XP_008803045.1| PREDICTED: ORM1-like protein 3 [Phoenix dactylifera]
Length=159

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = -2

Query  220  MANLYVR--APPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHL  47
            MA LYV+   P   DLN+NTEWF YPGVW+TYI IL FSWL+V S  GC+ G+AWT+V+L
Sbjct  1    MAKLYVQTVQPVDVDLNKNTEWFMYPGVWTTYILILFFSWLLVLSIFGCTPGMAWTVVNL  60

Query  46   SHCIVTYYFFHWKKG  2
             H  VTY+FFHWKKG
Sbjct  61   FHFAVTYHFFHWKKG  75



>ref|XP_007209727.1| hypothetical protein PRUPE_ppa012781mg [Prunus persica]
 ref|XP_008239202.1| PREDICTED: ORM1-like protein 1 [Prunus mume]
 gb|EMJ10926.1| hypothetical protein PRUPE_ppa012781mg [Prunus persica]
Length=154

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV A   TDLNRNTEWFTYPGVW+TYI  + FSWL+V     CS G+AWTIVHL H +V
Sbjct  1    MYVTAVRTTDLNRNTEWFTYPGVWTTYILTVFFSWLVVLCLFSCSPGMAWTIVHLCHFLV  60

Query  31   TYYFFHWKKG  2
            TY+FFHWKKG
Sbjct  61   TYHFFHWKKG  70



>ref|XP_009389450.1| PREDICTED: LOW QUALITY PROTEIN: ORM1-like protein 3 [Musa acuminata 
subsp. malaccensis]
Length=157

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+  PP DLN+NTEWF  PGVW+TYI IL FSW++V S   C+ G AWT+V+L H
Sbjct  1    MAKLYVQLVPPADLNKNTEWFMXPGVWTTYILILFFSWILVLSVFSCTPGTAWTVVNLVH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>gb|EMT26151.1| hypothetical protein F775_18242 [Aegilops tauschii]
Length=112

 Score =   101 bits (252),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LY++A PP DLN+NTEWF Y GVW+T+IFIL  SWL++ S  GC+  +AWT+V+L H
Sbjct  1    MAKLYMQAVPPLDLNKNTEWFMYLGVWTTHIFILFVSWLLILSIFGCTPSMAWTLVNLGH  60

Query  40   CIVTYYFFHWKKG  2
              +TY+FFHWKKG
Sbjct  61   FAITYHFFHWKKG  73



>gb|ACG38638.1| ORMDL family protein [Zea mays]
Length=162

 Score =   102 bits (254),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  YVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVT  29
            YV A PP D+N+NTEWF YPGVW+TYI +L F+ L+V S +GCS G AWT+V+L+H  +T
Sbjct  9    YVEAVPPVDVNKNTEWFMYPGVWTTYILMLFFALLLVLSVSGCSPGAAWTVVNLAHFAIT  68

Query  28   YYFFHWKKG  2
            Y+FFHWKKG
Sbjct  69   YHFFHWKKG  77



>ref|XP_009118800.1| PREDICTED: ORM1-like protein 2 [Brassica rapa]
Length=157

 Score =   102 bits (254),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA  YV+A    D+NRNTEWF YPGVW+TYI I+ F WL V S +GCS G+AWT+V+LSH
Sbjct  1    MAKQYVKAVAAPDMNRNTEWFMYPGVWTTYILIIFFGWLAVLSVSGCSPGMAWTVVNLSH  60

Query  40   CIVTYYFFHWKKG  2
             +VTY+ FHW KG
Sbjct  61   FLVTYHSFHWMKG  73



>emb|CDX90018.1| BnaA10g00640D [Brassica napus]
Length=179

 Score =   102 bits (255),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 61/95 (64%), Gaps = 22/95 (23%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MANLYV+A PP D+NRNTEWF YPGVW+TYI IL F WL+V S +GCS G+AWT+V+L+H
Sbjct  1    MANLYVKAAPPPDMNRNTEWFMYPGVWTTYILILFFGWLVVLSLSGCSPGMAWTVVNLAH  60

Query  40   CI----------------------VTYYFFHWKKG  2
             +                      VTY+ FHW KG
Sbjct  61   FVSQQFFEIDRFGSDDKAFDLDQAVTYHSFHWMKG  95



>ref|XP_010553573.1| PREDICTED: ORM1-like protein 2 isoform X1 [Tarenaya hassleriana]
Length=166

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 57/81 (70%), Gaps = 11/81 (14%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            +YV   P TD+NRNTEWFTYPGVW+TYI IL FSWLI  S  GCS G+AWTIVHL+H IV
Sbjct  2    VYVSTAPTTDVNRNTEWFTYPGVWTTYISILFFSWLIFLSVFGCSPGMAWTIVHLAHFIV  61

Query  31   -----------TYYFFHWKKG  2
                       TY FFHWKKG
Sbjct  62   IPLLGFDPFLATYNFFHWKKG  82



>ref|XP_008782518.1| PREDICTED: ORM1-like protein 2 isoform X3 [Phoenix dactylifera]
Length=157

 Score = 97.8 bits (242),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            M  LYV APPP  LNRNTEW  YPGVW+ Y+ ++ F+W+ V S   CS G+AWT+V+L+H
Sbjct  1    MLKLYVEAPPPPVLNRNTEWVMYPGVWTAYVLLIFFAWIAVLSLLRCSPGVAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+ FHW+KG
Sbjct  61   FFVTYHCFHWRKG  73



>ref|XP_008782511.1| PREDICTED: ORM1-like protein 2 isoform X2 [Phoenix dactylifera]
Length=158

 Score = 97.8 bits (242),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            M  LYV APPP  LNRNTEW  YPGVW+ Y+ ++ F+W+ V S   CS G+AWT+V+L+H
Sbjct  1    MLKLYVEAPPPPVLNRNTEWVMYPGVWTAYVLLIFFAWIAVLSLLRCSPGVAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+ FHW+KG
Sbjct  61   FFVTYHCFHWRKG  73



>ref|XP_008782503.1| PREDICTED: ORM1-like protein 2 isoform X1 [Phoenix dactylifera]
Length=166

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            M  LYV APPP  LNRNTEW  YPGVW+ Y+ ++ F+W+ V S   CS G+AWT+V+L+H
Sbjct  1    MLKLYVEAPPPPVLNRNTEWVMYPGVWTAYVLLIFFAWIAVLSLLRCSPGVAWTVVNLAH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+ FHW+KG
Sbjct  61   FFVTYHCFHWRKG  73



>gb|EEE67100.1| hypothetical protein OsJ_24107 [Oryza sativa Japonica Group]
Length=179

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 15/84 (18%)
 Frame = -2

Query  208  YVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH----  41
            YV A PP D+N+NTEWF YPGVW+TYI +L F+WL+V S + CS GIAWT+V+L+H    
Sbjct  11   YVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSACSPGIAWTVVNLAHFAVE  70

Query  40   -----------CIVTYYFFHWKKG  2
                         +TY+FFHWKKG
Sbjct  71   LKSNYAFSLKQLAITYHFFHWKKG  94



>ref|XP_001770210.1| predicted protein [Physcomitrella patens]
 gb|EDQ64885.1| predicted protein [Physcomitrella patens]
Length=179

 Score = 97.1 bits (240),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  217  ANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHC  38
              LYV+  PP D N+NT WF YPG+W+TYI I+LFSWL + S   C  G AWT+V+L H 
Sbjct  22   GGLYVKVVPPPDTNKNTSWFQYPGIWTTYILIILFSWLAIVSAFRCDAGTAWTVVNLVHF  81

Query  37   IVTYYFFHWKKG  2
             VTY FFHWKKG
Sbjct  82   AVTYRFFHWKKG  93



>ref|XP_010936907.1| PREDICTED: ORM1-like protein 2 [Elaeis guineensis]
Length=157

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            M  LY  A PP  LNRNTEW  YPGVW+ Y+ ++ F+W+ + S   CS G+AWT+V+L+H
Sbjct  1    MPKLYAEAAPPPVLNRNTEWVMYPGVWTAYVLLIFFAWIAILSLLRCSPGVAWTVVNLTH  60

Query  40   CIVTYYFFHWKKG  2
              VTY+ FHW+KG
Sbjct  61   FFVTYHCFHWRKG  73



>ref|XP_009415831.1| PREDICTED: ORM1-like protein 3 [Musa acuminata subsp. malaccensis]
Length=155

 Score = 92.0 bits (227),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LY +  PP D+N+NTEWF YPGVW+ Y+ ILL SWL+V S  GC+ G+AWT+V+L H
Sbjct  1    MAKLYAQTAPPMDMNKNTEWFLYPGVWTIYVLILLLSWLLVFSVFGCTPGMAWTLVNLFH  60

Query  40   CIVTYYFFHWKKG  2
              VTYYFFHWKKG
Sbjct  61   FAVTYYFFHWKKG  73



>gb|AFW72765.1| hypothetical protein ZEAMMB73_725836 [Zea mays]
Length=89

 Score = 89.4 bits (220),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
            MA LYV+A PP DLN+NTEWF YPGVW+TYI I+ FSWL+V S  GC+ G AWT+V+L H
Sbjct  1    MAKLYVQAFPPADLNKNTEWFMYPGVWTTYIIIVFFSWLLVLSVFGCTPGTAWTVVNLFH  60

Query  40   CIVTYYF  20
              VT  F
Sbjct  61   FAVTASF  67



>ref|NP_001141612.1| hypothetical protein [Zea mays]
 gb|ACF86717.1| unknown [Zea mays]
 tpg|DAA60486.1| TPA: hypothetical protein ZEAMMB73_239638 [Zea mays]
Length=95

 Score = 86.3 bits (212),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -2

Query  208  YVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVT  29
            YV A PP D+N+NTEWF YPGVW+TYI +L F+WL+V S +GCS G AWT+V+L+H  V+
Sbjct  9    YVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSGCSPGAAWTVVNLAHFAVS  68



>ref|XP_002963972.1| hypothetical protein SELMODRAFT_81257 [Selaginella moellendorffii]
 ref|XP_002967948.1| hypothetical protein SELMODRAFT_145077 [Selaginella moellendorffii]
 gb|EFJ31295.1| hypothetical protein SELMODRAFT_145077 [Selaginella moellendorffii]
 gb|EFJ34305.1| hypothetical protein SELMODRAFT_81257 [Selaginella moellendorffii]
Length=156

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  LYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIV  32
            ++V+   P DLN+NTEWF YPG+W+TYI I+  SWL+V S  GCS+G AWTIV+L H  V
Sbjct  1    MFVKVGHPADLNKNTEWFQYPGIWTTYILIIFLSWLLVLSLLGCSVGTAWTIVNLVHFGV  60

Query  31   TYYFFHWKKG  2
            TY FFHWKKG
Sbjct  61   TYNFFHWKKG  70



>tpg|DAA39685.1| TPA: hypothetical protein ZEAMMB73_441359 [Zea mays]
Length=95

 Score = 85.5 bits (210),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -2

Query  208  YVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVT  29
            YV A PP D+N+NTEWF YPGVW+TYI +L F+WL+V S +GCS G AWT+V+L+H  V+
Sbjct  9    YVEAVPPVDVNKNTEWFMYPGVWTTYILMLFFAWLLVLSVSGCSPGAAWTVVNLAHFAVS  68



>ref|XP_008802460.1| PREDICTED: ORM1-like protein 2 [Phoenix dactylifera]
Length=158

 Score = 86.3 bits (212),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = -2

Query  220  MANLYVRAPPPTD-LNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLS  44
            M  LY  A      LNRNTEW  YPGVW+TYI ++ F+W+ V S   CS G+AWTIV+L+
Sbjct  1    MPKLYAEAAGAAPVLNRNTEWVVYPGVWTTYILLIFFAWIAVLSLLRCSPGVAWTIVNLA  60

Query  43   HCIVTYYFFHWKKG  2
            H  VTY+ FHW+KG
Sbjct  61   HFFVTYHCFHWRKG  74



>gb|EMT29072.1| hypothetical protein F775_42792 [Aegilops tauschii]
Length=52

 Score = 68.6 bits (166),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIA  65
            MA LYV+A PP DLN+N EWF Y GVW+T+IFIL  SWL++ S   C+ G+A
Sbjct  1    MAKLYVQAVPPPDLNKNIEWFMYLGVWTTHIFILFVSWLLILSIFSCTPGMA  52



>ref|XP_002948063.1| hypothetical protein VOLCADRAFT_73521 [Volvox carteri f. nagariensis]
 gb|EFJ51051.1| hypothetical protein VOLCADRAFT_73521 [Volvox carteri f. nagariensis]
Length=153

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = -2

Query  202  RAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYY  23
            R     D+N+NT W  YP VW+ Y+ +++  WL +S+    + G+AWT VHL H + TYY
Sbjct  5    RTVSEVDVNKNTNWLNYPSVWTWYLAVIVLGWLGISALIDDA-GLAWTYVHLIHGVATYY  63

Query  22   FFHWKKG  2
              HW KG
Sbjct  64   LLHWIKG  70



>ref|XP_001703235.1| hypothetical protein CHLREDRAFT_185995 [Chlamydomonas reinhardtii]
 gb|EDO96531.1| predicted protein [Chlamydomonas reinhardtii]
Length=153

 Score = 65.1 bits (157),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = -2

Query  202  RAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYY  23
            R     D+N+NT W  YP VW+ Y+ +++  WL +S+    + G+AWT VH+ H ++TYY
Sbjct  5    RTVSEVDVNKNTNWLNYPSVWTWYLALIVLGWLGISALIDDA-GLAWTYVHIIHGVLTYY  63

Query  22   FFHWKKG  2
              HW KG
Sbjct  64   LLHWLKG  70



>ref|XP_005644615.1| ORMDL-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20071.1| ORMDL-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=170

 Score = 64.7 bits (156),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = -2

Query  202  RAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYY  23
            RA  P   N+N EW + P  W+  + ++   WLI+S F     G+AWT VHL H ++TYY
Sbjct  23   RASQPVTTNKNVEWLSAPEAWTFIVALICLGWLILSLFMDS--GLAWTYVHLLHGVITYY  80

Query  22   FFHWKKG  2
              HW KG
Sbjct  81   LLHWNKG  87



>ref|XP_005851151.1| hypothetical protein CHLNCDRAFT_29488 [Chlorella variabilis]
 gb|EFN59049.1| hypothetical protein CHLNCDRAFT_29488 [Chlorella variabilis]
Length=163

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = -2

Query  178  NRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYYFFHWKKG  2
            N+NTEW      W  YI +++  WL+++S+T    G+AWT VHL H  +TY+  HW KG
Sbjct  24   NKNTEWLNQKAAWCFYIILIVLCWLVLASWT--DPGMAWTYVHLGHGAITYFLLHWNKG  80



>gb|ABK93306.1| unknown [Populus trichocarpa]
Length=127

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  130  IFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYYFFHWKKG  2
            + I+  SWL+V S  GCS G+AWTIVH  H  VTY+FFHWKKG
Sbjct  1    MLIVFMSWLLVLSIFGCSPGMAWTIVHFCHFAVTYHFFHWKKG  43



>gb|KFM25525.1| Uncharacterized protein F751_0552 [Auxenochlorella protothecoides]
Length=157

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 5/73 (7%)
 Frame = -2

Query  220  MANLYVRAPPPTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSH  41
             A L ++A   ++ N+NT W   P  W  Y+ +LL SWL+VSSFT    GIAWT VH++H
Sbjct  7    QAGLGIKA---SEANKNTNWLDSPAAWVYYVALLLLSWLLVSSFTDP--GIAWTYVHIAH  61

Query  40   CIVTYYFFHWKKG  2
             ++TY  FHW KG
Sbjct  62   GVLTYIIFHWVKG  74



>ref|XP_001730127.1| hypothetical protein MGL_2509 [Malassezia globosa CBS 7966]
 gb|EDP42913.1| hypothetical protein MGL_2509 [Malassezia globosa CBS 7966]
Length=181

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  178  NRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYYFFHWKKG  2
            N N EW    G W  ++ +++ + LI++   G S  + WTIV++ + +V+Y  FH+ KG
Sbjct  20   NVNAEWVNMKGAWVIHVVLIVLAKLIINEVPGISDAMKWTIVNMGYMLVSYCIFHYVKG  78



>ref|XP_004340266.1| hypothetical protein ACA1_369890 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR18246.1| hypothetical protein ACA1_369890 [Acanthamoeba castellanii str. 
Neff]
Length=155

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  DLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYYFFHWKK  5
            + NRN  WF   G W  Y+ +++   + ++   G S   AWTI +L H + T+  FHW K
Sbjct  9    EENRNVTWFDSKGAWVAYLSLIIGFRIFLTFVPGISPSTAWTITNLVHALGTWMAFHWSK  68

Query  4    G  2
            G
Sbjct  69   G  69



>emb|CCG82007.1| ORM1 [Taphrina deformans PYCC 5710]
Length=204

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -2

Query  178  NRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYYFFHWKKG  2
            N N++W    G WS +I ++L + +  ++  G S  + WT+ +LS+   ++  FHW KG
Sbjct  54   NHNSDWVQSKGAWSIHIILILLAKIFYNTLPGVSKELGWTLTNLSYLAGSFLMFHWVKG  112



>ref|XP_007411097.1| hypothetical protein MELLADRAFT_43806 [Melampsora larici-populina 
98AG31]
 gb|EGG05608.1| hypothetical protein MELLADRAFT_43806 [Melampsora larici-populina 
98AG31]
Length=309

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -2

Query  178  NRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYYFFHWKKG  2
            N N +W  Y G W  +I ++ F  ++V    G +  ++WT V++++ +VTY  FH+  G
Sbjct  102  NLNADWVEYKGAWVIHIVLIFFGKILVDIIPGITQDVSWTTVNIAYDVVTYIMFHYVTG  160



>ref|XP_005709940.1| unnamed protein product [Chondrus crispus]
 emb|CDF39646.1| unnamed protein product [Chondrus crispus]
Length=156

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (54%), Gaps = 2/63 (3%)
 Frame = -2

Query  190  PTDLNRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYYFFHW  11
            P D+    EW   P  W+ Y+ I+     ++  + G     AWT V+++H ++T+Y FHW
Sbjct  9    PDDVG--VEWLNAPAAWAFYLGIVATVRFLIGLYPGLRDFQAWTFVNVTHAVITFYIFHW  66

Query  10   KKG  2
             KG
Sbjct  67   VKG  69



>emb|CBJ29398.1| conserved unknown protein [Ectocarpus siliculosus]
Length=185

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  178  NRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYYFFHWKKG  2
            N+NTEW      W  Y+  +   W +V      S+  + T+V++ H ++T+YFFHW KG
Sbjct  34   NKNTEWMQNSYTWVMYVLFIATIWGVVHMTQIFSVAKSTTMVNVVHGLITFYFFHWTKG  92



>ref|XP_007861670.1| Orm1 type endoplasmic reticulum protein [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ59194.1| Orm1 type endoplasmic reticulum protein [Gloeophyllum trabeum 
ATCC 11539]
Length=237

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -2

Query  178  NRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYYFFHWKKG  2
            N N EW    G W  +  +++   +++ +  G +  ++WT+ +L + I++Y+ FHW+ G
Sbjct  55   NVNAEWVNRKGAWLIHPVLIVAGKILIDTLPGMNQQVSWTLTNLLYIILSYFIFHWQTG  113



>gb|ESA18892.1| hypothetical protein GLOINDRAFT_139068 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX73440.1| Orm1p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX73441.1| Orm1p [Rhizophagus irregularis DAOM 197198w]
Length=171

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  178  NRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYYFFHWKKG  2
            N N+ W  Y G W  +I +++   +++SS  G S   +WT+ +LS+ + ++  FHW KG
Sbjct  27   NLNSNWVYYKGAWLVHIILIICVKILLSSVPGVSSETSWTLTNLSYMLGSFVMFHWVKG  85



>gb|EKC36467.1| ORM1-like protein 1 [Crassostrea gigas]
Length=168

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  GVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYYFFHWKKG  2
            G+W TY+ ILL +  ++ +    S+ +AWT+ ++ HC++TY+  H  KG
Sbjct  36   GIWITYVLILLITHFMLLTIPFFSVAVAWTLTNVVHCVITYFMLHVTKG  84



>gb|KDR84048.1| hypothetical protein GALMADRAFT_86882 [Galerina marginata CBS 
339.88]
Length=214

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  178  NRNTEWFTYPGVWSTYIFILLFSWLIVSSFTGCSLGIAWTIVHLSHCIVTYYFFHWKKG  2
            N N +W    G W  ++ +++   +IV +  G +  I+WT+V+L +  ++Y  FHW  G
Sbjct  54   NINADWVNAKGAWLIHVVLIILGKIIVDTIPGMTQQISWTLVNLLYLALSYLMFHWVTG  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514597271520