BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84912_g1_i1 len=1397 path=[1375:0-1396]

Length=1397
                                                                      Score     E

ref|XP_009761466.1|  PREDICTED: peroxidase 10-like                      506   8e-175   
ref|XP_009625722.1|  PREDICTED: peroxidase 10-like                      506   8e-175   
emb|CDO97144.1|  unnamed protein product                                484   2e-166   
ref|XP_006346525.1|  PREDICTED: peroxidase 10-like                      479   3e-164   
ref|XP_011088753.1|  PREDICTED: peroxidase 10                           474   2e-162   
ref|XP_004238604.1|  PREDICTED: peroxidase 10-like                      475   3e-162   
ref|XP_004230797.1|  PREDICTED: peroxidase 10                           474   3e-162   
ref|XP_002521844.1|  Peroxidase 10 precursor, putative                  471   8e-161   Ricinus communis
ref|XP_006342215.1|  PREDICTED: peroxidase 10-like                      469   4e-160   
ref|XP_007042356.1|  Peroxidase superfamily protein                     466   6e-159   
ref|XP_007200388.1|  hypothetical protein PRUPE_ppa008433mg             459   3e-156   
ref|XP_008236638.1|  PREDICTED: peroxidase 10                           457   1e-155   
ref|XP_006384450.1|  hypothetical protein POPTR_0004s15200g             448   6e-152   
gb|AHL39134.1|  class III peroxidase                                    447   1e-151   
ref|XP_010107984.1|  Peroxidase 10                                      446   2e-151   
gb|KDP38237.1|  hypothetical protein JCGZ_04880                         444   4e-151   
ref|XP_011001197.1|  PREDICTED: peroxidase 10                           443   4e-150   
ref|XP_004290337.1|  PREDICTED: peroxidase 10-like                      442   6e-150   
ref|XP_002313091.1|  hypothetical protein POPTR_0009s10960g             440   2e-149   Populus trichocarpa [western balsam poplar]
gb|AHL39161.1|  class III peroxidase                                    441   3e-149   
gb|KDO49149.1|  hypothetical protein CISIN_1g020451mg                   438   2e-148   
ref|XP_006480139.1|  PREDICTED: peroxidase 10-like                      438   3e-148   
ref|XP_006466643.1|  PREDICTED: peroxidase 10-like                      438   3e-148   
ref|XP_004288061.1|  PREDICTED: peroxidase 10-like                      438   3e-148   
ref|XP_006425837.1|  hypothetical protein CICLE_v10026130mg             436   1e-147   
ref|XP_009586909.1|  PREDICTED: peroxidase 10-like                      436   2e-147   
ref|XP_010268504.1|  PREDICTED: peroxidase 10                           436   4e-147   
ref|XP_009780492.1|  PREDICTED: peroxidase 10-like                      434   7e-147   
ref|XP_008338282.1|  PREDICTED: peroxidase 10                           431   3e-145   
ref|XP_010028506.1|  PREDICTED: peroxidase 10                           431   3e-145   
ref|XP_009366808.1|  PREDICTED: peroxidase 10                           429   7e-145   
ref|XP_008352500.1|  PREDICTED: peroxidase 10-like                      428   3e-144   
ref|XP_008241533.1|  PREDICTED: peroxidase 10-like                      427   7e-144   
ref|XP_006338218.1|  PREDICTED: peroxidase 10-like                      427   9e-144   
ref|XP_010070503.1|  PREDICTED: peroxidase 10-like                      426   1e-143   
ref|XP_007202220.1|  hypothetical protein PRUPE_ppa008504mg             424   7e-143   
gb|EYU44369.1|  hypothetical protein MIMGU_mgv1a018146mg                424   7e-143   
ref|XP_004233638.1|  PREDICTED: peroxidase 10-like                      423   2e-142   
ref|XP_007047175.1|  Peroxidase superfamily protein isoform 1           423   3e-142   
ref|XP_004141924.1|  PREDICTED: peroxidase 10-like                      423   3e-142   
ref|XP_010543944.1|  PREDICTED: peroxidase 10                           422   1e-141   
ref|XP_010550378.1|  PREDICTED: peroxidase 10-like                      421   1e-141   
ref|XP_010268491.1|  PREDICTED: peroxidase 10-like                      421   1e-141   
ref|XP_004232052.1|  PREDICTED: peroxidase 10-like                      420   3e-141   
ref|XP_002263033.2|  PREDICTED: peroxidase 10-like                      420   4e-141   Vitis vinifera
ref|XP_010935535.1|  PREDICTED: peroxidase 10                           418   2e-140   
ref|XP_010479392.1|  PREDICTED: peroxidase 10                           419   3e-140   
ref|XP_002306459.2|  peroxidase family protein                          417   4e-140   Populus trichocarpa [western balsam poplar]
ref|XP_006305198.1|  hypothetical protein CARUB_v10009564mg             418   6e-140   
ref|XP_008440251.1|  PREDICTED: peroxidase 10                           416   1e-139   
ref|XP_008805717.1|  PREDICTED: peroxidase 10                           416   2e-139   
ref|XP_007156533.1|  hypothetical protein PHAVU_003G294000g             415   4e-139   
ref|XP_010500501.1|  PREDICTED: peroxidase 10-like                      415   9e-139   
gb|KHN31052.1|  Peroxidase 10                                           413   1e-138   
emb|CDY16509.1|  BnaA08g02580D                                          415   1e-138   
ref|XP_006393244.1|  hypothetical protein EUTSA_v10011619mg             414   2e-138   
ref|XP_003529383.1|  PREDICTED: peroxidase 10-like                      413   2e-138   
ref|XP_011099203.1|  PREDICTED: peroxidase 10-like isoform X1           413   2e-138   
ref|XP_004288062.1|  PREDICTED: peroxidase 10-like                      413   3e-138   
ref|XP_010461798.1|  PREDICTED: peroxidase 10-like                      412   8e-138   
gb|KHN37487.1|  Peroxidase 10                                           410   2e-137   
ref|XP_009107290.1|  PREDICTED: peroxidase 10                           411   4e-137   
ref|XP_003518858.1|  PREDICTED: peroxidase 10-like                      410   5e-137   
ref|NP_175380.2|  peroxidase                                            410   5e-137   Arabidopsis thaliana [mouse-ear cress]
gb|ACU24350.1|  unknown                                                 410   6e-137   Glycine max [soybeans]
emb|CAA67341.1|  peroxidase                                             410   8e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891521.1|  predicted protein                                  409   1e-136   
gb|KHN37486.1|  Peroxidase 10                                           408   2e-136   
ref|NP_001240064.1|  uncharacterized protein LOC100805712 precursor     407   6e-136   
ref|XP_004511960.1|  PREDICTED: peroxidase 10-like                      406   1e-135   
ref|XP_007156825.1|  hypothetical protein PHAVU_002G020900g             402   3e-134   
gb|KFK36000.1|  hypothetical protein AALP_AA4G064800                    402   9e-134   
ref|XP_002281824.1|  PREDICTED: peroxidase 10 isoform X1                401   1e-133   Vitis vinifera
gb|AEX20391.1|  putative class III peroxidase                           397   4e-133   
ref|XP_011007672.1|  PREDICTED: peroxidase 10-like                      399   7e-133   
ref|XP_003611788.1|  Peroxidase                                         398   2e-132   
ref|XP_003611789.1|  Peroxidase                                         397   3e-132   
emb|CDP02473.1|  unnamed protein product                                392   4e-131   
ref|XP_010647781.1|  PREDICTED: peroxidase 10 isoform X2                392   2e-130   
ref|XP_003537345.2|  PREDICTED: peroxidase 10-like                      392   2e-130   
ref|XP_006848540.1|  hypothetical protein AMTR_s00169p00032570          389   4e-129   
ref|XP_003517286.2|  PREDICTED: peroxidase 10-like                      388   2e-128   
ref|XP_008459217.1|  PREDICTED: peroxidase 10-like                      387   3e-128   
ref|XP_004161643.1|  PREDICTED: peroxidase 10-like                      382   6e-126   
emb|CAN81423.1|  hypothetical protein VITISV_035943                     400   8e-126   Vitis vinifera
emb|CDX77234.1|  BnaC08g02790D                                          379   6e-125   
gb|KDP31892.1|  hypothetical protein JCGZ_12353                         372   3e-123   
gb|AEX20392.1|  putative class III peroxidase                           370   2e-122   
gb|EYU37713.1|  hypothetical protein MIMGU_mgv1a024365mg                357   9e-118   
gb|KHN36209.1|  Peroxidase 10                                           357   4e-117   
ref|XP_003551046.1|  PREDICTED: peroxidase 10-like                      347   1e-112   
ref|XP_002522322.1|  Peroxidase 10 precursor, putative                  345   2e-112   Ricinus communis
ref|XP_008449769.1|  PREDICTED: peroxidase N                            344   2e-111   
ref|XP_011099204.1|  PREDICTED: peroxidase 10-like isoform X2           339   4e-110   
ref|XP_007047176.1|  RNA ligase/cyclic nucleotide phosphodiestera...    338   4e-110   
ref|XP_010257485.1|  PREDICTED: peroxidase A2-like                      338   5e-109   
ref|XP_011099205.1|  PREDICTED: peroxidase 10-like isoform X3           335   1e-108   
ref|XP_009126399.1|  PREDICTED: peroxidase N-like isoform X1            337   1e-108   
ref|XP_004162079.1|  PREDICTED: peroxidase N-like                       336   3e-108   
ref|XP_004142143.1|  PREDICTED: peroxidase N-like                       336   3e-108   
gb|AAM66044.1|  peroxidase                                              334   3e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399147.1|  hypothetical protein EUTSA_v10013916mg             334   4e-107   
ref|NP_196291.1|  peroxidase 54                                         333   6e-107   Arabidopsis thaliana [mouse-ear cress]
gb|KGN54106.1|  hypothetical protein Csa_4G286310                       332   6e-107   
emb|CDX70074.1|  BnaA10g24230D                                          333   1e-106   
ref|XP_009122284.1|  PREDICTED: peroxidase A2                           332   2e-106   
emb|CDY42313.1|  BnaC02g09190D                                          331   2e-106   
emb|CDX98950.1|  BnaC09g48850D                                          332   2e-106   
emb|CCJ34833.1|  horseradish peroxidase isoenzyme HRP_4663              331   6e-106   
emb|CDP10156.1|  unnamed protein product                                330   8e-106   
ref|XP_006400553.1|  hypothetical protein EUTSA_v10014080mg             329   2e-105   
gb|KDO56405.1|  hypothetical protein CISIN_1g020050mg                   328   3e-105   
ref|XP_010420808.1|  PREDICTED: peroxidase N                            328   4e-105   
ref|XP_011083137.1|  PREDICTED: peroxidase N                            327   5e-105   
ref|XP_007202211.1|  hypothetical protein PRUPE_ppa008390mg             328   5e-105   
gb|AFN41087.1|  peroxidase precursor                                    327   6e-105   
ref|XP_010491253.1|  PREDICTED: peroxidase 54-like                      328   7e-105   
ref|XP_006492728.1|  PREDICTED: peroxidase 59-like                      327   1e-104   
ref|XP_002304020.2|  peroxidase family protein                          326   2e-104   Populus trichocarpa [western balsam poplar]
ref|XP_011025200.1|  PREDICTED: peroxidase N                            326   2e-104   
emb|CDX98949.1|  BnaC09g48860D                                          326   2e-104   
gb|AAR15704.3|  peroxidase                                              325   2e-104   Brassica napus [oilseed rape]
ref|XP_006288143.1|  hypothetical protein CARUB_v10001380mg             326   3e-104   
gb|KDP34262.1|  hypothetical protein JCGZ_12830                         325   3e-104   
gb|AAM65211.1|  peroxidase                                              325   5e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454279.1|  PREDICTED: peroxidase 59-like                      325   6e-104   
gb|AHL39128.1|  class III peroxidase                                    325   7e-104   
ref|XP_008240914.1|  PREDICTED: peroxidase A2-like                      325   8e-104   
ref|XP_010452613.1|  PREDICTED: peroxidase 54                           325   1e-103   
ref|XP_010491252.1|  PREDICTED: peroxidase 53                           324   1e-103   
ref|XP_007162335.1|  hypothetical protein PHAVU_001G143300g             324   1e-103   
ref|XP_009122283.1|  PREDICTED: peroxidase A2                           324   1e-103   
ref|XP_007014796.1|  Peroxidase superfamily protein                     323   2e-103   
ref|XP_009408603.1|  PREDICTED: peroxidase N-like                       323   4e-103   
emb|CCJ34826.1|  horseradish peroxidase isoenzyme HRP_A2B               323   5e-103   
emb|CCJ34825.1|  horseradish peroxidase isoenzyme HRP_A2A               323   5e-103   
ref|XP_002873970.1|  peroxidase                                         322   6e-103   
ref|NP_196290.1|  peroxidase 53                                         322   9e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423310.1|  PREDICTED: peroxidase 53-like                      322   1e-102   
ref|XP_006399146.1|  hypothetical protein EUTSA_v10014029mg             322   2e-102   
ref|XP_010265936.1|  PREDICTED: peroxidase N                            321   2e-102   
ref|XP_006575205.1|  PREDICTED: peroxidase 53-like                      321   2e-102   
emb|CDP17671.1|  unnamed protein product                                321   2e-102   
ref|XP_009784679.1|  PREDICTED: peroxidase 15-like                      321   2e-102   
sp|Q42517.1|PERN_ARMRU  RecName: Full=Peroxidase N; AltName: Full...    321   2e-102   Armoracia rusticana [horseradish]
ref|XP_010058197.1|  PREDICTED: peroxidase A2-like                      321   2e-102   
ref|XP_002982182.1|  hypothetical protein SELMODRAFT_421525             320   3e-102   
gb|KHN41710.1|  Peroxidase 53                                           320   3e-102   
ref|XP_006849541.1|  hypothetical protein AMTR_s00024p00166170          320   3e-102   
pdb|1PA2|A  Chain A, Arabidopsis Thaliana Peroxidase A2                 319   5e-102   
ref|XP_007206866.1|  hypothetical protein PRUPE_ppb006944mg             320   6e-102   
ref|XP_008387221.1|  PREDICTED: peroxidase A2-like                      320   6e-102   
gb|KHG30456.1|  Peroxidase N                                            320   7e-102   
ref|XP_010541735.1|  PREDICTED: peroxidase N                            319   8e-102   
ref|XP_009376683.1|  PREDICTED: peroxidase 59-like                      319   1e-101   
ref|XP_002530724.1|  Peroxidase 53 precursor, putative                  319   1e-101   Ricinus communis
ref|XP_008228270.1|  PREDICTED: peroxidase 59                           318   4e-101   
ref|XP_009364156.1|  PREDICTED: peroxidase N-like                       318   4e-101   
ref|XP_006373791.1|  hypothetical protein POPTR_0016s05860g             317   6e-101   
ref|XP_010520028.1|  PREDICTED: peroxidase A2-like                      317   6e-101   
gb|KDP24640.1|  hypothetical protein JCGZ_25556                         317   6e-101   
emb|CDX92492.1|  BnaA10g15310D                                          317   6e-101   
ref|XP_009369457.1|  PREDICTED: peroxidase A2-like                      317   6e-101   
gb|AGF25268.1|  peroxidase 1                                            317   7e-101   
emb|CAA67092.1|  peroxidase                                             317   8e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65571.1|  peroxidase ATP N                                        317   8e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AAD43561.1|AF155124_1  bacterial-induced peroxidase precursor        316   1e-100   Gossypium hirsutum [American cotton]
ref|XP_006290154.1|  hypothetical protein CARUB_v10003822mg             317   1e-100   
ref|XP_003535116.1|  PREDICTED: peroxidase 53-like                      316   2e-100   
ref|XP_007029017.1|  Peroxidase 2                                       316   2e-100   
ref|XP_002978872.1|  hypothetical protein SELMODRAFT_418626             316   2e-100   
ref|XP_009610510.1|  PREDICTED: peroxidase 15 {ECO:0000303|PubMed...    316   2e-100   
ref|XP_004295168.1|  PREDICTED: peroxidase N-like                       316   2e-100   
pdb|1QGJ|A  Chain A, Arabidopsis Thaliana Peroxidase N                  315   2e-100   
ref|XP_004497888.1|  PREDICTED: peroxidase 53-like                      315   3e-100   
ref|XP_006362277.1|  PREDICTED: peroxidase 15-like                      315   3e-100   
ref|XP_010493079.1|  PREDICTED: peroxidase 59                           315   3e-100   
ref|NP_568385.1|  peroxidase 59                                         315   3e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009120848.1|  PREDICTED: peroxidase N                            315   4e-100   
ref|XP_007145698.1|  hypothetical protein PHAVU_007G260700g             315   4e-100   
gb|KEH41719.1|  peroxidase family protein                               315   6e-100   
ref|XP_011078985.1|  PREDICTED: peroxidase 15-like                      315   6e-100   
ref|XP_004251296.1|  PREDICTED: peroxidase 15-like                      314   6e-100   
ref|XP_009409636.1|  PREDICTED: peroxidase A2-like                      315   7e-100   
ref|XP_008787874.1|  PREDICTED: peroxidase 15                           315   8e-100   
ref|XP_004138400.1|  PREDICTED: peroxidase 52-like                      314   8e-100   
ref|XP_008456761.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      314   9e-100   
ref|XP_003521220.1|  PREDICTED: peroxidase 15-like                      314   9e-100   
emb|CAD92857.1|  peroxidase                                             314   1e-99    Picea abies
ref|XP_002873275.1|  peroxidase                                         314   1e-99    
emb|CDY35842.1|  BnaC09g37740D                                          314   1e-99    
gb|KHN07440.1|  Peroxidase 15                                           314   1e-99    
gb|ABG46370.1|  rubber peroxidase 1                                     314   1e-99    Hevea brasiliensis [jebe]
ref|XP_004249178.1|  PREDICTED: peroxidase A2                           313   2e-99    
gb|KDO70903.1|  hypothetical protein CISIN_1g019976mg                   313   2e-99    
ref|XP_008361464.1|  PREDICTED: peroxidase N-like                       313   2e-99    
ref|XP_011039460.1|  PREDICTED: peroxidase A2-like                      313   3e-99    
ref|XP_003625275.1|  Peroxidase                                         314   3e-99    
ref|XP_003602463.1|  Peroxidase                                         312   3e-99    
gb|EAY77487.1|  hypothetical protein OsI_32530                          313   3e-99    Oryza sativa Indica Group [Indian rice]
ref|XP_009759099.1|  PREDICTED: peroxidase N                            313   3e-99    
ref|XP_006353885.1|  PREDICTED: peroxidase 52-like                      312   4e-99    
ref|XP_009620838.1|  PREDICTED: peroxidase N                            312   4e-99    
ref|XP_006363346.1|  PREDICTED: peroxidase 15-like                      312   4e-99    
ref|NP_001064031.1|  Os10g0109600                                       312   4e-99    Oryza sativa Japonica Group [Japonica rice]
gb|ABW82528.1|  class III peroxidase                                    312   4e-99    Gossypium hirsutum [American cotton]
ref|XP_006492847.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    312   4e-99    
dbj|BAJ93823.1|  predicted protein                                      312   5e-99    
ref|XP_002320417.1|  peroxidase family protein                          311   5e-99    Populus trichocarpa [western balsam poplar]
ref|XP_008351692.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    312   6e-99    
ref|XP_004307713.1|  PREDICTED: peroxidase 4-like                       312   6e-99    
ref|XP_010548306.1|  PREDICTED: peroxidase 49                           312   7e-99    
ref|XP_006661598.1|  PREDICTED: peroxidase N-like                       311   8e-99    
sp|P80679.1|PERA2_ARMRU  RecName: Full=Peroxidase A2                    311   8e-99    Armoracia rusticana [horseradish]
dbj|BAA03373.1|  putative peroxidase                                    312   9e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003549220.1|  PREDICTED: peroxidase N isoform X1                 311   9e-99    
ref|XP_009614894.1|  PREDICTED: peroxidase P7-like                      311   1e-98    
dbj|BAA84764.1|  peroxidase                                             311   1e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002988477.1|  hypothetical protein SELMODRAFT_235541             310   1e-98    
emb|CAL25299.1|  properoxidase                                          311   2e-98    Picea abies
ref|XP_006412001.1|  hypothetical protein EUTSA_v10025683mg             311   2e-98    
gb|ABK21983.1|  unknown                                                 311   2e-98    Picea sitchensis
ref|XP_002311022.2|  hypothetical protein POPTR_0008s02340g             310   2e-98    Populus trichocarpa [western balsam poplar]
ref|NP_001240914.1|  uncharacterized protein LOC100787073 precursor     310   3e-98    
gb|ABW82529.1|  class III peroxidase                                    310   3e-98    Gossypium hirsutum [American cotton]
dbj|BAA03372.1|  putative peroxidase                                    310   3e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011033755.1|  PREDICTED: peroxidase P7-like                      310   4e-98    
emb|CBI25854.3|  unnamed protein product                                307   5e-98    
ref|XP_010673530.1|  PREDICTED: peroxidase N-like                       310   5e-98    
ref|XP_002285642.1|  PREDICTED: peroxidase N isoform X2                 310   5e-98    Vitis vinifera
ref|XP_010246464.1|  PREDICTED: peroxidase P7-like                      309   6e-98    
ref|XP_009405166.1|  PREDICTED: peroxidase 59-like                      309   7e-98    
gb|AAX53172.1|  peroxidase                                              308   9e-98    Populus alba x Populus glandulosa
dbj|BAA08499.1|  peroxidase                                             309   9e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010695722.1|  PREDICTED: peroxidase P7-like                      309   9e-98    
emb|CDP13933.1|  unnamed protein product                                308   1e-97    
ref|XP_010087404.1|  Peroxidase 59                                      308   2e-97    
ref|XP_007137608.1|  hypothetical protein PHAVU_009G140700g             308   2e-97    
emb|CCJ34831.1|  horseradish peroxidase isoenzyme HRP_1350              308   2e-97    
ref|XP_003561850.1|  PREDICTED: peroxidase N-like                       308   2e-97    
ref|XP_006468993.1|  PREDICTED: peroxidase 52-like                      308   2e-97    
gb|KDO63401.1|  hypothetical protein CISIN_1g020966mg                   308   2e-97    
emb|CAL25298.1|  properoxidase                                          308   2e-97    Picea abies
gb|KFK30268.1|  hypothetical protein AALP_AA7G239300                    308   3e-97    
ref|XP_009138426.1|  PREDICTED: peroxidase 49                           308   3e-97    
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                  307   3e-97    Ricinus communis
ref|XP_007145699.1|  hypothetical protein PHAVU_007G260800g             308   3e-97    
ref|XP_009593782.1|  PREDICTED: peroxidase P7-like                      307   3e-97    
ref|XP_007048724.1|  Peroxidase superfamily protein                     307   4e-97    
ref|XP_006409192.1|  hypothetical protein EUTSA_v10022774mg             308   4e-97    
ref|XP_008787878.1|  PREDICTED: peroxidase N                            307   4e-97    
gb|AGN03454.1|  class III secretory peroxidase                          307   5e-97    
ref|XP_002873207.1|  hypothetical protein ARALYDRAFT_908444             307   5e-97    
ref|XP_010264466.1|  PREDICTED: peroxidase 4-like                       306   5e-97    
ref|XP_009620837.1|  PREDICTED: lignin-forming anionic peroxidase       307   5e-97    
ref|XP_010423480.1|  PREDICTED: peroxidase 52                           306   6e-97    
sp|Q9LEH3.1|PER15_IPOBA  RecName: Full=Peroxidase 15; Short=Prx15...    306   6e-97    Ipomoea batatas [batate]
ref|XP_010256947.1|  PREDICTED: peroxidase 4-like                       306   7e-97    
gb|AFK39887.1|  unknown                                                 307   8e-97    
ref|XP_010045399.1|  PREDICTED: peroxidase 4-like                       306   8e-97    
ref|XP_009129875.1|  PREDICTED: peroxidase 49-like                      307   8e-97    
ref|XP_004228346.1|  PREDICTED: peroxidase N-like                       306   9e-97    
gb|KEH37050.1|  peroxidase family protein                               307   1e-96    
gb|AAP42504.1|  anionic peroxidase swpa5                                306   1e-96    Ipomoea batatas [batate]
ref|XP_003523269.1|  PREDICTED: peroxidase 52-like isoform 1            306   1e-96    
ref|XP_006379469.1|  hypothetical protein POPTR_0008s02330g             306   1e-96    
ref|XP_010467620.1|  PREDICTED: peroxidase 15-like                      306   1e-96    
gb|EYU20688.1|  hypothetical protein MIMGU_mgv1a009598mg                306   1e-96    
gb|KEH32489.1|  peroxidase family protein                               306   2e-96    
emb|CDY64926.1|  BnaAnng19770D                                          306   2e-96    
emb|CCJ34840.1|  horseradish peroxidase isoenzyme HRP_6117              306   2e-96    
ref|XP_010489511.1|  PREDICTED: peroxidase 15                           306   2e-96    
gb|AFK35177.1|  unknown                                                 306   2e-96    
ref|XP_010104414.1|  Peroxidase 52                                      305   2e-96    
ref|XP_002281731.1|  PREDICTED: peroxidase P7                           305   3e-96    Vitis vinifera
ref|XP_009790966.1|  PREDICTED: peroxidase P7-like                      305   3e-96    
ref|XP_002281755.1|  PREDICTED: peroxidase P7                           305   3e-96    Vitis vinifera
ref|XP_004507960.1|  PREDICTED: peroxidase N-like                       305   3e-96    
gb|EPS63041.1|  hypothetical protein M569_11749                         305   3e-96    
ref|XP_002279920.1|  PREDICTED: peroxidase A2                           305   3e-96    
emb|CDX75574.1|  BnaA01g01280D                                          305   3e-96    
ref|XP_010045407.1|  PREDICTED: peroxidase 4-like                       305   3e-96    
gb|AHL39126.1|  class III peroxidase                                    306   3e-96    
ref|NP_195361.1|  peroxidase 49                                         305   4e-96    
ref|NP_196153.1|  peroxidase 52                                         305   4e-96    
ref|XP_006468162.1|  PREDICTED: peroxidase 4-like                       305   4e-96    
ref|XP_004983337.1|  PREDICTED: peroxidase N-like                       305   4e-96    
ref|XP_006649694.1|  PREDICTED: peroxidase N-like                       305   4e-96    
ref|XP_010413957.1|  PREDICTED: peroxidase 15-like                      305   4e-96    
ref|XP_007154627.1|  hypothetical protein PHAVU_003G134600g             305   4e-96    
ref|XP_010925616.1|  PREDICTED: peroxidase P7-like                      304   5e-96    
ref|XP_006299700.1|  hypothetical protein CARUB_v10015891mg             305   5e-96    
ref|XP_008644819.1|  PREDICTED: peroxidase N-like                       305   5e-96    
ref|XP_011032836.1|  PREDICTED: lignin-forming anionic peroxidase...    304   5e-96    
ref|XP_006398996.1|  hypothetical protein EUTSA_v10014105mg             304   5e-96    
ref|XP_009395537.1|  PREDICTED: peroxidase 72-like                      305   5e-96    
ref|NP_001049483.1|  Os03g0235000                                       305   5e-96    
gb|AES64745.2|  peroxidase family protein                               305   6e-96    
ref|XP_002468211.1|  hypothetical protein SORBIDRAFT_01g041790          304   6e-96    
ref|XP_008782624.1|  PREDICTED: peroxidase 4-like                       304   7e-96    
gb|EAY89165.1|  hypothetical protein OsI_10661                          304   7e-96    
ref|XP_009396319.1|  PREDICTED: peroxidase 72-like                      304   7e-96    
emb|CDY04948.1|  BnaAnng01300D                                          304   8e-96    
gb|KDO60611.1|  hypothetical protein CISIN_1g020951mg                   303   8e-96    
ref|XP_006466288.1|  PREDICTED: peroxidase 4-like                       303   9e-96    
ref|NP_179407.1|  peroxidase 15                                         304   9e-96    
gb|AAM61616.1|  putative peroxidase                                     304   1e-95    
gb|ADP95696.1|  class III heme peroxidase                               302   1e-95    
ref|XP_003616748.1|  Peroxidase                                         303   1e-95    
ref|XP_002304885.1|  peroxidase family protein                          304   1e-95    
ref|XP_002980452.1|  hypothetical protein SELMODRAFT_444510             304   1e-95    
ref|XP_009125598.1|  PREDICTED: peroxidase P7                           303   1e-95    
ref|XP_002465590.1|  hypothetical protein SORBIDRAFT_01g041760          303   1e-95    
ref|XP_010452439.1|  PREDICTED: peroxidase 52-like                      303   1e-95    
ref|XP_004967085.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P...    303   1e-95    
gb|AHL39158.1|  class III peroxidase                                    303   1e-95    
ref|XP_002962639.1|  hypothetical protein SELMODRAFT_230146             304   1e-95    
ref|XP_004294746.1|  PREDICTED: peroxidase 4-like                       303   1e-95    
emb|CDY14118.1|  BnaC02g02350D                                          303   1e-95    
ref|XP_004234419.1|  PREDICTED: peroxidase P7-like                      303   1e-95    
ref|XP_003549216.1|  PREDICTED: peroxidase N-like                       303   1e-95    
ref|XP_010246463.1|  PREDICTED: peroxidase P7-like                      303   1e-95    
ref|XP_010254703.1|  PREDICTED: peroxidase 72-like                      303   2e-95    
emb|CAN81400.1|  hypothetical protein VITISV_038539                     303   2e-95    
ref|XP_006833057.1|  hypothetical protein AMTR_s00170p00037010          303   2e-95    
ref|XP_009766291.1|  PREDICTED: lignin-forming anionic peroxidase...    303   2e-95    
dbj|BAF33316.1|  peroxidase                                             303   2e-95    
emb|CAA62226.1|  peroxidase1B                                           304   2e-95    
ref|XP_007142069.1|  hypothetical protein PHAVU_008G249900g             302   2e-95    
ref|XP_006492673.1|  PREDICTED: peroxidase 15-like                      303   2e-95    
pir||S60054  peroxidase (EC 1.11.1.7) A3a precursor - Japanese as...    303   3e-95 
gb|AFK41406.1|  unknown                                                 302   3e-95    
emb|CDX69223.1|  BnaC01g02300D                                          303   3e-95    
gb|ABK22680.1|  unknown                                                 303   4e-95    
ref|XP_002450134.1|  hypothetical protein SORBIDRAFT_05g001030          301   4e-95    
emb|CAA71492.1|  peroxidase                                             301   4e-95    
ref|XP_009404154.1|  PREDICTED: peroxidase A2-like                      302   4e-95    
ref|XP_003602462.1|  Peroxidase                                         301   5e-95    
ref|XP_002269918.1|  PREDICTED: peroxidase 4                            301   5e-95    
ref|XP_008795235.1|  PREDICTED: peroxidase P7-like                      301   5e-95    
ref|XP_008369321.1|  PREDICTED: peroxidase P7-like                      301   6e-95    
ref|XP_011025201.1|  PREDICTED: peroxidase A2-like                      303   6e-95    
ref|XP_004497889.1|  PREDICTED: peroxidase 53-like                      301   6e-95    
ref|XP_010939956.1|  PREDICTED: peroxidase N                            301   6e-95    
ref|XP_011076613.1|  PREDICTED: peroxidase P7                           301   7e-95    
ref|XP_010257484.1|  PREDICTED: peroxidase 15-like                      301   7e-95    
ref|XP_008457311.1|  PREDICTED: cationic peroxidase 1-like              301   7e-95    
dbj|BAJ94281.1|  predicted protein                                      301   8e-95    
ref|XP_006296673.1|  hypothetical protein CARUB_v10016420mg             301   8e-95    
dbj|BAF33314.1|  peroxidase                                             301   8e-95    
ref|XP_009144604.1|  PREDICTED: peroxidase 49-like                      301   9e-95    
ref|XP_010651318.1|  PREDICTED: peroxidase N isoform X1                 302   9e-95    
gb|KDP44301.1|  hypothetical protein JCGZ_19168                         302   1e-94    
ref|XP_002285649.1|  PREDICTED: lignin-forming anionic peroxidase       301   1e-94    
emb|CAH10839.1|  peroxidase                                             301   1e-94    
ref|XP_011008654.1|  PREDICTED: peroxidase P7                           301   1e-94    
ref|XP_002464560.1|  hypothetical protein SORBIDRAFT_01g020830          301   1e-94    
ref|XP_004295156.1|  PREDICTED: peroxidase 15-like                      301   1e-94    
gb|KFK40198.1|  hypothetical protein AALP_AA3G342700                    301   1e-94    
ref|XP_006284092.1|  hypothetical protein CARUB_v10005221mg             301   1e-94    
gb|ACU17608.1|  unknown                                                 301   1e-94    
gb|KFK24955.1|  hypothetical protein AALP_AA8G047500                    301   1e-94    
emb|CDY25140.1|  BnaC07g03670D                                          301   1e-94    
ref|XP_010695731.1|  PREDICTED: peroxidase P7-like                      300   1e-94    
emb|CDY46313.1|  BnaA07g01880D                                          301   1e-94    
ref|XP_003527340.1|  PREDICTED: peroxidase 52-like                      300   1e-94    
ref|NP_001241914.1|  uncharacterized protein LOC100790279 precursor     300   2e-94    
emb|CCJ34843.1|  horseradish peroxidase isoenzyme HRP_08562.1           301   2e-94    
ref|XP_004305595.1|  PREDICTED: lignin-forming anionic peroxidase...    300   2e-94    
ref|XP_009102275.1|  PREDICTED: peroxidase 15                           301   2e-94    
ref|XP_006386069.1|  hypothetical protein POPTR_0003s21640g             301   2e-94    
emb|CDY25139.1|  BnaC07g03680D                                          301   2e-94    
ref|XP_009608056.1|  PREDICTED: lignin-forming anionic peroxidase       300   2e-94    
gb|KHN45426.1|  Peroxidase 15                                           300   2e-94    
ref|XP_010432175.1|  PREDICTED: peroxidase 49                           300   2e-94    
ref|XP_004985086.1|  PREDICTED: peroxidase N-like                       300   2e-94    
ref|XP_004228694.1|  PREDICTED: peroxidase N-like isoform X1            300   2e-94    
ref|XP_008798950.1|  PREDICTED: peroxidase 15-like                      300   2e-94    
ref|XP_010231893.1|  PREDICTED: peroxidase 72-like                      300   2e-94    
ref|XP_008228153.1|  PREDICTED: peroxidase 15-like                      300   2e-94    
ref|XP_010446794.1|  PREDICTED: peroxidase 49-like                      300   2e-94    
ref|XP_004977590.1|  PREDICTED: cationic peroxidase 1-like              300   2e-94    
ref|XP_010058152.1|  PREDICTED: peroxidase A2-like                      300   2e-94    
emb|CAA66037.1|  peroxidase                                             301   2e-94    
ref|NP_179406.1|  peroxidase 14                                         300   2e-94    
ref|XP_010925617.1|  PREDICTED: peroxidase P7-like                      300   2e-94    
sp|P00434.3|PERP7_BRARR  RecName: Full=Peroxidase P7; AltName: Fu...    299   2e-94    
emb|CCJ34844.1|  horseradish peroxidase isoenzyme HRP_08562.4           300   2e-94    
ref|XP_002886150.1|  hypothetical protein ARALYDRAFT_480719             300   3e-94    
ref|XP_002979047.1|  hypothetical protein SELMODRAFT_271350             300   3e-94    
dbj|BAD97438.1|  peroxidase                                             300   4e-94    
dbj|BAM28608.1|  putative peroxidase                                    299   4e-94    
ref|XP_001769208.1|  predicted protein                                  300   4e-94    
ref|XP_003553432.1|  PREDICTED: peroxidase 15-like                      300   4e-94    
ref|XP_010936646.1|  PREDICTED: peroxidase 72-like                      300   4e-94    
ref|XP_010043876.1|  PREDICTED: peroxidase N                            300   4e-94    
gb|ACU24431.1|  unknown                                                 300   4e-94    
dbj|BAA11853.1|  peroxidase                                             300   4e-94    
ref|NP_001146489.1|  uncharacterized protein LOC100280077 precursor     300   5e-94    
ref|XP_010035872.1|  PREDICTED: peroxidase P7-like                      299   5e-94    
ref|XP_006365326.1|  PREDICTED: peroxidase 52-like                      299   5e-94    
gb|KDP21683.1|  hypothetical protein JCGZ_03354                         299   5e-94    
ref|XP_002991520.1|  hypothetical protein SELMODRAFT_272212             299   5e-94    
ref|XP_007206842.1|  hypothetical protein PRUPE_ppa027053mg             299   6e-94    
gb|AFK45898.1|  unknown                                                 299   6e-94    
ref|XP_006376028.1|  hypothetical protein POPTR_0013s08130g             299   6e-94    
emb|CDP08160.1|  unnamed protein product                                299   6e-94    
emb|CDY59700.1|  BnaC07g51170D                                          299   6e-94    
ref|XP_007205439.1|  hypothetical protein PRUPE_ppa007826mg             300   7e-94    
ref|XP_010653358.1|  PREDICTED: cationic peroxidase 1-like              299   7e-94    
ref|XP_003520284.1|  PREDICTED: peroxidase 72                           299   8e-94    
ref|XP_008352132.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 59      299   8e-94    
ref|XP_010263838.1|  PREDICTED: cationic peroxidase 1-like isofor...    298   9e-94    
gb|KHN00512.1|  Peroxidase 72                                           298   1e-93    
ref|XP_009126400.1|  PREDICTED: peroxidase N-like isoform X2            297   1e-93    
ref|XP_003519407.1|  PREDICTED: peroxidase 4-like                       298   1e-93    
ref|XP_008233851.1|  PREDICTED: peroxidase P7-like                      298   1e-93    
ref|XP_010437350.1|  PREDICTED: peroxidase 49-like                      298   1e-93    
ref|XP_011024238.1|  PREDICTED: peroxidase 5-like                       300   1e-93    
ref|XP_006354190.1|  PREDICTED: lignin-forming anionic peroxidase...    298   1e-93    
ref|NP_001136736.1|  uncharacterized protein LOC100216875 precursor     298   2e-93    
gb|KHG18057.1|  Peroxidase 52 -like protein                             298   2e-93    
ref|NP_001065566.1|  Os11g0112200                                       297   2e-93    
dbj|BAM28609.1|  putative peroxidase                                    297   2e-93    
ref|XP_006291411.1|  hypothetical protein CARUB_v10017550mg             298   2e-93    
ref|XP_007011229.1|  Peroxidase superfamily protein                     298   2e-93    
gb|AHL39166.1|  class III peroxidase                                    297   2e-93    
ref|XP_010491069.1|  PREDICTED: peroxidase 52-like                      298   2e-93    
ref|XP_009403860.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    297   2e-93    
ref|XP_004967775.1|  PREDICTED: peroxidase 72-like                      298   2e-93    
ref|XP_010650833.1|  PREDICTED: cationic peroxidase 1-like              297   2e-93    
ref|XP_010679795.1|  PREDICTED: peroxidase 72-like                      298   2e-93    
gb|AFU51540.1|  anionic peroxidase                                      297   2e-93    
dbj|BAB89258.1|  putative peroxidase ATP6a                              298   2e-93    
emb|CDY05024.1|  BnaC03g28220D                                          298   2e-93    
ref|XP_006378807.1|  hypothetical protein POPTR_0010s24330g             297   2e-93    
ref|XP_003547959.1|  PREDICTED: peroxidase 72-like                      298   2e-93    
tpe|CAH69378.1|  TPA: class III peroxidase 136 precursor                297   3e-93    
gb|ABK25962.1|  unknown                                                 297   3e-93    
gb|ACI22425.1|  pericarp peroxidase 3                                   297   3e-93    
ref|XP_010653359.1|  PREDICTED: cationic peroxidase 1-like              297   3e-93    
ref|XP_009771021.1|  PREDICTED: peroxidase 9-like                       297   3e-93    
gb|KHN27034.1|  Peroxidase 72                                           297   3e-93    
gb|EYU41994.1|  hypothetical protein MIMGU_mgv1a010221mg                297   3e-93    
ref|XP_006658122.1|  PREDICTED: peroxidase 70-like                      297   3e-93    
gb|AHL39106.1|  class III peroxidase                                    298   3e-93    
ref|XP_010058168.1|  PREDICTED: peroxidase A2-like                      297   3e-93    
ref|XP_010679794.1|  PREDICTED: peroxidase 72-like                      297   3e-93    
emb|CBI22007.3|  unnamed protein product                                300   4e-93    
ref|XP_006596457.1|  PREDICTED: cationic peroxidase 1-like              296   4e-93    
dbj|BAA01992.1|  peroxidase                                             297   4e-93    
gb|KDP21681.1|  hypothetical protein JCGZ_03352                         297   4e-93    
gb|AAP42508.1|  anionic peroxidase swpb3                                296   4e-93    
gb|ABG49114.1|  peroxidase                                              297   4e-93    
ref|NP_001043276.1|  Os01g0543100                                       297   4e-93    
dbj|BAM28607.1|  putative peroxidase                                    296   4e-93    
gb|EMT06858.1|  Peroxidase N                                            297   4e-93    
gb|EYU41993.1|  hypothetical protein MIMGU_mgv1a010225mg                296   5e-93    
emb|CAA66034.1|  peroxidase                                             297   5e-93    
dbj|BAA82306.1|  peroxidase                                             296   5e-93    
ref|XP_007207695.1|  hypothetical protein PRUPE_ppa023946mg             296   5e-93    
ref|NP_001234132.1|  peroxidase precursor                               296   6e-93    
gb|AAL58444.1|AF455807_1  anionic peroxidase                            296   6e-93    
ref|XP_008653195.1|  PREDICTED: peroxidase A2-like                      296   6e-93    
ref|XP_010027112.1|  PREDICTED: peroxidase 40                           297   7e-93    
ref|XP_003612078.1|  Peroxidase                                         296   7e-93    
gb|EMS60222.1|  Peroxidase 72                                           296   7e-93    
ref|XP_009793693.1|  PREDICTED: peroxidase 72-like                      296   7e-93    
ref|XP_003596719.1|  Peroxidase                                         296   7e-93    
ref|XP_004239964.1|  PREDICTED: peroxidase P7-like                      296   8e-93    
ref|XP_009375114.1|  PREDICTED: peroxidase A2-like                      296   9e-93    
gb|EAY74439.1|  hypothetical protein OsI_02330                          296   9e-93    
ref|XP_008390167.1|  PREDICTED: peroxidase A2-like                      295   1e-92    
gb|ABV24960.2|  putative secretory peroxidase                           296   1e-92    
ref|NP_190668.2|  peroxidase 36                                         296   1e-92    
gb|ACG44598.1|  peroxidase 72 precursor                                 296   1e-92    
ref|XP_010257483.1|  PREDICTED: peroxidase N-like                       296   1e-92    
gb|ACT35473.1|  peroxidase 52                                           295   1e-92    
ref|XP_004510041.1|  PREDICTED: peroxidase 52-like                      295   1e-92    
emb|CAB62621.1|  peroxidase-like protein                                296   1e-92    
gb|AAF63027.1|AF244924_1  peroxidase prx15 precursor                    296   1e-92    
ref|XP_009408894.1|  PREDICTED: peroxidase P7-like                      295   1e-92    
ref|XP_008374511.1|  PREDICTED: peroxidase P7-like isoform X1           295   1e-92    
emb|CAB67121.1|  peroxidase                                             295   1e-92    
ref|XP_002992278.1|  hypothetical protein SELMODRAFT_135052             295   1e-92    
ref|XP_006288218.1|  hypothetical protein CARUB_v10001455mg             295   1e-92    
ref|XP_003561855.1|  PREDICTED: peroxidase A2-like                      296   1e-92    
ref|XP_009381003.1|  PREDICTED: peroxidase A2-like                      296   1e-92    
gb|EYU41992.1|  hypothetical protein MIMGU_mgv1a010234mg                295   1e-92    
ref|XP_008374580.1|  PREDICTED: peroxidase P7-like                      295   1e-92    
ref|XP_010915491.1|  PREDICTED: peroxidase P7-like                      295   2e-92    
ref|XP_006356455.1|  PREDICTED: peroxidase N-like                       297   2e-92    
ref|XP_008369323.1|  PREDICTED: peroxidase 4-like                       295   2e-92    
gb|EMT21494.1|  Peroxidase 72                                           295   2e-92    
ref|XP_004967776.1|  PREDICTED: peroxidase 72-like                      296   2e-92    
ref|XP_006486214.1|  PREDICTED: peroxidase 4-like                       295   2e-92    
emb|CAL25300.1|  properoxidase                                          295   2e-92    
ref|XP_002521512.1|  Peroxidase 72 precursor, putative                  295   2e-92    
gb|AII99879.1|  peroxidase                                              296   2e-92    
ref|XP_010058176.1|  PREDICTED: peroxidase A2-like                      295   2e-92    



>ref|XP_009761466.1| PREDICTED: peroxidase 10-like [Nicotiana sylvestris]
Length=327

 Score =   506 bits (1302),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 243/320 (76%), Positives = 278/320 (87%), Gaps = 4/320 (1%)
 Frame = -3

Query  1311  LVVFLGFLA--APMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             L VF   ++  AP+   QLDY FY++SCP+L  IVRWGVWSA RNDSR+AA+L+RLHFHD
Sbjct  9     LTVFFCVISILAPLTVGQLDYSFYERSCPSLPRIVRWGVWSAYRNDSRIAAALLRLHFHD  68

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCDGSVLLDDT  FKGEKN LPNRNSARG+E+IDSIKAD+E+ACPSTVSC DILTL
Sbjct  69    CFVNGCDGSVLLDDTNDFKGEKNALPNRNSARGYEIIDSIKADLERACPSTVSCVDILTL  128

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMV  781
             AA   V MSGGPYW VLLGRRDGLTAS++A  +QLPSPFE L  I AKF+A+GLDLKD+V
Sbjct  129   AAREVVVMSGGPYWPVLLGRRDGLTASDKAANEQLPSPFEPLDKIAAKFTAKGLDLKDIV  188

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
             VLSGAH++G+AQCFTFKRRLFN+Q SGKPDP L+SS LSNLQ+TCPN D SN+K+APLD+
Sbjct  189   VLSGAHTIGYAQCFTFKRRLFNFQNSGKPDPNLDSSMLSNLQSTCPNRDESNSKIAPLDF  248

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
             QS  RFDNSYY NLVNN+GLLESDQALM+N QTADMVK YS+YPY FY DFA SM+KLGN
Sbjct  249   QSVSRFDNSYYRNLVNNSGLLESDQALMSNSQTADMVKSYSSYPYLFYQDFAASMLKLGN  308

Query  420   LGVLTGKDNGQIRKICGSVN  361
             +GVLTG+ +GQIRKICGSVN
Sbjct  309   VGVLTGQ-SGQIRKICGSVN  327



>ref|XP_009625722.1| PREDICTED: peroxidase 10-like [Nicotiana tomentosiformis]
Length=327

 Score =   506 bits (1302),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 238/311 (77%), Positives = 273/311 (88%), Gaps = 2/311 (1%)
 Frame = -3

Query  1290  LAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGS  1111
             + AP+   QLDY FY++SCP+   IVRWGVWSA RNDSR+AA+L+RLHFHDCFVNGCDGS
Sbjct  18    ILAPLTVGQLDYSFYERSCPSFPRIVRWGVWSAYRNDSRIAAALLRLHFHDCFVNGCDGS  77

Query  1110  VLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMS  931
             VLLDDT  FKGEKN LPNRNSARG+E+IDSIKAD+E+ACPSTVSC DILTL A   V MS
Sbjct  78    VLLDDTNDFKGEKNALPNRNSARGYEIIDSIKADLERACPSTVSCVDILTLVAREVVVMS  137

Query  930   GGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVG  754
             GGPYW VLLGRRDGLTAS++A  +QLPSPFE L  I AKF+A+GLDLKD+VVLSGAH++G
Sbjct  138   GGPYWPVLLGRRDGLTASDKAANEQLPSPFEPLDKIAAKFTAKGLDLKDVVVLSGAHTIG  197

Query  753   FAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNS  574
             +AQCFTFKRRLFN+Q SGKPDP L+SS LSNLQ+TCPN DGSN+K+APLD+QS  RFDNS
Sbjct  198   YAQCFTFKRRLFNFQNSGKPDPNLDSSMLSNLQSTCPNTDGSNSKIAPLDFQSVTRFDNS  257

Query  573   YYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDN  394
             YY NLVNN+GLLESDQALM+N QTADMVK YS+YPYRFY DFA SM+KLGN+G+LT + +
Sbjct  258   YYRNLVNNSGLLESDQALMSNSQTADMVKSYSSYPYRFYQDFAASMMKLGNVGILT-EQS  316

Query  393   GQIRKICGSVN  361
             GQIRKICGSVN
Sbjct  317   GQIRKICGSVN  327



>emb|CDO97144.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   484 bits (1245),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 228/312 (73%), Positives = 268/312 (86%), Gaps = 2/312 (1%)
 Frame = -3

Query  1293  FLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDG  1114
             FL  P+A  QLDY FYD  CPNL M+VRWGVW+A+RND+RMAASL+RLHFHDCFVNGCDG
Sbjct  2     FLFEPLANGQLDYNFYDDLCPNLPMMVRWGVWAALRNDTRMAASLLRLHFHDCFVNGCDG  61

Query  1113  SVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGM  934
             SVLLDDT  FKGEKN LPNRNSARGFEVI+SIKADVE+ACPS VSC DIL LAA  AV +
Sbjct  62    SVLLDDTPNFKGEKNALPNRNSARGFEVIESIKADVERACPSIVSCADILALAAREAVIL  121

Query  933   SGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSV  757
             S GP+W V LGRRD LTAS +A  +QLP+PFESL +I AKF++ GLDL+D+VVLSGAH++
Sbjct  122   SEGPFWPVSLGRRDALTASTKAANEQLPTPFESLDNIVAKFASNGLDLRDVVVLSGAHTL  181

Query  756   GFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDN  577
             G+AQCFTFKRRLF+++GSGKPDP L++S +++LQ TCPNVD SN+KLAPLD Q+ Y+FDN
Sbjct  182   GYAQCFTFKRRLFDFKGSGKPDPLLDASMVASLQGTCPNVDESNSKLAPLDVQTVYKFDN  241

Query  576   SYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKD  397
             +YY NL+ NTGLLESDQALM NP+TA+MV +YS YPY +  DFA SMVKLGN+GVLTG+D
Sbjct  242   AYYKNLMTNTGLLESDQALMGNPKTAEMVNFYSTYPYLYSRDFAASMVKLGNIGVLTGQD  301

Query  396   NGQIRKICGSVN  361
              GQIRK CGSVN
Sbjct  302   -GQIRKKCGSVN  312



>ref|XP_006346525.1| PREDICTED: peroxidase 10-like [Solanum tuberosum]
Length=330

 Score =   479 bits (1233),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 232/320 (73%), Positives = 265/320 (83%), Gaps = 5/320 (2%)
 Frame = -3

Query  1311  LVVFLGFLA--APMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             L VF   ++  AP+   QLDY +YD++CP L  I+RW VWSA+RNDSR+AASL+RLHFHD
Sbjct  10    LTVFFCMISIMAPLTSGQLDYSYYDRACPVLPRIIRWNVWSALRNDSRIAASLLRLHFHD  69

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCDGSVLLDDT  FKGEKN  PNRNS RGFE ID+IKAD+E+ACP TVSC DILTL
Sbjct  70    CFVNGCDGSVLLDDTNDFKGEKNAAPNRNSVRGFETIDNIKADLERACPLTVSCVDILTL  129

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMV  781
             AA   V MSGGP+W VLLGRRDGLTASE+A   QLPSPFE L  I AKF+ +GLDL+D+V
Sbjct  130   AAREVVVMSGGPFWPVLLGRRDGLTASEKAANDQLPSPFEPLDKIAAKFTDKGLDLRDVV  189

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
             VLSGAH++GFAQCFTFKRRLFNYQ SGKPDP L+SS LSNLQ+TCP  +G NTK+ PLD 
Sbjct  190   VLSGAHTIGFAQCFTFKRRLFNYQDSGKPDPILDSSMLSNLQSTCPE-EGPNTKITPLDI  248

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
             QS  RFDN+YY NL+ NTGLLESDQALM+N +TADMVK YS YPY F+ DFA SMVKLGN
Sbjct  249   QSVTRFDNAYYRNLMINTGLLESDQALMSNSETADMVKSYSLYPYLFFQDFAASMVKLGN  308

Query  420   LGVLTGKDNGQIRKICGSVN  361
             +GVLTG + GQIRK+CGSVN
Sbjct  309   VGVLTG-ETGQIRKVCGSVN  327



>ref|XP_011088753.1| PREDICTED: peroxidase 10 [Sesamum indicum]
Length=337

 Score =   474 bits (1221),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 228/305 (75%), Positives = 263/305 (86%), Gaps = 2/305 (1%)
 Frame = -3

Query  1272  ESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDT  1093
             +  L Y FYD+SCPNL MIVRWGVW+A++ND+RMAASL+RLHFHDCFV+GC+GSVLLDDT
Sbjct  34    DGPLSYNFYDKSCPNLGMIVRWGVWAALKNDTRMAASLLRLHFHDCFVDGCEGSVLLDDT  93

Query  1092  KGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWR  913
             K FKGEKN LPNRNSARG++VIDSIKADVEK CPSTVSC DIL LAA  AV MSGGP+W 
Sbjct  94    KDFKGEKNALPNRNSARGYDVIDSIKADVEKYCPSTVSCVDILALAAREAVVMSGGPFWP  153

Query  912   VLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFT  736
             VLLGR DGL+ASE+ A +QLPSPFE L +ITAKF ++GLD+KD+VVLSGAH++GFAQCFT
Sbjct  154   VLLGRLDGLSASEKSANEQLPSPFEPLDNITAKFVSKGLDVKDVVVLSGAHTIGFAQCFT  213

Query  735   FKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLV  556
             FKRRLFNY+G+GKPDP+L+SSFLSNLQT CPNVD SNTKL  LD Q+  RFDN YY N+V
Sbjct  214   FKRRLFNYKGTGKPDPSLDSSFLSNLQTLCPNVDKSNTKLTALDSQTINRFDNMYYKNIV  273

Query  555   NNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKI  376
             NNTGLLESDQAL+ +P+TA MVK YSA P+ F  DFA SMVKLG LG++TG+D GQIRK 
Sbjct  274   NNTGLLESDQALIGDPKTAAMVKDYSADPFLFAKDFAASMVKLGKLGLITGQD-GQIRKK  332

Query  375   CGSVN  361
             C  VN
Sbjct  333   CSVVN  337



>ref|XP_004238604.1| PREDICTED: peroxidase 10-like [Solanum lycopersicum]
Length=360

 Score =   475 bits (1222),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 228/318 (72%), Positives = 261/318 (82%), Gaps = 3/318 (1%)
 Frame = -3

Query  1311  LVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCF  1132
             L   + FLA P +  QLDY +Y+++CP+L  IVRW  W A+R+DSR+AASL+RLHFHDCF
Sbjct  13    LFCVMSFLA-PFSNGQLDYSYYERTCPSLHKIVRWNAWEALRSDSRIAASLLRLHFHDCF  71

Query  1131  VNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAA  952
             VNGCDGSVLLDDT  FKGEKN  PNRNS RG+E ID IKA VE+ACPSTVSC DILTLAA
Sbjct  72    VNGCDGSVLLDDTFYFKGEKNAAPNRNSVRGYETIDIIKAHVERACPSTVSCVDILTLAA  131

Query  951   SYAVGMSGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVL  775
                V M+GGP+W VLLGRRDGL+ASEEA  +QLPSPFE L  I AKF+ +GLDLKD+VVL
Sbjct  132   REVVVMAGGPFWPVLLGRRDGLSASEEAANEQLPSPFEPLDKIAAKFTDKGLDLKDLVVL  191

Query  774   SGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQS  595
             SGAH++GFAQCFTFK RLFNYQ SGKPDP L+SS LSNLQ TCP+ D SNT L PLD QS
Sbjct  192   SGAHTIGFAQCFTFKERLFNYQDSGKPDPNLDSSMLSNLQCTCPDTDESNTTLTPLDMQS  251

Query  594   TYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLG  415
               RFDN+YY NL+NN+GLLESDQ LM+N QTADMVK YS YP+ FY DFA SMVKLGNLG
Sbjct  252   VTRFDNAYYRNLMNNSGLLESDQVLMSNSQTADMVKSYSLYPHLFYEDFAASMVKLGNLG  311

Query  414   VLTGKDNGQIRKICGSVN  361
             VLTG+  GQIR++CGSV+
Sbjct  312   VLTGR-TGQIREVCGSVS  328



>ref|XP_004230797.1| PREDICTED: peroxidase 10 [Solanum lycopersicum]
Length=330

 Score =   474 bits (1219),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 227/311 (73%), Positives = 262/311 (84%), Gaps = 3/311 (1%)
 Frame = -3

Query  1290  LAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGS  1111
             + AP+   QLDY +YD++CP L  I+RW VWSA+RNDSR+AASL+RLHFHDCFVNGCDGS
Sbjct  19    IMAPLTFGQLDYSYYDRACPVLPRIIRWNVWSALRNDSRIAASLLRLHFHDCFVNGCDGS  78

Query  1110  VLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMS  931
             VLLDDT  FKGEKN  PNRNS RGFE ID+IKAD+E+ACP TVSC DILTLAA   V MS
Sbjct  79    VLLDDTNDFKGEKNAAPNRNSVRGFETIDNIKADLERACPFTVSCVDILTLAAREVVVMS  138

Query  930   GGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVG  754
             GGP+W VLLGRRDGLTASE+A  +QLPSPFE L  I AKF+ +GL+L+D+VVLSGAH++G
Sbjct  139   GGPFWPVLLGRRDGLTASEKAANEQLPSPFEPLDKIAAKFTDKGLNLRDVVVLSGAHTIG  198

Query  753   FAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNS  574
             FAQCFTFKRRLFNYQ SGKPDP L+ S L NLQ+TCP  +G N+K+ PLD QS  RFDN+
Sbjct  199   FAQCFTFKRRLFNYQDSGKPDPLLDYSMLLNLQSTCPE-EGPNSKITPLDNQSVTRFDNA  257

Query  573   YYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDN  394
             YY NL+NNTGLLESDQALM+N +TADMVK YS YPY FY DFA SMVKLGN+GVLTG ++
Sbjct  258   YYRNLMNNTGLLESDQALMSNSETADMVKAYSLYPYLFYQDFAASMVKLGNIGVLTG-ES  316

Query  393   GQIRKICGSVN  361
             GQIRK+CGSVN
Sbjct  317   GQIRKVCGSVN  327



>ref|XP_002521844.1| Peroxidase 10 precursor, putative [Ricinus communis]
 gb|EEF40480.1| Peroxidase 10 precursor, putative [Ricinus communis]
Length=340

 Score =   471 bits (1211),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 267/329 (81%), Gaps = 6/329 (2%)
 Frame = -3

Query  1323  VAISLVVFLGFLAAPMAES----QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLI  1156
             V   L++ L    AP   +    QLDY FYDQSCP L+MIV++GVW+A+RNDSRMAASL+
Sbjct  11    VPFFLILALSIPVAPFRPTAYGQQLDYNFYDQSCPRLEMIVKYGVWAALRNDSRMAASLL  70

Query  1155  RLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSC  976
             RLHFHDCFVNGCDGS+LLDDTK F+GEKN LPNRNSARGFEVIDSIK DVE+ACP TVSC
Sbjct  71    RLHFHDCFVNGCDGSILLDDTKKFQGEKNALPNRNSARGFEVIDSIKEDVERACPFTVSC  130

Query  975   TDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQ-LPSPFESLKDITAKFSAQGL  799
              DIL LAA  AV  SGGP+W V LGRRDGLTAS++A  + LP PFESL++ITAKF AQGL
Sbjct  131   ADILALAAREAVLQSGGPFWSVPLGRRDGLTASQKAANENLPIPFESLENITAKFVAQGL  190

Query  798   DLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTK  619
             DLKD+VVLSGAH++GFAQCFTFK RLFN++GSG PDP L+SS L NLQ+ CPN D SN  
Sbjct  191   DLKDVVVLSGAHTLGFAQCFTFKNRLFNFKGSGMPDPGLDSSALKNLQSMCPNKDASNRD  250

Query  618   LAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATS  439
             L PLD  S YRFDNSY+TNLV NTGLLESDQALM + +TA +V  YS+YPY F  DFA S
Sbjct  251   LVPLDSASAYRFDNSYFTNLVTNTGLLESDQALMTDSRTAALVNSYSSYPYLFSSDFAAS  310

Query  438   MVKLGNLGVLTGKDNGQIRKICGSVN*GY  352
             MVK+G++GVLTG + GQIR+ CGSVN G+
Sbjct  311   MVKMGSVGVLTG-EQGQIRRKCGSVNYGW  338



>ref|XP_006342215.1| PREDICTED: peroxidase 10-like [Solanum tuberosum]
Length=360

 Score =   469 bits (1208),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 223/311 (72%), Positives = 259/311 (83%), Gaps = 2/311 (1%)
 Frame = -3

Query  1290  LAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGS  1111
             + AP ++ QLDY +Y+++CP+L  IVRW VW A+R+DSR+AASL+RLHFHDCFVNGCDGS
Sbjct  19    ILAPFSDGQLDYSYYERACPSLHRIVRWNVWEALRSDSRIAASLLRLHFHDCFVNGCDGS  78

Query  1110  VLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMS  931
             VLLDDT  FKGEKN  PNRNS RG+E ID IKA VE+ACP TVSC DILTLAA   V M+
Sbjct  79    VLLDDTYYFKGEKNAAPNRNSVRGYETIDIIKAHVERACPLTVSCVDILTLAAREVVVMA  138

Query  930   GGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVG  754
             GGP+W VLLGRRDGL+A+E+A  +QLPSPFE L  I AKFS +GLDL+D+VVLSGAH++G
Sbjct  139   GGPFWPVLLGRRDGLSANEKAANEQLPSPFEPLDKIVAKFSDKGLDLRDLVVLSGAHTIG  198

Query  753   FAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNS  574
             FAQCFTFK RLFNYQ SGKPDP L+SS LS LQ TCP+ D SNT L PLD QS  RFDN+
Sbjct  199   FAQCFTFKGRLFNYQDSGKPDPNLDSSMLSKLQCTCPDTDESNTTLTPLDIQSVTRFDNA  258

Query  573   YYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDN  394
             YY NL+NN+GLLESDQALM+N QTADMVK YS YP+ FY DFA SMVKLGN+GVLTG+  
Sbjct  259   YYRNLMNNSGLLESDQALMSNSQTADMVKSYSLYPHLFYKDFAASMVKLGNVGVLTGR-T  317

Query  393   GQIRKICGSVN  361
             GQIR+ICGSV+
Sbjct  318   GQIREICGSVS  328



>ref|XP_007042356.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOX98187.1| Peroxidase superfamily protein [Theobroma cacao]
Length=334

 Score =   466 bits (1198),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 222/306 (73%), Positives = 263/306 (86%), Gaps = 2/306 (1%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             A SQLDY FYD+SCP L  +V++GVW+A +ND R+AASL+RLHFHDCFVNGCD SVLLDD
Sbjct  29    ANSQLDYRFYDRSCPRLSSMVKYGVWAAYKNDIRIAASLLRLHFHDCFVNGCDASVLLDD  88

Query  1095  TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYW  916
             T+ F+GEKN  PNRNSARG+EVID+IKADVE+ CPSTVSC DILTLAA  AV +SGGP+W
Sbjct  89    TEDFQGEKNAFPNRNSARGYEVIDNIKADVERFCPSTVSCVDILTLAAREAVVLSGGPFW  148

Query  915   RVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCF  739
              VLLGRRDG TAS++A  +QLPSP E +++ITAKF+++GLDLKD+VVLSGAH++G+AQCF
Sbjct  149   PVLLGRRDGTTASQQAANEQLPSPIEPMENITAKFTSKGLDLKDVVVLSGAHTIGYAQCF  208

Query  738   TFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             TFKRRLFN+ G+G+PDPTL++S L++LQ+ CPN+D SN+ LAPLD  STYRFDN YYTNL
Sbjct  209   TFKRRLFNFLGTGRPDPTLDASALASLQSMCPNMDSSNSNLAPLDSASTYRFDNMYYTNL  268

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             VNNTGLLESDQALM +P+TA MV  YS  PY F  DFATSM KLGN+GVLTGK  GQIRK
Sbjct  269   VNNTGLLESDQALMQDPKTAAMVNSYSTNPYLFGNDFATSMAKLGNIGVLTGK-KGQIRK  327

Query  378   ICGSVN  361
              CGSVN
Sbjct  328   KCGSVN  333



>ref|XP_007200388.1| hypothetical protein PRUPE_ppa008433mg [Prunus persica]
 gb|EMJ01587.1| hypothetical protein PRUPE_ppa008433mg [Prunus persica]
Length=332

 Score =   459 bits (1180),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 222/308 (72%), Positives = 261/308 (85%), Gaps = 3/308 (1%)
 Frame = -3

Query  1281  PMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLL  1102
             P A SQLDY FYD+SCP L MIVR+ +W+AIRND+RMAASL+R+HFHDC VNGCDGSVLL
Sbjct  27    PFAYSQLDYNFYDRSCPRLSMIVRYNLWAAIRNDTRMAASLLRMHFHDCIVNGCDGSVLL  86

Query  1101  DDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGP  922
             DDT+ FKGEKN LPNR S RGFEVID+IKADVE+ CPSTVSC DILTLAA  AVG++GGP
Sbjct  87    DDTEDFKGEKNALPNRKSLRGFEVIDNIKADVERFCPSTVSCADILTLAAREAVGLAGGP  146

Query  921   YWRVLLGRRDGLTASEEA-TKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQ  745
             +W V LGRRDG TASE+A T+QLPSP E L++ITAKF+++GLD+KD+VVLSG H++GFAQ
Sbjct  147   FWPVPLGRRDGTTASEKAVTEQLPSPIEPLENITAKFTSKGLDIKDVVVLSGGHTLGFAQ  206

Query  744   CFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYT  565
             CFTFKRRLF++ GSG PDPTL+SS L+NL++ CP  D +N+ LAPLD  +  RFDN+YYT
Sbjct  207   CFTFKRRLFDFDGSGNPDPTLDSSALTNLRSICPKKDSANSNLAPLD-STNLRFDNAYYT  265

Query  564   NLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQI  385
             NLV+NTGLLESDQAL+ +P TA MV  YSA  + F  DFA SMVKLGN+GVLTGKD GQI
Sbjct  266   NLVSNTGLLESDQALVKDPNTAAMVNSYSANHFLFSNDFAASMVKLGNVGVLTGKD-GQI  324

Query  384   RKICGSVN  361
             RK CGSVN
Sbjct  325   RKKCGSVN  332



>ref|XP_008236638.1| PREDICTED: peroxidase 10 [Prunus mume]
Length=332

 Score =   457 bits (1176),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 222/308 (72%), Positives = 261/308 (85%), Gaps = 3/308 (1%)
 Frame = -3

Query  1281  PMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLL  1102
             P A SQLDY FYD+SCP L MIVR+ +W+AIRND+R+AASL+R+HFHDC VNGCDGSVLL
Sbjct  27    PFAYSQLDYNFYDRSCPRLSMIVRYNLWAAIRNDTRIAASLLRMHFHDCIVNGCDGSVLL  86

Query  1101  DDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGP  922
             DDT+ FKGEKN LPNR S RGFEVID+IKADVE+ CPSTVSC DILTLAAS AV ++GGP
Sbjct  87    DDTEDFKGEKNALPNRKSLRGFEVIDNIKADVERFCPSTVSCADILTLAASEAVVLAGGP  146

Query  921   YWRVLLGRRDGLTASEEA-TKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQ  745
             +W V LGRRDG TASE+A T+QLPSP E L++ITAKF+++GLD+KD+VVLSG H++GFAQ
Sbjct  147   FWPVPLGRRDGTTASEKAVTEQLPSPIEPLENITAKFTSKGLDIKDVVVLSGGHTLGFAQ  206

Query  744   CFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYT  565
             CFTFKRRLF++ GSGKPDPTL+SS L+NL+  CP  D +N+ LAPLD  +   FDN+YYT
Sbjct  207   CFTFKRRLFDFNGSGKPDPTLDSSALTNLRRLCPKKDSANSNLAPLD-STNLIFDNAYYT  265

Query  564   NLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQI  385
             NLV+NTGLLESDQAL+ +P TA MV  YSA P+ F  DFA SMVKLGN+GVLTGKD GQI
Sbjct  266   NLVSNTGLLESDQALVKDPNTAAMVNSYSANPFLFSNDFAASMVKLGNVGVLTGKD-GQI  324

Query  384   RKICGSVN  361
             RK CGSVN
Sbjct  325   RKKCGSVN  332



>ref|XP_006384450.1| hypothetical protein POPTR_0004s15200g [Populus trichocarpa]
 gb|ERP62247.1| hypothetical protein POPTR_0004s15200g [Populus trichocarpa]
Length=339

 Score =   448 bits (1152),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 213/296 (72%), Positives = 254/296 (86%), Gaps = 2/296 (1%)
 Frame = -3

Query  1245  DQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNG  1066
             D SCP L MIV++GVW+A +ND+R+AASL+RLHFHDCFVNGCD SVLLDDT  F+GEKN 
Sbjct  45    DSSCPRLGMIVKYGVWAAFKNDTRIAASLLRLHFHDCFVNGCDASVLLDDTINFRGEKNA  104

Query  1065  LPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRDGL  886
             LPNRNSARG+EVI+SIKADVEKACPSTVSC DIL LAA  +V +SGGPY+ + LG  DGL
Sbjct  105   LPNRNSARGYEVIESIKADVEKACPSTVSCVDILALAARESVLLSGGPYYPLSLGGLDGL  164

Query  885   TASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQ  709
             TASE+A  +QLPSPFE L++ITAKF+++GLD+KD+VVLSGAH++GFAQCF+FKRRLF+++
Sbjct  165   TASEKAANEQLPSPFEPLENITAKFASKGLDIKDVVVLSGAHTIGFAQCFSFKRRLFDFK  224

Query  708   GSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLESD  529
             G+GKPDPTL+SS ++NLQ TCPN D SN+KLAPLD  STYRFDN+YY NLVN TGLLESD
Sbjct  225   GTGKPDPTLDSSAVANLQGTCPNKDASNSKLAPLDSASTYRFDNAYYVNLVNRTGLLESD  284

Query  528   QALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
             QALM + +TA MV  YS+  Y F  DFA+SMVK+ NLG+LTG  NGQIRK CGSVN
Sbjct  285   QALMGDSKTAAMVTAYSSNSYLFSADFASSMVKMSNLGILTGS-NGQIRKKCGSVN  339



>gb|AHL39134.1| class III peroxidase [Populus trichocarpa]
Length=337

 Score =   447 bits (1151),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 212/296 (72%), Positives = 254/296 (86%), Gaps = 2/296 (1%)
 Frame = -3

Query  1245  DQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNG  1066
             D SCP L MIV++GVW+A +ND+R+AASL+RLHFHDCFVNGCD S+LLDDT  F+GEKN 
Sbjct  43    DSSCPRLGMIVKYGVWAAFKNDTRIAASLLRLHFHDCFVNGCDASILLDDTINFRGEKNA  102

Query  1065  LPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRDGL  886
             LPNRNSARG+EVI+SIKADVEKACPSTVSC DIL LAA  +V +SGGPY+ + LG  DGL
Sbjct  103   LPNRNSARGYEVIESIKADVEKACPSTVSCVDILALAARESVLLSGGPYYPLSLGGLDGL  162

Query  885   TASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQ  709
             TASE+A  +QLPSPFE L++ITAKF+++GLD+KD+VVLSGAH++GFAQCF+FKRRLF+++
Sbjct  163   TASEKAANEQLPSPFEPLENITAKFASKGLDIKDVVVLSGAHTIGFAQCFSFKRRLFDFK  222

Query  708   GSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLESD  529
             G+GKPDPTL+SS ++NLQ TCPN D SN+KLAPLD  STYRFDN+YY NLVN TGLLESD
Sbjct  223   GTGKPDPTLDSSAVANLQGTCPNKDASNSKLAPLDSASTYRFDNAYYVNLVNRTGLLESD  282

Query  528   QALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
             QALM + +TA MV  YS+  Y F  DFA+SMVK+ NLG+LTG  NGQIRK CGSVN
Sbjct  283   QALMGDSKTAAMVTAYSSNSYLFSADFASSMVKMSNLGILTGS-NGQIRKKCGSVN  337



>ref|XP_010107984.1| Peroxidase 10 [Morus notabilis]
 gb|EXC17384.1| Peroxidase 10 [Morus notabilis]
Length=336

 Score =   446 bits (1148),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 219/325 (67%), Positives = 262/325 (81%), Gaps = 7/325 (2%)
 Frame = -3

Query  1317  ISLVVFLGFL----AAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRL  1150
             I   VFL F       P+A SQLDY FYD SCP L MIVR  VW+AIRND+R+AASL+RL
Sbjct  12    IPFYVFLLFFPFVQVHPVAYSQLDYRFYDWSCPRLQMIVRNNVWAAIRNDARIAASLLRL  71

Query  1149  HFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKAC-PSTVSCT  973
             HFHDC V+GCD SVLLDDT+ F+GEKN  PNRNS RGF+VID IKADVE  C P TVSCT
Sbjct  72    HFHDCIVDGCDSSVLLDDTEDFQGEKNAFPNRNSLRGFDVIDRIKADVENFCVPQTVSCT  131

Query  972   DILTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLD  796
             DILTLAA  AVG+SGGP+W VLLGRRDG TAS++ A +Q+P P +SLK ITAKF+A+GLD
Sbjct  132   DILTLAAREAVGLSGGPFWPVLLGRRDGTTASQQSANQQIPFPSDSLKTITAKFTAKGLD  191

Query  795   LKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKL  616
             LKD+VVLSGAH++GFAQCFTFK RLFN++GSG PDP+L+ S LS+LQ+TCPN+D SNT L
Sbjct  192   LKDVVVLSGAHTIGFAQCFTFKSRLFNFKGSGNPDPSLDPSVLSSLQSTCPNIDSSNTNL  251

Query  615   APLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSM  436
             APLD  ST+RFDN+YY N++  TGLL+SDQAL+ +P+ A +V  YS  P+ F  DFA SM
Sbjct  252   APLDSHSTFRFDNTYYGNVIKKTGLLQSDQALLDDPRAAALVNSYSNNPFLFSRDFAASM  311

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             VKL N+G+LTG+D G+IR+ CGSVN
Sbjct  312   VKLVNVGILTGQD-GEIREKCGSVN  335



>gb|KDP38237.1| hypothetical protein JCGZ_04880 [Jatropha curcas]
Length=286

 Score =   444 bits (1141),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 214/287 (75%), Positives = 245/287 (85%), Gaps = 2/287 (1%)
 Frame = -3

Query  1218  IVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARG  1039
             +V++GVW+A+RND+R+AAS++RLHFHDCFVNGCDGS+LLDDT   KGEKN LPNRNSARG
Sbjct  1     MVKYGVWAALRNDTRIAASILRLHFHDCFVNGCDGSILLDDTNEMKGEKNALPNRNSARG  60

Query  1038  FEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATK-  862
             FEVIDSIK DVE+ CPSTVSCTDIL LAA  AV +SGGPYW V LGRRDGLTASE+A   
Sbjct  61    FEVIDSIKEDVERYCPSTVSCTDILALAAREAVLLSGGPYWSVPLGRRDGLTASEKAAND  120

Query  861   QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTL  682
              LPSPFESL +ITAKF++ GLDLKD+VVLSGAH++GFAQCFTFK RLF+++GSGKPDP L
Sbjct  121   NLPSPFESLANITAKFTSNGLDLKDVVVLSGAHTLGFAQCFTFKNRLFDFKGSGKPDPAL  180

Query  681   ESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQT  502
             +SS L+NLQT CPN D SN+ LAPLD  S YRFDNSYYTNLV+NTGLLESDQALM + +T
Sbjct  181   DSSLLTNLQTMCPNKDTSNSNLAPLDSASAYRFDNSYYTNLVSNTGLLESDQALMGDSRT  240

Query  501   ADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
               MV  YS+YPY F  DFA SMVKLGN+GVLTGK  GQIRK C +VN
Sbjct  241   LAMVNSYSSYPYLFSNDFAASMVKLGNVGVLTGK-KGQIRKNCRAVN  286



>ref|XP_011001197.1| PREDICTED: peroxidase 10 [Populus euphratica]
Length=338

 Score =   443 bits (1140),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 214/312 (69%), Positives = 260/312 (83%), Gaps = 6/312 (2%)
 Frame = -3

Query  1281  PMAESQLDYLFY----DQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDG  1114
             P A  Q+DY +     D+SCP+L MIV++GVW+A +ND+R+AASL+RLHFHDCFVNGCD 
Sbjct  28    PSANGQIDYNYNYNYYDRSCPSLGMIVKYGVWAAFKNDTRIAASLLRLHFHDCFVNGCDA  87

Query  1113  SVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGM  934
             S+LLDDT  F+GEKN LPNRNSARG+EVI+SIKADVEKACPSTVSC DIL LAA  +V +
Sbjct  88    SILLDDTIDFRGEKNALPNRNSARGYEVIESIKADVEKACPSTVSCVDILALAARESVLL  147

Query  933   SGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSV  757
             SGGPY+ + LG  DGLTASE+A  +QLPSPFE L++ITAKF+++GLD+KD+VVLSGAH++
Sbjct  148   SGGPYYPLSLGGLDGLTASEKAANEQLPSPFEPLENITAKFTSKGLDIKDVVVLSGAHTI  207

Query  756   GFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDN  577
             GFAQCF FKRRLF+++G+GKPDPTL+SS ++NLQ  CPN D SN+KLAPLD  STYRFDN
Sbjct  208   GFAQCFAFKRRLFDFKGTGKPDPTLDSSAVANLQGMCPNKDASNSKLAPLDSVSTYRFDN  267

Query  576   SYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKD  397
             +YY NLVN T LLESDQALM + +TA MV  YS+  Y F  DFA+SMVK+ N+G+LTG  
Sbjct  268   AYYVNLVNRTALLESDQALMGDSKTAAMVTAYSSNSYLFSADFASSMVKMSNIGILTGS-  326

Query  396   NGQIRKICGSVN  361
             NGQIRK CGSVN
Sbjct  327   NGQIRKQCGSVN  338



>ref|XP_004290337.1| PREDICTED: peroxidase 10-like [Fragaria vesca subsp. vesca]
Length=332

 Score =   442 bits (1138),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 211/303 (70%), Positives = 254/303 (84%), Gaps = 3/303 (1%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QLDY FYD++CP L MIV++ VW+A++ND+RMAASL+R+HFHDC V+GC+GSVLLDDT+ 
Sbjct  31    QLDYNFYDRTCPRLPMIVKYNVWAAVKNDTRMAASLLRMHFHDCIVDGCEGSVLLDDTED  90

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
             F+GEKN  PNRNS RGFEVID+IK D+E+ CPSTVSC DILTLAA  AV ++GGPYW V 
Sbjct  91    FRGEKNAPPNRNSLRGFEVIDNIKIDLERFCPSTVSCADILTLAAREAVVLAGGPYWNVP  150

Query  906   LGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRDG TASE+ A +Q+PSP ESL+ ITAKF+++GLD+KD+VVLSG H++GFAQCFTFK
Sbjct  151   LGRRDGTTASEKSANEQIPSPIESLQKITAKFTSKGLDIKDVVVLSGGHTIGFAQCFTFK  210

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
             RRLFN+ GSG PDPTL+SS L+NLQ+ CPN D +N+ LAPLD  STY+FDN YYT+LVNN
Sbjct  211   RRLFNFDGSGNPDPTLDSSVLTNLQSMCPNKDTANSNLAPLD-SSTYKFDNVYYTSLVNN  269

Query  549   TGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICG  370
              GLLESDQAL+ +P TA MV  YS  P+ F  DFA SMVKLGN+GVLTG+  G IRK CG
Sbjct  270   AGLLESDQALVKDPNTAAMVNSYSGNPFLFSQDFAASMVKLGNVGVLTGQ-KGHIRKRCG  328

Query  369   SVN  361
             SVN
Sbjct  329   SVN  331



>ref|XP_002313091.1| hypothetical protein POPTR_0009s10960g [Populus trichocarpa]
 gb|EEE87046.1| hypothetical protein POPTR_0009s10960g [Populus trichocarpa]
Length=301

 Score =   440 bits (1132),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 208/294 (71%), Positives = 248/294 (84%), Gaps = 2/294 (1%)
 Frame = -3

Query  1239  SCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLP  1060
             SCP L MIV++GVW+A +ND+R+AASL+RLHFHDCFVNGCD S+LLDDT  F+GEKN  P
Sbjct  9     SCPRLGMIVKYGVWAAFKNDTRIAASLLRLHFHDCFVNGCDASILLDDTIDFRGEKNAFP  68

Query  1059  NRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRDGLTA  880
             NRNS RG+EVI+SIKADVE AC STVSC DILTLAA  +V +SGGPY+ +  GRRDGLTA
Sbjct  69    NRNSVRGYEVIESIKADVENACSSTVSCADILTLAARESVLLSGGPYYPLSFGRRDGLTA  128

Query  879   SEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGS  703
             SE+A  +QLPSP E L++ITAKF+++GLD+KD+ VLSGAH++GFAQCFTFKRRLF+++G+
Sbjct  129   SEKAANEQLPSPIEPLENITAKFTSKGLDMKDVAVLSGAHTIGFAQCFTFKRRLFDFKGT  188

Query  702   GKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQA  523
             GKPDPTLES  L+NLQ  CPN D SN+ LAPLDY STYRFDN+YY NLVN+TGLLESDQA
Sbjct  189   GKPDPTLESLALTNLQGMCPNKDASNSNLAPLDYASTYRFDNAYYVNLVNSTGLLESDQA  248

Query  522   LMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
             LM +P+TA +V  YS+  Y F  DFA+SM KL NLG+LTG  NGQIRK CGSVN
Sbjct  249   LMGDPRTAALVTAYSSNSYLFSADFASSMTKLSNLGILTGS-NGQIRKKCGSVN  301



>gb|AHL39161.1| class III peroxidase [Populus trichocarpa]
Length=337

 Score =   441 bits (1134),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 213/312 (68%), Positives = 256/312 (82%), Gaps = 6/312 (2%)
 Frame = -3

Query  1281  PMAESQLDYLFY----DQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDG  1114
             P    Q+DY +     D+SCP L MIV++GVW+A +ND+R+AASL+RLHFHDCFVNGCD 
Sbjct  27    PFGSGQIDYNYNYNYYDRSCPRLGMIVKYGVWAAFKNDTRIAASLLRLHFHDCFVNGCDA  86

Query  1113  SVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGM  934
             S+LLDDT  F+GEKN  PNRNS RG+EVI+SIKADVE AC STVSC DILTLAA  +V +
Sbjct  87    SILLDDTIDFRGEKNAFPNRNSVRGYEVIESIKADVENACSSTVSCADILTLAARESVLL  146

Query  933   SGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSV  757
             SGGPY+ +  GRRDGLTASE+A  +QLPSP E L++ITAKF+++GLD+KD+ VLSGAH++
Sbjct  147   SGGPYYPLSFGRRDGLTASEKAANEQLPSPIEPLENITAKFTSKGLDMKDVAVLSGAHTI  206

Query  756   GFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDN  577
             GFAQCFTFKRRLF+++G+GKPDPTLES  L+NLQ  CPN D SN+ LAPLDY STYRFDN
Sbjct  207   GFAQCFTFKRRLFDFKGTGKPDPTLESLALTNLQGMCPNKDASNSNLAPLDYASTYRFDN  266

Query  576   SYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKD  397
             +YY NLVN+TGLLESDQALM +P+TA +V  YS+  Y F  DFA+SM KL NLG+LTG  
Sbjct  267   AYYVNLVNSTGLLESDQALMGDPRTAALVTAYSSNSYLFSADFASSMTKLSNLGILTGS-  325

Query  396   NGQIRKICGSVN  361
             NGQIRK CGSVN
Sbjct  326   NGQIRKKCGSVN  337



>gb|KDO49149.1| hypothetical protein CISIN_1g020451mg [Citrus sinensis]
Length=326

 Score =   438 bits (1127),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 214/304 (70%), Positives = 244/304 (80%), Gaps = 2/304 (1%)
 Frame = -3

Query  1269  SQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTK  1090
             S   Y  +D SCP L MIVR GVW A R D+R+AASL+RLHFHDCF+ GCD S+LLDDT 
Sbjct  24    SSFPYSQFDGSCPYLPMIVRNGVWDAFRKDNRIAASLLRLHFHDCFIIGCDASILLDDTN  83

Query  1089  GFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRV  910
              FKGEKN +PNRNSARG+EVIDSIKADVEKACP ++SC DIL LAA  AV +SGGPYW+V
Sbjct  84    DFKGEKNAVPNRNSARGYEVIDSIKADVEKACPLSISCADILALAAREAVVLSGGPYWQV  143

Query  909   LLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTF  733
              LGRRDGLTASE A   QLPSPFE L +I AKF A+GLD+KD+VVLSGAH++GFAQC TF
Sbjct  144   QLGRRDGLTASESAANAQLPSPFEPLDNIVAKFLAKGLDIKDVVVLSGAHTIGFAQCITF  203

Query  732   KRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVN  553
             K RLFNY+GSG+PDP L+SS L +L+T CPN D SN+ LAPLD  S YRFDN YYTNLV 
Sbjct  204   KNRLFNYKGSGQPDPALDSSALPDLKTICPNQDSSNSNLAPLDSPSAYRFDNVYYTNLVR  263

Query  552   NTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKIC  373
              TGLLESDQALM +P+TA +VK YS  PY FY DFATSMVK+ N+G+L GKD GQIRK C
Sbjct  264   RTGLLESDQALMGDPRTAALVKAYSMNPYLFYNDFATSMVKMSNIGILAGKD-GQIRKSC  322

Query  372   GSVN  361
               VN
Sbjct  323   RFVN  326



>ref|XP_006480139.1| PREDICTED: peroxidase 10-like [Citrus sinensis]
Length=326

 Score =   438 bits (1127),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 214/304 (70%), Positives = 244/304 (80%), Gaps = 2/304 (1%)
 Frame = -3

Query  1269  SQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTK  1090
             S   Y  +D SCP L MIVR GVW A R D+R+AASL+RLHFHDCF+ GCD S+LLDDT 
Sbjct  24    SSFPYSQFDGSCPYLPMIVRNGVWDAFRKDNRIAASLLRLHFHDCFIIGCDASILLDDTN  83

Query  1089  GFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRV  910
              FKGEKN +PNRNSARG+EVIDSIKADVEKACP ++SC DIL LAA  AV +SGGPYW+V
Sbjct  84    DFKGEKNAVPNRNSARGYEVIDSIKADVEKACPLSISCADILALAAREAVVLSGGPYWQV  143

Query  909   LLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTF  733
              LGRRDGLTASE A   QLPSPFE L +I AKF A+GLD+KD+VVLSGAH++GFAQC  F
Sbjct  144   QLGRRDGLTASESAANAQLPSPFEPLDNIVAKFLAKGLDIKDVVVLSGAHTLGFAQCIAF  203

Query  732   KRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVN  553
             K RLFNY+GSG+PDP L+SS L +L+T CPN D SN+ LAPLD  S YRFDN YYTNLV 
Sbjct  204   KNRLFNYKGSGQPDPALDSSALPDLKTICPNQDSSNSNLAPLDSPSAYRFDNVYYTNLVR  263

Query  552   NTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKIC  373
              TGLLESDQALM +P+TA +VK YS  PY FY DFATSMVK+ N+G+LTGKD GQIRK C
Sbjct  264   RTGLLESDQALMGDPRTAALVKVYSMNPYLFYNDFATSMVKMSNIGILTGKD-GQIRKSC  322

Query  372   GSVN  361
               VN
Sbjct  323   RFVN  326



>ref|XP_006466643.1| PREDICTED: peroxidase 10-like [Citrus sinensis]
Length=329

 Score =   438 bits (1127),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 211/319 (66%), Positives = 255/319 (80%), Gaps = 5/319 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             +S V+FL  L +     QLDY +YD +CP+L  IVR+GVWSAI N++RMAASL+RLHFHD
Sbjct  16    LSCVMFLSTLVS----CQLDYKYYDDTCPSLTRIVRYGVWSAISNETRMAASLLRLHFHD  71

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFV GCDGSVLLDDT   KGEKN  PNRNSARGFEVID+IKA++EKACP+TVSCTDILTL
Sbjct  72    CFVKGCDGSVLLDDTSTTKGEKNAFPNRNSARGFEVIDAIKANLEKACPATVSCTDILTL  131

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
              A  AV + GGP+W V LGRRDGLTASE     LPSPFE L++ITAKF+A+GLDLKD+VV
Sbjct  132   VAREAVFLGGGPFWAVPLGRRDGLTASESEANNLPSPFEPLQNITAKFTARGLDLKDVVV  191

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSG H++GFAQC +FK RLF++ GSGKPDPTL++S L +LQ+TCP+   S+TKL  LD  
Sbjct  192   LSGGHTIGFAQCLSFKNRLFDFSGSGKPDPTLDASLLQSLQSTCPSQADSDTKLVALDSV  251

Query  597   STYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNL  418
             +T +FDN Y+ NLVN +GLL+SDQALM + +TA MV+YYS YPY F  DF  SMVK+ N+
Sbjct  252   TTNKFDNIYFQNLVNKSGLLQSDQALMGDNRTAAMVQYYSKYPYFFSKDFGASMVKMANI  311

Query  417   GVLTGKDNGQIRKICGSVN  361
             GVLTG+D G+IRK C  VN
Sbjct  312   GVLTGQD-GEIRKNCRVVN  329



>ref|XP_004288061.1| PREDICTED: peroxidase 10-like [Fragaria vesca subsp. vesca]
Length=330

 Score =   438 bits (1127),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 213/325 (66%), Positives = 261/325 (80%), Gaps = 4/325 (1%)
 Frame = -3

Query  1329  VMVAISLVVFLGFLAAPMAESQ-LDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIR  1153
             ++  ++L  FL F++ P+  SQ L+Y FYD SCPNL  IV+ GVWSAI NDSR+AASL+R
Sbjct  8     LLTCVTLFCFL-FISPPLVSSQQLNYKFYDSSCPNLTKIVQQGVWSAIANDSRIAASLLR  66

Query  1152  LHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCT  973
             LHFHDCFVNGCD SVLLDDT   +GEKN  PN++SARGFEVID IK+++E+ACPSTVSCT
Sbjct  67    LHFHDCFVNGCDASVLLDDTSTLQGEKNAFPNKDSARGFEVIDKIKSNLEEACPSTVSCT  126

Query  972   DILTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQ-LPSPFESLKDITAKFSAQGLD  796
             DILTLAA+ AV  SGGPYW V LGRRDG TAS++A    LPSPFE L++ITAKF+A+GLD
Sbjct  127   DILTLAATSAVYFSGGPYWPVALGRRDGTTASKDAANNDLPSPFEPLENITAKFTAKGLD  186

Query  795   LKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKL  616
             +KD+VVLSGAH++GFAQCFTFK RLFN+  SGKPDPTL++S L+NLQ+ CPN   S+TKL
Sbjct  187   MKDVVVLSGAHTIGFAQCFTFKPRLFNFDDSGKPDPTLDTSLLTNLQSVCPNQADSDTKL  246

Query  615   APLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSM  436
             APLD  ++ +FDN Y+  LVNN+GLL+SDQ LM + +TA MV  YS +PY F  DF  SM
Sbjct  247   APLDPVTSTKFDNVYFKRLVNNSGLLQSDQVLMGDNRTASMVISYSRFPYLFNKDFGASM  306

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             VK+ N+GVLTG+ +GQIRK C  VN
Sbjct  307   VKMANIGVLTGQ-SGQIRKNCRVVN  330



>ref|XP_006425837.1| hypothetical protein CICLE_v10026130mg [Citrus clementina]
 gb|ESR39077.1| hypothetical protein CICLE_v10026130mg [Citrus clementina]
 gb|KDO37975.1| hypothetical protein CISIN_1g021592mg [Citrus sinensis]
Length=310

 Score =   436 bits (1120),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 206/306 (67%), Positives = 248/306 (81%), Gaps = 1/306 (0%)
 Frame = -3

Query  1278  MAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLD  1099
             +   QLDY +YD +CP+L  IVR+GVWSAI N++RMAASL+RLHFHDCFV GCDGSVLLD
Sbjct  6     LVSCQLDYKYYDDTCPSLTRIVRYGVWSAISNETRMAASLLRLHFHDCFVKGCDGSVLLD  65

Query  1098  DTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPY  919
             DT   KGEKN  PNRNSARGFEVID+IKA++EKACP+TVSCTDILTL A  AV + GGP+
Sbjct  66    DTSTTKGEKNAFPNRNSARGFEVIDAIKANLEKACPATVSCTDILTLVAREAVFLGGGPF  125

Query  918   WRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCF  739
             W V LGRRDGLTASE     LPSPFE L++ITAKF+A+GLDLKD+VVLSG H++GFAQC 
Sbjct  126   WAVPLGRRDGLTASESEANNLPSPFEPLQNITAKFTARGLDLKDVVVLSGGHTIGFAQCL  185

Query  738   TFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             +FK RLF++ GSGKPDPTL++S L +LQ+TCP+   S+TKL  LD  +T +FDN Y+ NL
Sbjct  186   SFKNRLFDFSGSGKPDPTLDASLLQSLQSTCPSQADSDTKLVALDSVTTNKFDNIYFQNL  245

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             VN +GLL+SDQALM + +TA MV+YYS YPY F  DF  SMVK+ N+GVLTG+D G+IRK
Sbjct  246   VNKSGLLQSDQALMGDNRTAAMVQYYSKYPYFFSKDFGASMVKMANIGVLTGQD-GEIRK  304

Query  378   ICGSVN  361
              C  VN
Sbjct  305   NCRVVN  310



>ref|XP_009586909.1| PREDICTED: peroxidase 10-like [Nicotiana tomentosiformis]
Length=327

 Score =   436 bits (1121),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 212/319 (66%), Positives = 256/319 (80%), Gaps = 4/319 (1%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             SL+ F+ FL++     QLDY +YD +CPNL  IVR+G+WSAI N++RMAASL+RLHFHDC
Sbjct  12    SLICFI-FLSS-FVYGQLDYKYYDATCPNLTKIVRYGIWSAISNETRMAASLLRLHFHDC  69

Query  1134  FVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLA  955
             FVNGCDGSVLLDDT  F GEKN   NRNSARGFEVID+IKA+VEKACPSTVSC DILTLA
Sbjct  70    FVNGCDGSVLLDDTSTFTGEKNASANRNSARGFEVIDTIKANVEKACPSTVSCADILTLA  129

Query  954   ASYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVV  778
             A  A+ ++GGPYW V LGRRD LTAS+ A   Q+PSPFE L++ITAKF ++GLD+KD+VV
Sbjct  130   AREAIYLTGGPYWSVSLGRRDSLTASQSAANAQIPSPFEPLENITAKFVSKGLDVKDVVV  189

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSG+H++GFAQCFTFK+RLF++ GSG PDPTL+SS L NL++ CPN   S++ LAPLD  
Sbjct  190   LSGSHTIGFAQCFTFKQRLFDFDGSGNPDPTLDSSLLGNLRSVCPNQSDSDSNLAPLDAV  249

Query  597   STYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNL  418
             +  +FDN Y+ NL+NN+GLL+SDQALM +  TA MV  YS YPY F   FA SMVKL NL
Sbjct  250   TINKFDNVYFKNLMNNSGLLQSDQALMNDNNTASMVSTYSKYPYLFSKAFAASMVKLTNL  309

Query  417   GVLTGKDNGQIRKICGSVN  361
             GVLTG+D G+IRK C  VN
Sbjct  310   GVLTGQD-GEIRKNCRLVN  327



>ref|XP_010268504.1| PREDICTED: peroxidase 10 [Nelumbo nucifera]
Length=330

 Score =   436 bits (1120),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 206/308 (67%), Positives = 251/308 (81%), Gaps = 3/308 (1%)
 Frame = -3

Query  1281  PMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLL  1102
             P+   +LDY  Y+  CP+L  IV++GVW+A++N++R+AASL+RLHFHDC VNGCDGSVLL
Sbjct  25    PVGHCELDYYIYNNKCPDLFRIVKYGVWAAVQNETRIAASLLRLHFHDCLVNGCDGSVLL  84

Query  1101  DDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGP  922
             D T  F  EKN LPNRNSARGFEVI+ IKADVE ACPS VSC DIL +AA  AV ++GGP
Sbjct  85    DATAKFTSEKNALPNRNSARGFEVIEKIKADVEAACPSIVSCADILAIAARDAVVVAGGP  144

Query  921   YWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQ  745
             +W V LGRRDG TASEE A +QLPSPFESL +ITAKF+++GL+LKD+VVLSGAH++G+AQ
Sbjct  145   FWLVPLGRRDGTTASEETANQQLPSPFESLNNITAKFTSKGLELKDVVVLSGAHTIGYAQ  204

Query  744   CFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYT  565
             CFTFKRRLF++ GSGKPD +L+S+ L NLQ+TCP   GS++ LAPLD  S  +FDN YY+
Sbjct  205   CFTFKRRLFDFNGSGKPDKSLDSTLLQNLQSTCPK-GGSDSNLAPLDSASASKFDNGYYS  263

Query  564   NLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQI  385
             NL  ++GLLESDQALM +P TA +V  Y+ YPY FY DFA SMVK+GNLGVLTG + GQI
Sbjct  264   NLAKSSGLLESDQALMNDPTTASIVNSYTQYPYLFYKDFAESMVKMGNLGVLTG-NKGQI  322

Query  384   RKICGSVN  361
             RK CGSVN
Sbjct  323   RKKCGSVN  330



>ref|XP_009780492.1| PREDICTED: peroxidase 10-like [Nicotiana sylvestris]
Length=327

 Score =   434 bits (1117),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 215/327 (66%), Positives = 261/327 (80%), Gaps = 4/327 (1%)
 Frame = -3

Query  1338  KS*VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASL  1159
             KS + +  SL  FL FL++ +   QLDY +YD +CPNL  IVR+G+WSAI N++RMAASL
Sbjct  4     KSHMPLTNSLFCFL-FLSSFVC-GQLDYKYYDATCPNLTKIVRYGIWSAISNETRMAASL  61

Query  1158  IRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVS  979
             +RLHFHDCFVNGCDGSVLLDDT  F GEKN   NRNSARGFEVID+IKA+VEKACPSTVS
Sbjct  62    LRLHFHDCFVNGCDGSVLLDDTSTFTGEKNAPANRNSARGFEVIDAIKANVEKACPSTVS  121

Query  978   CTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQG  802
             C DILTLAA  A+ ++GGPYW V LGRRD LTAS+ A   Q+PSPFE L++ITAKF ++G
Sbjct  122   CADILTLAAREAIYLTGGPYWSVSLGRRDSLTASQSAANAQIPSPFEPLENITAKFVSKG  181

Query  801   LDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNT  622
             LD+KD+VVLSGAH++GFAQCFTFK+RLF++ GSG PDPTL+SS L NL++ CPN + S++
Sbjct  182   LDIKDVVVLSGAHTIGFAQCFTFKQRLFDFDGSGNPDPTLDSSLLGNLRSVCPNQNDSDS  241

Query  621   KLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFAT  442
              LAPLD  +  +FDN Y+ NL+NN+GLL+SDQALM +  TA +V  YS YPY F   FA 
Sbjct  242   NLAPLDAVTINKFDNVYFKNLMNNSGLLQSDQALMNDNNTASLVSTYSKYPYLFSKAFAA  301

Query  441   SMVKLGNLGVLTGKDNGQIRKICGSVN  361
             SMVKL NLGVLTG+D G+IRK C  VN
Sbjct  302   SMVKLTNLGVLTGQD-GEIRKNCRLVN  327



>ref|XP_008338282.1| PREDICTED: peroxidase 10 [Malus domestica]
Length=328

 Score =   431 bits (1107),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 208/303 (69%), Positives = 244/303 (81%), Gaps = 2/303 (1%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QLD+ FYD +CPNL  IV+ GVWSAI ND+R+AASL+RLHFHDCFVNGCD S+LLDDT G
Sbjct  25    QLDFKFYDSTCPNLTKIVQSGVWSAIANDTRIAASLLRLHFHDCFVNGCDASLLLDDTSG  84

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
             FKGEKN  PN+NSARGFEVID+IK+ VE+ACPSTVSCTDI+TL +  AV  SGGPYW V 
Sbjct  85    FKGEKNAAPNKNSARGFEVIDTIKSKVEEACPSTVSCTDIITLVSRAAVYFSGGPYWPVP  144

Query  906   LGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRDG TASE+ A KQLPSPFE L +ITAKF+A+GLDLKD+VVLSGAH++GFAQCFTFK
Sbjct  145   LGRRDGTTASEDAANKQLPSPFEPLXNITAKFTAKGLDLKDVVVLSGAHTIGFAQCFTFK  204

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
              RLFN+  SGKPDPTL++S L NLQ+ CPN   S+T L P D  ++ +FDN YY  LVNN
Sbjct  205   TRLFNFDDSGKPDPTLDTSRLQNLQSVCPNQADSDTNLVPFDPVTSAKFDNIYYKTLVNN  264

Query  549   TGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICG  370
             +GLL+SDQ LM + +TA MV  YS +P+ F  DF  SMVK+ NLGVLTG  NG+IRK C 
Sbjct  265   SGLLQSDQVLMGDNRTASMVLSYSKFPFLFNNDFGASMVKMANLGVLTGS-NGEIRKNCR  323

Query  369   SVN  361
              VN
Sbjct  324   VVN  326



>ref|XP_010028506.1| PREDICTED: peroxidase 10 [Eucalyptus grandis]
 gb|KCW55244.1| hypothetical protein EUGRSUZ_I01176 [Eucalyptus grandis]
Length=331

 Score =   431 bits (1107),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 211/323 (65%), Positives = 257/323 (80%), Gaps = 3/323 (1%)
 Frame = -3

Query  1326  MVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLH  1147
             +  ISL++ +    A     QL   +YD SCP L  IVR  VW+A + D+R+AASL+RLH
Sbjct  11    ITLISLILAVSCFPAHSPIGQLSPYYYDGSCPRLQWIVRSNVWAAFQKDTRIAASLLRLH  70

Query  1146  FHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             FHDC V+GC+GSVLLDDT   KGEKN LPNRNS RGFEVID+IKAD+E  CP TVSCTDI
Sbjct  71    FHDCIVDGCEGSVLLDDTVDMKGEKNALPNRNSLRGFEVIDAIKADLENFCPFTVSCTDI  130

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLK  790
             LTLAA  AV MSGGPYW VLLGRRDG+TAS++ A +Q+PSP E L +I AKF+++GL+LK
Sbjct  131   LTLAAREAVYMSGGPYWAVLLGRRDGITASDKSANEQIPSPIEPLDNIIAKFTSKGLELK  190

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             D+VVLSG H++GFAQCFTFKRRLFN++GSGKPDPTL++S LS+LQ+TCPN D SNT LAP
Sbjct  191   DVVVLSGGHTIGFAQCFTFKRRLFNFKGSGKPDPTLDTSLLSSLQSTCPNKDASNTNLAP  250

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             LD  +  +FDN YY NLVNN+GLLESDQAL+A+ + A +V  Y+  P  FY DFA SM+K
Sbjct  251   LD-STVDKFDNYYYANLVNNSGLLESDQALIADARAAPLVNSYTTNPTLFYNDFAASMLK  309

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             LGN+G+LTG+ +GQIRK CGSVN
Sbjct  310   LGNVGILTGQ-SGQIRKQCGSVN  331



>ref|XP_009366808.1| PREDICTED: peroxidase 10 [Pyrus x bretschneideri]
Length=327

 Score =   429 bits (1104),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 207/303 (68%), Positives = 242/303 (80%), Gaps = 2/303 (1%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QLD+ FYD +CPNL  IV +GVWSAI ND+R+AASL+RLHFHDCFVNGCD S+LLDDT  
Sbjct  25    QLDFKFYDSTCPNLTKIVHFGVWSAIANDTRIAASLLRLHFHDCFVNGCDASLLLDDTSS  84

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
             FKGEKN  PN+NSARGFEVID+IK+ VE+ACPSTVSCTDI+TL    AV  SGGPYW V 
Sbjct  85    FKGEKNAAPNKNSARGFEVIDTIKSKVEEACPSTVSCTDIITLVLRAAVYFSGGPYWPVP  144

Query  906   LGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRDG TASE+ A KQLPSPFE L++ITAKF+A+GLDLKD+VVLSGAH++GFAQCFTFK
Sbjct  145   LGRRDGTTASEDAANKQLPSPFEPLENITAKFTAKGLDLKDVVVLSGAHTIGFAQCFTFK  204

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
              RLFN+  SGKPDPTL++S L NLQ  CPN   S+T L P D  ++ +FDN YY  LVNN
Sbjct  205   TRLFNFDDSGKPDPTLDTSRLQNLQRVCPNQADSDTNLVPFDPVTSAKFDNIYYKTLVNN  264

Query  549   TGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICG  370
             +GLL+SDQ LM N +TA MV  YS +P+ F  DF  SMVK+ N+GVLTG  NG+IRK C 
Sbjct  265   SGLLQSDQVLMGNNRTASMVLSYSKFPFLFNNDFGASMVKMANIGVLTGS-NGEIRKNCR  323

Query  369   SVN  361
              VN
Sbjct  324   VVN  326



>ref|XP_008352500.1| PREDICTED: peroxidase 10-like [Malus domestica]
Length=328

 Score =   428 bits (1100),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 207/303 (68%), Positives = 243/303 (80%), Gaps = 2/303 (1%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QLD+ FYD +CPNL  IV+ GVWSAI ND+R+AASL+RLHFHDCFVNGCD S+LLDDT G
Sbjct  25    QLDFKFYDSTCPNLTKIVQSGVWSAIANDTRIAASLLRLHFHDCFVNGCDASLLLDDTSG  84

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
             FK EKN  PN+NSARGFEVID+IK+ VE+ACPSTVSCTDI+TL +  AV  SGGPYW V 
Sbjct  85    FKXEKNAAPNKNSARGFEVIDTIKSKVEEACPSTVSCTDIITLVSRAAVYFSGGPYWPVP  144

Query  906   LGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRDG TASE+ A KQLPSPFE L +ITAKF+A+GLDLKD+VVLSGAH++GFAQCFTFK
Sbjct  145   LGRRDGTTASEDAANKQLPSPFEPLXNITAKFTAKGLDLKDVVVLSGAHTIGFAQCFTFK  204

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
              RLFN+  SGKPDPTL++S L NLQ+ CPN   S+T L P D  ++ +FDN YY  LVNN
Sbjct  205   TRLFNFDDSGKPDPTLDTSRLQNLQSVCPNQADSDTNLVPFDPVTSAKFDNIYYKTLVNN  264

Query  549   TGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICG  370
             +GLL+SDQ LM + +TA MV  YS +P+ F  DF  SMVK+ NLGVLTG  NG+IRK C 
Sbjct  265   SGLLQSDQVLMGDNRTASMVLSYSKFPFLFNNDFGASMVKMANLGVLTGS-NGEIRKNCR  323

Query  369   SVN  361
              VN
Sbjct  324   VVN  326



>ref|XP_008241533.1| PREDICTED: peroxidase 10-like [Prunus mume]
Length=329

 Score =   427 bits (1098),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 207/318 (65%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -3

Query  1311  LVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCF  1132
             + +F     +P+   QLDY FYD +CPNL  IV+ GVWSAI NDSR+AASL+RLHFHDCF
Sbjct  8     VTLFCLLFLSPLVSCQLDYRFYDATCPNLTRIVQSGVWSAIANDSRIAASLLRLHFHDCF  67

Query  1131  VNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAA  952
             VNGCD S+LLDDT    GEKN   N+NS RGFEVID IK+ VE+ACPSTVSCTDI+TL +
Sbjct  68    VNGCDASLLLDDTGSLVGEKNAPGNKNSVRGFEVIDKIKSTVEEACPSTVSCTDIVTLVS  127

Query  951   SYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVL  775
               AV  SGGPYW V LGRRD  TASE A K QLPSPFE L++ITAKF+A+GLD+KD+VVL
Sbjct  128   RAAVYFSGGPYWPVPLGRRDSTTASENAVKEQLPSPFEPLENITAKFTAKGLDIKDLVVL  187

Query  774   SGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQS  595
             SGAH++GFAQCFTFK RLFN++ SGKPDPTL++S L NLQ+ CPN   S+T+LAPLD  +
Sbjct  188   SGAHTIGFAQCFTFKTRLFNFRESGKPDPTLDASLLQNLQSLCPNQADSDTQLAPLDPVT  247

Query  594   TYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLG  415
             + +FDN Y+ NLVNN+GLL SDQ LM N +TA MV  YS +P+ FY DF  SMV + N+G
Sbjct  248   STKFDNIYFKNLVNNSGLLLSDQVLMGNNRTASMVFGYSKFPFLFYRDFGASMVNMANIG  307

Query  414   VLTGKDNGQIRKICGSVN  361
             VLTG  NG+IRK C +VN
Sbjct  308   VLTGS-NGEIRKNCRAVN  324



>ref|XP_006338218.1| PREDICTED: peroxidase 10-like [Solanum tuberosum]
Length=327

 Score =   427 bits (1097),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 252/318 (79%), Gaps = 4/318 (1%)
 Frame = -3

Query  1311  LVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCF  1132
             L+ FL FL++     QLDY +YD +CPNL  IVR GVWSAI ND+RM ASL+RLHFHDCF
Sbjct  13    LLCFL-FLSS-FVNGQLDYKYYDTTCPNLTKIVRNGVWSAISNDTRMPASLLRLHFHDCF  70

Query  1131  VNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAA  952
             VNGCDGS+LLDDT  F GEKN  PNRNSARG+EVID+IKA+VEKACPSTVSCTDILTLAA
Sbjct  71    VNGCDGSILLDDTSTFTGEKNAFPNRNSARGYEVIDAIKANVEKACPSTVSCTDILTLAA  130

Query  951   SYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVL  775
               A+ ++ GP+W V LGRRD LTAS+ A   QLPSPFE L +ITAKF ++GLD+KD+VVL
Sbjct  131   REAIYLTRGPFWSVCLGRRDSLTASQSAANDQLPSPFEPLVNITAKFVSKGLDVKDVVVL  190

Query  774   SGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQS  595
             SGAH++GFAQCFTFKRRLF++ GSG PDPTL+SS L +L++ CPN   S++ LAPLD  +
Sbjct  191   SGAHTIGFAQCFTFKRRLFDFDGSGNPDPTLDSSLLGSLRSVCPNQSDSDSNLAPLDAVT  250

Query  594   TYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLG  415
               RFDN Y+ NL+NN+GLLESDQALM +  TA +V  YS  P  F  +FA SMVKL N+G
Sbjct  251   INRFDNVYFKNLMNNSGLLESDQALMNDNTTAALVSNYSRNPSLFSKEFAASMVKLINIG  310

Query  414   VLTGKDNGQIRKICGSVN  361
             VLTG+ NG+IRK C  VN
Sbjct  311   VLTGQ-NGEIRKNCRVVN  327



>ref|XP_010070503.1| PREDICTED: peroxidase 10-like [Eucalyptus grandis]
Length=325

 Score =   426 bits (1095),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 253/315 (80%), Gaps = 3/315 (1%)
 Frame = -3

Query  1302  FLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNG  1123
             F     +    SQL+Y FYD SCPNL  +VR+GVWSA+ N++RMAAS++RLHFHDC V+G
Sbjct  13    FCILFCSLFVSSQLNYKFYDDSCPNLTKLVRYGVWSAMANETRMAASILRLHFHDCLVDG  72

Query  1122  CDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYA  943
             C+GSVLLDDT   KGEKN   NRNSARGFEVID+IKA+VEKACP+ VSC DILTLAA  A
Sbjct  73    CEGSVLLDDTSTIKGEKNAFANRNSARGFEVIDAIKANVEKACPAMVSCADILTLAAREA  132

Query  942   VGMSGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGA  766
             V ++GG ++ V LGRRDGL++S+ A  +QLPSP E L++ITAKF+++GLD+KD+VVLSGA
Sbjct  133   VYLTGGQFYAVPLGRRDGLSSSDSAANEQLPSPLEPLENITAKFTSKGLDMKDVVVLSGA  192

Query  765   HSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYR  586
             H++GFAQCFTFK RLFN+ GSGKPDP L++SFL NLQ TCPN D S+TKLA LD  S  +
Sbjct  193   HTIGFAQCFTFKTRLFNFGGSGKPDPALDTSFLQNLQVTCPNQDDSDTKLAALDTTSD-K  251

Query  585   FDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLT  406
             FDN YY NL+NN+GLL+SDQALM + +TA  V YYS YP+ F+ DF  SMVK+ N+GVLT
Sbjct  252   FDNYYYKNLINNSGLLQSDQALMGDNRTAAAVMYYSKYPFLFWRDFGASMVKMANIGVLT  311

Query  405   GKDNGQIRKICGSVN  361
             G+ NGQIRK C +VN
Sbjct  312   GQ-NGQIRKNCRAVN  325



>ref|XP_007202220.1| hypothetical protein PRUPE_ppa008504mg [Prunus persica]
 gb|EMJ03419.1| hypothetical protein PRUPE_ppa008504mg [Prunus persica]
Length=329

 Score =   424 bits (1091),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 205/318 (64%), Positives = 249/318 (78%), Gaps = 2/318 (1%)
 Frame = -3

Query  1311  LVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCF  1132
             + +F     +P+   QL+Y FYD +CPNL  IV+ GVWSAI NDSR+AASL+RLHFHDCF
Sbjct  8     VTLFCLLFLSPLVSCQLNYRFYDATCPNLTRIVQSGVWSAIANDSRIAASLLRLHFHDCF  67

Query  1131  VNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAA  952
             VNGCD S+LLDDT    GEKN   N+NS RGFEVID+IK++VE+ACPSTVSCTDI+TL +
Sbjct  68    VNGCDASLLLDDTGSLIGEKNAPGNKNSVRGFEVIDTIKSNVEEACPSTVSCTDIITLVS  127

Query  951   SYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVL  775
               AV  SGGPYW V LGRRD  TASE A + QLPSPFE L++ITAKF+A+GLD+KD+VVL
Sbjct  128   RAAVYFSGGPYWPVPLGRRDSTTASENAVREQLPSPFEPLENITAKFTAKGLDIKDLVVL  187

Query  774   SGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQS  595
             SGAH++GFAQCFTFK RLFN+  SGKPDPTL++S L NLQ+ CPN   S+T+LAPLD  +
Sbjct  188   SGAHTIGFAQCFTFKTRLFNFGESGKPDPTLDASLLQNLQSLCPNQADSDTQLAPLDPVT  247

Query  594   TYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLG  415
             + +FDN Y+ NLVNN+GLL+SDQ LM N +TA MV  YS  P+ FY DF  SMV + N+G
Sbjct  248   STKFDNIYFKNLVNNSGLLQSDQVLMGNNRTASMVFGYSKLPFLFYRDFGASMVNMANIG  307

Query  414   VLTGKDNGQIRKICGSVN  361
             VLTG  NG+IRK C +VN
Sbjct  308   VLTGS-NGEIRKNCRAVN  324



>gb|EYU44369.1| hypothetical protein MIMGU_mgv1a018146mg [Erythranthe guttata]
Length=326

 Score =   424 bits (1091),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 251/320 (78%), Gaps = 5/320 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             I  +  L  LA     SQLDY FYD SCPNL  I+R+GVWSAI N++R+AASL+RLHFHD
Sbjct  11    IPFICLLSLLA--FGSSQLDYKFYDNSCPNLSKIIRYGVWSAIANETRIAASLLRLHFHD  68

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGC+GS+LLDD+  FKGEKN  PNRNS RGFEVID+IK ++EKACPSTVSCTDILTL
Sbjct  69    CFVNGCEGSILLDDSSNFKGEKNAFPNRNSVRGFEVIDAIKQNLEKACPSTVSCTDILTL  128

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASE-EATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A   AV +SGGP+W V LGRRDGLTASE  A   LPSPFE L++ITAKF ++GLD+KDMV
Sbjct  129   ATRDAVFLSGGPFWPVSLGRRDGLTASEASANTDLPSPFEPLENITAKFISKGLDVKDMV  188

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSG H++GFAQC TFK+RLF++ G+G PDP L+++ L NL+  CPN D S+T LAP D 
Sbjct  189   ALSGGHTIGFAQCSTFKQRLFDFDGAGNPDPILDAALLGNLRGICPNQDNSDTNLAPFDS  248

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
              S  +FDNSY+ +L NN+GLL+SDQALM + +TA +V  YS +P+ F  DFA+SMVK+GN
Sbjct  249   TSA-KFDNSYFKSLANNSGLLQSDQALMGDNKTAAVVLNYSKFPFLFMRDFASSMVKMGN  307

Query  420   LGVLTGKDNGQIRKICGSVN  361
             + VLTG+D G+IRK C  VN
Sbjct  308   IAVLTGQD-GEIRKNCRVVN  326



>ref|XP_004233638.1| PREDICTED: peroxidase 10-like [Solanum lycopersicum]
Length=334

 Score =   423 bits (1088),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 212/327 (65%), Positives = 254/327 (78%), Gaps = 4/327 (1%)
 Frame = -3

Query  1338  KS*VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASL  1159
             KS V +   L+ FL FL++     QLDY +YD +CPNL  IVR GVWSAI ND+RM ASL
Sbjct  11    KSHVFLIYPLLCFL-FLSS-FVYGQLDYKYYDTTCPNLTKIVRNGVWSAISNDTRMPASL  68

Query  1158  IRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVS  979
             +RLHFHDCFVNGCDGS+LLDDT  F GEKN  PNRNSARG+EVID+IKA+VEKACPSTVS
Sbjct  69    LRLHFHDCFVNGCDGSILLDDTSTFTGEKNAFPNRNSARGYEVIDAIKANVEKACPSTVS  128

Query  978   CTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQG  802
             CTDILTLAA  A+ ++ GP+W V LGRRD LTAS+ A   QLPSPFE L +ITAKF ++G
Sbjct  129   CTDILTLAAREAIYLTRGPFWSVCLGRRDSLTASQSAANDQLPSPFEPLVNITAKFVSKG  188

Query  801   LDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNT  622
             LD+KD+VVLSGAH++GFAQCF FKRRLF++ GSG PDPTL+ S L +L++ CPN   S++
Sbjct  189   LDVKDVVVLSGAHTIGFAQCFMFKRRLFDFDGSGNPDPTLDLSLLGSLRSVCPNQSDSDS  248

Query  621   KLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFAT  442
              LAPLD  +  RFDN Y+ NL+NN+GLLESDQALM +  TA +V  YS  P  F  +FA 
Sbjct  249   NLAPLDAVTINRFDNVYFKNLMNNSGLLESDQALMNDNTTAALVSNYSRNPSLFSKEFAA  308

Query  441   SMVKLGNLGVLTGKDNGQIRKICGSVN  361
             SMVKL N+GVLTG+ NG+IRK C  VN
Sbjct  309   SMVKLINIGVLTGQ-NGEIRKNCRVVN  334



>ref|XP_007047175.1| Peroxidase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91332.1| Peroxidase superfamily protein isoform 1 [Theobroma cacao]
Length=327

 Score =   423 bits (1087),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/328 (64%), Positives = 257/328 (78%), Gaps = 4/328 (1%)
 Frame = -3

Query  1341  HKS*VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAAS  1162
             HK+  +  + L+  L FL+  +   QLDY +YD +CPNL  IVR+GVWSAI ND+RMAAS
Sbjct  3     HKTCKLPFVRLIYIL-FLSH-LVFCQLDYKYYDSTCPNLARIVRYGVWSAITNDTRMAAS  60

Query  1161  LIRLHFHDCFVNGCDGSVLLDDT-KGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPST  985
             L+RLHFHDCFVNGCDGS+LLDD    F GEKN L N+NSARG+EVID+IKA+VEKACPST
Sbjct  61    LVRLHFHDCFVNGCDGSILLDDIGSTFVGEKNALANQNSARGYEVIDNIKANVEKACPST  120

Query  984   VSCTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQ  805
             VSC+DILTLAA  AV  +GG YW V LGRRDG TA++ A  +LPSPFESL  I AKF+++
Sbjct  121   VSCSDILTLAARDAVYFAGGSYWMVPLGRRDGRTANKTAANELPSPFESLDSIIAKFNSK  180

Query  804   GLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSN  625
             GLD+KD+VVLSGAH++GFAQCFTFK RLFN+ GSGKPDP L++SFL  LQ+ CP+   S+
Sbjct  181   GLDIKDVVVLSGAHTIGFAQCFTFKSRLFNFGGSGKPDPELDASFLKGLQSVCPDQVDSD  240

Query  624   TKLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFA  445
             T L PLD  ++ +FDNSYY N+VN++GLL+SDQ L  + +TA MV  YS YPY F  DF 
Sbjct  241   TNLVPLDSVTSTKFDNSYYKNIVNSSGLLQSDQLLGTDNRTASMVLNYSKYPYLFLKDFG  300

Query  444   TSMVKLGNLGVLTGKDNGQIRKICGSVN  361
              SMVK+GN+GVLTG+D G+IRK C  VN
Sbjct  301   ASMVKMGNIGVLTGQD-GEIRKNCKVVN  327



>ref|XP_004141924.1| PREDICTED: peroxidase 10-like [Cucumis sativus]
 ref|XP_004167562.1| PREDICTED: peroxidase 10-like [Cucumis sativus]
 gb|KGN48508.1| hypothetical protein Csa_6G490230 [Cucumis sativus]
Length=327

 Score =   423 bits (1087),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 238/320 (74%), Gaps = 1/320 (0%)
 Frame = -3

Query  1320  AISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFH  1141
              + LV+   FL   +  SQLDY FYD SCPNL  IVR+GVW A+ ND+RMAASL+RLHFH
Sbjct  9     VVVLVISFFFLNQVLVSSQLDYRFYDASCPNLTRIVRYGVWMAVSNDTRMAASLLRLHFH  68

Query  1140  DCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILT  961
             DCFVNGCDGS+LLDDT  FKGEKN LPN NS RG+EVID+IKA +EK CPS VSCTDI+T
Sbjct  69    DCFVNGCDGSLLLDDTNTFKGEKNALPNVNSVRGYEVIDNIKAVLEKFCPSVVSCTDIVT  128

Query  960   LAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             LAA  AV ++GGP+W++ LGRRDG TASE    QLPSP E L+DI AKF+++G ++KD+V
Sbjct  129   LAAREAVYLAGGPFWQIPLGRRDGTTASESEANQLPSPVEPLEDIIAKFTSKGFNVKDVV  188

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH+ GFA+C  FK RLFN+ G+G PDP L+     NLQ  CPN D SN K APLD 
Sbjct  189   ALSGAHTFGFARCMMFKHRLFNFDGAGNPDPELDVMLRQNLQNNCPNQDDSNNKFAPLDA  248

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
              +  RFDN YY NLVN  GLL+SDQ LM +  TA +V  YS YPY FY DF  SMVKL N
Sbjct  249   YTINRFDNVYYRNLVNKLGLLQSDQDLMKDNTTASLVVSYSRYPYMFYRDFGASMVKLAN  308

Query  420   LGVLTGKDNGQIRKICGSVN  361
              G+LTG+ NG+IRK C  VN
Sbjct  309   TGILTGQ-NGEIRKNCRVVN  327



>ref|XP_010543944.1| PREDICTED: peroxidase 10 [Tarenaya hassleriana]
Length=340

 Score =   422 bits (1085),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 201/302 (67%), Positives = 238/302 (79%), Gaps = 2/302 (1%)
 Frame = -3

Query  1263  LDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGF  1084
             L Y FYD SCPNL M VR GVW A R+DSR+AASL+RLHFHDCFVNGCDGS+LLD+T+ F
Sbjct  40    LTYRFYDISCPNLQMTVRSGVWKAFRDDSRVAASLLRLHFHDCFVNGCDGSILLDETEEF  99

Query  1083  KGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVLL  904
             KGEKN  PNRNS RG+EVID+IKA VEK+CP TVSC D++ LAA  AV ++GGP+W V L
Sbjct  100   KGEKNAFPNRNSVRGYEVIDAIKAQVEKSCPLTVSCADLVALAAREAVVLTGGPFWPVPL  159

Query  903   GRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKR  727
             GRRD  TA E+A    LPSP E L++ITAKF + GLD KD+VVLSGAH++GFAQCF FK 
Sbjct  160   GRRDSTTADEQAANTNLPSPLEPLENITAKFVSMGLDFKDVVVLSGAHTIGFAQCFVFKN  219

Query  726   RLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNT  547
             RLFN++GSG+PDP L  S L+ LQ TCPNVD SN+KLAPLD  S+ +FDN+YY NL+  T
Sbjct  220   RLFNFRGSGQPDPNLAVSVLTKLQDTCPNVDSSNSKLAPLDVASSVKFDNAYYVNLMKKT  279

Query  546   GLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICGS  367
             GLLESDQ LM +P++A +VK YS  PY F  DFA SMVK+G++GVLTG D G IR  CG 
Sbjct  280   GLLESDQILMNDPKSAALVKSYSENPYLFMNDFAVSMVKMGSIGVLTGND-GIIRAKCGL  338

Query  366   VN  361
             VN
Sbjct  339   VN  340



>ref|XP_010550378.1| PREDICTED: peroxidase 10-like [Tarenaya hassleriana]
Length=328

 Score =   421 bits (1083),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/320 (65%), Positives = 252/320 (79%), Gaps = 4/320 (1%)
 Frame = -3

Query  1311  LVVFLGFLAAPMA--ESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             LV  +  + APM     QLDY++Y +SCPNL  IVR+GV SA+ ND+RMAASL+RLHFHD
Sbjct  10    LVCTVLLVTAPMVMVTCQLDYMYYVRSCPNLARIVRYGVASALSNDTRMAASLLRLHFHD  69

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             C VNGCDGS+LLDD  G K EKN LPN+NSARGFEVIDSIKA++EKACPSTVSC+DIL L
Sbjct  70    CIVNGCDGSLLLDDNDGIKSEKNALPNQNSARGFEVIDSIKANLEKACPSTVSCSDILAL  129

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A+  AV ++GGP+  + LGRRDG +AS + A +Q+PSPFE L ++TAKF+++GL LKD+V
Sbjct  130   ASRDAVYLAGGPFVPMPLGRRDGRSASIDGANRQIPSPFEPLDNLTAKFTSKGLSLKDVV  189

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
             VLSGAH++GFAQCF FK RLFN+ GSGKPDPTL  SFL +LQT CPN D S+T LAPLD 
Sbjct  190   VLSGAHTIGFAQCFLFKSRLFNFGGSGKPDPTLSESFLQSLQTQCPNQDSSDTNLAPLDG  249

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
              +T RFDN YY NL+N +GLL SDQALM +  T+ +V YYS YPY FY DF  S+VK+ N
Sbjct  250   VTTTRFDNVYYRNLLNGSGLLGSDQALMTDNTTSSLVLYYSQYPYAFYRDFGVSLVKMAN  309

Query  420   LGVLTGKDNGQIRKICGSVN  361
             +GVLTG D G+IRK C  +N
Sbjct  310   IGVLTGSD-GEIRKSCRLLN  328



>ref|XP_010268491.1| PREDICTED: peroxidase 10-like [Nelumbo nucifera]
Length=327

 Score =   421 bits (1082),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 201/315 (64%), Positives = 247/315 (78%), Gaps = 2/315 (1%)
 Frame = -3

Query  1302  FLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNG  1123
             F+  L  P+   QLDY FYD  CPNL  IVR+GVWSAI+N++R+AASL+RLHFHDC VNG
Sbjct  14    FVILLVNPLVFCQLDYKFYDDICPNLTNIVRYGVWSAIKNETRVAASLLRLHFHDCIVNG  73

Query  1122  CDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYA  943
             CDGS+LLDDT   KGEK+  PN+NSARGFEV+D+IKA+VEKACPS VSC DIL LAA  A
Sbjct  74    CDGSILLDDTSTMKGEKSAAPNQNSARGFEVLDAIKANVEKACPSIVSCADILALAAREA  133

Query  942   VGMSGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGA  766
             V ++GGPYW + LGRRD  TAS+ A  +Q+PSP E L++ITAKF+++GL+LKD+VVLSG 
Sbjct  134   VYLTGGPYWSLPLGRRDSTTASQSAANEQIPSPLEPLENITAKFTSKGLELKDVVVLSGG  193

Query  765   HSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYR  586
             H++GFAQCFTFK+RLF+Y  SGK DPTLESSFL  LQ+ CPN   S++ LAPLD  +T +
Sbjct  194   HTIGFAQCFTFKQRLFDYNSSGKADPTLESSFLQXLQSLCPNQASSDSNLAPLDRVTTNK  253

Query  585   FDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLT  406
             FDN Y+ NL+NN+GLL+SDQALM +  TA MV  YS  PY F+ DF  SMVK+  + VLT
Sbjct  254   FDNGYFKNLLNNSGLLQSDQALMGDSDTASMVNNYSKSPYLFFTDFGASMVKMSKIRVLT  313

Query  405   GKDNGQIRKICGSVN  361
             GK+ G+IRK C  VN
Sbjct  314   GKE-GEIRKNCRVVN  327



>ref|XP_004232052.1| PREDICTED: peroxidase 10-like [Solanum lycopersicum]
Length=334

 Score =   420 bits (1080),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 204/303 (67%), Positives = 243/303 (80%), Gaps = 2/303 (1%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QLDY +YD +CP L  IVR GVWSAI ND+RM ASL+RLHFHDCFVNGCDGS+LLDDT  
Sbjct  33    QLDYKYYDTTCPILTKIVRNGVWSAISNDTRMPASLLRLHFHDCFVNGCDGSILLDDTST  92

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
             F GEKN  PNRNSARG+EVID+IKA+VEKACPSTVSCTDILTLAA  A+ ++ GP+W V 
Sbjct  93    FTGEKNAFPNRNSARGYEVIDAIKANVEKACPSTVSCTDILTLAAREAIYLTRGPFWPVC  152

Query  906   LGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRD LTAS+ A   QLPSPFE L +ITAKF ++GL++KD+VVLSGAH++GFAQC TFK
Sbjct  153   LGRRDSLTASQNAANDQLPSPFEPLVNITAKFVSKGLNVKDVVVLSGAHTLGFAQCSTFK  212

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
             RRLF++ GSG PDPTL+SS L +L++ CPN   S++ LAPLD  S  RFDN Y+ NL+ N
Sbjct  213   RRLFDFDGSGNPDPTLDSSLLGSLRSVCPNQKDSDSNLAPLDAVSINRFDNVYFKNLMKN  272

Query  549   TGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICG  370
             +GLLESDQALM +  TA +V  +S YPY F  +FA SMVKL N+GVLTG+ NG+IRK C 
Sbjct  273   SGLLESDQALMNDNTTAALVSNFSKYPYLFSKEFAASMVKLINIGVLTGQ-NGEIRKNCR  331

Query  369   SVN  361
              VN
Sbjct  332   VVN  334



>ref|XP_002263033.2| PREDICTED: peroxidase 10-like [Vitis vinifera]
Length=327

 Score =   420 bits (1079),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 206/322 (64%), Positives = 248/322 (77%), Gaps = 6/322 (2%)
 Frame = -3

Query  1323  VAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHF  1144
             V +  ++FLG   +     QLDY FYD SCPNL  IVR GV SA+  ++RMAASL+RLHF
Sbjct  11    VPLFCLLFLGHFVS----GQLDYNFYDHSCPNLTGIVRNGVASAVAKETRMAASLLRLHF  66

Query  1143  HDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDIL  964
             HDCFVNGCD S+LLD++  FKGEKN LPNRNS RGFEVID+IKADVE+ACPSTVSC DIL
Sbjct  67    HDCFVNGCDASILLDESSAFKGEKNALPNRNSVRGFEVIDAIKADVERACPSTVSCADIL  126

Query  963   TLAASYAVGMSGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKD  787
             TLA   A+ + GGP+W V +GRRDGLTA+E A  +QLPSP E L++ITAKF+++GL LKD
Sbjct  127   TLAVREAIYLVGGPFWLVAMGRRDGLTANETAANEQLPSPIEPLENITAKFTSKGLTLKD  186

Query  786   MVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPL  607
             +VVLSGAH++GFAQCFTFK RLFN+  +G PDPTL++S L +LQ  CPN   SNT LAPL
Sbjct  187   VVVLSGAHTIGFAQCFTFKSRLFNFDNTGNPDPTLDASLLQSLQQICPNQADSNTNLAPL  246

Query  606   DYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKL  427
             D  +T +FDN YY NLVNN+GLL+SDQALM + +TA MV  Y+  PY F   F TSMVK+
Sbjct  247   DSVTTNKFDNVYYRNLVNNSGLLQSDQALMGDNRTAPMVMLYNRLPYLFASAFKTSMVKM  306

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
               +GVLTG D G+IRK C  VN
Sbjct  307   SYIGVLTGHD-GEIRKNCRVVN  327



>ref|XP_010935535.1| PREDICTED: peroxidase 10 [Elaeis guineensis]
Length=327

 Score =   418 bits (1075),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 204/322 (63%), Positives = 248/322 (77%), Gaps = 4/322 (1%)
 Frame = -3

Query  1323  VAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHF  1144
             +  SLV  L  + +P    QLDY FYD SCPNL  IVR+GVWSA+ N++RMAASL+R+HF
Sbjct  9     IIFSLVCLL--ILSPPIHGQLDYRFYDTSCPNLTRIVRYGVWSAMLNETRMAASLLRMHF  66

Query  1143  HDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDIL  964
             HDCFV+GCD S+LLDD+     EK+  PN+NS RG+EVIDSIKADVEKACPSTVSC DIL
Sbjct  67    HDCFVDGCDASLLLDDSDDIISEKSASPNKNSVRGYEVIDSIKADVEKACPSTVSCADIL  126

Query  963   TLAASYAVGMSGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKD  787
             T+AA  AV +SGGP+W V LGRRDG  A+  A  +QLPSPF+SL  ITAKF+A+GLD KD
Sbjct  127   TIAAREAVFLSGGPFWYVALGRRDGTAANRTAANEQLPSPFDSLTTITAKFAAKGLDTKD  186

Query  786   MVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPL  607
             +VVLSGAH++GFAQCFTFK RLFN+  SG+PDP L++S L NLQ+ CPN   SN+ LAPL
Sbjct  187   VVVLSGAHTIGFAQCFTFKNRLFNFNNSGEPDPALDTSLLRNLQSLCPNNVSSNSNLAPL  246

Query  606   DYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKL  427
             D  +T RFDN YY NL+N++GLL+SDQAL+ +  TA MV  YS YPY F+ DF  SMVK+
Sbjct  247   DPVTTSRFDNVYYKNLMNSSGLLQSDQALLDDSDTASMVSDYSRYPYMFFRDFGASMVKM  306

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
              ++GVLTG  NG+IR  C  VN
Sbjct  307   DSIGVLTGG-NGEIRTNCRVVN  327



>ref|XP_010479392.1| PREDICTED: peroxidase 10 [Camelina sativa]
Length=351

 Score =   419 bits (1076),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 200/303 (66%), Positives = 241/303 (80%), Gaps = 4/303 (1%)
 Frame = -3

Query  1269  SQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTK  1090
             S LDY FYD+SCP L MI+R GVW A ++DSR+AASL+RLHFHDCFVNGCDGS+LL+D++
Sbjct  47    SNLDYRFYDRSCPRLQMIIRSGVWRAFKDDSRIAASLLRLHFHDCFVNGCDGSILLNDSE  106

Query  1089  GFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRV  910
              FKGEKN  PNRNS RGFEVI+ IK+D+E +CP TVSC DI+ LAA  AV ++GGP+W V
Sbjct  107   DFKGEKNARPNRNSVRGFEVIEDIKSDIESSCPLTVSCADIVALAAREAVVVTGGPFWPV  166

Query  909   LLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTF  733
              LGRRD LTASE+A    LPSPFE L++ITAKF   GLDLKD+VVLSGAH++GFAQCF F
Sbjct  167   PLGRRDSLTASEQAANTNLPSPFEPLENITAKFVTLGLDLKDVVVLSGAHTIGFAQCFVF  226

Query  732   KRRLFNYQGSGKPDPTL--ESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             K RLFN++GSG+PDP L   SS LS L+ TCPNVD S++KLA LD  S+ +FDN+YY NL
Sbjct  227   KHRLFNFKGSGQPDPNLAASSSLLSKLKDTCPNVDSSDSKLAALDAASSVKFDNAYYVNL  286

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             +NN GLL+SDQ LM++P  A +VK YS  PY F  DFA SMVK+GN+GV+TG D G IR 
Sbjct  287   MNNIGLLDSDQTLMSDPTAAALVKSYSENPYLFSRDFAVSMVKMGNVGVMTGSD-GVIRA  345

Query  378   ICG  370
              CG
Sbjct  346   KCG  348



>ref|XP_002306459.2| peroxidase family protein [Populus trichocarpa]
 gb|EEE93455.2| peroxidase family protein [Populus trichocarpa]
 gb|AHL39139.1| class III peroxidase [Populus trichocarpa]
Length=322

 Score =   417 bits (1072),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 204/303 (67%), Positives = 249/303 (82%), Gaps = 7/303 (2%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QL+Y FYD +CPNL  IVR GVWSA+RNDSRMAASL+RLHFHDCFVNGCDGS+LLD    
Sbjct  26    QLNYKFYDYTCPNLTKIVRSGVWSAMRNDSRMAASLLRLHFHDCFVNGCDGSLLLD----  81

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
               GEKN  PNRNSARGFEVID IKA++E+ACP+TVSCTDILTLAA  AV +SGGPYW + 
Sbjct  82    -GGEKNAFPNRNSARGFEVIDDIKANLERACPATVSCTDILTLAAREAVYLSGGPYWFLP  140

Query  906   LGRRDGLTASE-EATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRDGLTASE +A +QLP   E L++ITAKF+++GL+LKD+VVLSGAH++GFAQCFTFK
Sbjct  141   LGRRDGLTASESDANEQLPGFSEPLENITAKFTSKGLELKDVVVLSGAHTIGFAQCFTFK  200

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
              RLF++ GSG+PDP L+++ L++LQ+TCPN D S+TKLAPLD  S+ +FDN YY  L+NN
Sbjct  201   SRLFDFGGSGEPDPLLDTALLTSLQSTCPNQDDSDTKLAPLDSASSSKFDNLYYKLLLNN  260

Query  549   TGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICG  370
             +GLL+SDQALM +  T+ +V  YS +PY F  DF  SMVK+ N+GVLTG+ NG+IRK C 
Sbjct  261   SGLLQSDQALMGDNTTSSLVLNYSKFPYLFSKDFGASMVKMANIGVLTGQ-NGEIRKNCR  319

Query  369   SVN  361
              VN
Sbjct  320   LVN  322



>ref|XP_006305198.1| hypothetical protein CARUB_v10009564mg [Capsella rubella]
 gb|EOA38096.1| hypothetical protein CARUB_v10009564mg [Capsella rubella]
Length=356

 Score =   418 bits (1074),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 201/303 (66%), Positives = 240/303 (79%), Gaps = 4/303 (1%)
 Frame = -3

Query  1269  SQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTK  1090
             S L+Y FYD+SCP L MIV+ GVW A ++DSR+AASL+RLHFHDCFVNGCDGS+LL+D++
Sbjct  52    SDLNYRFYDRSCPRLQMIVKSGVWRAFKDDSRIAASLLRLHFHDCFVNGCDGSILLNDSE  111

Query  1089  GFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRV  910
              FKGEKN  PNRNS RGFEVI+ IK+D+E +CP TVSC DI+ LAA  AV ++GGP+W V
Sbjct  112   DFKGEKNARPNRNSVRGFEVIEDIKSDIESSCPLTVSCADIVALAAREAVVLTGGPFWSV  171

Query  909   LLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTF  733
              LGRRD LTASE+A    LPSPFE L++ITAKF   GLDLKD+VVLSGAH++GFAQCF F
Sbjct  172   PLGRRDSLTASEQAANTNLPSPFEPLENITAKFVNLGLDLKDVVVLSGAHTIGFAQCFVF  231

Query  732   KRRLFNYQGSGKPDPTL--ESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             K RLFN++GSG+PDP L   S+ LS L+ TCPNVD SN+KLA LD  S+ +FDN+YY NL
Sbjct  232   KHRLFNFKGSGQPDPNLAASSALLSTLKDTCPNVDSSNSKLAALDAASSVKFDNAYYVNL  291

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             +NN GLL+SDQ LM +P  A MVK YS  PY F  DFA SMVK+GN+GVLTG D G IR 
Sbjct  292   MNNIGLLDSDQTLMTDPTAAAMVKSYSENPYLFSRDFAVSMVKMGNVGVLTGSD-GVIRA  350

Query  378   ICG  370
              CG
Sbjct  351   KCG  353



>ref|XP_008440251.1| PREDICTED: peroxidase 10 [Cucumis melo]
Length=327

 Score =   416 bits (1069),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 198/320 (62%), Positives = 236/320 (74%), Gaps = 1/320 (0%)
 Frame = -3

Query  1320  AISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFH  1141
              + LV+   FL   +  SQLDY FYD SCPNL  IVR+GVW A+ ND+RMAASL+RLHFH
Sbjct  9     VVFLVISFFFLNHLLVSSQLDYRFYDASCPNLTRIVRYGVWMAVSNDTRMAASLLRLHFH  68

Query  1140  DCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILT  961
             DCFVNGCDGS+LLDDT  FKGEKN LPN NS RG+EVID+IKA +EK CP  VSCTDI+T
Sbjct  69    DCFVNGCDGSLLLDDTNTFKGEKNALPNVNSVRGYEVIDNIKAVLEKVCPCVVSCTDIVT  128

Query  960   LAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             LAA  AV ++GGP+W++ LGRRDG TASE    QLPSP E L++I AKF+++GL++KD+V
Sbjct  129   LAAREAVYLAGGPFWQIPLGRRDGTTASESEANQLPSPLEPLENIIAKFTSKGLNVKDLV  188

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSG H+ GFA+C  FK RLFN+ G+G PDP L+     NL+  CPN D SN   APLD 
Sbjct  189   ALSGGHTFGFARCMMFKHRLFNFDGAGNPDPELDVMLRQNLENNCPNQDDSNNNFAPLDA  248

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
              +  RFDN YY NLVN  GLL+SDQALM +  TA +V  YS YPY FY DF  SMVKL N
Sbjct  249   YTINRFDNVYYRNLVNKLGLLQSDQALMKDNTTASLVVNYSRYPYLFYRDFGASMVKLAN  308

Query  420   LGVLTGKDNGQIRKICGSVN  361
              G+LTG+  G+IRK C  VN
Sbjct  309   TGILTGQ-KGEIRKNCRMVN  327



>ref|XP_008805717.1| PREDICTED: peroxidase 10 [Phoenix dactylifera]
Length=327

 Score =   416 bits (1068),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/322 (63%), Positives = 247/322 (77%), Gaps = 4/322 (1%)
 Frame = -3

Query  1323  VAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHF  1144
             +  SLV  L  + +P+  SQLDY FYD SCP+L  IVR GVWSA+RN++RMAASL+RLHF
Sbjct  9     IIFSLVCLL--ILSPLIHSQLDYSFYDTSCPSLTRIVRNGVWSAMRNETRMAASLLRLHF  66

Query  1143  HDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDIL  964
             HDCFV+GCD S+LLDD+     EK+  PNRNS RG+EVIDSIKADVEKACPSTVSC DI+
Sbjct  67    HDCFVDGCDASLLLDDSNDIISEKSASPNRNSVRGYEVIDSIKADVEKACPSTVSCADIV  126

Query  963   TLAASYAVGMSGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKD  787
             T+AA  AV +SGGPYW V LGRRDG TA+  A  +QLPSP + L  ITAKF+A+GLD KD
Sbjct  127   TIAAREAVFLSGGPYWFVALGRRDGTTANRTAANEQLPSPLDDLTTITAKFAAKGLDAKD  186

Query  786   MVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPL  607
             +VVLSGAH++GFAQCFTFK RLFN+  SG PD  L+ S L NLQ+ CPN   S++ LAPL
Sbjct  187   VVVLSGAHTIGFAQCFTFKNRLFNFNSSGGPDLELDVSLLKNLQSLCPNNVSSDSNLAPL  246

Query  606   DYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKL  427
             D  +T RFDN YY NL+N++GLL+SDQAL+ +  TA MV  YS YPY F+ DF  SM+K+
Sbjct  247   DPVTTSRFDNIYYKNLMNSSGLLQSDQALLDDSDTASMVSNYSIYPYLFFRDFGASMLKM  306

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
              N+GVLTG  NG+IR  C +VN
Sbjct  307   ANIGVLTGG-NGEIRTNCRAVN  327



>ref|XP_007156533.1| hypothetical protein PHAVU_003G294000g [Phaseolus vulgaris]
 gb|ESW28527.1| hypothetical protein PHAVU_003G294000g [Phaseolus vulgaris]
Length=333

 Score =   415 bits (1067),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 200/308 (65%), Positives = 238/308 (77%), Gaps = 2/308 (1%)
 Frame = -3

Query  1281  PMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLL  1102
             P   +QLD  FYD+SCPNL MIVR+GVWSA+R+D RMAASL+RLHFHDC VNGCD SVLL
Sbjct  27    PFGTNQLDINFYDRSCPNLAMIVRYGVWSAVRDDKRMAASLLRLHFHDCIVNGCDASVLL  86

Query  1101  DDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGP  922
             DDT  F GEKN LPN NS RGFEVID IK  VE+ CP+TVSC DIL LAA  A+ M GGP
Sbjct  87    DDTPYFTGEKNALPNHNSLRGFEVIDDIKEHVERMCPATVSCADILALAAREAIRMVGGP  146

Query  921   YWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQ  745
              W V LGRRD +T S+EA  +QLPSP E L++ITAKF ++GL+L+D+V LSG H++GFAQ
Sbjct  147   SWDVALGRRDAITTSKEAAEQQLPSPIEPLQNITAKFYSKGLELRDVVALSGGHTIGFAQ  206

Query  744   CFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYT  565
             CFTFK RLF++QGSG+PDP L+SS L+ LQ+ CPN D SNT LAPLD  ST+ FDN YY 
Sbjct  207   CFTFKGRLFDFQGSGRPDPVLDSSLLTTLQSMCPNEDTSNTNLAPLDASSTFMFDNEYYR  266

Query  564   NLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQI  385
             NL+ NTGLL+SDQ L  + +TA MV YYS   + FY DF+ SM +L N+GVLTG + G+I
Sbjct  267   NLIYNTGLLQSDQVLARDRRTAAMVYYYSNNRFAFYDDFSQSMERLSNVGVLTGME-GEI  325

Query  384   RKICGSVN  361
             R  CG VN
Sbjct  326   RGKCGYVN  333



>ref|XP_010500501.1| PREDICTED: peroxidase 10-like [Camelina sativa]
Length=351

 Score =   415 bits (1066),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 199/303 (66%), Positives = 240/303 (79%), Gaps = 4/303 (1%)
 Frame = -3

Query  1269  SQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTK  1090
             S LDY FYD+SCP L MIV+ GVW A ++DSR+AASL+RLHFHDCFVNGCDGS+LL+D++
Sbjct  47    SNLDYRFYDRSCPRLQMIVKSGVWRAFKDDSRIAASLLRLHFHDCFVNGCDGSILLNDSE  106

Query  1089  GFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRV  910
              FKGEKN  PNRNS RGFEVI+ IK+D+E +CP TVSC DI+ LAA  AV ++GGP+W V
Sbjct  107   AFKGEKNARPNRNSVRGFEVIEDIKSDIESSCPLTVSCADIVALAAREAVVLTGGPFWPV  166

Query  909   LLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTF  733
              LGRRD LTASE+A    LPSPFE L++ITAKF   GLDLKD+VVLSGAH++GFAQCF  
Sbjct  167   PLGRRDSLTASEQAANTNLPSPFEPLENITAKFVTLGLDLKDVVVLSGAHTIGFAQCFVI  226

Query  732   KRRLFNYQGSGKPDPTL--ESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             K RLFN++GSG+PDP L   SS LS L+ TCPNVD S++KLA LD  S+ +FDN+YY NL
Sbjct  227   KHRLFNFKGSGQPDPNLAASSSLLSKLKDTCPNVDSSDSKLAALDPASSVKFDNAYYVNL  286

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             +NN GLL+SDQ LM++P  A +VK YS  PY F  DFA SMVK+GN+GV+TG D G IR 
Sbjct  287   MNNIGLLDSDQTLMSDPTAAALVKSYSENPYLFSRDFAVSMVKMGNVGVMTGSD-GVIRA  345

Query  378   ICG  370
              CG
Sbjct  346   KCG  348



>gb|KHN31052.1| Peroxidase 10 [Glycine soja]
Length=314

 Score =   413 bits (1062),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 203/303 (67%), Positives = 234/303 (77%), Gaps = 2/303 (1%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QLD  FYD+SCPNL  IV +GVW A+RND+RMAASL+RLHFHDC VNGCD SVLLDDT  
Sbjct  12    QLDLNFYDRSCPNLHKIVGYGVWLALRNDNRMAASLLRLHFHDCIVNGCDASVLLDDTPY  71

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
             F GEKN LPN NS RGFEVID IK  +E+ CPSTVSC DIL LAA  A+   GGP W V 
Sbjct  72    FTGEKNALPNHNSLRGFEVIDDIKEHLERICPSTVSCADILALAAREAIDQIGGPSWPVQ  131

Query  906   LGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRD  T S+EA  +Q+PSP E L++ITAKF ++GLD+KD+V LSGAH++GFA+CFTFK
Sbjct  132   LGRRDATTTSKEAAEQQIPSPIEPLENITAKFFSKGLDMKDVVALSGAHTIGFARCFTFK  191

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
             RRLF++QGSG+PDP LE S LS LQ  CPN D SN+ LAPLD  ST  FDN YY N+V N
Sbjct  192   RRLFDFQGSGRPDPVLEFSLLSKLQNMCPNEDASNSNLAPLDATSTMTFDNEYYRNIVYN  251

Query  549   TGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICG  370
             TGLLESDQAL+ + +TA  V YYS   + FY DFA SMVKL N+GVLTG + GQIR  CG
Sbjct  252   TGLLESDQALIKDRRTAPTVYYYSNNQFSFYNDFAESMVKLSNVGVLTGTE-GQIRYKCG  310

Query  369   SVN  361
             SVN
Sbjct  311   SVN  313



>emb|CDY16509.1| BnaA08g02580D [Brassica napus]
Length=369

 Score =   415 bits (1067),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 199/303 (66%), Positives = 238/303 (79%), Gaps = 4/303 (1%)
 Frame = -3

Query  1269  SQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTK  1090
             S LDY FYD+SCP L M+V+ GVW A ++DSR+AASL+RLHFHDCFVNGCDGS+LLDD++
Sbjct  65    SNLDYRFYDRSCPRLQMMVKSGVWRAFKDDSRIAASLLRLHFHDCFVNGCDGSILLDDSE  124

Query  1089  GFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRV  910
              FKGEKN LPNRNS RGF+VI+ IK D+E ACP TVSC DI+ LAA  AV ++GGPYW V
Sbjct  125   DFKGEKNALPNRNSVRGFDVIEDIKTDIESACPLTVSCADIVALAAREAVVLTGGPYWPV  184

Query  909   LLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTF  733
              LGRRD LTASE+A    LPSPFE L++ITAKF + GLD KD+VVLSGAH++GFAQCF F
Sbjct  185   PLGRRDSLTASEQAANTNLPSPFEPLENITAKFVSLGLDFKDVVVLSGAHTIGFAQCFVF  244

Query  732   KRRLFNYQGSGKPDPTLESS--FLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             K RLFN++GSG+PDP L +S   LS L  TCPNVD SN+ LA LD  S  +FDN+YY NL
Sbjct  245   KHRLFNFKGSGQPDPNLAASSDLLSKLTDTCPNVDSSNSNLAALDAASVVKFDNAYYVNL  304

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             +NN GLL+SDQ LM++   A +VK YS  PY F  DFA SMVK+GN+GV+TG+D G IR 
Sbjct  305   MNNVGLLDSDQILMSDSNAAALVKSYSENPYLFSRDFAVSMVKMGNIGVMTGRD-GVIRA  363

Query  378   ICG  370
              CG
Sbjct  364   KCG  366



>ref|XP_006393244.1| hypothetical protein EUTSA_v10011619mg [Eutrema salsugineum]
 gb|ESQ30530.1| hypothetical protein EUTSA_v10011619mg [Eutrema salsugineum]
Length=347

 Score =   414 bits (1063),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 198/303 (65%), Positives = 239/303 (79%), Gaps = 4/303 (1%)
 Frame = -3

Query  1269  SQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTK  1090
             S LDY FYD+SCP L MIV+ GVW A ++DSR+AASL+RLHFHDCFVNGCDGS+LL+D++
Sbjct  43    SNLDYRFYDRSCPRLQMIVKTGVWKAFKDDSRIAASLLRLHFHDCFVNGCDGSILLEDSE  102

Query  1089  GFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRV  910
              FKGEKN LPNRNS RGFEVI+ IK+D+E +CP TVSC DI+ LAA  AV ++GGP+W V
Sbjct  103   DFKGEKNALPNRNSVRGFEVIEDIKSDIESSCPLTVSCADIVALAAREAVVLTGGPFWPV  162

Query  909   LLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTF  733
              LGRRD LTASE+A    LPSPFE L +ITAKF + GLDLKD+VVLSGAH++GFAQCFTF
Sbjct  163   PLGRRDSLTASEQAANTNLPSPFEPLANITAKFVSLGLDLKDVVVLSGAHTIGFAQCFTF  222

Query  732   KRRLFNYQGSGKPDPTL--ESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             K RLFN++GSG+PDP L   S+ +S L+ TCPNVD S++KLA LD  S  +FDN+YY NL
Sbjct  223   KHRLFNFKGSGQPDPNLAASSALISKLKNTCPNVDSSDSKLAALDAASAVKFDNAYYVNL  282

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             +NN GLL+SDQ LM +   A +VK YS   Y F  DFA SMVK+GN+GV+TG D G IR 
Sbjct  283   MNNVGLLDSDQTLMTDSTAAALVKSYSENSYLFSRDFAISMVKMGNIGVMTGSD-GVIRA  341

Query  378   ICG  370
              CG
Sbjct  342   KCG  344



>ref|XP_003529383.1| PREDICTED: peroxidase 10-like [Glycine max]
Length=338

 Score =   413 bits (1062),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/303 (67%), Positives = 234/303 (77%), Gaps = 2/303 (1%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QLD  FYD+SCPNL  IV +GVW A+RND+RMAASL+RLHFHDC VNGCD SVLLDDT  
Sbjct  36    QLDLNFYDRSCPNLHKIVGYGVWLALRNDNRMAASLLRLHFHDCIVNGCDASVLLDDTPY  95

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
             F GEKN LPN NS RGFEVID IK  +E+ CPSTVSC DIL LAA  A+   GGP W V 
Sbjct  96    FTGEKNALPNHNSLRGFEVIDDIKEHLERICPSTVSCADILALAAREAIDQIGGPSWPVQ  155

Query  906   LGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRD  T S+EA  +Q+PSP E L++ITAKF ++GLD+KD+V LSGAH++GFA+CFTFK
Sbjct  156   LGRRDATTTSKEAAEQQIPSPIEPLENITAKFFSKGLDMKDVVALSGAHTIGFARCFTFK  215

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
             RRLF++QGSG+PDP LE S LS LQ  CPN D SN+ LAPLD  ST  FDN YY N+V N
Sbjct  216   RRLFDFQGSGRPDPVLEFSLLSKLQNMCPNEDASNSNLAPLDATSTMMFDNEYYRNIVYN  275

Query  549   TGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICG  370
             TGLLESDQAL+ + +TA  V YYS   + FY DFA SMVKL N+GVLTG + GQIR  CG
Sbjct  276   TGLLESDQALIKDRRTAPTVYYYSNNQFSFYNDFAESMVKLSNVGVLTGTE-GQIRYKCG  334

Query  369   SVN  361
             SVN
Sbjct  335   SVN  337



>ref|XP_011099203.1| PREDICTED: peroxidase 10-like isoform X1 [Sesamum indicum]
Length=327

 Score =   413 bits (1061),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 202/328 (62%), Positives = 251/328 (77%), Gaps = 4/328 (1%)
 Frame = -3

Query  1341  HKS*VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAAS  1162
              ++   +AI LV  L       + SQLDY FYD +CPNL  IVR GV SAI N++R+AAS
Sbjct  3     QRASAFLAIPLVCLL--FQITFSSSQLDYKFYDSTCPNLAKIVRNGVLSAIVNETRIAAS  60

Query  1161  LIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTV  982
             L+RLHFHDCFV+GC+GSVLLDD+  F GEKN  PNRNSARGFEVID+IK +VEKACPSTV
Sbjct  61    LLRLHFHDCFVDGCEGSVLLDDSSNFTGEKNAFPNRNSARGFEVIDAIKENVEKACPSTV  120

Query  981   SCTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQ  805
             SCTDILTLAA  AV ++GGP+W+V LGRRDGLTA+E A    LPSPFE L++ITAKF ++
Sbjct  121   SCTDILTLAARDAVFLTGGPFWQVALGRRDGLTANETAANTDLPSPFEPLENITAKFVSK  180

Query  804   GLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSN  625
             GLDLKDMVVLSG H++GFAQC TFK RLFN+ G+G PDP L+ S L++L+  CPN D S+
Sbjct  181   GLDLKDMVVLSGGHTIGFAQCSTFKPRLFNFDGAGNPDPILDESLLASLRIVCPNQDDSD  240

Query  624   TKLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFA  445
             T L  LD  ++ +FDNSY+ +LVNN+G+L+SDQ LM + QTA +V  YS +P+ F  DF 
Sbjct  241   TNLVALDAATSSKFDNSYFRSLVNNSGILQSDQDLMGDNQTAALVLSYSKFPFLFSKDFG  300

Query  444   TSMVKLGNLGVLTGKDNGQIRKICGSVN  361
              SM K+  +GVLTG++ G+IRK C  VN
Sbjct  301   KSMAKMSCIGVLTGQE-GEIRKNCRVVN  327



>ref|XP_004288062.1| PREDICTED: peroxidase 10-like [Fragaria vesca subsp. vesca]
Length=332

 Score =   413 bits (1061),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 248/320 (78%), Gaps = 3/320 (1%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ++L+  L FL+ P   S+L Y FYD SCPNL  IV+ GV SAI NDSR+AASL+RLHFHD
Sbjct  11    VALLCLL-FLSPPFVSSELSYKFYDSSCPNLSKIVQDGVRSAIANDSRIAASLLRLHFHD  69

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFV+GCD S+LLDDT   KGEKN LPN++SARG+EVID IK  +E+ACP TVSCTDILTL
Sbjct  70    CFVSGCDASILLDDTSTLKGEKNALPNKDSARGYEVIDKIKLALEEACPCTVSCTDILTL  129

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             AA+ AV  SGGPYW V LGRRDGLTAS + A   LPSPFE L++ITAKF+A+GLDL+D+V
Sbjct  130   AATSAVYFSGGPYWPVALGRRDGLTASIDAANNDLPSPFEPLENITAKFAAKGLDLQDVV  189

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
             VLSGAH++GFAQCFTFK RLFN+  SGKPDP L++S L+ LQ  CPN   S+TKLAPLD 
Sbjct  190   VLSGAHTIGFAQCFTFKTRLFNFGDSGKPDPVLDTSTLTKLQRVCPNQADSDTKLAPLDS  249

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
              ++ +FDN Y+  LVN +GLL+SDQ LM + +TA MV  YS +   F  DF  SMVK+ N
Sbjct  250   VTSTKFDNFYFKRLVNKSGLLQSDQLLMGDNRTASMVISYSRFANLFNKDFGASMVKMAN  309

Query  420   LGVLTGKDNGQIRKICGSVN  361
             +GVLTG+ NGQIR+ C  VN
Sbjct  310   IGVLTGQ-NGQIRRNCRVVN  328



>ref|XP_010461798.1| PREDICTED: peroxidase 10-like [Camelina sativa]
Length=351

 Score =   412 bits (1060),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 198/303 (65%), Positives = 240/303 (79%), Gaps = 4/303 (1%)
 Frame = -3

Query  1269  SQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTK  1090
             S LDY FYD+SCP L MIV+ GVW A ++DSR+AASL+RLHFHDCFVNGCDGS+LL+D++
Sbjct  47    SNLDYRFYDRSCPRLQMIVKSGVWRAFKDDSRIAASLLRLHFHDCFVNGCDGSILLNDSE  106

Query  1089  GFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRV  910
              FKGE+N  PNRNS RGFEVI+ IK+D+E +CP TVSC DI+ LAA  AV ++GGP+W V
Sbjct  107   DFKGEQNARPNRNSVRGFEVIEDIKSDIESSCPLTVSCADIVALAAREAVVLTGGPFWPV  166

Query  909   LLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTF  733
              LGRRD LTASE+A    LPSPFE L++ITAKF   GLDLKD+VVLSGAH++GFAQCF  
Sbjct  167   PLGRRDSLTASEQAANTNLPSPFEPLENITAKFVTLGLDLKDVVVLSGAHTIGFAQCFVI  226

Query  732   KRRLFNYQGSGKPDPTL--ESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             K RLFN++GSG+PDP L   SS LS L+ TCPNVD S++KLA LD  S+ +FDN+YY NL
Sbjct  227   KHRLFNFKGSGQPDPNLAASSSLLSKLKDTCPNVDSSDSKLAALDPASSVKFDNAYYVNL  286

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             +NN GLL+SDQ LM++P  A +VK YS  PY F  DFA SMVK+GN+GV+TG D G IR 
Sbjct  287   MNNIGLLDSDQTLMSDPTAAALVKSYSENPYLFSRDFAVSMVKMGNVGVMTGSD-GVIRA  345

Query  378   ICG  370
              CG
Sbjct  346   KCG  348



>gb|KHN37487.1| Peroxidase 10 [Glycine soja]
Length=314

 Score =   410 bits (1053),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/303 (66%), Positives = 235/303 (78%), Gaps = 2/303 (1%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QLD  FYD+SCPNL  IV +GVW A++ND+RMAASL+RLHFHDC VNGCD SVLLDDT  
Sbjct  12    QLDLNFYDRSCPNLQRIVGYGVWLALKNDNRMAASLLRLHFHDCIVNGCDASVLLDDTPY  71

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
             F GEKN LPNRNS RGFEVID IK  +E+ CPSTVSC DIL LAA  A+   GGP W+V 
Sbjct  72    FTGEKNALPNRNSLRGFEVIDDIKEHLERICPSTVSCADILALAAREAIDQIGGPSWQVQ  131

Query  906   LGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRD  T S+EA  +Q+PSP E L++ITAKF ++GLD+KD+V LSGAH++GFA+CFTFK
Sbjct  132   LGRRDATTTSKEAAEQQIPSPIEPLENITAKFFSKGLDMKDVVALSGAHTIGFARCFTFK  191

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
              RLF++QGSG+PDP L+ S LS LQ TCPN D SN+ LAPLD  ST  FDN YY N+V N
Sbjct  192   GRLFDFQGSGRPDPALDFSLLSKLQNTCPNEDASNSNLAPLDATSTMMFDNEYYRNIVYN  251

Query  549   TGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICG  370
             T LLESDQAL+ + +TA  V YYS   + FY DFA SMVKL N+GVLTG + GQIR  CG
Sbjct  252   TALLESDQALLKDRRTAPTVYYYSNNRFSFYNDFAKSMVKLSNVGVLTGAE-GQIRYKCG  310

Query  369   SVN  361
             SVN
Sbjct  311   SVN  313



>ref|XP_009107290.1| PREDICTED: peroxidase 10 [Brassica rapa]
Length=369

 Score =   411 bits (1057),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 198/303 (65%), Positives = 236/303 (78%), Gaps = 4/303 (1%)
 Frame = -3

Query  1269  SQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTK  1090
             S LDY FYD+SCP L M+V+ GVW A ++DSR+AASL+RLHFHDCFVNGCDGS+LLDD++
Sbjct  65    SNLDYRFYDRSCPRLQMMVKSGVWRAFKDDSRIAASLLRLHFHDCFVNGCDGSILLDDSE  124

Query  1089  GFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRV  910
              FKGEKN LPNRNS RGF+VI+ IK D+E ACP TVSC DI+ LAA  AV ++GGPYW V
Sbjct  125   DFKGEKNALPNRNSVRGFDVIEDIKTDIESACPITVSCADIVALAAREAVVLTGGPYWPV  184

Query  909   LLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTF  733
              LGRRD LTASE+A    LPSPFE L++ITAKF + GLD KD+VVLSGAH++GFAQCF F
Sbjct  185   PLGRRDSLTASEQAANTNLPSPFEPLENITAKFVSLGLDFKDVVVLSGAHTIGFAQCFVF  244

Query  732   KRRLFNYQGSGKPDPTLESS--FLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             K RLFN++GSG+PDP L +S   LS L  TCPNV  SN+ LA LD  S  +FDN+YY NL
Sbjct  245   KHRLFNFKGSGQPDPNLAASSDLLSKLTDTCPNVASSNSNLAALDAASVVKFDNAYYVNL  304

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             +NN GLL+SDQ LM++   A +VK YS  PY F  DFA SMVK+GN+GV+TG D G IR 
Sbjct  305   MNNVGLLDSDQILMSDSNAAALVKSYSENPYLFSRDFAVSMVKMGNIGVMTGSD-GVIRA  363

Query  378   ICG  370
              CG
Sbjct  364   KCG  366



>ref|XP_003518858.1| PREDICTED: peroxidase 10-like [Glycine max]
Length=338

 Score =   410 bits (1053),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 201/303 (66%), Positives = 235/303 (78%), Gaps = 2/303 (1%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QLD  FYD+SCPNL  IV +GVW A++ND+RMAASL+RLHFHDC VNGCD SVLLDDT  
Sbjct  36    QLDLNFYDRSCPNLQRIVGYGVWLALKNDNRMAASLLRLHFHDCIVNGCDASVLLDDTPY  95

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
             F GEKN LPNRNS RGFEVID IK  +E+ CPSTVSC DIL LAA  A+   GGP W+V 
Sbjct  96    FTGEKNALPNRNSLRGFEVIDDIKEHLERICPSTVSCADILALAAREAIDQIGGPSWQVQ  155

Query  906   LGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRD  T S+EA  +Q+PSP E L++ITAKF ++GLD+KD+V LSGAH++GFA+CFTFK
Sbjct  156   LGRRDATTTSKEAAEQQIPSPIEPLENITAKFFSKGLDMKDVVALSGAHTIGFARCFTFK  215

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
              RLF++QGSG+PDP L+ S LS LQ TCPN D SN+ LAPLD  ST  FDN YY N+V N
Sbjct  216   GRLFDFQGSGRPDPALDFSLLSKLQNTCPNEDASNSNLAPLDATSTMMFDNEYYRNIVYN  275

Query  549   TGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICG  370
             T LLESDQAL+ + +TA  V YYS   + FY DFA SMVKL N+GVLTG + GQIR  CG
Sbjct  276   TALLESDQALLKDRRTAPTVYYYSNNRFSFYNDFAKSMVKLSNVGVLTGAE-GQIRYKCG  334

Query  369   SVN  361
             SVN
Sbjct  335   SVN  337



>ref|NP_175380.2| peroxidase [Arabidopsis thaliana]
 sp|Q9FX85.1|PER10_ARATH RecName: Full=Peroxidase 10; Short=Atperox P10; AltName: Full=ATP5a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG13043.1|AC011807_2 peroxidase ATP5a [Arabidopsis thaliana]
 dbj|BAC43700.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAP12891.1| At1g49570 [Arabidopsis thaliana]
 gb|AEE32443.1| peroxidase [Arabidopsis thaliana]
Length=350

 Score =   410 bits (1054),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 239/303 (79%), Gaps = 4/303 (1%)
 Frame = -3

Query  1269  SQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTK  1090
             S L+Y FYD+SCP L  IV+ GVW A ++DSR+AASL+RLHFHDCFVNGCDGS+LL+D++
Sbjct  46    SNLNYRFYDRSCPRLQTIVKSGVWRAFKDDSRIAASLLRLHFHDCFVNGCDGSILLNDSE  105

Query  1089  GFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRV  910
              FKGEKN  PNRNS RGFEVI+ IK+D+E +CP TVSC DI+ LAA  AV ++GGP+W V
Sbjct  106   DFKGEKNAQPNRNSVRGFEVIEDIKSDIESSCPLTVSCADIVALAAREAVVLTGGPFWPV  165

Query  909   LLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTF  733
              LGRRD LTASE+A    LPSPFE+L++ITAKF   GLDLKD+VVLSGAH++GFAQCF  
Sbjct  166   PLGRRDSLTASEQAANTNLPSPFEALENITAKFVTLGLDLKDVVVLSGAHTIGFAQCFVI  225

Query  732   KRRLFNYQGSGKPDPTL--ESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             K RLFN++GSG+PDP L   S+ LS L+ TCPNVD S++KLA LD  S+ +FDN+YY NL
Sbjct  226   KHRLFNFKGSGQPDPNLAASSALLSKLKDTCPNVDSSDSKLAALDAASSVKFDNAYYVNL  285

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             +NN GLL+SDQ LM +P  A +VK YS  PY F  DFA SMVK+GN+GV+TG D G IR 
Sbjct  286   MNNIGLLDSDQTLMTDPTAAALVKSYSENPYLFSRDFAVSMVKMGNIGVMTGSD-GVIRG  344

Query  378   ICG  370
              CG
Sbjct  345   KCG  347



>gb|ACU24350.1| unknown [Glycine max]
Length=338

 Score =   410 bits (1053),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 201/303 (66%), Positives = 235/303 (78%), Gaps = 2/303 (1%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QLD  FYD+SCPNL  IV +GVW A++ND+RMAASL+RLHFHDC VNGCD SVLLDDT  
Sbjct  36    QLDLNFYDRSCPNLQRIVGYGVWLALKNDNRMAASLLRLHFHDCIVNGCDASVLLDDTPY  95

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
             F GEKN LPNRNS RGFEVID IK  +E+ CPSTVSC DIL LAA  A+   GGP W+V 
Sbjct  96    FTGEKNALPNRNSLRGFEVIDDIKEHLERICPSTVSCADILALAAREAIDHIGGPSWQVQ  155

Query  906   LGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRD  T S+EA  +Q+PSP E L++ITAKF ++GLD+KD+V LSGAH++GFA+CFTFK
Sbjct  156   LGRRDATTTSKEAAEQQIPSPIEPLENITAKFFSKGLDMKDVVALSGAHTIGFARCFTFK  215

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
              RLF++QGSG+PDP L+ S LS LQ TCPN D SN+ LAPLD  ST  FDN YY N+V N
Sbjct  216   GRLFDFQGSGRPDPALDFSLLSKLQNTCPNEDASNSNLAPLDATSTMMFDNEYYRNIVYN  275

Query  549   TGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICG  370
             T LLESDQAL+ + +TA  V YYS   + FY DFA SMVKL N+GVLTG + GQIR  CG
Sbjct  276   TALLESDQALLKDRRTAPTVYYYSNNRFSFYNDFAKSMVKLSNVGVLTGAE-GQIRYKCG  334

Query  369   SVN  361
             SVN
Sbjct  335   SVN  337



>emb|CAA67341.1| peroxidase [Arabidopsis thaliana]
Length=350

 Score =   410 bits (1053),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 239/303 (79%), Gaps = 4/303 (1%)
 Frame = -3

Query  1269  SQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTK  1090
             S L+Y FYD+SCP L  IV+ GVW A ++DSR+AASL+RLHFHDCFVNGCDGS+LL+D++
Sbjct  46    SNLNYRFYDRSCPRLQTIVKSGVWRAFKDDSRIAASLLRLHFHDCFVNGCDGSILLNDSE  105

Query  1089  GFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRV  910
              FKGEKN  PNRNS RGFEVI+ IK+D+E +CP TVSC DI+ LAA  AV ++GGP+W V
Sbjct  106   DFKGEKNAQPNRNSVRGFEVIEDIKSDIESSCPLTVSCADIVALAAREAVVLTGGPFWPV  165

Query  909   LLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTF  733
              LGRRD LTASE+A    LPSPFE+L++ITAKF+  GLDLKD+VVLSGAH++GFAQCF  
Sbjct  166   PLGRRDSLTASEQAANTNLPSPFEALENITAKFATLGLDLKDVVVLSGAHTIGFAQCFVI  225

Query  732   KRRLFNYQGSGKPDPTL--ESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             K RLFN++GSG+PDP L   S+ LS L+ TCPNVD S++KLA LD  S+ +FDN+YY NL
Sbjct  226   KHRLFNFKGSGQPDPNLAASSALLSKLKDTCPNVDSSDSKLAALDAASSVKFDNAYYVNL  285

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             +NN GLL+SDQ LM +P  A +VK YS  PY F  DFA SMVK+GN+GV TG D G IR 
Sbjct  286   MNNIGLLDSDQTLMTDPTAAALVKSYSENPYLFSRDFAVSMVKMGNIGVQTGSD-GVIRG  344

Query  378   ICG  370
              CG
Sbjct  345   KCG  347



>ref|XP_002891521.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67780.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score =   409 bits (1052),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 237/303 (78%), Gaps = 4/303 (1%)
 Frame = -3

Query  1269  SQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTK  1090
             S L+Y FYD+SCP L  IV+ GVW A ++DSR+AASL+RLHFHDCFVNGCDGS+LL+D++
Sbjct  46    SNLNYRFYDRSCPRLQTIVKSGVWRAFKDDSRIAASLLRLHFHDCFVNGCDGSILLNDSE  105

Query  1089  GFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRV  910
              FKGEKN  PNRNS RGFEVI+ IK+D+E +CP TVSC DI+ LAA  AV ++GGP+W V
Sbjct  106   DFKGEKNARPNRNSVRGFEVIEDIKSDIESSCPLTVSCADIVALAAREAVVLTGGPFWPV  165

Query  909   LLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTF  733
              LGRRD LTASE+A    LPSP E L++ITAKF   GLDLKD+VVLSGAH++GFAQCF F
Sbjct  166   PLGRRDSLTASEQAANTNLPSPLEPLENITAKFVTLGLDLKDVVVLSGAHTIGFAQCFVF  225

Query  732   KRRLFNYQGSGKPDPTL--ESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             K RLFN++GSG+PDP L   S+ LS L+ TCPNVD S++KLA LD  S+ +FDN+YY NL
Sbjct  226   KHRLFNFKGSGQPDPNLAASSALLSKLKDTCPNVDSSDSKLAALDAASSVKFDNAYYVNL  285

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             VNN GLL+SDQ LM +P  A +VK YS  PY F  DF  SMVK+GN+GV+TG D G IR 
Sbjct  286   VNNIGLLDSDQTLMTDPTAAALVKSYSENPYLFSKDFVVSMVKMGNIGVMTGSD-GVIRA  344

Query  378   ICG  370
              CG
Sbjct  345   KCG  347



>gb|KHN37486.1| Peroxidase 10 [Glycine soja]
Length=332

 Score =   408 bits (1049),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/306 (64%), Positives = 237/306 (77%), Gaps = 2/306 (1%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             + +QLD  FYD SCPNL  IVR+GVWSAI+ND+RMAASL+RLHFHDC VNGCD SVLLDD
Sbjct  27    SNNQLDTNFYDGSCPNLATIVRYGVWSAIKNDNRMAASLLRLHFHDCIVNGCDASVLLDD  86

Query  1095  TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYW  916
             T  F GEKN  PNRNS RG EVID+IK  VE+ CPSTVSC DIL+LA   A+ + GGP W
Sbjct  87    TPYFTGEKNASPNRNSLRGMEVIDNIKEQVERQCPSTVSCADILSLAVREAIDLVGGPSW  146

Query  915   RVLLGRRDGLTASE-EATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCF  739
              V LGRRD   A+  EA +Q+PSPFE L +I AKF+++GL+L+D+V LSGAH++G+A+C 
Sbjct  147   PVALGRRDATKANRMEANQQIPSPFEPLDNIIAKFTSKGLNLRDVVALSGAHTIGYARCL  206

Query  738   TFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             TFKRRLF++QGSG+PDP L SS LS LQ+TCPN D SN+ +APLD  +T  FDN YY NL
Sbjct  207   TFKRRLFDFQGSGRPDPVLASSLLSKLQSTCPNGDTSNSYIAPLDSNTTLTFDNEYYRNL  266

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             + N GLLESD AL+A+ +T+ M  +YS   Y FY DFA SMVKL N+GVLTG   GQIR+
Sbjct  267   LYNKGLLESDMALLADRRTSSMAYFYSTDQYSFYNDFAASMVKLSNVGVLTGI-QGQIRR  325

Query  378   ICGSVN  361
              CGSVN
Sbjct  326   KCGSVN  331



>ref|NP_001240064.1| uncharacterized protein LOC100805712 precursor [Glycine max]
 gb|ACU21179.1| unknown [Glycine max]
Length=332

 Score =   407 bits (1046),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 237/306 (77%), Gaps = 2/306 (1%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             + +QLD  FYD SCPNL  IVR+GVWSAI+ND+RMAASL+RLHFHDC VNGCD SVLLDD
Sbjct  27    SNNQLDTNFYDGSCPNLATIVRYGVWSAIKNDNRMAASLLRLHFHDCIVNGCDASVLLDD  86

Query  1095  TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYW  916
             T  F GEKN  PNRNS RG EVID+IK  VE+ CPSTVSC DIL+LA   A+ + GGP W
Sbjct  87    TPYFTGEKNASPNRNSLRGMEVIDNIKEQVERQCPSTVSCADILSLAVREAIDLVGGPSW  146

Query  915   RVLLGRRDGLTASE-EATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCF  739
              V LGRRD   A+  EA +Q+PSPFE L +I AKF+++GL+L+D+V LSGAH++G+A+C 
Sbjct  147   PVALGRRDATKANRMEANQQIPSPFEPLDNIIAKFTSKGLNLRDVVALSGAHTIGYARCL  206

Query  738   TFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             TFKRRLF++QGSG+PDP L SS LS LQ+TCPN D SN+ +APLD  +T  FDN YY NL
Sbjct  207   TFKRRLFDFQGSGRPDPVLASSLLSKLQSTCPNGDTSNSYIAPLDSNTTLTFDNEYYRNL  266

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             + N GLLESD AL+++ +T+ M  +YS   Y FY DFA SMVKL N+GVLTG   GQIR+
Sbjct  267   LYNKGLLESDMALLSDRRTSSMAYFYSTDQYSFYNDFAASMVKLSNVGVLTGI-QGQIRR  325

Query  378   ICGSVN  361
              CGSVN
Sbjct  326   KCGSVN  331



>ref|XP_004511960.1| PREDICTED: peroxidase 10-like [Cicer arietinum]
Length=326

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/317 (63%), Positives = 241/317 (76%), Gaps = 3/317 (1%)
 Frame = -3

Query  1305  VFLGFLA--APMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCF  1132
             VF+ +L    P+  SQL Y FYD +CPNL  IVR+ VWSA+ ND+R+AASL+RLHFHDCF
Sbjct  11    VFMFYLVFLTPLVCSQLYYNFYDLTCPNLTRIVRYNVWSAMANDTRIAASLLRLHFHDCF  70

Query  1131  VNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAA  952
             V GCD SVLLDDT    GEKN LPN+NS RGF+VID IK+D+E ACPSTVSC DILTLAA
Sbjct  71    VIGCDASVLLDDTNTLTGEKNALPNKNSIRGFDVIDKIKSDLENACPSTVSCADILTLAA  130

Query  951   SYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLS  772
               AV +S GP+W V LGRRDG TASE     LPSPFE L++ITAKF ++GL+ KD+ VLS
Sbjct  131   REAVYLSKGPFWAVPLGRRDGTTASESEANNLPSPFEPLENITAKFISKGLEKKDVAVLS  190

Query  771   GAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQST  592
             GAH+ GFAQCFTFK RLF++ GSGK DPTL++S L NLQ TCPN   S+T LAPLD  +T
Sbjct  191   GAHTFGFAQCFTFKTRLFDFGGSGKSDPTLDTSLLQNLQKTCPNQADSDTNLAPLDPVTT  250

Query  591   YRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGV  412
               FDN+YY NLV N GLL+SDQAL+ +  T+ +V  YS +P  F+ DFA S+ K+G +GV
Sbjct  251   NTFDNTYYKNLVTNVGLLQSDQALLGDNTTSSLVTNYSKWPILFFRDFAVSIEKMGRIGV  310

Query  411   LTGKDNGQIRKICGSVN  361
             LTG+  GQIR+ C +VN
Sbjct  311   LTGQ-QGQIRRNCRAVN  326



>ref|XP_007156825.1| hypothetical protein PHAVU_002G020900g [Phaseolus vulgaris]
 gb|ESW28819.1| hypothetical protein PHAVU_002G020900g [Phaseolus vulgaris]
Length=327

 Score =   402 bits (1033),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 198/322 (61%), Positives = 242/322 (75%), Gaps = 5/322 (2%)
 Frame = -3

Query  1326  MVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLH  1147
              V++  +VFL    +P+  SQL Y FY+ +CPNL  IVR+ VWSA+  D+R+AASL+RLH
Sbjct  11    FVSMFWLVFL----SPLVCSQLYYNFYESTCPNLTGIVRYNVWSAMAKDARIAASLLRLH  66

Query  1146  FHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             FHDCFV GCD SVLLDDT   KGEKN LPN+NS RGFEVID+IKA++EKACPSTVSC DI
Sbjct  67    FHDCFVLGCDASVLLDDTDTLKGEKNALPNKNSLRGFEVIDTIKANLEKACPSTVSCADI  126

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKD  787
             LTLAA  AV +S GP+W V LGRRDG TASE     LPSPFE ++DIT KF ++GL+ KD
Sbjct  127   LTLAAREAVYLSRGPFWSVPLGRRDGTTASESEANNLPSPFEPIEDITTKFISKGLEKKD  186

Query  786   MVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPL  607
             + VLSGAH+ GFAQCFTFK RLFN+ GSGK DP L+ S L +LQ  CPN   S+T LAPL
Sbjct  187   VAVLSGAHTFGFAQCFTFKPRLFNFGGSGKSDPALDDSVLQSLQKVCPNQADSDTNLAPL  246

Query  606   DYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKL  427
             D  +T  FDN+YY N+VNN+GLL+SDQAL+ +  TA +V  YS +P  F+ DFA SM K+
Sbjct  247   DPVTTNTFDNTYYKNIVNNSGLLQSDQALLGDNTTASLVNNYSKWPLLFFRDFAVSMEKM  306

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             G +G LTG+  GQIR  C ++N
Sbjct  307   GRIGALTGQ-QGQIRANCRALN  327



>gb|KFK36000.1| hypothetical protein AALP_AA4G064800 [Arabis alpina]
Length=350

 Score =   402 bits (1033),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 238/306 (78%), Gaps = 4/306 (1%)
 Frame = -3

Query  1278  MAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLD  1099
             ++ S LDY FYD+SCP L  IV+ GVW A ++DSR+AASL+RLHFHDCFVNGCDGS+LL+
Sbjct  43    ISTSNLDYRFYDRSCPRLQTIVKSGVWKAFKDDSRIAASLLRLHFHDCFVNGCDGSILLN  102

Query  1098  DTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPY  919
             D++ FKGEKN  PN+NS RG+EVI+ IK D+E +CP TVSC DI+ LAA  AV ++GGP+
Sbjct  103   DSEDFKGEKNARPNKNSVRGYEVIEDIKTDIETSCPLTVSCADIVALAAREAVVLTGGPF  162

Query  918   WRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQC  742
             W V LGRRD LTASE+A    LPSPFE L +ITAKF   GLDLKD+VVLSGAH++GFAQC
Sbjct  163   WPVPLGRRDSLTASEQAANTNLPSPFEPLANITAKFVNLGLDLKDVVVLSGAHTIGFAQC  222

Query  741   FTFKRRLFNYQGSGKPDPTL--ESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYY  568
             F FK RLFN++GSG+PDP L   S+ LS L  TCPNV+ S++KLA LD  S+ +FDN+YY
Sbjct  223   FVFKHRLFNFKGSGQPDPNLAASSALLSKLTDTCPNVNSSDSKLAALDAASSVKFDNAYY  282

Query  567   TNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQ  388
              NL+NN GLL+SDQ LM++  +A +VK YS  PY F  DFA SM+K+G +GV+TG D G 
Sbjct  283   VNLMNNVGLLDSDQTLMSDSTSAALVKSYSENPYLFSRDFAISMIKMGKIGVMTGSD-GV  341

Query  387   IRKICG  370
             IR  CG
Sbjct  342   IRAKCG  347



>ref|XP_002281824.1| PREDICTED: peroxidase 10 isoform X1 [Vitis vinifera]
 emb|CBI32463.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 200/320 (63%), Positives = 242/320 (76%), Gaps = 3/320 (1%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQ-LDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFH  1141
             I  +    FL  P A SQ LDY FYD+SCP+L +IV   VW A   +SR+AA+L+RLHFH
Sbjct  12    IPFLCLFSFLV-PSAYSQFLDYKFYDRSCPDLPVIVVRNVWEAYWKESRVAATLLRLHFH  70

Query  1140  DCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILT  961
             DC VNGCD SVLLDDT+ FKGEK+   NR     FEVID+IK DVE ACPSTVSC DILT
Sbjct  71    DCIVNGCDASVLLDDTEDFKGEKSTPVNRMLPLAFEVIDNIKEDVESACPSTVSCVDILT  130

Query  960   LAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             LAA   V +SGG YW V LGRRDG T+  +A  Q+P+PFE L++ITAKF+++GLDLKD+V
Sbjct  131   LAAREGVILSGGRYWNVPLGRRDGTTSDPKAVVQIPAPFEPLENITAKFTSKGLDLKDVV  190

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH++GFAQCFTFK RLFN+QG+G+PDPTL++S LS+L+ TCPN D ++T +APLD 
Sbjct  191   ALSGAHTIGFAQCFTFKSRLFNFQGTGQPDPTLDASVLSDLRKTCPNKDSADTNIAPLDS  250

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
              ST RFDN+YY NLV NTGLL+SDQALM +P TA +V  Y   P  F+ DF TSMVKL  
Sbjct  251   VSTNRFDNAYYGNLVRNTGLLKSDQALMTDPDTAALVNRYRTNPRYFFRDFVTSMVKLSY  310

Query  420   LGVLTGKDNGQIRKICGSVN  361
             +G+LTG + GQIRK C  VN
Sbjct  311   VGILTG-EKGQIRKDCRFVN  329



>gb|AEX20391.1| putative class III peroxidase [Coffea arabica x Coffea canephora]
Length=265

 Score =   397 bits (1020),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 190/263 (72%), Positives = 224/263 (85%), Gaps = 2/263 (1%)
 Frame = -3

Query  1146  FHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             F D FVNGCDGSVLLDDT  FKGEKN LPNRNSARGFEVI+SIKADVE+ACPS VSC DI
Sbjct  1     FQDWFVNGCDGSVLLDDTPNFKGEKNALPNRNSARGFEVIESIKADVERACPSIVSCADI  60

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLK  790
             L LAA  AV +S GP+W V LGRRD LTAS +A  +QLP+PFESL +I  KF++ GLDL+
Sbjct  61    LALAAREAVILSEGPFWPVSLGRRDALTASTKAANEQLPTPFESLDNIVTKFASNGLDLR  120

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             D+VVLSGAH++G+AQCFTFKRRLF+++GSGKPDP L++S +++LQ TCPNVD SN+KLAP
Sbjct  121   DVVVLSGAHTLGYAQCFTFKRRLFDFKGSGKPDPLLDASMVASLQGTCPNVDESNSKLAP  180

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             LD Q+ Y+FDN+YY NL+ NTGLLESDQALM NP+TA+MV +YS YPY +  DFA SMVK
Sbjct  181   LDVQTVYKFDNAYYKNLMTNTGLLESDQALMGNPKTAEMVNFYSTYPYLYSRDFAASMVK  240

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             LGN+GVLTG+D GQIRK CGSVN
Sbjct  241   LGNIGVLTGQD-GQIRKKCGSVN  262



>ref|XP_011007672.1| PREDICTED: peroxidase 10-like [Populus euphratica]
Length=322

 Score =   399 bits (1024),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 203/303 (67%), Positives = 246/303 (81%), Gaps = 7/303 (2%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QL+Y FYD +CP+L  IVR GVWSA+ NDSRMAASL+RLHFHDCFVNGCDGSVLLD    
Sbjct  26    QLNYKFYDYTCPDLTKIVRSGVWSAMTNDSRMAASLLRLHFHDCFVNGCDGSVLLD----  81

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
               GEKN  PNRNSARGFEVID IKA++E+ACP+TVSCTDILTLAA  AV +SGGPYW + 
Sbjct  82    -GGEKNAFPNRNSARGFEVIDDIKANLERACPATVSCTDILTLAAREAVYLSGGPYWFLP  140

Query  906   LGRRDGLTASE-EATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRDGLTASE +A +QLP   E L +ITAKF+++GL+ KD+VVLSGAH++GFAQCFTFK
Sbjct  141   LGRRDGLTASESDANEQLPGFSEPLVNITAKFTSKGLEPKDVVVLSGAHTIGFAQCFTFK  200

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
              RLF++ GSG+PDP L++S L++LQ+TCPN D S++KLAPLD  S+ +FDN YY  L+NN
Sbjct  201   SRLFDFGGSGEPDPLLDTSLLTSLQSTCPNQDDSDSKLAPLDSSSSSKFDNLYYKLLLNN  260

Query  549   TGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICG  370
             +GLL+SDQALM +  TA +V  YS +PY F  DF  SMVK+ N+GVLTG+ NG+IRK C 
Sbjct  261   SGLLQSDQALMGDKTTASLVLNYSKFPYLFSKDFGASMVKMANIGVLTGQ-NGEIRKNCR  319

Query  369   SVN  361
              VN
Sbjct  320   LVN  322



>ref|XP_003611788.1| Peroxidase [Medicago truncatula]
 gb|AES94746.1| class III peroxidase [Medicago truncatula]
Length=326

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/323 (61%), Positives = 245/323 (76%), Gaps = 5/323 (2%)
 Frame = -3

Query  1329  VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRL  1150
             V + +  +VFL     P+  SQL Y FY+++CPNL+ IV+  + SAI NDSR+AASL+RL
Sbjct  9     VFIFMFCLVFL----TPLVCSQLYYNFYNRTCPNLNKIVKDNILSAIANDSRIAASLLRL  64

Query  1149  HFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTD  970
             HFHDCFVNGCDGSVLLDDT   KGEKN LPN+NS RGF+VID IK+D+E ACPSTVSC D
Sbjct  65    HFHDCFVNGCDGSVLLDDTDTLKGEKNALPNKNSIRGFDVIDKIKSDLENACPSTVSCAD  124

Query  969   ILTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLK  790
             ILTLAA  AV  S GP+W V LGRRDG TASE     LPSPFE L++ITAKF ++GL+ K
Sbjct  125   ILTLAARDAVYQSKGPFWAVPLGRRDGTTASESDANNLPSPFEPLENITAKFISKGLEKK  184

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             D+ VLSGAH+ GFAQCFTFK RLF++ GSGK DP+L+SS L NLQ  CPN   S++ LAP
Sbjct  185   DVAVLSGAHTFGFAQCFTFKPRLFDFGGSGKSDPSLDSSLLQNLQKVCPNQADSDSNLAP  244

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             LD  +T  FDN+YY N+++N+GLL+SDQAL+ +  T+ +V  YS +P  F+ DFA S+ K
Sbjct  245   LDPVTTNTFDNTYYKNVLSNSGLLQSDQALLGDNTTSALVTNYSKWPILFFRDFAVSVEK  304

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +G +G+L G+  GQIRK C +VN
Sbjct  305   MGRIGILAGQ-QGQIRKNCRAVN  326



>ref|XP_003611789.1| Peroxidase [Medicago truncatula]
 gb|AES94747.1| peroxidase family protein [Medicago truncatula]
Length=326

 Score =   397 bits (1020),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 198/323 (61%), Positives = 244/323 (76%), Gaps = 5/323 (2%)
 Frame = -3

Query  1329  VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRL  1150
             V V +  +VFL     P   SQL Y FY ++CPNL+ IV+  + SAI NDSR+AASL+RL
Sbjct  9     VFVFMFCLVFL----TPNVCSQLYYNFYIRTCPNLNRIVKNNILSAIANDSRIAASLLRL  64

Query  1149  HFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTD  970
             HFHDCFVNGC+GSVLLDDT   KGEKN LPN+NS RGF++ID IK+D+E ACP+TVSC D
Sbjct  65    HFHDCFVNGCEGSVLLDDTDTLKGEKNALPNKNSLRGFDIIDKIKSDLEYACPNTVSCAD  124

Query  969   ILTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLK  790
             ILTLAA  AV  S GP+W V LGRRDG TASE     LPSPFE L++ITAKF ++GL+ K
Sbjct  125   ILTLAARDAVYQSRGPFWAVPLGRRDGTTASESEANNLPSPFEPLENITAKFISKGLEKK  184

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             D+ VLSGAH+ GFAQCFTFK RLF++ GSGK DP+L+SS L NLQ  CPN   S+T LAP
Sbjct  185   DVAVLSGAHTFGFAQCFTFKPRLFDFGGSGKSDPSLDSSLLQNLQRVCPNQADSDTNLAP  244

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             LD  ++  FDN+YY N+++N+GLL+SDQAL+ +  TA +V YYS +P  F+ DFA S+ K
Sbjct  245   LDPVTSNTFDNTYYRNVLSNSGLLQSDQALLGDSTTASLVNYYSKWPILFFRDFAVSVEK  304

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +G +GVLTG+  GQIRK C  VN
Sbjct  305   MGRIGVLTGQ-QGQIRKNCRVVN  326



>emb|CDP02473.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   392 bits (1008),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 188/272 (69%), Positives = 224/272 (82%), Gaps = 2/272 (1%)
 Frame = -3

Query  1173  MAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKAC  994
             MAAS++RLHFHDCFVNGC+GSVLLDD+   KGEKN +PN+NSARGFEVID+IKA+VEKAC
Sbjct  1     MAASILRLHFHDCFVNGCEGSVLLDDSSTIKGEKNAVPNKNSARGFEVIDAIKANVEKAC  60

Query  993   PSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASE-EATKQLPSPFESLKDITAK  817
             PSTVSC DIL LAA  AV ++GGPYW VLLGRRDGLTASE  A  QLPSPFESL +ITAK
Sbjct  61    PSTVSCADILALAAREAVYLAGGPYWPVLLGRRDGLTASEGAANTQLPSPFESLANITAK  120

Query  816   FSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNV  637
             F+ +GLD+KD+VVLSG H++GFAQCFTFK RLFN+ G+G PDPTL+++ L++L+  CPN 
Sbjct  121   FTDKGLDMKDVVVLSGGHTIGFAQCFTFKPRLFNFDGAGNPDPTLDATLLTSLRGLCPNE  180

Query  636   DGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFY  457
               S++ LAPLD  S  +FDNSYY NLVNN+GLL SDQ LM++  TA MV YYS +P+ F 
Sbjct  181   ASSDSNLAPLDAASVSKFDNSYYKNLVNNSGLLGSDQVLMSDNTTAAMVSYYSKFPFLFS  240

Query  456   MDFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
              DF  SMVK+GN+GVLTG+D GQIRK C  VN
Sbjct  241   KDFGVSMVKMGNIGVLTGQD-GQIRKNCRVVN  271



>ref|XP_010647781.1| PREDICTED: peroxidase 10 isoform X2 [Vitis vinifera]
Length=324

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 198/320 (62%), Positives = 239/320 (75%), Gaps = 8/320 (3%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQ-LDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFH  1141
             I  +    FL  P A SQ LDY FYD+SCP+L +IV   VW A   +SR+AA+L+RLHFH
Sbjct  12    IPFLCLFSFLV-PSAYSQFLDYKFYDRSCPDLPVIVVRNVWEAYWKESRVAATLLRLHFH  70

Query  1140  DCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILT  961
             DC VNGCD SVLLDDT+ FKGEK+   NR     FEVID+IK DVE ACPSTVSC DILT
Sbjct  71    DCIVNGCDASVLLDDTEDFKGEKSTPVNRMLPLAFEVIDNIKEDVESACPSTVSCVDILT  130

Query  960   LAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             LAA       GG YW V LGRRDG T+  +A  Q+P+PFE L++ITAKF+++GLDLKD+V
Sbjct  131   LAAR-----EGGRYWNVPLGRRDGTTSDPKAVVQIPAPFEPLENITAKFTSKGLDLKDVV  185

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH++GFAQCFTFK RLFN+QG+G+PDPTL++S LS+L+ TCPN D ++T +APLD 
Sbjct  186   ALSGAHTIGFAQCFTFKSRLFNFQGTGQPDPTLDASVLSDLRKTCPNKDSADTNIAPLDS  245

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
              ST RFDN+YY NLV NTGLL+SDQALM +P TA +V  Y   P  F+ DF TSMVKL  
Sbjct  246   VSTNRFDNAYYGNLVRNTGLLKSDQALMTDPDTAALVNRYRTNPRYFFRDFVTSMVKLSY  305

Query  420   LGVLTGKDNGQIRKICGSVN  361
             +G+LTG + GQIRK C  VN
Sbjct  306   VGILTG-EKGQIRKDCRFVN  324



>ref|XP_003537345.2| PREDICTED: peroxidase 10-like [Glycine max]
 gb|KHN42063.1| Peroxidase 10 [Glycine soja]
Length=327

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 195/321 (61%), Positives = 236/321 (74%), Gaps = 5/321 (2%)
 Frame = -3

Query  1323  VAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHF  1144
             V++  +VFL    +P+   QL Y FYD +CPNL  IVR  VWSA+  D+R+AASL+RLHF
Sbjct  12    VSMFWLVFL----SPLVNCQLYYNFYDSTCPNLTGIVRSNVWSAMAKDARIAASLLRLHF  67

Query  1143  HDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDIL  964
             HDCFV GCD SVLLDDT   KGEKN LPN+NS RGFEVID+IK+ +EKACPSTVSC DIL
Sbjct  68    HDCFVIGCDASVLLDDTGTLKGEKNALPNKNSLRGFEVIDTIKSALEKACPSTVSCADIL  127

Query  963   TLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDM  784
              LAA  AV +S G +W V LGRRDG TASE     LPSPFE +++ITAKF ++GL+ KD+
Sbjct  128   ALAAREAVNLSKGTFWYVPLGRRDGTTASESEANNLPSPFEPIENITAKFISKGLEKKDV  187

Query  783   VVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLD  604
              VLSGAH++GFAQCFTFK RLF++ GSGK DP L+ S L NL   CPN   S+T LAPLD
Sbjct  188   AVLSGAHTLGFAQCFTFKPRLFDFGGSGKSDPALDVSLLQNLVKLCPNQADSDTNLAPLD  247

Query  603   YQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLG  424
               +T  FDN YY N+VNN+GLL+SDQAL+ +  TA +V  YS +P  F+ DF  SM K+G
Sbjct  248   PVTTNTFDNMYYKNIVNNSGLLQSDQALLGDSTTASLVNTYSKWPLMFFRDFGISMEKMG  307

Query  423   NLGVLTGKDNGQIRKICGSVN  361
              +GVLTG   GQIR  C +VN
Sbjct  308   RIGVLTGSQ-GQIRTNCRAVN  327



>ref|XP_006848540.1| hypothetical protein AMTR_s00169p00032570 [Amborella trichopoda]
 gb|ERN10121.1| hypothetical protein AMTR_s00169p00032570 [Amborella trichopoda]
Length=311

 Score =   389 bits (998),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 227/306 (74%), Gaps = 3/306 (1%)
 Frame = -3

Query  1272  ESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDT  1093
              SQLDY FY  SCPNL  +V+  VW+A++NDSRMAASL+RLHFHDCFVNGCD S+LLDDT
Sbjct  5     HSQLDYNFYKSSCPNLTRLVKGAVWAAVKNDSRMAASLLRLHFHDCFVNGCDASLLLDDT  64

Query  1092  KGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWR  913
               F  EKN  PNRNS RGFEV+D+IKA VEK CP+TVSC+DIL LAA  +V + GGPYW 
Sbjct  65    ANFTSEKNAGPNRNSTRGFEVVDTIKASVEKECPATVSCSDILALAARDSVFLMGGPYWY  124

Query  912   VLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFT  736
             V LGRRDG   SE A   ++P P ESL  IT KF A+GL+LKD+VVLSG H+ GFA+C T
Sbjct  125   VYLGRRDGKVGSESAANSEIPGPSESLDKITDKFVAKGLNLKDVVVLSGGHTFGFAKCST  184

Query  735   FKRRLFNYQGSGKPDPTLESSFLSNLQTTCP-NVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             F  RLFN+ G+G PDPTL+S+ L +LQ+ CP N   ++T LAPLD  +T  FDN YY NL
Sbjct  185   FSSRLFNHSGTGSPDPTLDSTLLEDLQSQCPNNASDTSTNLAPLDRVTTNYFDNVYYKNL  244

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             +NN GLL+SDQAL+ N QTA MV  YS   Y F+ DF  SMVK+ N+ VLTG+D G IRK
Sbjct  245   INNLGLLKSDQALLTNNQTASMVANYSYNQYLFFKDFMVSMVKMANISVLTGQD-GDIRK  303

Query  378   ICGSVN  361
              C  VN
Sbjct  304   NCRFVN  309



>ref|XP_003517286.2| PREDICTED: peroxidase 10-like [Glycine max]
Length=327

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/323 (60%), Positives = 236/323 (73%), Gaps = 5/323 (2%)
 Frame = -3

Query  1329  VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRL  1150
             + V+I   VFL    +P+   QL Y FYD +CPNL  IVR  V SA+  D+R+AASL+RL
Sbjct  10    LFVSIFWFVFL----SPLVNCQLYYNFYDTTCPNLTGIVRDNVRSAMAKDARIAASLLRL  65

Query  1149  HFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTD  970
             HFHDCFV GCD SVLLDDT   KGEKN LPN+NS RGFEVID+IKA +EKACPSTVSC D
Sbjct  66    HFHDCFVIGCDASVLLDDTGTLKGEKNALPNKNSLRGFEVIDTIKAALEKACPSTVSCAD  125

Query  969   ILTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLK  790
             ILTLAA   V +S GP+W V LGRRDG TASE     LPSPFE +++ITAKF ++GL+ K
Sbjct  126   ILTLAARETVYLSKGPFWYVPLGRRDGTTASESEANNLPSPFEPVENITAKFISKGLEKK  185

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             D+ VLSGAH++GFAQCF+FK RLF++ GSGK DP+L+ S L NL   CPN   S+T LAP
Sbjct  186   DVAVLSGAHTLGFAQCFSFKPRLFDFGGSGKSDPSLDVSLLQNLVKLCPNQADSDTNLAP  245

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             LD  +T  FDN YY N+VNN+GLL+SDQAL+ +   A +V  YS +P  F+ DFA SM K
Sbjct  246   LDPVTTNTFDNMYYKNIVNNSGLLQSDQALLGDSTIASLVNVYSKWPIMFFRDFAVSMEK  305

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +  +GVLTG   GQIR  C +VN
Sbjct  306   MSRIGVLTGS-RGQIRTNCRAVN  327



>ref|XP_008459217.1| PREDICTED: peroxidase 10-like [Cucumis melo]
Length=335

 Score =   387 bits (995),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 190/325 (58%), Positives = 244/325 (75%), Gaps = 3/325 (1%)
 Frame = -3

Query  1329  VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRL  1150
             + +++  ++F  F+    A  +L   FYD+SCP L MI+R+ +W+A++NDSRMAASL+RL
Sbjct  7     IFLSLLFLIFPFFIQQSNAYIELRPDFYDESCPRLPMIIRYHIWAAVQNDSRMAASLLRL  66

Query  1149  HFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTD  970
             +FHDC V+GC+ SVLLDDT+  KGEKN   N  S RGFEVID IKAD+E  CP TVSC D
Sbjct  67    NFHDCIVDGCEASVLLDDTRDMKGEKNAPGNVKSLRGFEVIDGIKADLETYCPQTVSCAD  126

Query  969   ILTLAASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDL  793
             I+ LAA  AV + GGP+W + LGRRDGLTAS +    QLPSP  SL++ TAKF ++GLDL
Sbjct  127   IVNLAAREAVYLVGGPFWHLPLGRRDGLTASLKSVLAQLPSPKASLENNTAKFISKGLDL  186

Query  792   KDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNV-DGSNTKL  616
             KD+VVLSGAH++GFA+C TFK RLFNY+GSG PDP + ++ LS+L++ CPN  DG+   L
Sbjct  187   KDLVVLSGAHTIGFARCVTFKARLFNYKGSGNPDPDINTAMLSDLRSMCPNRNDGTGANL  246

Query  615   APLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSM  436
             APLD  S  RFDN Y+TNL+ N GLLESDQ LMA+PQTA MV+ YS  P  FY DF+ SM
Sbjct  247   APLDVASYDRFDNEYFTNLIGNVGLLESDQGLMADPQTARMVREYSFDPNLFYEDFSESM  306

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             +++  +GV+TG++ GQIRK CG VN
Sbjct  307   MRMSLVGVMTGRE-GQIRKQCGVVN  330



>ref|XP_004161643.1| PREDICTED: peroxidase 10-like [Cucumis sativus]
Length=338

 Score =   382 bits (980),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 188/312 (60%), Positives = 234/312 (75%), Gaps = 3/312 (1%)
 Frame = -3

Query  1290  LAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGS  1111
             L   MA  +L   FYD+SCP L MI+R+ +W+A++NDSRMAASL+RL+FHDC V+GCD S
Sbjct  23    LKCKMAYIELRPDFYDESCPRLPMIIRYHIWAAVQNDSRMAASLLRLNFHDCIVDGCDAS  82

Query  1110  VLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMS  931
             VLLDDT   KGEKN   N  S RGFEVID IKAD+E  CP TVSC DI+ LAA  AV + 
Sbjct  83    VLLDDTTEMKGEKNAPGNVKSLRGFEVIDGIKADLEAYCPQTVSCADIVNLAAREAVYLV  142

Query  930   GGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVG  754
             GGP+W + LGRRDGLTAS +    QLPSP  SL++ TAKF ++GLDLKD+VVLSGAH++G
Sbjct  143   GGPFWHLPLGRRDGLTASIKSVLAQLPSPKASLENNTAKFISKGLDLKDLVVLSGAHTIG  202

Query  753   FAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNV-DGSNTKLAPLDYQSTYRFDN  577
             FA+C TFK RLFN++GSG PDP + ++ L++L++ CPN  DG+   LAPLD  S  RFDN
Sbjct  203   FARCVTFKGRLFNFKGSGNPDPDINAAMLTDLRSMCPNRNDGTGANLAPLDVASYDRFDN  262

Query  576   SYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKD  397
              Y+TNL+ N GLLESDQ LMA+PQT  MV+ YS  P  F+ DFA SM ++  +GV+TG++
Sbjct  263   EYFTNLIGNVGLLESDQGLMADPQTGRMVREYSFDPNLFFEDFAESMFRMSLVGVMTGRE  322

Query  396   NGQIRKICGSVN  361
              GQIRK CG VN
Sbjct  323   -GQIRKQCGVVN  333



>emb|CAN81423.1| hypothetical protein VITISV_035943 [Vitis vinifera]
Length=941

 Score =   400 bits (1028),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 193/306 (63%), Positives = 235/306 (77%), Gaps = 6/306 (2%)
 Frame = -3

Query  1290  LAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGS  1111
             LA+P+    LDY FYD+SCP+L M+V   VW A R +SR+AA+L+RLHFHDC VNGCD S
Sbjct  390   LASPLLGQFLDYKFYDRSCPDLPMMVMRNVWEAYRKESRVAATLLRLHFHDCIVNGCDAS  449

Query  1110  VLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMS  931
             VLLDDT+ FKGEK+   NR     FEVID+IK DVE ACPSTVSC DILTLAA       
Sbjct  450   VLLDDTEDFKGEKSTPVNRMLPLAFEVIDNIKEDVESACPSTVSCVDILTLAAR-----E  504

Query  930   GGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGF  751
             GG YW V LGRRDG T+  +A  Q+P+PFE L++ITAKF+++GLDLKD+V LSGAH++GF
Sbjct  505   GGRYWNVPLGRRDGTTSDPKAVVQIPAPFEPLENITAKFTSKGLDLKDVVALSGAHTIGF  564

Query  750   AQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSY  571
             AQCFTFK RLFN+QG+G+PDPTL++S LS+L+ TCPN D ++T +APLD  ST RFDN+Y
Sbjct  565   AQCFTFKSRLFNFQGTGQPDPTLDASVLSDLRKTCPNKDSADTNIAPLDSVSTNRFDNAY  624

Query  570   YTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNG  391
             Y NLV NTGLL+SDQALM +P TA +V  Y   P  F+ DF TSMVKL  +G+LTG + G
Sbjct  625   YENLVRNTGLLKSDQALMTDPDTAALVNRYRTNPRYFFRDFVTSMVKLSYVGILTG-EKG  683

Query  390   QIRKIC  373
             QIRK C
Sbjct  684   QIRKDC  689



>emb|CDX77234.1| BnaC08g02790D [Brassica napus]
Length=331

 Score =   379 bits (972),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 182/278 (65%), Positives = 219/278 (79%), Gaps = 4/278 (1%)
 Frame = -3

Query  1194  AIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIK  1015
             ++ +DSR+AASL+RLHFHDCFVNGCDGS+LLDD++ FKGEKN LPNRNS RGF+VI+ IK
Sbjct  52    SMTDDSRIAASLLRLHFHDCFVNGCDGSILLDDSEDFKGEKNALPNRNSVRGFDVIEDIK  111

Query  1014  ADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFES  838
              D+E ACP TVSC DI+ LAA  AV ++GGP+W V LGRRD LTASE+A    LPSPFE 
Sbjct  112   TDIESACPLTVSCADIVALAAREAVVLTGGPFWPVPLGRRDSLTASEQAANTNLPSPFEP  171

Query  837   LKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESS--FLS  664
             L++ITAKF + GLD KD+VVLSGAH++GFAQCF FK RLFN++GSG+PDP L +S   LS
Sbjct  172   LENITAKFVSLGLDFKDVVVLSGAHTIGFAQCFVFKHRLFNFKGSGQPDPNLAASSDLLS  231

Query  663   NLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKY  484
              L  TCPNVD SN+ LAPLD  S  +FDN+YY NL+NN GLL+SDQ LM++   A +VK 
Sbjct  232   KLTDTCPNVDSSNSNLAPLDAASVVKFDNAYYVNLMNNVGLLDSDQILMSDSNAAALVKS  291

Query  483   YSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICG  370
             YS  PY F  DFA SMVK+GN+GV+TG D G IR  CG
Sbjct  292   YSENPYLFSGDFAVSMVKMGNIGVMTGSD-GVIRARCG  328



>gb|KDP31892.1| hypothetical protein JCGZ_12353 [Jatropha curcas]
Length=267

 Score =   372 bits (954),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/268 (69%), Positives = 220/268 (82%), Gaps = 6/268 (2%)
 Frame = -3

Query  1173  MAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKAC  994
             MAASL+RLHFHDCFVNGCDGSVLLD   G  GEKN  PNRNSARGFEVID+IKA++EKAC
Sbjct  1     MAASLLRLHFHDCFVNGCDGSVLLD---GDDGEKNAFPNRNSARGFEVIDNIKANLEKAC  57

Query  993   PSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASE-EATKQLPSPFESLKDITAK  817
             P+TVSC D LTLAA  AV ++GGPYW V LGRRDGLTAS  +A +QLPSPFE L++ITAK
Sbjct  58    PATVSCADTLTLAAREAVYLTGGPYWNVPLGRRDGLTASRSDANEQLPSPFEPLENITAK  117

Query  816   FSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNV  637
             F+++GL+LKD+VVLSG HS+GFAQCFTFK RLFN+ GSGKPDP L++SFL NLQ+ CPN 
Sbjct  118   FTSKGLELKDVVVLSGGHSLGFAQCFTFKPRLFNFGGSGKPDPALDTSFLQNLQSLCPNQ  177

Query  636   DGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFY  457
             D S+T LA LD  S+ +FDN YY  L+NN+GLL+SDQALM +  TA +V YYS +PY F 
Sbjct  178   DDSDTNLASLDSTSS-KFDNLYYKLLMNNSGLLQSDQALMGSNTTASLVSYYSKFPYWFS  236

Query  456   MDFATSMVKLGNLGVLTGKDNGQIRKIC  373
              DF  SMVK+G +GV+TG+ NG+IRK C
Sbjct  237   RDFGASMVKMGGIGVITGQ-NGEIRKNC  263



>gb|AEX20392.1| putative class III peroxidase [Coffea arabica x Coffea canephora]
Length=264

 Score =   370 bits (949),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/265 (67%), Positives = 215/265 (81%), Gaps = 2/265 (1%)
 Frame = -3

Query  1152  LHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCT  973
             + F D FVNGC+GSVLLDD+   KGEKN +PN+NSARGFEVID++KA+VEKACPSTVSC 
Sbjct  1     MQFQDWFVNGCEGSVLLDDSSTIKGEKNAVPNKNSARGFEVIDAVKANVEKACPSTVSCA  60

Query  972   DILTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLD  796
             DIL LAA  AV ++GGPYW VLLGRRDGLTASE+A   QLPSPFESL +ITAKF+ +GLD
Sbjct  61    DILALAAREAVYLAGGPYWPVLLGRRDGLTASEDAANTQLPSPFESLANITAKFTDKGLD  120

Query  795   LKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKL  616
             +KD+VVLSG H++GFAQCFTFK RLFN+ G+G PDPTL+++ L++L+  CPN   S++ L
Sbjct  121   MKDVVVLSGGHTIGFAQCFTFKPRLFNFDGAGNPDPTLDATLLTSLRGLCPNEASSDSNL  180

Query  615   APLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSM  436
             APLD  S  +FDNSYY NLVNN+GLL SDQ LM++  TA MV YYS +P+ F  DF  SM
Sbjct  181   APLDAASVSKFDNSYYKNLVNNSGLLGSDQVLMSDNTTAAMVPYYSKFPFLFSKDFGVSM  240

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             VK+GN+GVLTG+D GQIRK C  VN
Sbjct  241   VKMGNIGVLTGQD-GQIRKNCRVVN  264



>gb|EYU37713.1| hypothetical protein MIMGU_mgv1a024365mg, partial [Erythranthe 
guttata]
Length=256

 Score =   357 bits (917),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 175/256 (68%), Positives = 211/256 (82%), Gaps = 1/256 (0%)
 Frame = -3

Query  1125  GCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASY  946
             GC+GS+LLDDTK FKGEKN +PNRNS RG++VI++IKA+VEK+CPS VSC DIL LAA  
Sbjct  1     GCEGSILLDDTKSFKGEKNAVPNRNSVRGYDVIENIKAEVEKSCPSIVSCVDILALAARE  60

Query  945   AVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSG  769
             AV +SGGP+W V LGR DGLTAS + A +QLPSPFE L++IT+KF ++GLDLKD+VVLSG
Sbjct  61    AVVLSGGPFWEVPLGRLDGLTASAKSANEQLPSPFEPLENITSKFVSKGLDLKDVVVLSG  120

Query  768   AHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTY  589
             AH++GFAQCFTFKRRLFN++GSGKPDPTL+SS LS+L+ +CPN D SNTKLAPLD Q+  
Sbjct  121   AHTIGFAQCFTFKRRLFNFKGSGKPDPTLDSSVLSSLRNSCPNTDKSNTKLAPLDSQTIN  180

Query  588   RFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVL  409
              FDN YY NLVNNTGLLESDQAL+ +P+TA MVK YS  P  F  DFA SMVK+  +GV+
Sbjct  181   SFDNMYYKNLVNNTGLLESDQALVGDPKTASMVKDYSVDPNLFARDFAASMVKISRIGVI  240

Query  408   TGKDNGQIRKICGSVN  361
             +    GQ+RK C SVN
Sbjct  241   SSGGGGQVRKKCSSVN  256



>gb|KHN36209.1| Peroxidase 10 [Glycine soja]
Length=276

 Score =   357 bits (915),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/274 (64%), Positives = 208/274 (76%), Gaps = 1/274 (0%)
 Frame = -3

Query  1182  DSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVE  1003
             D+R+AASL+RLHFHDCFV GCD SVLLDDT   KGEKN LPN+NS RGFEVID+IKA +E
Sbjct  4     DARIAASLLRLHFHDCFVIGCDASVLLDDTGTLKGEKNALPNKNSLRGFEVIDTIKAALE  63

Query  1002  KACPSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDIT  823
             KACPSTVSC DILTLAA   V +S GP+W V LGRRDG TASE     LPSPFE +++IT
Sbjct  64    KACPSTVSCADILTLAARETVYLSKGPFWYVPLGRRDGTTASESEANNLPSPFEPIENIT  123

Query  822   AKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCP  643
             AKF ++GL+ KD+ VLSGAH++GFAQCFTFK RLF++ GSGK DP+L+ S L NL   CP
Sbjct  124   AKFISKGLEKKDVAVLSGAHTLGFAQCFTFKPRLFDFGGSGKSDPSLDVSLLQNLVKLCP  183

Query  642   NVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYR  463
             N   S+T LAPLD  +T  FDN YY N+VNN+GLL+SDQAL+ +   A +V  YS +P  
Sbjct  184   NQADSDTNLAPLDPVTTNTFDNMYYKNIVNNSGLLQSDQALLGDSTIASLVNVYSKWPIM  243

Query  462   FYMDFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
             F+ DFA SM K+  +GVLTG   GQIR  C +VN
Sbjct  244   FFRDFAVSMEKMSRIGVLTGS-RGQIRTNCRAVN  276



>ref|XP_003551046.1| PREDICTED: peroxidase 10-like [Glycine max]
 gb|KHN28813.1| Peroxidase 10 [Glycine soja]
Length=331

 Score =   347 bits (891),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 224/307 (73%), Gaps = 7/307 (2%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QL Y +Y  +CP L  IVR  +  A+ ++ R+AAS++RLHFHDCF NGCD SVLLDDT  
Sbjct  27    QLRYDYYFATCPTLTFIVRNSLVLAMADEQRIAASILRLHFHDCFANGCDASVLLDDTSS  86

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGP-YWR-  913
             FKGEK+ LPN NS +GFE+ID+IK+ +E  CPSTVSC DIL LAA  AV +S G  YWR 
Sbjct  87    FKGEKSALPNLNSLKGFELIDTIKSQIEWICPSTVSCADILALAAREAVNLSIGTYYWRP  146

Query  912   VLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTF  733
              LLGRRDG TASE     LPSP ++L++IT KF ++GLD+KD+VVLSGAH++G+A+CFT 
Sbjct  147   ALLGRRDGTTASESEASWLPSPSDTLQNITNKFLSKGLDIKDLVVLSGAHTIGYARCFTL  206

Query  732   KRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVN  553
             K+R FNY+ +GKPDP+L++S L +LQ  CP+ + S+T LAPLD  +TY FDN YY NLV 
Sbjct  207   KQRFFNYKDTGKPDPSLDASLLQHLQKLCPD-NSSDTNLAPLDPVTTYTFDNMYYKNLVK  265

Query  552   NTGLLESDQALMANPQTADMVKYYSAYP---YRFYMDFATSMVKLGNLGVLTGKDNGQIR  382
             N GLL +D+ALM++  TA +V  YS +P     FY DF  S+ K+G +GVLTG   G IR
Sbjct  266   NLGLLPTDEALMSDSTTASLVNKYSQWPSGMVYFYKDFDVSLEKMGLIGVLTGP-QGDIR  324

Query  381   KICGSVN  361
             K C  +N
Sbjct  325   KNCRVIN  331



>ref|XP_002522322.1| Peroxidase 10 precursor, putative [Ricinus communis]
 gb|EEF40006.1| Peroxidase 10 precursor, putative [Ricinus communis]
Length=274

 Score =   345 bits (884),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 205/252 (81%), Gaps = 5/252 (2%)
 Frame = -3

Query  1299  LGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGC  1120
             L FL+A     QLDY +YD +CPNL  IVR+GVWSAI ND+RMAASL+RLHFHDCFVNGC
Sbjct  16    LMFLSA-FVTCQLDYRYYDGTCPNLTRIVRYGVWSAISNDTRMAASLLRLHFHDCFVNGC  74

Query  1119  DGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAV  940
             +GSVLLD   G  GEK+ L N+NSARGFEVID+IKA +E+ CP TVSC DILTLAA  AV
Sbjct  75    EGSVLLD---GDNGEKSSLANQNSARGFEVIDNIKATLERFCPGTVSCADILTLAAREAV  131

Query  939   GMSGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAH  763
              ++GGPYW + LGRRDGLTAS+ A  +QLPSPFESL++ITAKF+A+GL+LKD+VVLSG H
Sbjct  132   YLAGGPYWSIPLGRRDGLTASQSAADEQLPSPFESLQNITAKFTAKGLELKDVVVLSGGH  191

Query  762   SVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRF  583
             ++GFAQCFTFK RLF++ GSGKPDP L++S L +LQ  CPN   S+T LAPLD  ++ RF
Sbjct  192   TLGFAQCFTFKPRLFDFGGSGKPDPALDTSLLQSLQGVCPNQADSDTNLAPLDSVTSSRF  251

Query  582   DNSYYTNLVNNT  547
             DNSYY  L+NN+
Sbjct  252   DNSYYKLLLNNS  263



>ref|XP_008449769.1| PREDICTED: peroxidase N [Cucumis melo]
Length=334

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 176/324 (54%), Positives = 220/324 (68%), Gaps = 9/324 (3%)
 Frame = -3

Query  1320  AISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFH  1141
             ++ +++ + F+      SQL   FY +SCPN+  +VR  V +A++ND RMAASL+RLHFH
Sbjct  14    SLVMIMIILFMICGSTRSQLTVDFYKRSCPNVLRMVRREVINALKNDMRMAASLLRLHFH  73

Query  1140  DCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILT  961
             DCFV+GCDGSVLLD   G  GE+N LPN NS RG EV+D IKA VE +CP  VSC DILT
Sbjct  74    DCFVSGCDGSVLLD---GSDGEQNALPNINSLRGLEVVDRIKAVVENSCPGVVSCADILT  130

Query  960   LAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             +AA  +V +SGGP W+VLLGRRDGL A+    ++LPSPFESL  IT KF+  GLD  D+V
Sbjct  131   IAARDSVLLSGGPAWKVLLGRRDGLVANRTGAEELPSPFESLDAITKKFNDVGLDTTDVV  190

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH++GFA+C  F  RLFN+ GS  PDPT+ES+ +S+LQ  CP  D  N K   LD 
Sbjct  191   ALSGAHTIGFARCAMFNNRLFNFSGSDSPDPTMESTMVSDLQALCPLTDDGN-KTTVLDR  249

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALM----ANPQTADMVKYYSAYPYRFYMDFATSMV  433
              ST  FDN YY NL+N  GLL SDQ L     A   T  +V+ YS+    F+ DF  +M+
Sbjct  250   NSTDLFDNHYYKNLLNQKGLLGSDQILFSSNEAQTTTKALVEAYSSNVTLFFNDFVKAMI  309

Query  432   KLGNLGVLTGKDNGQIRKICGSVN  361
             K+GN+  LTG  NGQIR  CG VN
Sbjct  310   KMGNMSPLTGS-NGQIRNNCGIVN  332



>ref|XP_011099204.1| PREDICTED: peroxidase 10-like isoform X2 [Sesamum indicum]
Length=275

 Score =   339 bits (869),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/259 (63%), Positives = 203/259 (78%), Gaps = 2/259 (1%)
 Frame = -3

Query  1134  FVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLA  955
              VNGC+GSVLLDD+  F GEKN  PNRNSARGFEVID+IK +VEKACPSTVSCTDILTLA
Sbjct  18    LVNGCEGSVLLDDSSNFTGEKNAFPNRNSARGFEVIDAIKENVEKACPSTVSCTDILTLA  77

Query  954   ASYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVV  778
             A  AV ++GGP+W+V LGRRDGLTA+E A    LPSPFE L++ITAKF ++GLDLKDMVV
Sbjct  78    ARDAVFLTGGPFWQVALGRRDGLTANETAANTDLPSPFEPLENITAKFVSKGLDLKDMVV  137

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSG H++GFAQC TFK RLFN+ G+G PDP L+ S L++L+  CPN D S+T L  LD  
Sbjct  138   LSGGHTIGFAQCSTFKPRLFNFDGAGNPDPILDESLLASLRIVCPNQDDSDTNLVALDAA  197

Query  597   STYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNL  418
             ++ +FDNSY+ +LVNN+G+L+SDQ LM + QTA +V  YS +P+ F  DF  SM K+  +
Sbjct  198   TSSKFDNSYFRSLVNNSGILQSDQDLMGDNQTAALVLSYSKFPFLFSKDFGKSMAKMSCI  257

Query  417   GVLTGKDNGQIRKICGSVN  361
             GVLTG++ G+IRK C  VN
Sbjct  258   GVLTGQE-GEIRKNCRVVN  275



>ref|XP_007047176.1| RNA ligase/cyclic nucleotide phosphodiesterase family protein 
isoform 2 [Theobroma cacao]
 gb|EOX91333.1| RNA ligase/cyclic nucleotide phosphodiesterase family protein 
isoform 2 [Theobroma cacao]
Length=256

 Score =   338 bits (867),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 167/256 (65%), Positives = 203/256 (79%), Gaps = 2/256 (1%)
 Frame = -3

Query  1125  GCDGSVLLDDTKG-FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAAS  949
             GCDGS+LLDD    F GEKN L N+NSARG+EVID+IKA+VEKACPSTVSC+DILTLAA 
Sbjct  2     GCDGSILLDDIGSTFVGEKNALANQNSARGYEVIDNIKANVEKACPSTVSCSDILTLAAR  61

Query  948   YAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSG  769
              AV  +GG YW V LGRRDG TA++ A  +LPSPFESL  I AKF+++GLD+KD+VVLSG
Sbjct  62    DAVYFAGGSYWMVPLGRRDGRTANKTAANELPSPFESLDSIIAKFNSKGLDIKDVVVLSG  121

Query  768   AHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTY  589
             AH++GFAQCFTFK RLFN+ GSGKPDP L++SFL  LQ+ CP+   S+T L PLD  ++ 
Sbjct  122   AHTIGFAQCFTFKSRLFNFGGSGKPDPELDASFLKGLQSVCPDQVDSDTNLVPLDSVTST  181

Query  588   RFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVL  409
             +FDNSYY N+VN++GLL+SDQ L  + +TA MV  YS YPY F  DF  SMVK+GN+GVL
Sbjct  182   KFDNSYYKNIVNSSGLLQSDQLLGTDNRTASMVLNYSKYPYLFLKDFGASMVKMGNIGVL  241

Query  408   TGKDNGQIRKICGSVN  361
             TG+D G+IRK C  VN
Sbjct  242   TGQD-GEIRKNCKVVN  256



>ref|XP_010257485.1| PREDICTED: peroxidase A2-like [Nelumbo nucifera]
Length=328

 Score =   338 bits (866),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 168/310 (54%), Positives = 215/310 (69%), Gaps = 5/310 (2%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             + +QL+  FY  SCPN+  IVR  +  A+++D+R  ASLIRLHFHDCFVNGCDGS+LLD+
Sbjct  21    SSAQLNATFYSISCPNVSSIVRGVIQQALQSDARNGASLIRLHFHDCFVNGCDGSILLDN  80

Query  1095  TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYW  916
             +   + EK+  PN NS RGF+V+D IK  +E +CP  VSC DIL LAA  +V ++GGP W
Sbjct  81    SGSIQSEKDAAPNANSTRGFDVVDDIKTALENSCPGVVSCADILALAAEASVSLAGGPSW  140

Query  915   RVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCF  739
              VLLGRRD  TA++  A   +PSPFE+L +ITAKFSA GLD  D+V LSGAH+ G AQC 
Sbjct  141   NVLLGRRDSTTANQAGANTSIPSPFENLTEITAKFSAVGLDTTDLVALSGAHTFGRAQCR  200

Query  738   TFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             TF  RL+N+ GSG PDPTL SS+L+ LQ TCP  +GS+T LA LD  +   FDN+Y++NL
Sbjct  201   TFSSRLYNFSGSGNPDPTLNSSYLATLQQTCPQ-NGSSTTLANLDPTTPDTFDNNYFSNL  259

Query  558   VNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQI  385
              NN GLL SDQ L++     T  +V  +SA    F+  FA SM+ +GN+  LTG  +GQI
Sbjct  260   ENNQGLLLSDQELLSTSGAATISIVNNFSANQTAFFQSFAQSMINMGNISPLTGS-SGQI  318

Query  384   RKICGSVN*G  355
             R  C  VN G
Sbjct  319   RSDCKKVNGG  328



>ref|XP_011099205.1| PREDICTED: peroxidase 10-like isoform X3 [Sesamum indicum]
Length=263

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/256 (63%), Positives = 201/256 (79%), Gaps = 2/256 (1%)
 Frame = -3

Query  1125  GCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASY  946
             GC+GSVLLDD+  F GEKN  PNRNSARGFEVID+IK +VEKACPSTVSCTDILTLAA  
Sbjct  9     GCEGSVLLDDSSNFTGEKNAFPNRNSARGFEVIDAIKENVEKACPSTVSCTDILTLAARD  68

Query  945   AVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSG  769
             AV ++GGP+W+V LGRRDGLTA+E A    LPSPFE L++ITAKF ++GLDLKDMVVLSG
Sbjct  69    AVFLTGGPFWQVALGRRDGLTANETAANTDLPSPFEPLENITAKFVSKGLDLKDMVVLSG  128

Query  768   AHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTY  589
              H++GFAQC TFK RLFN+ G+G PDP L+ S L++L+  CPN D S+T L  LD  ++ 
Sbjct  129   GHTIGFAQCSTFKPRLFNFDGAGNPDPILDESLLASLRIVCPNQDDSDTNLVALDAATSS  188

Query  588   RFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVL  409
             +FDNSY+ +LVNN+G+L+SDQ LM + QTA +V  YS +P+ F  DF  SM K+  +GVL
Sbjct  189   KFDNSYFRSLVNNSGILQSDQDLMGDNQTAALVLSYSKFPFLFSKDFGKSMAKMSCIGVL  248

Query  408   TGKDNGQIRKICGSVN  361
             TG++ G+IRK C  VN
Sbjct  249   TGQE-GEIRKNCRVVN  263



>ref|XP_009126399.1| PREDICTED: peroxidase N-like isoform X1 [Brassica rapa]
 emb|CDY44951.1| BnaA02g04560D [Brassica napus]
Length=324

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 175/323 (54%), Positives = 219/323 (68%), Gaps = 8/323 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             + L VF   +    A++QL+   Y +SCP L +IVR  V +A++ D+RMAASLIRLHFHD
Sbjct  5     VLLTVFTLCMLCSGAKAQLNPNIYAKSCPYLVLIVRRQVMNALKADTRMAASLIRLHFHD  64

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD SVLLD   G   EK  +PN NSARGFEVID+IKADVE ACP  VSC DILTL
Sbjct  65    CFVNGCDASVLLD---GDDSEKLAIPNLNSARGFEVIDTIKADVEYACPGVVSCADILTL  121

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V +SGGP WRV LGR DGL A++ +   LPSPFE L  ITAKF A GL++ D+V 
Sbjct  122   AARDSVVLSGGPQWRVALGRTDGLVANQSSANNLPSPFEPLDAITAKFVAVGLNVADVVA  181

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G A+C  F  RLFN+ G+G PD TLE++ LS+L+T CP   GS  + APLD  
Sbjct  182   LSGAHTFGQAKCDVFSNRLFNFDGAGSPDATLETTLLSDLRTVCP-AGGSGNQTAPLDRN  240

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             STY FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS   Y F+ DF  SM+K
Sbjct  241   STYAFDNNYFKNLLEGKGLLSSDQILFSSDLAVNTTKRLVEAYSRSQYLFFRDFTRSMIK  300

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +G +  L    +G++RK C  +N
Sbjct  301   MGGITNLVNGSSGEVRKNCRVIN  323



>ref|XP_004162079.1| PREDICTED: peroxidase N-like [Cucumis sativus]
Length=334

 Score =   336 bits (862),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 216/324 (67%), Gaps = 9/324 (3%)
 Frame = -3

Query  1320  AISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFH  1141
             ++ +++ + F+      SQL   FY +SCPN+  IVR  V +A++ND RMAASL+RLHFH
Sbjct  14    SLVMIMIIFFMICGSTSSQLTVDFYRRSCPNVLRIVRREVINALKNDMRMAASLLRLHFH  73

Query  1140  DCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILT  961
             DCFV+GCD SVLLD   G  GE+N LPN NS RG EV+D+IKA VE +CP  VSC DILT
Sbjct  74    DCFVSGCDASVLLD---GSDGEQNALPNINSLRGLEVMDNIKAVVENSCPGVVSCADILT  130

Query  960   LAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             +AA  +V +SGGP W+VLLGRRDGL A+    ++LPSPFESL  I  KF   GL++ D+ 
Sbjct  131   IAARDSVLLSGGPAWKVLLGRRDGLVANRTGAEELPSPFESLDGIIKKFIQVGLNVTDVA  190

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH+ GFA+C  F  RLFN+ GS  PDPT+ES  +S+LQ  CP  D  N K   LD 
Sbjct  191   ALSGAHTFGFARCAMFNNRLFNFSGSDSPDPTMESMMVSDLQALCPLTDDGN-KTTVLDR  249

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALM----ANPQTADMVKYYSAYPYRFYMDFATSMV  433
              ST  FDN YY NL+N  GLL SDQ L     A   T  +V+ YS+    F+ DF  +M+
Sbjct  250   NSTDLFDNHYYKNLLNQKGLLASDQILFSSDEAQTTTKPLVEAYSSNTTLFFSDFVKAMI  309

Query  432   KLGNLGVLTGKDNGQIRKICGSVN  361
             K+GN+  LTG  NGQIR  CG VN
Sbjct  310   KMGNMSPLTGS-NGQIRNNCGIVN  332



>ref|XP_004142143.1| PREDICTED: peroxidase N-like [Cucumis sativus]
Length=334

 Score =   336 bits (862),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 216/324 (67%), Gaps = 9/324 (3%)
 Frame = -3

Query  1320  AISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFH  1141
             ++ +++ + F+      SQL   FY +SCPN+  IVR  V +A++ND RMAASL+RLHFH
Sbjct  14    SLVMIMIIFFMICGSTSSQLTVDFYRRSCPNVLRIVRREVINALKNDMRMAASLLRLHFH  73

Query  1140  DCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILT  961
             DCFV+GCD SVLLD   G  GE+N LPN NS RG EV+D+IKA VE +CP  VSC DILT
Sbjct  74    DCFVSGCDASVLLD---GSDGEQNALPNINSLRGLEVMDNIKAVVENSCPGVVSCADILT  130

Query  960   LAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             +AA  +V +SGGP W+VLLGRRDGL A+    ++LPSPFESL  I  KF   GL++ D+ 
Sbjct  131   IAARDSVLLSGGPAWKVLLGRRDGLVANRTGAEELPSPFESLDGIIKKFIQVGLNVTDVA  190

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH+ GFA+C  F  RLFN+ GS  PDPT+ES  +S+LQ  CP  D  N K   LD 
Sbjct  191   ALSGAHTFGFARCAMFNNRLFNFSGSDSPDPTMESMMVSDLQALCPLTDDGN-KTTVLDR  249

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALM----ANPQTADMVKYYSAYPYRFYMDFATSMV  433
              ST  FDN YY NL+N  GLL SDQ L     A   T  +V+ YS+    F+ DF  +M+
Sbjct  250   NSTDLFDNHYYKNLLNQKGLLASDQILFSSDEAQTTTKPLVEAYSSNTTLFFSDFVKAMI  309

Query  432   KLGNLGVLTGKDNGQIRKICGSVN  361
             K+GN+  LTG  NGQIR  CG VN
Sbjct  310   KMGNMSPLTGS-NGQIRNNCGIVN  332



>gb|AAM66044.1| peroxidase [Arabidopsis thaliana]
 gb|AAS17637.1| peroxidase ATP29a [Arabidopsis thaliana]
Length=358

 Score =   334 bits (857),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 219/322 (68%), Gaps = 6/322 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ISL+V +  L    + +QL+  FY  +CPN   IVR  +  A+++D+R+  SLIRLHFHD
Sbjct  16    ISLIVVVSSLFG-ASSAQLNATFYSGTCPNASAIVRSTIQQALQSDARIGGSLIRLHFHD  74

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCDGS+LLDDT   + EKN   N NS RGF V+DSIK  +E ACP  VSC+DIL L
Sbjct  75    CFVNGCDGSLLLDDTSSIQSEKNAPANANSTRGFNVVDSIKTALENACPGIVSCSDILAL  134

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A+  +V ++GGP W VLLGRRDGLTA+   A   LPSPFE L +IT+KF A GL+  D+V
Sbjct  135   ASEASVSLAGGPSWTVLLGRRDGLTANLSGANSSLPSPFEGLNNITSKFVAVGLNTTDVV  194

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH+ G  QC TF  RLFN+ G+G PDPTL S+ LS+LQ  CP  +GSNT +  LD 
Sbjct  195   SLSGAHTFGRGQCVTFNNRLFNFNGTGNPDPTLNSTLLSSLQQLCPQ-NGSNTGITNLDL  253

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTAD--MVKYYSAYPYRFYMDFATSMVKL  427
              +   FDN+Y+TNL +N GLL+SDQ L +N  +A   +V  +++    F+  F  SM+K+
Sbjct  254   STPDAFDNNYFTNLQSNNGLLQSDQELFSNTGSATVPIVNSFASNQTLFFEAFVQSMIKM  313

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG  +G+IR+ C  VN
Sbjct  314   GNISPLTGS-SGEIRQDCKVVN  334



>ref|XP_006399147.1| hypothetical protein EUTSA_v10013916mg [Eutrema salsugineum]
 gb|ESQ40600.1| hypothetical protein EUTSA_v10013916mg [Eutrema salsugineum]
Length=361

 Score =   334 bits (857),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/321 (51%), Positives = 220/321 (69%), Gaps = 5/321 (2%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             SL+V +  +    + +QL+  FY  +CPN   IVR  +  A+++D R+ ASLIRLHFHDC
Sbjct  17    SLLVIVSSILFGTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDPRIGASLIRLHFHDC  76

Query  1134  FVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLA  955
             FVNGCDGS+LLDD+   + EKN  PN NSARGF V+D+IK  +E ACP  VSC+D+L LA
Sbjct  77    FVNGCDGSILLDDSGSIQSEKNAAPNANSARGFNVVDNIKTALENACPGIVSCSDVLALA  136

Query  954   ASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             +  +V ++GGP W VLLGRRDGLTA++  A   LPSPFE L +IT+KFSA GL+  D+V 
Sbjct  137   SEASVSLAGGPTWTVLLGRRDGLTANQAGANTSLPSPFEGLNNITSKFSAVGLNTTDLVA  196

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G   C TF  RLFN+ G+G PDPTL S+ LS+LQ  CP  +GS + +  LD  
Sbjct  197   LSGAHTFGRGNCVTFNNRLFNFNGTGNPDPTLNSTLLSSLQQICPQ-NGSGSGITNLDLS  255

Query  597   STYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLG  424
             +   FDN+Y+TNL +N GLL+SDQ L ++    T  +V  +++    F+  FA SM+K+G
Sbjct  256   TPDAFDNNYFTNLQSNNGLLQSDQELFSDTGSPTIAIVTSFASNQTLFFEAFAQSMIKMG  315

Query  423   NLGVLTGKDNGQIRKICGSVN  361
             N+  LTG  +G+IR+ C  +N
Sbjct  316   NISPLTGS-SGEIRQDCKVIN  335



>ref|NP_196291.1| peroxidase 54 [Arabidopsis thaliana]
 sp|Q9FG34.1|PER54_ARATH RecName: Full=Peroxidase 54; Short=Atperox P54; AltName: Full=ATP29a; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09807.1| peroxidase [Arabidopsis thaliana]
 dbj|BAC43417.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAP40411.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED91056.1| peroxidase [Arabidopsis thaliana]
Length=358

 Score =   333 bits (855),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 218/322 (68%), Gaps = 6/322 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ISL+V +  L    + +QL+  FY  +CPN   IVR  +  A+++D+R+  SLIRLHFHD
Sbjct  16    ISLIVIVSSLFG-TSSAQLNATFYSGTCPNASAIVRSTIQQALQSDARIGGSLIRLHFHD  74

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCDGS+LLDDT   + EKN   N NS RGF V+DSIK  +E ACP  VSC+DIL L
Sbjct  75    CFVNGCDGSLLLDDTSSIQSEKNAPANANSTRGFNVVDSIKTALENACPGIVSCSDILAL  134

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A+  +V ++GGP W VLLGRRDGLTA+   A   LPSPFE L +IT+KF A GL   D+V
Sbjct  135   ASEASVSLAGGPSWTVLLGRRDGLTANLSGANSSLPSPFEGLNNITSKFVAVGLKTTDVV  194

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH+ G  QC TF  RLFN+ G+G PDPTL S+ LS+LQ  CP  +GSNT +  LD 
Sbjct  195   SLSGAHTFGRGQCVTFNNRLFNFNGTGNPDPTLNSTLLSSLQQLCPQ-NGSNTGITNLDL  253

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTAD--MVKYYSAYPYRFYMDFATSMVKL  427
              +   FDN+Y+TNL +N GLL+SDQ L +N  +A   +V  +++    F+  F  SM+K+
Sbjct  254   STPDAFDNNYFTNLQSNNGLLQSDQELFSNTGSATVPIVNSFASNQTLFFEAFVQSMIKM  313

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG  +G+IR+ C  VN
Sbjct  314   GNISPLTGS-SGEIRQDCKVVN  334



>gb|KGN54106.1| hypothetical protein Csa_4G286310 [Cucumis sativus]
Length=311

 Score =   332 bits (851),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 172/307 (56%), Positives = 208/307 (68%), Gaps = 9/307 (3%)
 Frame = -3

Query  1269  SQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTK  1090
             SQL   FY +SCPN+  IVR  V +A++ND RMAASL+RLHFHDCFV+GCD SVLLD   
Sbjct  8     SQLTVDFYRRSCPNVLRIVRREVINALKNDMRMAASLLRLHFHDCFVSGCDASVLLD---  64

Query  1089  GFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRV  910
             G  GE+N LPN NS RG EV+D+IKA VE +CP  VSC DILT+AA  +V +SGGP W+V
Sbjct  65    GSDGEQNALPNINSLRGLEVMDNIKAVVENSCPGVVSCADILTIAARDSVLLSGGPAWKV  124

Query  909   LLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LLGRRDGL A+    ++LPSPFESL  I  KF   GL++ D+  LSGAH+ GFA+C  F 
Sbjct  125   LLGRRDGLVANRTGAEELPSPFESLDGIIKKFIQVGLNVTDVAALSGAHTFGFARCAMFN  184

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
              RLFN+ GS  PDPT+ES  +S+LQ  CP  D  N K   LD  ST  FDN YY NL+N 
Sbjct  185   NRLFNFSGSDSPDPTMESMMVSDLQALCPLTDDGN-KTTVLDRNSTDLFDNHYYKNLLNQ  243

Query  549   TGLLESDQALM----ANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIR  382
              GLL SDQ L     A   T  +V+ YS+    F+ DF  +M+K+GN+  LTG  NGQIR
Sbjct  244   KGLLASDQILFSSDEAQTTTKPLVEAYSSNTTLFFSDFVKAMIKMGNMSPLTGS-NGQIR  302

Query  381   KICGSVN  361
               CG VN
Sbjct  303   NNCGIVN  309



>emb|CDX70074.1| BnaA10g24230D [Brassica napus]
Length=358

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/322 (52%), Positives = 223/322 (69%), Gaps = 7/322 (2%)
 Frame = -3

Query  1311  LVVFLGFLAAPMAES--QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ++ FL  ++A    S  QL+  FY  +CPN+  IVR  +  A+++D R+ ASLIRLHFHD
Sbjct  15    IISFLVIVSALFGTSSAQLNATFYSGTCPNVSAIVRSTIEQALQSDPRIGASLIRLHFHD  74

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCDGS+LLDD+   + EKN +PN NS RGF V+D IK  +E ACP  VSC+DIL L
Sbjct  75    CFVNGCDGSLLLDDSANIQSEKNAVPNANSTRGFNVVDDIKTALENACPGIVSCSDILAL  134

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A+  +V ++GGP W VLLGRRDGLTA+   A   LPSPFE + +ITAKF+A GL+  D+V
Sbjct  135   ASEASVSLAGGPTWAVLLGRRDGLTANLSGANTGLPSPFEGITNITAKFTAVGLNTTDVV  194

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
             VLSGAH+ G A C TF  RLFN+ G+G PDPTL S+ LS+LQ  CP  +GS + +  LD 
Sbjct  195   VLSGAHTFGRAACATFNNRLFNFNGTGSPDPTLNSTLLSSLQQLCPQ-NGSASVVTNLDL  253

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKL  427
              +   FDN+Y+TNL +N GLL+SDQ L+++    T  +V  +++   +F+  FA SM+K+
Sbjct  254   STPDAFDNNYFTNLQSNNGLLQSDQELLSDTGSPTIPIVTSFASNQTQFFEAFALSMIKM  313

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG  +G+IR+ C  VN
Sbjct  314   GNISPLTGS-SGEIRQDCKVVN  334



>ref|XP_009122284.1| PREDICTED: peroxidase A2 [Brassica rapa]
Length=358

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/322 (52%), Positives = 223/322 (69%), Gaps = 7/322 (2%)
 Frame = -3

Query  1311  LVVFLGFLAAPMAES--QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ++ FL  ++A    S  QL+  FY  +CPN+  IVR  +  A+++D R+ ASLIRLHFHD
Sbjct  15    IISFLVIVSALFGTSSAQLNATFYSGTCPNVSAIVRSTIEQALQSDPRIGASLIRLHFHD  74

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCDGS+LLDD+   + EKN +PN NS RGF V+D IK  +E ACP  VSC+DIL L
Sbjct  75    CFVNGCDGSLLLDDSANIQSEKNAVPNANSTRGFNVVDDIKTALENACPGIVSCSDILAL  134

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A+  +V ++GGP W VLLGRRDGLTA+   A   LPSPFE + +ITAKF+A GL+  D+V
Sbjct  135   ASEASVSLAGGPTWAVLLGRRDGLTANLSGANTGLPSPFEGITNITAKFTAVGLNTTDVV  194

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
             VLSGAH+ G A C TF  RLFN+ G+G PDPTL S+ LS+LQ  CP  +GS + +  LD 
Sbjct  195   VLSGAHTFGRAACATFNNRLFNFNGTGSPDPTLNSTLLSSLQQLCPQ-NGSASVVTNLDL  253

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKL  427
              +   FDN+Y+TNL +N GLL+SDQ L+++    T  +V  +++   +F+  FA SM+K+
Sbjct  254   STPDAFDNNYFTNLQSNNGLLQSDQELLSDTGSPTIPIVTSFASNQTQFFEAFALSMIKM  313

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG  +G+IR+ C  VN
Sbjct  314   GNISPLTGS-SGEIRQDCKVVN  334



>emb|CDY42313.1| BnaC02g09190D [Brassica napus]
Length=324

 Score =   331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 217/323 (67%), Gaps = 8/323 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             + L VF   +    A++QL+   Y +SCP L  IVR  V +A++ D+RMAASLIRLHFHD
Sbjct  5     VLLTVFTLCMLCSGAKAQLNPNIYAKSCPYLVPIVRRQVMNALKADTRMAASLIRLHFHD  64

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD SVLLD   G   EK  +PN NSARGF+VID+IKA VE ACP  VSC DILTL
Sbjct  65    CFVNGCDASVLLD---GDDSEKLAIPNLNSARGFDVIDTIKAAVEYACPGVVSCADILTL  121

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V +SGGP WRV LGR+DGL A++ +   LPSPFE L  ITAKF A GL+  D+V 
Sbjct  122   AARDSVVLSGGPQWRVALGRKDGLVANQSSANNLPSPFEPLDAITAKFVAVGLNAADVVA  181

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G A+C  F  RLFN+ G+G PD TLE++ LS+L+T CP   GS  + APLD  
Sbjct  182   LSGAHTFGQAKCDVFSNRLFNFDGAGSPDATLETTLLSDLRTVCP-AGGSGNQTAPLDRN  240

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             STY FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS   Y F+ DF  SM+K
Sbjct  241   STYAFDNNYFKNLLEGKGLLSSDQILFSSDLAVNTTKRLVEAYSRSQYLFFRDFTRSMIK  300

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +G +  L    +G++RK C  +N
Sbjct  301   MGGITNLVNGSSGEVRKNCRVIN  323



>emb|CDX98950.1| BnaC09g48850D [Brassica napus]
Length=358

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/322 (51%), Positives = 223/322 (69%), Gaps = 7/322 (2%)
 Frame = -3

Query  1311  LVVFLGFLAAPMAES--QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ++  LG +++    S  QL+  FY  +CPN+  IVR  +  A+++D R+ ASLIRLHFHD
Sbjct  15    IISLLGIVSSLFGTSSAQLNATFYSGTCPNVSAIVRSTIQQALQSDPRIGASLIRLHFHD  74

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCDGS+LLDD+   + EKN +PN NS RGF V+D IK  +E ACP  VSC+DIL L
Sbjct  75    CFVNGCDGSLLLDDSATIQSEKNAVPNANSTRGFNVVDDIKTALENACPGIVSCSDILAL  134

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A+  +V ++GGP W VLLGRRDGLTA+   A   LPSPFE + +ITAKF+A GL+  D+V
Sbjct  135   ASEASVSLAGGPTWTVLLGRRDGLTANLSGANTGLPSPFEGITNITAKFTAVGLNTTDVV  194

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
             VLSGAH+ G A C TF  RLFN+ G+G PDPTL S+ LS+LQ  CP  +G+ + +  LD 
Sbjct  195   VLSGAHTFGRAACATFNNRLFNFNGTGSPDPTLNSTLLSSLQQLCPQ-NGNASVVTNLDL  253

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKL  427
              +   FDN+Y+TNL +N GLL+SDQ L+++    T  +V  +++   +F+  FA SM+K+
Sbjct  254   STPDAFDNNYFTNLQSNNGLLQSDQELLSDTGSPTIPIVTSFASNQTQFFEAFALSMIKM  313

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG  +G+IR+ C  VN
Sbjct  314   GNISPLTGS-SGEIRQDCKVVN  334



>emb|CCJ34833.1| horseradish peroxidase isoenzyme HRP_4663 [Armoracia rusticana]
Length=358

 Score =   331 bits (848),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 219/322 (68%), Gaps = 6/322 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ISL+V    L    + +QL+  FY  +CPN   IVR  +  A+++D R+ ASLIRLHFHD
Sbjct  16    ISLLVIASSLFG-TSSAQLNATFYSGTCPNASAIVRSTIQQALQSDPRIGASLIRLHFHD  74

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCDGS+LLDDT   + EKN   N NSARGF V+D IK  +E ACP  VSC+DIL L
Sbjct  75    CFVNGCDGSLLLDDTGSIQSEKNAPANANSARGFNVVDDIKTALENACPGIVSCSDILAL  134

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A+  +V ++GGP W VL+GRRDGLTA+   A   LPSPFE L +IT+KF A GL+  D+V
Sbjct  135   ASEASVSLAGGPSWTVLVGRRDGLTANLSGANSSLPSPFEGLNNITSKFLAVGLNTTDVV  194

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
             VLSGAH+ G  QC TF  RLFN+ G+G PDPTL S+ LS+LQ  CP  +GS + +  LD 
Sbjct  195   VLSGAHTFGRGQCVTFNNRLFNFNGTGSPDPTLNSTLLSSLQQICPQ-NGSGSAITNLDL  253

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKL  427
              +   FD++YYTNL +N GLL+SDQ L +N    T  +V  +++    F+  FA SM+K+
Sbjct  254   TTPDAFDSNYYTNLQSNNGLLQSDQELFSNTGSPTIAIVNSFASNQTLFFEAFAQSMIKM  313

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG  +G+IR+ C +VN
Sbjct  314   GNISPLTGT-SGEIRQDCKAVN  334



>emb|CDP10156.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   330 bits (847),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 159/317 (50%), Positives = 217/317 (68%), Gaps = 5/317 (2%)
 Frame = -3

Query  1302  FLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNG  1123
             FLG +   ++ +QL+  FY  +CPN+  IV+  +  A+++D R+ ASLIRLHFHDCFV+G
Sbjct  41    FLGAIQLHVSNAQLNATFYSNTCPNVSAIVQNVIQQALQSDPRIGASLIRLHFHDCFVDG  100

Query  1122  CDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYA  943
             CD S+LLD+    + EK+  PN NSARGF+V+D IK  VE +CP  VSC D+L LAA  +
Sbjct  101   CDASILLDNNGTLRSEKDAAPNTNSARGFDVVDKIKTAVENSCPGIVSCADVLALAAESS  160

Query  942   VGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGA  766
             V +SGGP W VLLGRRD  TA++  A   +P+PFESL +ITAKF+A GL++ D+V LSGA
Sbjct  161   VSLSGGPSWNVLLGRRDSKTANQAGANTSIPAPFESLSNITAKFTAVGLNINDLVALSGA  220

Query  765   HSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYR  586
             H+ G AQC  F  RL+N+ GSG PDP+L +++L+ L+  CP  +GS T LA LD+ +   
Sbjct  221   HTFGRAQCRLFSSRLYNFSGSGNPDPSLNTTYLATLRQICPQ-NGSTTALANLDFTTPNT  279

Query  585   FDNSYYTNLVNNTGLLESDQALMANP--QTADMVKYYSAYPYRFYMDFATSMVKLGNLGV  412
             FDN+Y++NL  N GLL+SDQ L + P   T  +V  +S+    F+  FA SM+ +GN+  
Sbjct  280   FDNNYFSNLQTNQGLLQSDQELFSTPGAATISIVNTFSSNQNAFFQSFAQSMINMGNISP  339

Query  411   LTGKDNGQIRKICGSVN  361
             LTG  NG+IR  C  VN
Sbjct  340   LTGT-NGEIRSDCKKVN  355



>ref|XP_006400553.1| hypothetical protein EUTSA_v10014080mg [Eutrema salsugineum]
 gb|ESQ42006.1| hypothetical protein EUTSA_v10014080mg [Eutrema salsugineum]
Length=331

 Score =   329 bits (843),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 171/323 (53%), Positives = 212/323 (66%), Gaps = 8/323 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             + L VF   +      +QL    Y +SCPNL  IVR  V  A++ + RMAASLIRLHFHD
Sbjct  12    VILTVFTLCMLCSGVRAQLSPDIYAKSCPNLMQIVRKQVMVALKAEMRMAASLIRLHFHD  71

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD SVLLD   G   EK  +PN NSARGFEV+D+IK  VE ACP  VSC DILTL
Sbjct  72    CFVNGCDASVLLD---GTDSEKLAIPNVNSARGFEVVDTIKDAVENACPGVVSCADILTL  128

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V +SGGP WRV LGR+DGL A++ +   LPSPFE L  I AKF A GL++ D+V 
Sbjct  129   AARDSVFLSGGPQWRVALGRKDGLVANQSSANNLPSPFEPLDAIIAKFVAVGLNVSDVVA  188

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G A+C  F  RLFN+ G+G PD TLES+ LSNLQT CP V G+  + APLD  
Sbjct  189   LSGAHTFGQAKCDVFSNRLFNFTGAGTPDATLESTLLSNLQTVCP-VGGNGNQTAPLDRN  247

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             ST  FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS   Y F+ DF  SM++
Sbjct  248   STDAFDNNYFKNLLEGKGLLSSDQILFSSDLAVNTTKRLVEAYSRSQYLFFRDFTCSMIR  307

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +G +  L    +G++RK C  +N
Sbjct  308   MGGITNLVNGSSGEVRKNCRVIN  330



>gb|KDO56405.1| hypothetical protein CISIN_1g020050mg [Citrus sinensis]
Length=332

 Score =   328 bits (842),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 174/327 (53%), Positives = 219/327 (67%), Gaps = 17/327 (5%)
 Frame = -3

Query  1326  MVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLH  1147
             + AI  V+ LG       +SQL   FY ++CPN+  IVR  V  AI+ + RMAASLIRLH
Sbjct  13    LFAIFFVLCLG------VKSQLSTNFYSKTCPNVLQIVRREVQKAIKVEMRMAASLIRLH  66

Query  1146  FHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             FHDCFVNGCD SVLLD   G   EK   PNRNSARGFEVID+IK  VE+ C   VSC DI
Sbjct  67    FHDCFVNGCDASVLLD---GSDSEKFAAPNRNSARGFEVIDAIKTAVERQCSGVVSCADI  123

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKD  787
             L +AA  +V +SGGP W+VLLGRRDGL A++     LPSPFE L  +TAKF+A GL++ D
Sbjct  124   LAIAARDSVLLSGGPTWKVLLGRRDGLVANQTGANALPSPFEGLNILTAKFAAVGLNITD  183

Query  786   MVVLS-GAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             +V LS GAH++G A+C  F  RL N+ G+G PD T+++S +S L++ C N DG+NT  AP
Sbjct  184   LVSLSGGAHTIGLAKCAFFSNRLSNFSGTGAPDATMDTSLVSELRSLCANGDGNNT--AP  241

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALM----ANPQTADMVKYYSAYPYRFYMDFAT  442
             LD  S   FDN Y+ NL+NN GLL SDQ L     A   T  +V+ YS+    F+ +F  
Sbjct  242   LDRNSIDLFDNHYFQNLINNKGLLSSDQILYSSDEAKSTTKSLVESYSSNSNLFFANFVN  301

Query  441   SMVKLGNLGVLTGKDNGQIRKICGSVN  361
             SM+K+GN+  LTG  NG+IRK C +VN
Sbjct  302   SMIKMGNVSPLTGT-NGEIRKNCRAVN  327



>ref|XP_010420808.1| PREDICTED: peroxidase N [Camelina sativa]
Length=329

 Score =   328 bits (840),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 171/323 (53%), Positives = 214/323 (66%), Gaps = 11/323 (3%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             + L VF  F+      SQL+   Y +SCP+L  IVR  V  A+  + RMAASLIRLHFHD
Sbjct  13    VLLTVFTLFMLCSGVRSQLNPDIYAKSCPSLGQIVRNQVTIAMNAEKRMAASLIRLHFHD  72

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD S+LLD   G   EK  +PN NSARGFEV+D+IKA VE ACP  VSC DILTL
Sbjct  73    CFVNGCDASILLD---GTDSEKLAIPNLNSARGFEVVDTIKAAVENACPGVVSCADILTL  129

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V +SGGP WRV LGR+DGL A++ +   LPSPFESL  I AKF A GL++ D+V 
Sbjct  130   AARDSVSLSGGPRWRVALGRKDGLVANQSSANNLPSPFESLDAIIAKFVAVGLNITDVVA  189

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G A+C  F  RLFN+ G+G PD TLE+S LSNLQ+ CP + G+    APLD  
Sbjct  190   LSGAHTFGQAKCDLFSNRLFNFTGTGTPDATLETSLLSNLQSVCP-LGGNGNITAPLDSG  248

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             ST  FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS   Y F+ DF  SM++
Sbjct  249   STDAFDNNYFKNLLQGKGLLSSDQILFSSDLAVNTTKTLVEAYSRNQYLFFRDFTCSMIR  308

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +GN+       +G++RK C  +N
Sbjct  309   MGNIA---NGASGEVRKNCRVIN  328



>ref|XP_011083137.1| PREDICTED: peroxidase N [Sesamum indicum]
Length=325

 Score =   327 bits (839),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 174/312 (56%), Positives = 216/312 (69%), Gaps = 12/312 (4%)
 Frame = -3

Query  1278  MAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLD  1099
             +A SQL   FY  SCPNL  +VR  V +AIRN+ RMAASL+RLHFHDCFVNGCDGSVLLD
Sbjct  19    VARSQLTVDFYSTSCPNLLALVRREVKNAIRNEMRMAASLLRLHFHDCFVNGCDGSVLLD  78

Query  1098  DTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPY  919
                G  GEK   PN NSARGFEVID+IK+ VE ACP+ VSC DILT+AA  +V +SGGP 
Sbjct  79    ---GSDGEKFAAPNLNSARGFEVIDAIKSAVESACPNIVSCADILTIAARDSVLLSGGPS  135

Query  918   WRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQC  742
             W+VLLGRRDGL +++  A   LPSPFESL  I AKF+A GL+  D+V LSG H++G ++C
Sbjct  136   WKVLLGRRDGLVSNQTGANLSLPSPFESLDAIIAKFAAVGLNTTDVVALSGGHTIGLSRC  195

Query  741   FTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCP-NVDGSNTKLAPLDYQSTYRFDNSYYT  565
               F  RL N+ G+G PD TL+SS + +LQ  CP N DG+NT    LD  S   FDN Y+ 
Sbjct  196   AFFSDRLSNFSGTGAPDSTLDSSLIPDLQAACPANSDGNNT--VALDVTSRDLFDNHYFV  253

Query  564   NLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKD  397
             NLVN  G+L+SDQ+L    +A   T ++ + YS     F+ DF  SM+K+G++  LTG  
Sbjct  254   NLVNGRGILQSDQSLFSSDLALSTTKNIAQLYSNNSAVFFGDFVNSMIKMGSISPLTGS-  312

Query  396   NGQIRKICGSVN  361
             NG+IRK C  VN
Sbjct  313   NGEIRKNCRVVN  324



>ref|XP_007202211.1| hypothetical protein PRUPE_ppa008390mg [Prunus persica]
 gb|EMJ03410.1| hypothetical protein PRUPE_ppa008390mg [Prunus persica]
Length=333

 Score =   328 bits (840),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 168/327 (51%), Positives = 220/327 (67%), Gaps = 10/327 (3%)
 Frame = -3

Query  1323  VAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHF  1144
             +AI+ V+ + +    ++ +QL+  FY  +CPN+  IVR  V  A+++DSR+ ASLIRLHF
Sbjct  13    LAITFVLLMLY----VSNAQLNTTFYSSTCPNVTTIVRSVVQQALQSDSRIGASLIRLHF  68

Query  1143  HDCFVNGCDGSVLLDDTKGFK-GEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             HDCFVNGCD S+LLD     +  EK+  PN NS RGF+V+D+IK  VE +CP+ VSC DI
Sbjct  69    HDCFVNGCDASILLDKGGSIQLSEKDAAPNTNSTRGFDVVDNIKTAVENSCPAVVSCADI  128

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLK  790
             L LAA  +V +SGG  W VLLGRRD LTA++  A   +PSPFE L +IT+KFSA GL+  
Sbjct  129   LALAAEASVSLSGGISWNVLLGRRDSLTANQAGANTSIPSPFEGLANITSKFSAVGLNTN  188

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             D+V LSGAH+ G AQC  F  RL+N+ G+G PDPTL SS+L+ LQ TCP  +GS T LA 
Sbjct  189   DLVALSGAHTFGRAQCQRFSNRLYNFNGTGNPDPTLNSSYLTTLQQTCPQ-NGSGTALAN  247

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSM  436
             LD  +   FDNSY++NL NN GLL+SDQ L +     T  +V  +S+    F+  FA SM
Sbjct  248   LDPTTPDSFDNSYFSNLQNNQGLLQSDQELFSTTGAATVSIVNSFSSNQSAFFQSFAQSM  307

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN*G  355
             + +GN+  L G  NG+IR  C  VN G
Sbjct  308   INMGNISPLVGS-NGEIRLDCKKVNGG  333



>gb|AFN41087.1| peroxidase precursor [Corylus avellana]
Length=330

 Score =   327 bits (839),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 172/327 (53%), Positives = 217/327 (66%), Gaps = 9/327 (3%)
 Frame = -3

Query  1314  SLVVFLGFLAAPM---AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHF  1144
             SL V   F+A  M   + +QL+  FY  +C N   IVR  V  A+++DSR+ ASLIRLHF
Sbjct  6     SLAVATIFVAVIMLYESNAQLNATFYGDTCSNASTIVRNAVQQALQSDSRIGASLIRLHF  65

Query  1143  HDCFVNGCDGSVLLDDTKGF-KGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             HDCFVNGCDGS+LLD      + EK+  PN NS RGF+V+D+IKA +E +CPS VSC DI
Sbjct  66    HDCFVNGCDGSILLDRGGSITQSEKDAAPNTNSTRGFDVVDNIKAALESSCPSVVSCADI  125

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLK  790
             L LAA  +V +SGGP W VLLGRRD LTA++  A   +PSP E L +IT+KFSA GLD  
Sbjct  126   LALAAEASVSLSGGPTWNVLLGRRDSLTANQAGANTSIPSPVEGLSNITSKFSAVGLDTN  185

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             D+V LSGAH+ G AQC  F  RL+N+ G+G PDPT+ S++L+ LQ TCP  +G  T LA 
Sbjct  186   DLVALSGAHTFGRAQCRLFIGRLYNFNGTGNPDPTINSTYLTTLQQTCPQ-NGDGTVLAN  244

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALM--ANPQTADMVKYYSAYPYRFYMDFATSM  436
             LD  +   FDN Y+TNL NN GLL+SDQ L   A   T  +V  +S+    F+  FA SM
Sbjct  245   LDPTTPDSFDNGYFTNLQNNQGLLQSDQELFSTAGASTVSIVNSFSSNQTAFFERFAQSM  304

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN*G  355
             + +GN+  LTG  NG+IR  C  VN G
Sbjct  305   INMGNISPLTGT-NGEIRSDCKKVNGG  330



>ref|XP_010491253.1| PREDICTED: peroxidase 54-like [Camelina sativa]
Length=359

 Score =   328 bits (841),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 163/322 (51%), Positives = 218/322 (68%), Gaps = 6/322 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ISL++ +  L    + +QL+  FY  +CPN   IVR  +  A+++D R+ ASLIRLHFHD
Sbjct  16    ISLLIIVSLLFG-TSSAQLNATFYSGTCPNASAIVRSTIQQALQSDPRIGASLIRLHFHD  74

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCDGS+LLDD    + EKN  PN NS RGF V+D+IK  +E ACP  VSC+D+L L
Sbjct  75    CFVNGCDGSLLLDDAGSIQSEKNAPPNANSTRGFNVVDNIKTALENACPGIVSCSDVLAL  134

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A+  +V ++GGP W VLLGRRDGL A+   A   LPSPFE L +IT+KF A GL+  D+V
Sbjct  135   ASEASVSLAGGPSWSVLLGRRDGLNANLTGANSSLPSPFEGLNNITSKFVAVGLNTTDVV  194

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH+ G A+C TF  RLFN+ G+G PDPTL S+ LS+LQ  CP+ +GS + +  LD 
Sbjct  195   ALSGAHTFGRAKCVTFNNRLFNFSGTGNPDPTLNSTLLSSLQQICPH-NGSGSGITNLDL  253

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKL  427
              +   FDNSY+TNL +N GLL+SDQ L +N    T  +V  +++    F+  F  SM+ +
Sbjct  254   TTPDAFDNSYFTNLQSNNGLLQSDQELFSNTGSDTVAIVNSFASNQTLFFEAFVQSMINM  313

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG  +G+IR+ C +VN
Sbjct  314   GNISPLTGS-SGEIRQDCKAVN  334



>ref|XP_006492728.1| PREDICTED: peroxidase 59-like [Citrus sinensis]
Length=332

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/327 (53%), Positives = 218/327 (67%), Gaps = 17/327 (5%)
 Frame = -3

Query  1326  MVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLH  1147
             + AI  V+ LG       +SQL   FY ++CPN+  IVR  V  AI+ + RMAASLIRLH
Sbjct  13    LFAIFFVLCLG------VKSQLSTNFYSKTCPNVLQIVRREVQKAIKVEMRMAASLIRLH  66

Query  1146  FHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             FHDCFVNGCD SVLLD   G   EK   PNRNSARGFEVID+IK  VE+ C   VSC DI
Sbjct  67    FHDCFVNGCDASVLLD---GSDSEKFAAPNRNSARGFEVIDAIKTAVERQCSGVVSCADI  123

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKD  787
             L +AA  +V +SGGP W+VLLGRRDGL A++     LPSPFE L  +TAKF+A GL++ D
Sbjct  124   LAIAARDSVLLSGGPTWKVLLGRRDGLVANQTGANALPSPFEGLNILTAKFAAVGLNITD  183

Query  786   MVVLS-GAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             +V LS GAH++G A+C  F  RL N+ G+G PD T+++S +S L++ C N DG+NT   P
Sbjct  184   LVSLSGGAHTIGLAKCAFFSNRLSNFSGTGAPDATMDTSLVSELRSLCANGDGNNT--TP  241

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALM----ANPQTADMVKYYSAYPYRFYMDFAT  442
             LD  S   FDN Y+ NL+NN GLL SDQ L     A   T  +V+ YS+    F+ +F  
Sbjct  242   LDRNSIDLFDNHYFQNLINNKGLLSSDQILYSSDEAKSTTKSLVESYSSNSNLFFANFVN  301

Query  441   SMVKLGNLGVLTGKDNGQIRKICGSVN  361
             SM+K+GN+  LTG  NG+IRK C +VN
Sbjct  302   SMIKMGNVSPLTGT-NGEIRKNCRAVN  327



>ref|XP_002304020.2| peroxidase family protein [Populus trichocarpa]
 gb|EEE78999.2| peroxidase family protein [Populus trichocarpa]
Length=326

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 177/319 (55%), Positives = 214/319 (67%), Gaps = 9/319 (3%)
 Frame = -3

Query  1305  VFLGFLA-APMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFV  1129
             +FL  L    +A SQL   FY  +CPNL  IVR  V  AI+ ++RMAASLIRLHFHDCFV
Sbjct  12    LFLTILMLCVVARSQLTTDFYSTTCPNLLQIVRREVQKAIKFETRMAASLIRLHFHDCFV  71

Query  1128  NGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAAS  949
             NGCD SVLLD   G  GEK  LPN NSARGFEV+D+IK  VE  C   VSC DILT+AA 
Sbjct  72    NGCDASVLLD---GNDGEKFALPNINSARGFEVVDAIKTAVESQCSGVVSCADILTIAAR  128

Query  948   YAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLS  772
              +V +SGG  WRVLLGRRDGL A++  A  +LPSPFE +  I  KF+A GL++ D+V LS
Sbjct  129   DSVLLSGGKSWRVLLGRRDGLVANQTGANAKLPSPFEDVDTIINKFAAVGLNIIDVVALS  188

Query  771   GAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQST  592
             GAH++G A+C TF  RLFN+ G+G PD T+ESS +S+LQ  CP  D  N K   LD  ST
Sbjct  189   GAHTIGQARCATFNNRLFNFSGTGAPDSTMESSMVSDLQNLCPLTDDGN-KTTVLDRNST  247

Query  591   YRFDNSYYTNLVNNTGLLESDQALMA--NPQTADMVKYYSAYPYRFYMDFATSMVKLGNL  418
               FD  Y+ NL+NN GLL SDQ L +  N  T  +V+ YS     F  DFA SM+K+GN+
Sbjct  248   DLFDIHYFQNLLNNKGLLSSDQELFSSTNLTTKALVQTYSTNQNLFLNDFANSMIKMGNI  307

Query  417   GVLTGKDNGQIRKICGSVN  361
               LTG  +G+IRK C  VN
Sbjct  308   SPLTGS-SGEIRKKCSVVN  325



>ref|XP_011025200.1| PREDICTED: peroxidase N [Populus euphratica]
Length=326

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 173/309 (56%), Positives = 211/309 (68%), Gaps = 8/309 (3%)
 Frame = -3

Query  1278  MAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLD  1099
             +A SQL   FY  +CPNL  IVR  V  AI+ ++RMAASLIRLHFHDCFVNGCD SVLLD
Sbjct  22    VARSQLTTDFYSTTCPNLLQIVRREVQKAIKFETRMAASLIRLHFHDCFVNGCDASVLLD  81

Query  1098  DTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPY  919
                G  GEK  LPN NSARGFEV+D+IK  VE  C   VSC DIL +AA  +V +SGG  
Sbjct  82    ---GNDGEKFALPNINSARGFEVVDAIKTAVESQCSGVVSCADILAIAARDSVLLSGGKS  138

Query  918   WRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQC  742
             WRVLLGRRDGL A++  A  +LPSPFE +  I  KF+A GL++ D+V LSGAH++G A+C
Sbjct  139   WRVLLGRRDGLVANQTGANAKLPSPFEDVDTIINKFAAVGLNIIDVVALSGAHTIGQARC  198

Query  741   FTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTN  562
              TF  RLFN+ G+G PD T+ESS +S+LQ  CP  D  N K   LD  ST  FDN Y+ N
Sbjct  199   ATFNNRLFNFSGTGAPDSTMESSMVSDLQNLCPLTDDGN-KTTALDRNSTDLFDNHYFQN  257

Query  561   LVNNTGLLESDQALMA--NPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQ  388
             L+N+ GLL SDQ L +  N  T  +V+ YSA    F  DFA SM+++GN+  LTG  +G+
Sbjct  258   LLNSKGLLSSDQELFSSTNLTTKVLVQAYSANQNLFLNDFANSMIRMGNISPLTGS-SGE  316

Query  387   IRKICGSVN  361
             IRK C  VN
Sbjct  317   IRKKCSVVN  325



>emb|CDX98949.1| BnaC09g48860D [Brassica napus]
Length=338

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/308 (52%), Positives = 212/308 (69%), Gaps = 5/308 (2%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             + +QL+  FY  +CPN   IVR  +  A+++DSR+ ASLIRLHFHDCFVNGCD S+LLD+
Sbjct  31    SNAQLNATFYSGTCPNASAIVRTTIQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDN  90

Query  1095  TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYW  916
             +   + EKN  PN NSARGF V+D+IK  +E ACP  VSC+DIL LA+  +V +SGGP W
Sbjct  91    SGSIQSEKNAGPNANSARGFNVVDNIKTALENACPGAVSCSDILALASEASVSLSGGPSW  150

Query  915   RVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCF  739
              VLLGRRD LTA++  A   +PSPFESL +IT+KFSA GL+  D+V LSGAH+ G A+C 
Sbjct  151   TVLLGRRDSLTANQAGANSSIPSPFESLSNITSKFSAVGLNTNDLVALSGAHTFGRARCG  210

Query  738   TFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
              F  RLFN+ GSG PDPTL ++ LS+LQ  CP  +G+ + +  LD  +   FDN+Y+TNL
Sbjct  211   VFSNRLFNFSGSGNPDPTLNTTLLSSLQQICPQ-NGTGSGITNLDLSTPDAFDNNYFTNL  269

Query  558   VNNTGLLESDQALMANPQTAD--MVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQI  385
              +N GLL+SDQ L +   +A   +V  +++    F+  FA SM+ +GN+  LTG   G+I
Sbjct  270   QSNNGLLQSDQELFSTTGSATIAIVTSFASNQSLFFQAFAQSMINMGNISPLTGSS-GEI  328

Query  384   RKICGSVN  361
             R  C  VN
Sbjct  329   RLDCKKVN  336



>gb|AAR15704.3| peroxidase [Brassica napus]
Length=306

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 213/305 (70%), Gaps = 5/305 (2%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QL+  FY  +CPN+  IVR  +  A ++D R+ ASLIRLHFHDCFV GCDGS+LLDD+  
Sbjct  1     QLNPTFYSGTCPNVSAIVRSTIEQAPQSDPRIGASLIRLHFHDCFVKGCDGSLLLDDSAN  60

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
              + EKN +PN NS RGF V+D IK  +E ACP  VSC+DIL LA+  +V ++GGP W VL
Sbjct  61    IQSEKNAVPNANSTRGFNVVDDIKTALENACPGIVSCSDILALASEASVSLAGGPTWAVL  120

Query  906   LGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRDGLTA+   A   LPSPFE + +ITAKF+A GL+  D+VVLSGAH+ G A C TF 
Sbjct  121   LGRRDGLTANLSGANTGLPSPFEGITNITAKFTAVGLNTTDVVVLSGAHTFGRAACATFN  180

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
              RLFN+ G+G PDPTL S+ LS+LQ  CP  +GS + +  LD  +   FDN+Y+TNL +N
Sbjct  181   NRLFNFNGTGSPDPTLNSTLLSSLQQLCPQ-NGSASVVTNLDLSTPDAFDNNYFTNLQSN  239

Query  549   TGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKI  376
              GLL+SDQ L+++    T  +V  +++   +F+  FA SM+K+GN+  LTG  +G+IR+ 
Sbjct  240   NGLLQSDQELLSDTGSPTIPIVTSFASNQTQFFEAFALSMIKMGNISPLTGS-SGEIRQD  298

Query  375   CGSVN  361
             C  VN
Sbjct  299   CKVVN  303



>ref|XP_006288143.1| hypothetical protein CARUB_v10001380mg [Capsella rubella]
 gb|EOA21041.1| hypothetical protein CARUB_v10001380mg [Capsella rubella]
Length=336

 Score =   326 bits (835),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/322 (51%), Positives = 216/322 (67%), Gaps = 6/322 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ISL+V +  L    + +QL+  FY  +CPN   IVR  +  A+++D+R+ ASLIRLHFHD
Sbjct  16    ISLLVIVSLLFG-TSSAQLNATFYSATCPNASAIVRSTIQQALQSDARIGASLIRLHFHD  74

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCDGS+LLDDT   + EKN  PN NS RGF V+D+IK  +E ACP  VSC+D+L L
Sbjct  75    CFVNGCDGSLLLDDTGSIQSEKNAAPNANSTRGFNVVDNIKTALENACPGIVSCSDVLAL  134

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A+  +V ++GGP W VLLGRRD LTA+   A   +PSP ESL +IT+KFSA GL+  D+V
Sbjct  135   ASEASVSLAGGPSWTVLLGRRDSLTANLAGANSAIPSPVESLSNITSKFSAVGLNTNDLV  194

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH+ G A+C  F  RLFN+ G+G PDPTL S+ LS+LQ  CP  +GS + +  LD 
Sbjct  195   ALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQ-NGSASTITNLDL  253

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKL  427
              +   FDN+Y+ NL +N GLL+SDQ L +     T  +V  +++    F+  FA SM+ +
Sbjct  254   STPDAFDNNYFNNLQSNNGLLQSDQELFSTTVSSTIAIVTSFASNQTLFFQVFAQSMINM  313

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG  NG+IR  C  VN
Sbjct  314   GNISPLTGS-NGEIRLDCKKVN  334



>gb|KDP34262.1| hypothetical protein JCGZ_12830 [Jatropha curcas]
Length=328

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 177/336 (53%), Positives = 223/336 (66%), Gaps = 16/336 (5%)
 Frame = -3

Query  1353  SFLIHKS*VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSR  1174
             S  ++K  + VAI ++  +G        SQL   FY ++CP L  IVR  V +AI+ + R
Sbjct  3     SLSLYKWYLFVAILILYVVG------VRSQLSSDFYSKTCPKLLQIVRKEVQNAIKFEMR  56

Query  1173  MAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKAC  994
             MAASL+RLHFHDCFVNGCDGSVLLD   G  GEK  + NRNSARGFEV+DSIK  VE  C
Sbjct  57    MAASLLRLHFHDCFVNGCDGSVLLD---GTDGEKFAVANRNSARGFEVVDSIKTAVESQC  113

Query  993   PSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASE-EATKQLPSPFESLKDITAK  817
                VSC DIL +AA  +V +SGGP W+VLLGRRD L  ++ +A   LPSPFE L  I AK
Sbjct  114   SGIVSCADILAIAARDSVLLSGGPSWKVLLGRRDALIGNQAQANISLPSPFEGLDAIIAK  173

Query  816   FSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNV  637
             F A GL++ D+V LSG H++G A+C TF  RL+N+ G G PD TL++S LS+LQ  CP V
Sbjct  174   FDAVGLNITDVVSLSGGHTIGQAKCATFSNRLYNFSGPGVPDATLDTSMLSDLQNLCP-V  232

Query  636   DGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQ----TADMVKYYSAYP  469
             +G   K   LD  ST  FDN Y+ NLVNN GLL SDQ L ++ +    T ++V+ YS+  
Sbjct  233   NGDGNKTTALDRNSTDLFDNHYFQNLVNNKGLLGSDQILFSSAEAVSTTLNLVQSYSSNT  292

Query  468   YRFYMDFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
               F+ DFA SM+K+GN+  LTG  NG+IRK C  VN
Sbjct  293   KLFFDDFANSMIKMGNISPLTGS-NGEIRKNCRVVN  327



>gb|AAM65211.1| peroxidase [Arabidopsis thaliana]
 gb|AAS17636.1| peroxidase ATPA2 [Arabidopsis thaliana]
Length=335

 Score =   325 bits (834),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 163/322 (51%), Positives = 215/322 (67%), Gaps = 6/322 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ISL+V L  +    + +QL+  FY  +CPN   IVR  +  A+++D+R+ ASLIRLHFHD
Sbjct  15    ISLIVILSSIFG-TSSAQLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHD  73

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD S+LLDDT   + EKN  PN NSARGF V+D+IK  +E ACP  VSC+D+L L
Sbjct  74    CFVNGCDASILLDDTGSIQSEKNAGPNVNSARGFNVVDNIKTALENACPGVVSCSDVLAL  133

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A+  +V ++GGP W VLLGRRD LTA+   A   +PSP ESL +IT+KFSA GL+  D+V
Sbjct  134   ASEASVSLAGGPSWTVLLGRRDSLTANLAGANSSIPSPVESLSNITSKFSAVGLNTNDLV  193

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH+ G A+C  F  RLFN+ G+G PDPTL S+ LS LQ  CP  +GS + +  LD 
Sbjct  194   ALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSTLQQLCPQ-NGSASTITNLDL  252

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKL  427
              +   FDN+Y+ NL +N GLL+SDQ L +     T  +V  +++    F+  FA SM+ +
Sbjct  253   STPDAFDNNYFANLQSNNGLLQSDQELFSTTGSSTIAIVTSFASNQTLFFQAFAQSMINM  312

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG  NG+IR  C  VN
Sbjct  313   GNISPLTGS-NGEIRLDCKKVN  333



>ref|XP_010454279.1| PREDICTED: peroxidase 59-like [Camelina sativa]
Length=329

 Score =   325 bits (832),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 213/323 (66%), Gaps = 11/323 (3%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             + L VF  F+      +QL+   Y +SCP+L  IVR  V  A+  + RMAASLIRLHFHD
Sbjct  13    VLLTVFTLFMLCSGVSAQLNPEIYAKSCPSLGQIVRNQVTIAMNAEKRMAASLIRLHFHD  72

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD S+LLD   G   EK  +PN NSARGFEV+D+IKA VE ACP  VSC DILTL
Sbjct  73    CFVNGCDASILLD---GTDSEKLAIPNLNSARGFEVVDTIKAAVENACPGVVSCADILTL  129

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V +SGGP WRV LGR+DGL A++ +   LPSPFE L  I AKF A GL++ D+V 
Sbjct  130   AARDSVSLSGGPRWRVALGRKDGLVANQNSANNLPSPFEPLDAIIAKFVAVGLNITDVVA  189

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G A+C  F  RLFN+ G+G PD TLE+S LSNLQ+ CP + G+    APLD  
Sbjct  190   LSGAHTFGQAKCGLFSNRLFNFTGAGTPDATLETSLLSNLQSVCP-LGGNGNITAPLDNG  248

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             ST  FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS   Y F+ DF  SM++
Sbjct  249   STDAFDNNYFKNLLQGKGLLSSDQILFSSELAVNTTKGLVEAYSRNQYLFFRDFTCSMIR  308

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +GN+       +G++RK C  +N
Sbjct  309   MGNIA---NGASGEVRKNCRVIN  328



>gb|AHL39128.1| class III peroxidase [Populus trichocarpa]
Length=326

 Score =   325 bits (832),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 173/309 (56%), Positives = 209/309 (68%), Gaps = 8/309 (3%)
 Frame = -3

Query  1278  MAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLD  1099
             +A SQL   FY  +CPNL  IVR  V  AI+ ++RMAASLIRLHFHDCFVNGCD SVLLD
Sbjct  22    VARSQLTTDFYSTTCPNLLQIVRREVQKAIKFETRMAASLIRLHFHDCFVNGCDASVLLD  81

Query  1098  DTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPY  919
                G  GEK  LPN NSARGFEV+D+IK  VE  C   VSC DIL +AA  +V +SGG  
Sbjct  82    ---GNDGEKFALPNINSARGFEVVDAIKTAVESQCSGVVSCADILAIAARDSVLLSGGKS  138

Query  918   WRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQC  742
             WRVLLGRRDGL A++  A  +LPSPFE +  I  KF+A GL++ D+V LSGAH++G A+C
Sbjct  139   WRVLLGRRDGLVANQTGANAKLPSPFEDVDTIINKFAAVGLNIIDVVALSGAHTIGQARC  198

Query  741   FTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTN  562
              TF  RLFN+ G+G PD T+ESS +S+LQ  CP  D  N K   LD  ST  FD  Y+ N
Sbjct  199   ATFNNRLFNFSGTGAPDSTMESSMVSDLQNLCPLTDDGN-KTTVLDRNSTDLFDIHYFQN  257

Query  561   LVNNTGLLESDQALMA--NPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQ  388
             L+NN GLL SDQ L +  N  T  +V+ YS     F  DFA SM+K+GN+  LTG  +G+
Sbjct  258   LLNNKGLLSSDQELFSSTNLTTKALVQTYSTNQNLFLNDFANSMIKMGNISPLTGS-SGE  316

Query  387   IRKICGSVN  361
             IRK C  VN
Sbjct  317   IRKKCSVVN  325



>ref|XP_008240914.1| PREDICTED: peroxidase A2-like [Prunus mume]
Length=333

 Score =   325 bits (832),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 164/312 (53%), Positives = 212/312 (68%), Gaps = 6/312 (2%)
 Frame = -3

Query  1278  MAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLD  1099
             ++ +QL+  FY  +CPN+  IVR  V  A+++DSR+ ASLIRLHFHDCFVNGCD S+LLD
Sbjct  24    VSNAQLNTTFYSSTCPNVTTIVRSVVQQALQSDSRIGASLIRLHFHDCFVNGCDASILLD  83

Query  1098  DTKGFK-GEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGP  922
                  +  EK+  PN NS RGF+V+D+IK  VE +CP+ VSC DIL LAA  +V +SGG 
Sbjct  84    KGGSIQLSEKDAAPNTNSTRGFDVVDNIKTAVENSCPAVVSCADILALAAEASVSLSGGI  143

Query  921   YWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQ  745
              W VLLGRRD LTA++  A   +PSP E L +IT+KFSA GL+  D+V LSGAH+ G AQ
Sbjct  144   SWNVLLGRRDSLTANQAGANTSIPSPVEGLANITSKFSALGLNTNDLVALSGAHTFGRAQ  203

Query  744   CFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYT  565
             C TF  RL+N+ G+G PDPTL SS+L+ LQ TCP  +GS T LA LD  +   FDN+Y++
Sbjct  204   CRTFSNRLYNFTGTGNPDPTLNSSYLTTLQQTCPQ-NGSGTALANLDPTTPDSFDNNYFS  262

Query  564   NLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNG  391
             NL NN GLL+SDQ L +     T  +V  +S+    F+  FA SM+ +GN+  L G  NG
Sbjct  263   NLQNNQGLLQSDQELFSTTGAATVSIVNSFSSNQSAFFQSFAQSMINMGNISPLVGS-NG  321

Query  390   QIRKICGSVN*G  355
             +IR  C  VN G
Sbjct  322   EIRLDCKKVNGG  333



>ref|XP_010452613.1| PREDICTED: peroxidase 54 [Camelina sativa]
Length=358

 Score =   325 bits (834),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 216/322 (67%), Gaps = 6/322 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ISL++ +  L    + +QL+  FY  +CPN   IVR  +  A+++D R+ ASLIRLHFHD
Sbjct  16    ISLLIIVSLLFG-TSSAQLNATFYSGTCPNASAIVRSTIQQALQSDPRIGASLIRLHFHD  74

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCDGS+LLDDT   + EKN  PN NS RGF V+D+IK  +E ACP  VSC+D+L L
Sbjct  75    CFVNGCDGSLLLDDTGSIQSEKNAPPNANSTRGFNVVDNIKTALENACPGIVSCSDVLAL  134

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A+  +V ++GGP W VLLGRRDGL A+   A   LPSPFE L +IT+KF A GL+  D+V
Sbjct  135   ASEASVSLAGGPSWSVLLGRRDGLNANLTGANSSLPSPFEGLNNITSKFVAVGLNTTDVV  194

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH+ G  +C TF  RLFN+ G+G PDPTL S+ LS+LQ  CP  + S + +  LD 
Sbjct  195   ALSGAHTFGRGKCVTFNNRLFNFSGTGNPDPTLNSTLLSSLQQICPQ-NSSGSGITNLDL  253

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTAD--MVKYYSAYPYRFYMDFATSMVKL  427
              +   FDNSY+TNL +N GLL+SDQ L +N  +A   +V  +++    F+  F  SM+ +
Sbjct  254   TTPDAFDNSYFTNLQSNNGLLQSDQELFSNSGSATVAVVNSFASNQTLFFEAFVQSMINM  313

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG  +G+IR+ C  VN
Sbjct  314   GNISPLTGS-SGEIRQDCKVVN  334



>ref|XP_010491252.1| PREDICTED: peroxidase 53 [Camelina sativa]
Length=336

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/326 (50%), Positives = 218/326 (67%), Gaps = 7/326 (2%)
 Frame = -3

Query  1326  MVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLH  1147
             ++ ISL+  +  +    + +QL+  FY  +CPN   IVR  +  A+++D+R+ ASLIRLH
Sbjct  12    LLIISLIAIVSSIFG-TSSAQLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLH  70

Query  1146  FHDCFVNGCDGSVLLDDTKG-FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTD  970
             FHDCFVNGCD S+LLDD  G  + EKN  PN NSARGF V+D+IK  +E ACP  VSC+D
Sbjct  71    FHDCFVNGCDASILLDDVSGSIQSEKNAGPNANSARGFNVVDNIKTALENACPGVVSCSD  130

Query  969   ILTLAASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDL  793
             +L LA+  +V ++GGP W VLLGRRD LTA+   A   +PSP ESL +IT+KFSA GL+ 
Sbjct  131   VLALASEASVSLAGGPSWTVLLGRRDSLTANLAGANSTIPSPVESLSNITSKFSAVGLNT  190

Query  792   KDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLA  613
              D+V LSGAH+ G A+C  F  RLFN+ G+G PDPTL S+ LS+LQ  CP  +GS T + 
Sbjct  191   NDLVALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQ-NGSATTIT  249

Query  612   PLDYQSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATS  439
              LD  +   FDN+Y+TNL +N GLL+SDQ L +     T  +V  +++    F+  FA S
Sbjct  250   NLDLSTPDAFDNNYFTNLQSNNGLLQSDQELFSTTGSSTIAIVTSFASNQTLFFQTFAQS  309

Query  438   MVKLGNLGVLTGKDNGQIRKICGSVN  361
             M+ +GN+  LTG  NG+IR  C  VN
Sbjct  310   MINMGNISPLTGS-NGEIRLDCKKVN  334



>ref|XP_007162335.1| hypothetical protein PHAVU_001G143300g [Phaseolus vulgaris]
 gb|ESW34329.1| hypothetical protein PHAVU_001G143300g [Phaseolus vulgaris]
Length=331

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 211/309 (68%), Gaps = 6/309 (2%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             + +QL   FY  +CPN+  IVR  +  A+++D+R+AASLIRLHFHDCFVNGCDGS+LLD 
Sbjct  23    SNAQLSSTFYSSTCPNVSSIVRSVIQQALQSDTRIAASLIRLHFHDCFVNGCDGSLLLDQ  82

Query  1095  TKGFK-GEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPY  919
                    EKN +PN NSARGF V+D+IK  +E +CP  VSC DIL LAA  +V + GGP 
Sbjct  83    GGNITLSEKNAVPNNNSARGFNVVDNIKTSLENSCPGVVSCADILALAAEASVSLGGGPS  142

Query  918   WRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQC  742
             W VLLGRRDGL A++  A   +P+P ESL +ITAKFSA GL++ D+V LSGAH+ G AQC
Sbjct  143   WTVLLGRRDGLIANQSGANSSIPAPTESLANITAKFSAVGLNITDLVALSGAHTFGRAQC  202

Query  741   FTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTN  562
               F +RLFN+ G+G PDPTL+SS+L+ LQ  CP  +GS   L  LD  S   FDN+Y+ N
Sbjct  203   RFFNQRLFNFSGTGSPDPTLDSSYLATLQQNCPQ-NGSGNTLNNLDPSSPDTFDNNYFQN  261

Query  561   LVNNTGLLESDQALMANPQTADM--VKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQ  388
             L+NN GLL++DQ L +   +A M  V  +++    F+  FA SM+ +GN+  LTG   G+
Sbjct  262   LLNNRGLLQTDQELFSTNGSATMSIVSNFASNQSAFFEAFAQSMINMGNISPLTGSQ-GE  320

Query  387   IRKICGSVN  361
             IR  C  VN
Sbjct  321   IRSDCKKVN  329



>ref|XP_009122283.1| PREDICTED: peroxidase A2 [Brassica rapa]
 emb|CDX70075.1| BnaA10g24240D [Brassica napus]
Length=338

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/308 (51%), Positives = 213/308 (69%), Gaps = 5/308 (2%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             + +QL+  FY  +CPN   IVR  +  A+++DSR+ ASLIRLHFHDCFVNGCD S+LLDD
Sbjct  31    SNAQLNATFYSGTCPNASAIVRTTIQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDD  90

Query  1095  TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYW  916
             +   + EKN  PN NSARGF V+D+IK  +E ACP  VSC+D+L LA+  +V +SGGP W
Sbjct  91    SGSIQSEKNAGPNANSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLSGGPSW  150

Query  915   RVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCF  739
              VLLGRRD LTA++  A   +PSP ESL +IT+KFSA GL+  D+V LSGAH+ G A+C 
Sbjct  151   TVLLGRRDSLTANQAGANSSIPSPVESLTNITSKFSAVGLNTNDLVALSGAHTFGRARCG  210

Query  738   TFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
              F  RLFN+ GSG PDPTL ++ LS+LQ  CP  +G+ + +  LD  +   FDN+Y+TNL
Sbjct  211   VFSNRLFNFSGSGNPDPTLNTTLLSSLQQICPQ-NGTGSGITNLDLSTPDAFDNNYFTNL  269

Query  558   VNNTGLLESDQALMANPQTAD--MVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQI  385
              +N GLL+SDQ L +   +A   +V  +++    F+  FA SM+ +GN+  LTG ++G+I
Sbjct  270   QSNNGLLQSDQELFSTTGSATIAIVTSFASNQSLFFQAFAQSMINMGNITPLTG-NSGEI  328

Query  384   RKICGSVN  361
             R  C  VN
Sbjct  329   RLDCKKVN  336



>ref|XP_007014796.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY32415.1| Peroxidase superfamily protein [Theobroma cacao]
Length=329

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 169/321 (53%), Positives = 212/321 (66%), Gaps = 9/321 (3%)
 Frame = -3

Query  1308  VVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFV  1129
             ++ + F+      SQL   FY ++CP+L  IVR  V SA++ + RMAASL+RLHFHDCFV
Sbjct  12    LLIICFMHCVAVRSQLTTDFYSKTCPSLLSIVRRQVQSAVKTEMRMAASLLRLHFHDCFV  71

Query  1128  NGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAAS  949
             NGCD SVLLD       EK  LPN NSARGFEV+D+IK  VE AC   VSC DIL +AA 
Sbjct  72    NGCDASVLLDGDN--TTEKFALPNLNSARGFEVVDAIKTAVENACSGVVSCADILAIAAR  129

Query  948   YAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLS  772
              +V +SGGP WRVLLGRRDGL ++   A   LPSPFE+L  I  KF   GL++ D+V LS
Sbjct  130   DSVVLSGGPTWRVLLGRRDGLISNATLANAALPSPFEALDAIIQKFVNVGLNITDVVSLS  189

Query  771   GAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQST  592
             G H++G A+C TF  RL N+ G+G PD T+E+S LS+LQ+ CP V+G   K   LD  ST
Sbjct  190   GGHTIGLAKCATFSNRLLNFSGTGAPDTTMEASMLSDLQSFCP-VNGDGNKTTVLDRNST  248

Query  591   YRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVKLG  424
               FDN Y+ NL+N  GLL SDQ L    +A   T  +V+ YS+    F+ DFA SM+K+G
Sbjct  249   DLFDNHYFQNLLNGKGLLGSDQILHSSELATSTTKSLVESYSSNSQLFFQDFANSMIKMG  308

Query  423   NLGVLTGKDNGQIRKICGSVN  361
             N+  LTG  NGQIR  C +VN
Sbjct  309   NISPLTGS-NGQIRTNCRAVN  328



>ref|XP_009408603.1| PREDICTED: peroxidase N-like [Musa acuminata subsp. malaccensis]
Length=332

 Score =   323 bits (827),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 169/322 (52%), Positives = 211/322 (66%), Gaps = 10/322 (3%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             +LVV   +L+  +  SQL   FY  SCP +  +VR  + SA+RND+RMAASL+RLHFHDC
Sbjct  17    ALVVL--WLSMGVCRSQLSTNFYANSCPAVFRVVRRQLLSALRNDTRMAASLLRLHFHDC  74

Query  1134  FVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLA  955
             FVNGCDGSVLLD   G   EK  LPNRNSARGF+VID+IK  VE AC +TVSC DILT+A
Sbjct  75    FVNGCDGSVLLD---GSDSEKLALPNRNSARGFDVIDTIKTAVENACNATVSCADILTIA  131

Query  954   ASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVVL  775
             A  +V +SGGPYW VLLGRRDGL A++     LPSPF+S+  I  KF A GL+  D+V L
Sbjct  132   ARDSVYLSGGPYWNVLLGRRDGLVANQTGANDLPSPFDSIDTIIDKFVAVGLNTTDVVSL  191

Query  774   SGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQS  595
             SG H++G A+C TF  RL+++      DPTL+ S  + LQT CP   G     APLD  S
Sbjct  192   SGGHTIGRARCVTFSGRLYDFSEDSSVDPTLDPSMATELQTLCPQSGGDGNATAPLDRNS  251

Query  594   TYRFDNSYYTNLVNNTGLLESDQALMANPQ----TADMVKYYSAYPYRFYMDFATSMVKL  427
              Y FDN Y+ NLV   GLL SDQ L ++ +    T  +V+ YS     F+ DF  SM+K+
Sbjct  252   NYAFDNHYFKNLVEQKGLLSSDQGLFSSDEGQAATKALVQAYSNSSILFFRDFVNSMIKM  311

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LT    G+IR+ C  VN
Sbjct  312   GNISPLTSS-AGEIRRNCRVVN  332



>emb|CCJ34826.1| horseradish peroxidase isoenzyme HRP_A2B [Armoracia rusticana]
Length=336

 Score =   323 bits (827),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 215/322 (67%), Gaps = 6/322 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ISL+V +  L    + +QL+  FY  +CPN   IVR  +  A ++D+R+ ASLIRLHFHD
Sbjct  16    ISLLVIVSSLFG-TSSAQLNATFYSGTCPNASAIVRSTIQQAFQSDTRIGASLIRLHFHD  74

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD S+LLDD+   + EKN  PN NSARGF V+D+IK  +E  CP  VSC+DIL L
Sbjct  75    CFVNGCDASILLDDSGSIQSEKNAGPNANSARGFNVVDNIKTALENTCPGVVSCSDILAL  134

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A+  +V ++GGP W VLLGRRD LTA+   A   +PSPFE L +IT+KFSA GL+  D+V
Sbjct  135   ASEASVSLTGGPSWTVLLGRRDSLTANLAGANSAIPSPFEGLSNITSKFSAVGLNTNDLV  194

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH+ G A+C  F  RLFN+ G+G PDPTL S+ LS+LQ  CP  +GS + +  LD 
Sbjct  195   ALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQ-NGSASTITNLDL  253

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADM--VKYYSAYPYRFYMDFATSMVKL  427
              +   FDN+Y+ NL +N GLL+SDQ L +   +A +  V  +++    F+  FA SM+ +
Sbjct  254   STPDAFDNNYFANLQSNNGLLQSDQELFSTTGSATITVVTSFASNQTLFFQAFAQSMINM  313

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG  NG+IR  C  VN
Sbjct  314   GNISPLTGS-NGEIRLDCKKVN  334



>emb|CCJ34825.1| horseradish peroxidase isoenzyme HRP_A2A [Armoracia rusticana]
Length=336

 Score =   323 bits (827),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 215/322 (67%), Gaps = 6/322 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ISL+V +  L    + +QL+  FY  +CPN   IVR  +  A ++D+R+ ASLIRLHFHD
Sbjct  16    ISLLVIVSSLFG-TSSAQLNATFYSGTCPNASAIVRSTIQQAFQSDTRIGASLIRLHFHD  74

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD S+LLDD+   + EKN  PN NSARGF V+D+IK  +E  CP  VSC+DIL L
Sbjct  75    CFVNGCDASILLDDSGSIQSEKNAGPNANSARGFNVVDNIKTALENTCPGVVSCSDILAL  134

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A+  +V ++GGP W VLLGRRD LTA+   A   +PSPFE L +IT+KFSA GL+  D+V
Sbjct  135   ASEASVSLTGGPSWTVLLGRRDSLTANLAGANSAIPSPFEGLSNITSKFSAVGLNTNDLV  194

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH+ G A+C  F  RLFN+ G+G PDPTL S+ LS+LQ  CP  +GS + +  LD 
Sbjct  195   ALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQ-NGSASTITNLDL  253

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADM--VKYYSAYPYRFYMDFATSMVKL  427
              +   FDN+Y+ NL +N GLL+SDQ L +   +A +  V  +++    F+  FA SM+ +
Sbjct  254   STPDAFDNNYFANLQSNNGLLQSDQELFSTTGSATIAVVTSFASNQTLFFQAFAQSMINM  313

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG  NG+IR  C  VN
Sbjct  314   GNISPLTGS-NGEIRLDCKKVN  334



>ref|XP_002873970.1| peroxidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50229.1| peroxidase [Arabidopsis lyrata subsp. lyrata]
Length=328

 Score =   322 bits (826),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 171/323 (53%), Positives = 210/323 (65%), Gaps = 11/323 (3%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             + L VF   +      +QL +  Y +SCPNL  IVR  V  A++ + RMAASLIRLHFHD
Sbjct  12    VLLTVFTLCMLCSGVRAQLSFDIYAKSCPNLVQIVRRQVIIALKAEIRMAASLIRLHFHD  71

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD SVLLD   G   EK  +PN NSARGFEVID+IK  VE ACP  VSC DILTL
Sbjct  72    CFVNGCDASVLLD---GADSEKLAIPNINSARGFEVIDTIKDAVENACPGVVSCADILTL  128

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V +SGGP WRV LGR+DGL A++ +   LPSPFE L  I AKF A  L++ D+V 
Sbjct  129   AARDSVFLSGGPQWRVALGRKDGLVANQNSANNLPSPFEPLDAIIAKFVAVNLNITDVVA  188

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G A+C  F  RLFN+ G+G PD TLE+S LSNLQT CP    SNT  APLD  
Sbjct  189   LSGAHTFGQAKCAVFSNRLFNFTGAGTPDATLETSLLSNLQTVCPLGGNSNTT-APLDRN  247

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             ST  FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS     F+ DF  SM++
Sbjct  248   STDAFDNNYFKNLLEGKGLLSSDQILFSSDLAVNTTKRLVEAYSRSQNLFFRDFTCSMIR  307

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +GN+       +G++RK C  +N
Sbjct  308   MGNIA---NGASGEVRKNCRVIN  327



>ref|NP_196290.1| peroxidase 53 [Arabidopsis thaliana]
 sp|Q42578.1|PER53_ARATH RecName: Full=Peroxidase 53; Short=Atperox P53; AltName: Full=ATPA2; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA68212.1| peroxidase [Arabidopsis thaliana]
 dbj|BAB09806.1| peroxidase [Arabidopsis thaliana]
 gb|AAL07035.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAM20347.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED91055.1| peroxidase 2 [Arabidopsis thaliana]
Length=335

 Score =   322 bits (825),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 214/322 (66%), Gaps = 6/322 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ISL+V +  +    + +QL+  FY  +CPN   IVR  +  A+++D+R+ ASLIRLHFHD
Sbjct  15    ISLIVIVSSIFG-TSSAQLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHD  73

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD S+LLDDT   + EKN  PN NSARGF V+D+IK  +E ACP  VSC+D+L L
Sbjct  74    CFVNGCDASILLDDTGSIQSEKNAGPNVNSARGFNVVDNIKTALENACPGVVSCSDVLAL  133

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             A+  +V ++GGP W VLLGRRD LTA+   A   +PSP ESL +IT KFSA GL+  D+V
Sbjct  134   ASEASVSLAGGPSWTVLLGRRDSLTANLAGANSSIPSPIESLSNITFKFSAVGLNTNDLV  193

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH+ G A+C  F  RLFN+ G+G PDPTL S+ LS LQ  CP  +GS + +  LD 
Sbjct  194   ALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSTLQQLCPQ-NGSASTITNLDL  252

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKL  427
              +   FDN+Y+ NL +N GLL+SDQ L +     T  +V  +++    F+  FA SM+ +
Sbjct  253   STPDAFDNNYFANLQSNDGLLQSDQELFSTTGSSTIAIVTSFASNQTLFFQAFAQSMINM  312

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG  NG+IR  C  VN
Sbjct  313   GNISPLTGS-NGEIRLDCKKVN  333



>ref|XP_010423310.1| PREDICTED: peroxidase 53-like [Camelina sativa]
Length=336

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/326 (50%), Positives = 217/326 (67%), Gaps = 7/326 (2%)
 Frame = -3

Query  1326  MVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLH  1147
             ++ ISL+  +  +    + +QL+  FY  +CPN   IVR  +  A+++D+R+ ASLIRLH
Sbjct  12    LLIISLIAIVSSMFG-TSSAQLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLH  70

Query  1146  FHDCFVNGCDGSVLLDDTKG-FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTD  970
             FHDCFVNGCD S+LLDD  G  + EKN  PN NSARGF V+D+IK  +E ACP  VSC+D
Sbjct  71    FHDCFVNGCDASILLDDVSGSIQSEKNAGPNANSARGFNVVDNIKTALENACPGVVSCSD  130

Query  969   ILTLAASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDL  793
             +L LA+  +V ++GGP W VLLGRRD LTA+   A   +PSP ESL +IT+KFSA GL+ 
Sbjct  131   VLALASEASVSLAGGPSWTVLLGRRDSLTANLAGANSAIPSPVESLSNITSKFSAVGLNS  190

Query  792   KDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLA  613
              D+V LSGAH+ G A+C  F  RLFN+ G+G PDPTL S+ LS+LQ  CP  +GS T + 
Sbjct  191   NDLVALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQ-NGSATTIT  249

Query  612   PLDYQSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATS  439
              LD  +   FDN+Y+ NL +N GLL+SDQ L +     T  +V  +++    F+  FA S
Sbjct  250   NLDLSTPDAFDNNYFANLQSNNGLLQSDQELFSTTGSSTIAIVTSFASNQTLFFQTFAQS  309

Query  438   MVKLGNLGVLTGKDNGQIRKICGSVN  361
             M+ +GN+  LTG  NG+IR  C  VN
Sbjct  310   MINMGNISPLTGS-NGEIRLDCKKVN  334



>ref|XP_006399146.1| hypothetical protein EUTSA_v10014029mg [Eutrema salsugineum]
 gb|ESQ40599.1| hypothetical protein EUTSA_v10014029mg [Eutrema salsugineum]
Length=339

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/308 (50%), Positives = 211/308 (69%), Gaps = 5/308 (2%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             + +QL+  FY ++CPN   IVR  +  A+++DSR+ ASLIRLHFHDCFVNGCD S+LLDD
Sbjct  32    SSAQLNATFYSRTCPNASAIVRSTIQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDD  91

Query  1095  TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYW  916
             +   + EKN  PN NSARGF V+D+IK  +E ACP  VSC+D+L LA+  +V ++GGP W
Sbjct  92    SGSIQSEKNAAPNANSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSW  151

Query  915   RVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCF  739
              VLLGRRD LTA++  A   +PSP ESL +IT+KFSA GL+  D+V LSGAH+ G A+C 
Sbjct  152   TVLLGRRDSLTANQAGANSSIPSPVESLANITSKFSAVGLNTNDLVALSGAHTFGRARCG  211

Query  738   TFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
              F  RL N+ GSG PDPTL ++ L++LQ  CP  +GS + +  LD  +   FDN+Y++NL
Sbjct  212   VFSNRLINFSGSGNPDPTLNTTLLNSLQQICPQ-NGSGSGITNLDLSTPDAFDNNYFSNL  270

Query  558   VNNTGLLESDQALMANPQTAD--MVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQI  385
              +N GLL+SDQ L +   +A   +V  +++    F+  FA SM+ +GN+  LTG   G+I
Sbjct  271   QSNNGLLQSDQELFSTTGSATIAIVTSFASNQTLFFQAFAQSMINMGNISPLTGSS-GEI  329

Query  384   RKICGSVN  361
             R  C  VN
Sbjct  330   RLDCKKVN  337



>ref|XP_010265936.1| PREDICTED: peroxidase N [Nelumbo nucifera]
Length=333

 Score =   321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 208/311 (67%), Gaps = 12/311 (4%)
 Frame = -3

Query  1272  ESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDT  1093
             +SQL   FY+ +CPNL  IVR  V +AI N+ RMAASL+RLHFHDCFVNGCD SVLLD  
Sbjct  28    KSQLSSDFYNSTCPNLLKIVRKQVNTAIMNEIRMAASLLRLHFHDCFVNGCDASVLLD--  85

Query  1092  KGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWR  913
              G   EK  +PN NSARGF+VID+IK+ VE  CP  VSC DIL +AA  +V +SGGP W+
Sbjct  86    -GSDSEKLAVPNLNSARGFDVIDTIKSAVESECPGVVSCADILAIAARDSVLLSGGPSWK  144

Query  912   VLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFT  736
             VLLGRRDGL A++  A   LPSPFES+ +I AKF+A GL+L D+V LSG H++G A+C T
Sbjct  145   VLLGRRDGLVANQTGANNGLPSPFESVDEIAAKFAAVGLNLTDVVSLSGGHTIGLARCAT  204

Query  735   FKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLV  556
             F  RLFN+ G+G PD T+ +  +++LQ  CP   G   K   LD  ST  FDN Y+ NL+
Sbjct  205   FSTRLFNFSGTGAPDTTMNTDMVTDLQNLCPQ-SGDGNKTTALDRNSTDLFDNHYFKNLL  263

Query  555   NNTGLLESDQALMANPQ------TADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDN  394
             N  GLL SDQ L +N        T  +V+ YS     F+ DF  SM+K+GN+  LTG  N
Sbjct  264   NAKGLLFSDQNLFSNTSSQAGSTTKALVESYSNSSKLFFQDFVNSMIKMGNISPLTGT-N  322

Query  393   GQIRKICGSVN  361
             GQIR  C  VN
Sbjct  323   GQIRNNCSVVN  333



>ref|XP_006575205.1| PREDICTED: peroxidase 53-like [Glycine max]
Length=331

 Score =   321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 212/309 (69%), Gaps = 6/309 (2%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             +E+QL+  FY  +CPN+  IV   V  A+++DSR+ ASLIRLHFHDCFVNGCD S+LLD 
Sbjct  23    SEAQLNATFYSSTCPNVSSIVSNAVQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDQ  82

Query  1095  TKGF-KGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPY  919
                  + EKN +PN NS RGF+++D+IK+ +E +CP  VSC DIL LAA  +V +SGGP 
Sbjct  83    GGNITQSEKNAVPNFNSVRGFDIVDNIKSSLESSCPGVVSCADILALAAESSVSLSGGPS  142

Query  918   WRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQC  742
             W VLLGRRDGLTA++  A   LPSPFESL ++++KFSA GLD  D+V LSGAH+ G +QC
Sbjct  143   WNVLLGRRDGLTANQAGANSSLPSPFESLANVSSKFSAVGLDTTDLVALSGAHTFGRSQC  202

Query  741   FTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTN  562
               F +RLFN+ G+G PDPTL S++L+ LQ  CP  +G+ + L  LD  +   FDN+Y+TN
Sbjct  203   QFFSQRLFNFSGTGSPDPTLNSTYLATLQQNCPQ-NGNGSTLNNLDPSTPDTFDNNYFTN  261

Query  561   LVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQ  388
             L+ N GLL++DQ L +     T  +V  ++     F+  FA SM+ +GN+  LTG   G+
Sbjct  262   LLINQGLLQTDQELFSTNGSSTISIVNNFANNQSAFFAAFAQSMINMGNISPLTGTQ-GE  320

Query  387   IRKICGSVN  361
             IR  C  VN
Sbjct  321   IRTDCKKVN  329



>emb|CDP17671.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 210/313 (67%), Gaps = 13/313 (4%)
 Frame = -3

Query  1278  MAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLD  1099
             +A SQL   FY  +CPNL  IVR  V  AI N+ RMAASL+RLHFHDCFVNGCD S+LLD
Sbjct  22    VARSQLSIDFYSSTCPNLLKIVRTEVQKAIMNEIRMAASLLRLHFHDCFVNGCDASLLLD  81

Query  1098  DTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPY  919
                G   EK  +PN NSARGFEV+D+IK  VE AC   VSC DIL +AA  +V +SGGP 
Sbjct  82    ---GSNSEKLAVPNLNSARGFEVVDTIKNAVESACAGVVSCADILAIAARDSVLLSGGPA  138

Query  918   WRVLLGRRDGLTASEEATKQ--LPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQ  745
             WRVLLGRRDGL A++ A     LP PF+S+  I AKF+A GLD+ D+V LSGAH++G A+
Sbjct  139   WRVLLGRRDGLVANQTAANASVLPGPFDSVNTIIAKFAAVGLDVTDVVALSGAHTIGLAK  198

Query  744   CFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNV-DGSNTKLAPLDYQSTYRFDNSYY  568
             C  F  RLFN  G+G PD T+++S +S+LQ+ C    DG+NT  APLD  S   FDN Y+
Sbjct  199   CAVFSSRLFNSSGTGAPDSTMDTSMVSDLQSLCSQTSDGNNT--APLDRNSRDLFDNHYF  256

Query  567   TNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGK  400
              NL++  GLL+SDQ L     A   T  +V+ YS     F+ DF  SM+K+GN+  LTG 
Sbjct  257   QNLLSGKGLLQSDQILYSSDAAASTTRSIVENYSKNSVLFFNDFVNSMIKMGNISPLTGS  316

Query  399   DNGQIRKICGSVN  361
              +GQIRK C  VN
Sbjct  317   -SGQIRKNCRVVN  328



>ref|XP_009784679.1| PREDICTED: peroxidase 15-like [Nicotiana sylvestris]
Length=330

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/325 (50%), Positives = 217/325 (67%), Gaps = 7/325 (2%)
 Frame = -3

Query  1320  AISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFH  1141
             A+  ++ L   +   + +QL   FY  +CPN+  IV+  +  A+++D+R+ ASLIRLHFH
Sbjct  8     AVLCILLLAIFSFYESNAQLSANFYSTTCPNVSSIVQNAIQQALQSDARIGASLIRLHFH  67

Query  1140  DCFVNGCDGSVLLDD--TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             DCFVNGCD S+LLD+  T     EK+  PN NSARGF+V+D+IK+ VE +CP  VSC DI
Sbjct  68    DCFVNGCDASLLLDNNATANIVSEKDAAPNANSARGFDVVDNIKSAVESSCPGVVSCADI  127

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLK  790
             L LAA  +V ++GGP W V LGRRD  TA++  A   +PSPFE L +ITAKFSA GL++ 
Sbjct  128   LALAAEASVSLAGGPSWNVSLGRRDSRTANQGGANTSIPSPFEGLSNITAKFSAVGLNVT  187

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             D+V LSGAH+ G AQC  F  RL N+ G+G PDPTL +++L+NL+  CP  +G+ T LA 
Sbjct  188   DLVALSGAHTFGRAQCRVFSARLNNFNGTGNPDPTLNTTYLANLRQICPQ-NGNATALAN  246

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALM--ANPQTADMVKYYSAYPYRFYMDFATSM  436
             LD  ++  FDN+Y+TNL NN GLL+SDQ L   A   T  +V  +S+    F+  F  SM
Sbjct  247   LDPTTSDSFDNNYFTNLQNNQGLLQSDQELFSTAGAATVSIVNTFSSNQNTFFQSFVQSM  306

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             + +GN+  LTG  NG+IR  C  VN
Sbjct  307   ITMGNISPLTGT-NGEIRSDCKRVN  330



>sp|Q42517.1|PERN_ARMRU RecName: Full=Peroxidase N; AltName: Full=Neutral peroxidase; 
Flags: Precursor [Armoracia rusticana]
 emb|CAA40796.1| peroxidase [Armoracia rusticana]
Length=327

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 212/323 (66%), Gaps = 11/323 (3%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             + L VF   +      +QL    Y +SCPNL  IVR  V  A++ + RMAASLIRLHFHD
Sbjct  12    VLLTVFTLCMLCSAVRAQLSPDIYAKSCPNLLQIVRDQVKIALKAEIRMAASLIRLHFHD  71

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD SVLLD   G   EK  +PN NS RGFEVID+IKA VE ACP  VSC DILTL
Sbjct  72    CFVNGCDASVLLD---GTNSEKLAIPNVNSVRGFEVIDTIKAAVENACPGVVSCADILTL  128

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V +SGGP WRV LGR+DGL A++ +   LPSPFE L  I AKF+A GL++ D+V 
Sbjct  129   AARDSVYLSGGPQWRVALGRKDGLVANQSSANNLPSPFEPLDAIIAKFAAVGLNVTDVVA  188

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G A+C  F  RLFN+ G+G PD TLE++ LS+LQT CP + G+  K APLD  
Sbjct  189   LSGAHTFGQAKCDLFSNRLFNFTGAGTPDSTLETTLLSDLQTVCP-IGGNGNKTAPLDRN  247

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             ST  FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS   Y F+ DF  SM++
Sbjct  248   STDAFDNNYFKNLLEGKGLLSSDQILFSSDLAVNTTKRLVEAYSRSQYLFFRDFTCSMIR  307

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +G+   L    +G++R  C  +N
Sbjct  308   MGS---LVNGASGEVRTNCRVIN  327



>ref|XP_010058197.1| PREDICTED: peroxidase A2-like [Eucalyptus grandis]
Length=334

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 218/330 (66%), Gaps = 6/330 (2%)
 Frame = -3

Query  1341  HKS*VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAAS  1162
             H    ++ I++   L FL  P + +QL   FY  SCPN+  IV+  +  A+++D R+ AS
Sbjct  6     HAPSSLMGIAVFAALLFLLHP-SSAQLSSNFYATSCPNVSNIVQTVIQQALQSDPRITAS  64

Query  1161  LIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTV  982
             L+RLHFHDCFV+GCDGS+LLD++     EK+  PN NS RGF+V+D+IK+ +E +CP TV
Sbjct  65    LLRLHFHDCFVDGCDGSLLLDNSATITSEKDAAPNTNSTRGFDVVDNIKSAIESSCPGTV  124

Query  981   SCTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQ  805
             SC DIL L A  +V +SGGP W VL GRRD LTA++  A   +PSPF+SL ++T+KF+A 
Sbjct  125   SCADILALGAQASVVLSGGPSWTVLSGRRDSLTANQAGANTSIPSPFDSLANLTSKFAAV  184

Query  804   GLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSN  625
             GLD  D+V LSGAH+ G AQC TF  RL+N+  SG PDPT+  S+L+ LQ  CP  +GS 
Sbjct  185   GLDTNDLVTLSGAHTFGRAQCRTFSPRLYNFNASGSPDPTISPSYLTTLQQLCPQ-NGSG  243

Query  624   TKLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMD  451
             + LA LD  +   FDN+YY NL NN GLL+SDQ L +     T  +V  +S     F+  
Sbjct  244   SVLANLDPTTVNTFDNNYYANLQNNQGLLQSDQELFSTSGAATISIVNSFSGNQSAFFQS  303

Query  450   FATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
             FA SM+ +GN+  LTG  +G+IR  C  VN
Sbjct  304   FAQSMINMGNISPLTGS-SGEIRSNCKKVN  332



>ref|XP_002982182.1| hypothetical protein SELMODRAFT_421525 [Selaginella moellendorffii]
 gb|EFJ16850.1| hypothetical protein SELMODRAFT_421525 [Selaginella moellendorffii]
Length=328

 Score =   320 bits (821),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 165/324 (51%), Positives = 219/324 (68%), Gaps = 9/324 (3%)
 Frame = -3

Query  1323  VAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHF  1144
             VAI+ +V L    +    +QL   FY+ +C ++  +V   V  A+ N+ RMAASL+RLHF
Sbjct  10    VAIASLVIL----SASTCAQLSPSFYNGTCRDVSHVVWKVVSQAVGNEKRMAASLLRLHF  65

Query  1143  HDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDIL  964
             HDCFVNGCDGSVLLDDT  F GEK+  PN+NS RGFEVID+IK+ +E  CP  VSC DI+
Sbjct  66    HDCFVNGCDGSVLLDDTASFTGEKSAGPNKNSLRGFEVIDAIKSQLESQCPGIVSCADIV  125

Query  963   TLAASYAVGMSGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKD  787
              LAA  +V M GGP W V LGRRD  TAS +A   Q+P P  ++ ++T+ F A+GL LKD
Sbjct  126   ALAAQTSVFMLGGPGWAVPLGRRDSTTASRDAANSQIPPPVFTVSELTSAFQAKGLSLKD  185

Query  786   MVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPL  607
             MVVLSGAH++G AQCFTF+ RL+++  +   DPT+++SFL+ LQ++CP   G + +L+ L
Sbjct  186   MVVLSGAHTIGAAQCFTFRNRLYSFNSTAASDPTIDASFLATLQSSCPKESGDD-QLSNL  244

Query  606   DYQSTYRFDNSYYTNLVNNTGLLESDQALMA--NPQTADMVKYYSAYPYRFYMDFATSMV  433
             D  +  RFDN YY NL  N GLL SDQ L +      A +V  Y++ P  F+ DF  SM+
Sbjct  245   DAVTPNRFDNQYYKNLQKNKGLLTSDQELFSGTGSDAATLVSSYASNPLTFWRDFKESMI  304

Query  432   KLGNLGVLTGKDNGQIRKICGSVN  361
             K+G++  LTG  NG+IRK C  VN
Sbjct  305   KMGDISPLTGT-NGEIRKNCHFVN  327



>gb|KHN41710.1| Peroxidase 53 [Glycine soja]
Length=331

 Score =   320 bits (821),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 212/309 (69%), Gaps = 6/309 (2%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             +E+QL+  FY  +CPN+  IV   V  A+++DSR+ ASLIRLHFHDCFVNGCD S+LLD 
Sbjct  23    SEAQLNATFYSSTCPNVSSIVSNAVQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDQ  82

Query  1095  TKGF-KGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPY  919
                  + EKN +PN NS RGF+++D+IK+ +E +CP  VSC DIL LAA  +V +SGGP 
Sbjct  83    GGNITQSEKNAVPNFNSVRGFDIVDNIKSSLESSCPGVVSCADILALAAESSVSLSGGPS  142

Query  918   WRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQC  742
             W VLLGRRDGLTA++  A   LPSPFESL ++++KFSA GLD  D+V LSGAH+ G +QC
Sbjct  143   WNVLLGRRDGLTANQAGANSSLPSPFESLANVSSKFSAVGLDTTDLVALSGAHTFGRSQC  202

Query  741   FTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTN  562
               F +RLFN+ G+G PDPTL S++L+ LQ  CP  +G+ + L  LD  +   FDN+Y+TN
Sbjct  203   QFFSQRLFNFSGTGSPDPTLNSTYLATLQQNCPQ-NGNGSTLNNLDPSTPDTFDNNYFTN  261

Query  561   LVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQ  388
             L+ N GLL++DQ L +     T  +V  ++     F+  FA SM+ +GN+  LTG   G+
Sbjct  262   LLINQGLLQTDQELFSTNGSSTISIVNNFANNQSAFFEAFAQSMINMGNISPLTGTQ-GE  320

Query  387   IRKICGSVN  361
             IR  C  VN
Sbjct  321   IRTDCKKVN  329



>ref|XP_006849541.1| hypothetical protein AMTR_s00024p00166170 [Amborella trichopoda]
 gb|ERN11122.1| hypothetical protein AMTR_s00024p00166170 [Amborella trichopoda]
Length=328

 Score =   320 bits (821),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 217/320 (68%), Gaps = 6/320 (2%)
 Frame = -3

Query  1308  VVFLGFLAA--PMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             +VFLG +     +  +QL   FYD +CPN+  IVR  V  A ++D+R+ ASLIRLHFHDC
Sbjct  9     LVFLGLVVGFFGVGRAQLSATFYDTTCPNVISIVRNVVQQAAQSDARIGASLIRLHFHDC  68

Query  1134  FVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLA  955
             FV+GCDGS+LLD++     EK+ +PN  S RGF V+D+IKAD+E  CP  VSC DIL +A
Sbjct  69    FVDGCDGSLLLDNSSSIVSEKDAVPNSGSVRGFPVVDNIKADLESQCPGIVSCADILAIA  128

Query  954   ASYAVGMSGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             +  +V ++GGP W VLLGRRDG TA+++A    LPSPFE + +I+ KFS  GLD  D+V 
Sbjct  129   SEVSVVLAGGPSWSVLLGRRDGTTANKDAANNNLPSPFEGISNISTKFSNVGLDTTDVVA  188

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G AQC  F+ RL+N+ GSG  DPT+ SS+++ LQ +CP   G +T L+ LD  
Sbjct  189   LSGAHTFGRAQCQFFRDRLYNFSGSGAADPTMNSSYVTTLQGSCPQ-SGGDTTLSDLDPT  247

Query  597   STYRFDNSYYTNLVNNTGLLESDQALMANP-QTADMVKYYSAYPYRFYMDFATSMVKLGN  421
             +   FDN+Y+TNL +N GLL+SDQ L +    T  +V+ Y++    F+  F  SM+K+GN
Sbjct  248   TPDGFDNAYFTNLESNRGLLQSDQELFSTSGATVSIVQNYASNQSAFFESFVKSMIKMGN  307

Query  420   LGVLTGKDNGQIRKICGSVN  361
             +  LTG  NGQIR  C  VN
Sbjct  308   ISPLTGT-NGQIRTNCSRVN  326



>pdb|1PA2|A Chain A, Arabidopsis Thaliana Peroxidase A2
 pdb|1QO4|A Chain A, Arabidopsis Thaliana Peroxidase A2 At Room Temperature
Length=306

 Score =   319 bits (817),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 205/305 (67%), Gaps = 5/305 (2%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QL+  FY  +CPN   IVR  +  A+++D+R+ ASLIRLHFHDCFVNGCD S+LLDDT  
Sbjct  2     QLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHDCFVNGCDASILLDDTGS  61

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
              + EKN  PN NSARGF V+D+IK  +E ACP  VSC+D+L LA+  +V ++GGP W VL
Sbjct  62    IQSEKNAGPNVNSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSWTVL  121

Query  906   LGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRD LTA+   A   +PSP ESL +IT KFSA GL+  D+V LSGAH+ G A+C  F 
Sbjct  122   LGRRDSLTANLAGANSSIPSPIESLSNITFKFSAVGLNTNDLVALSGAHTFGRARCGVFN  181

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
              RLFN+ G+G PDPTL S+ LS LQ  CP  +GS + +  LD  +   FDN+Y+ NL +N
Sbjct  182   NRLFNFSGTGNPDPTLNSTLLSTLQQLCPQ-NGSASTITNLDLSTPDAFDNNYFANLQSN  240

Query  549   TGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKI  376
              GLL+SDQ L +     T  +V  +++    F+  FA SM+ +GN+  LTG  NG+IR  
Sbjct  241   DGLLQSDQELFSTTGSSTIAIVTSFASNQTLFFQAFAQSMINMGNISPLTGS-NGEIRLD  299

Query  375   CGSVN  361
             C  VN
Sbjct  300   CKKVN  304



>ref|XP_007206866.1| hypothetical protein PRUPE_ppb006944mg [Prunus persica]
 gb|EMJ08065.1| hypothetical protein PRUPE_ppb006944mg [Prunus persica]
Length=332

 Score =   320 bits (820),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 216/325 (66%), Gaps = 13/325 (4%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             SL++ + F    +A++QL   FY  +CP+L  IVR  V +AI+ + RMAASL+RLHFHDC
Sbjct  13    SLLMIMFFALCLVAKAQLSTDFYKATCPDLLKIVRREVLNAIKTEMRMAASLLRLHFHDC  72

Query  1134  FVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLA  955
             FVNGCD S+LLD T     EK  LPN NSARGFEV+D IK+ VE AC   VSC DIL +A
Sbjct  73    FVNGCDASLLLDVTDS---EKAALPNLNSARGFEVVDRIKSSVESACSGVVSCADILAIA  129

Query  954   ASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             A  +V +SGG  W+VLLGRRDGL A++  A   LPSPFE+L  I +KF+  GLD+KD+V 
Sbjct  130   ARDSVVLSGGTPWKVLLGRRDGLVANQTGANNGLPSPFETLDVIISKFATVGLDVKDVVS  189

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNV-DGSNTKLAPLDY  601
             LSG H++G A+C TF  RLFN+ G+G PD TL+ S L++LQ  CP   DGSNT  AP D 
Sbjct  190   LSGGHTIGLAKCSTFSNRLFNFSGTGSPDSTLDQSMLTDLQNLCPLTGDGSNT--APFDR  247

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMAN-----PQTADMVKYYSAYPYRFYMDFATSM  436
              S   FDN Y+ NL+N  GLL SDQ L ++       T  +V  YS+    F  DFA SM
Sbjct  248   NSADLFDNHYFQNLINGKGLLGSDQILFSSDAAVTTNTKSLVLSYSSNSRLFLSDFADSM  307

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             VK+GN+  LTG   G+IRK C  VN
Sbjct  308   VKMGNISPLTGS-AGEIRKNCRLVN  331



>ref|XP_008387221.1| PREDICTED: peroxidase A2-like [Malus domestica]
Length=339

 Score =   320 bits (820),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 166/313 (53%), Positives = 213/313 (68%), Gaps = 6/313 (2%)
 Frame = -3

Query  1281  PMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLL  1102
             P + +QL+  FY  +CPN+  IVR  V  A+++DSR+ ASLIRLHFHDCFVNGCD S+LL
Sbjct  29    PNSNAQLNSTFYSTTCPNVTSIVRSAVQQALQSDSRIGASLIRLHFHDCFVNGCDASILL  88

Query  1101  DDTKGFK-GEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGG  925
             D     +  EK+  PN NSARGF+V+D+IK  +E +CP  VSC D+L LAA  +V +SGG
Sbjct  89    DKNGTIQQSEKDAAPNTNSARGFDVVDNIKTALENSCPGVVSCADLLALAAEASVSLSGG  148

Query  924   PYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFA  748
             P W  LLGRRD LTA++  A   +PSPFE L +IT+KFSA GL+  D+V LSGAH+ G A
Sbjct  149   PSWNALLGRRDSLTANQAGANTSIPSPFEGLANITSKFSAVGLNTNDLVALSGAHTFGRA  208

Query  747   QCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYY  568
             QC TF  RL+N+ G+G PDPTL SS+L+ LQ TCP  +GS T LA LD  +   FDN+Y+
Sbjct  209   QCRTFSNRLYNFNGTGNPDPTLNSSYLTTLQQTCPQ-NGSGTALANLDLXTPDAFDNNYF  267

Query  567   TNLVNNTGLLESDQALM--ANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDN  394
             TNL NN GLL+SDQ L   A   T  +V  +S+    F+  FA SM+ +GN+  L G   
Sbjct  268   TNLQNNEGLLQSDQELFSTAGAATVSIVNSFSSNQSAFFASFAQSMINMGNISPLVGTS-  326

Query  393   GQIRKICGSVN*G  355
             G+IR  C +VN G
Sbjct  327   GEIRLDCKNVNGG  339



>gb|KHG30456.1| Peroxidase N [Gossypium arboreum]
Length=332

 Score =   320 bits (819),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 217/324 (67%), Gaps = 15/324 (5%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ISL++ LG      A SQL   FY Q+CP+L   VR  V SAI+ + RMAASL+RLHFHD
Sbjct  18    ISLMLCLG------ARSQLTTDFYSQTCPSLLSTVRKQVQSAIKTEMRMAASLLRLHFHD  71

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD SVLLD       EK  L N NSARGFEVID+IK+ VE +C   VSC DIL +
Sbjct  72    CFVNGCDASVLLDGDN--STEKFALANVNSARGFEVIDAIKSAVESSCSGVVSCADILAI  129

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             AA  +V +SGGP WRVLLGRRDGL ++   A   LPSPFE+L  IT KF   GL++ D+V
Sbjct  130   AARDSVVLSGGPTWRVLLGRRDGLVSNGTLANAALPSPFEALDAITQKFVDVGLNITDVV  189

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSG H++G A+C TF  RLFN+ G+G PD T+E++ L++LQ+ CP V+G + +   LD 
Sbjct  190   SLSGGHTIGLAKCATFDNRLFNFSGTGAPDSTMEATMLADLQSFCP-VNGDSNRFTALDR  248

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMV  433
              ST  FDN Y+ NL+N  GLL SDQ L    +A   T ++V+ YS+    F+ DF  SM+
Sbjct  249   NSTDLFDNHYFKNLLNGKGLLGSDQILYSSDLAVSTTKNLVESYSSNSILFFNDFVNSMI  308

Query  432   KLGNLGVLTGKDNGQIRKICGSVN  361
             K+GN+  LTG  NG+IRK C  VN
Sbjct  309   KMGNISPLTGT-NGEIRKNCRDVN  331



>ref|XP_010541735.1| PREDICTED: peroxidase N [Tarenaya hassleriana]
Length=328

 Score =   319 bits (818),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 162/308 (53%), Positives = 208/308 (68%), Gaps = 8/308 (3%)
 Frame = -3

Query  1272  ESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDT  1093
              +QL+  FY QSCPNL  +VR  V +A++ + RMAASLIRLHFHDCFVNGCD S+LLD  
Sbjct  22    RAQLNPYFYAQSCPNLFQVVRKQVMTALKAEIRMAASLIRLHFHDCFVNGCDASILLD--  79

Query  1092  KGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWR  913
              G  GEK  +PN NSARG+EVIDSIK  VE ACP  VSC DIL +AA  +V +SGGP WR
Sbjct  80    -GNNGEKFAIPNVNSARGYEVIDSIKTAVENACPGVVSCADILAIAARDSVLLSGGPSWR  138

Query  912   VLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTF  733
             V LGRRDGL A++ +   LPSPF+ L  + +KF A GL++ D+V LSGAH+ G A+C  F
Sbjct  139   VPLGRRDGLVANQSSANNLPSPFDPLDVLISKFQAVGLNITDVVALSGAHTFGQAKCDLF  198

Query  732   KRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVN  553
               RLFN+ G+G PD TLE++ LS+LQ+ CP V G+  +   LD  ST  FDN Y+ N++ 
Sbjct  199   SNRLFNFSGTGAPDTTLETTVLSDLQSFCP-VGGNGNRTTSLDRNSTDLFDNHYFKNILE  257

Query  552   NTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQI  385
               GLL SDQ L    +A   T  +V  Y +    F+MDF +SMV++GN+     + NG+I
Sbjct  258   GKGLLSSDQILFSSDLATNTTKSLVVAYGSNQTLFFMDFTSSMVRMGNIMNPVNESNGEI  317

Query  384   RKICGSVN  361
             RK C  +N
Sbjct  318   RKNCRVIN  325



>ref|XP_009376683.1| PREDICTED: peroxidase 59-like [Pyrus x bretschneideri]
Length=332

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 168/325 (52%), Positives = 223/325 (69%), Gaps = 13/325 (4%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             SLV+   F    +A++QL   FY  +CP+L  IVR  V +A++++ RMAASL+RLHFHDC
Sbjct  13    SLVLIPFFAFCFVAKAQLSTDFYKATCPDLFKIVRREVQNAVKSEMRMAASLLRLHFHDC  72

Query  1134  FVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLA  955
             FVNGCD S+LLD   G   EK+  PN NSARGFEV+D IK+ VE +C   VSC DIL +A
Sbjct  73    FVNGCDASLLLD---GTGSEKDAGPNLNSARGFEVVDRIKSSVESSCNGVVSCADILAIA  129

Query  954   ASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             A  +V +SGG  W+VLLGRRDGL A++  A + LP+PFE+L  I +KF+A GL++ D+V 
Sbjct  130   ARDSVLLSGGSLWKVLLGRRDGLVANQTGANRALPAPFEALDSIISKFAAVGLNVNDVVS  189

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCP-NVDGSNTKLAPLDY  601
             LSGAH++G A+C TF+ RLFN+ G+G PD TLE S L++LQ  CP   DGS T  AP D 
Sbjct  190   LSGAHTIGLARCGTFRDRLFNFSGTGAPDITLEQSMLTDLQHLCPLTADGSIT--APFDR  247

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQ-----TADMVKYYSAYPYRFYMDFATSM  436
             +S   FDN Y+ NL+N  GL+ SDQ L ++       T  +V+ Y++   RF+ DFA SM
Sbjct  248   KSADLFDNHYFQNLINGKGLISSDQILFSSDAAVTTGTKSLVQSYNSNINRFFADFANSM  307

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             +K+GN+  LTG   G+IRK C +VN
Sbjct  308   IKMGNISPLTGS-AGEIRKNCRAVN  331



>ref|XP_002530724.1| Peroxidase 53 precursor, putative [Ricinus communis]
 gb|EEF31678.1| Peroxidase 53 precursor, putative [Ricinus communis]
Length=335

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 206/320 (64%), Gaps = 5/320 (2%)
 Frame = -3

Query  1311  LVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCF  1132
             L + +  L    +E+QL   FY  +CPN+  IV   V  A ++DSR+ ASLIRLHFHDCF
Sbjct  16    LSIIIAALVLNQSEAQLSTTFYASTCPNITSIVTNAVQQAFQSDSRIGASLIRLHFHDCF  75

Query  1131  VNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAA  952
             V+GCD S+LLD T   + EK   PN NS RGF V+D+IK   E +CP  VSC DIL L+A
Sbjct  76    VDGCDASILLDSTSSIQSEKLAGPNVNSTRGFGVVDNIKTAAESSCPGVVSCADILALSA  135

Query  951   SYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVL  775
               +V +SGGP W VLLGRRD LTA++  A   +PSPFE L +IT+KF+A GL+  D+V L
Sbjct  136   EASVSLSGGPSWNVLLGRRDSLTANQAGANTSIPSPFEGLNNITSKFTAVGLNTNDLVAL  195

Query  774   SGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQS  595
             SGAH+ G AQC TF  RLFN+  +G PDPTL +++L+ LQ  CP  +G+   L  LD  +
Sbjct  196   SGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQICPQ-NGNTAALVNLDPTT  254

Query  594   TYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
                FDN+Y+TNL +N GLL+SDQ L +     T  +V  ++     F+  F  SM+ +GN
Sbjct  255   PDTFDNNYFTNLQSNQGLLQSDQELFSTTGAATVSIVNSFAGNQTAFFQSFVQSMINMGN  314

Query  420   LGVLTGKDNGQIRKICGSVN  361
             +  LTG  NG+IR  C  VN
Sbjct  315   ISPLTGS-NGEIRADCKKVN  333



>ref|XP_008228270.1| PREDICTED: peroxidase 59 [Prunus mume]
Length=333

 Score =   318 bits (814),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 172/325 (53%), Positives = 213/325 (66%), Gaps = 12/325 (4%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             SL++   F    +A++QL   FY  +CP+L  IVR  V SAI+ + RMAASL+RLHFHDC
Sbjct  13    SLLMITFFALCLVAKAQLSTDFYRATCPDLLKIVRREVLSAIKTEMRMAASLLRLHFHDC  72

Query  1134  FVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLA  955
             FVNGCD S+LLD T     EK   PN NSARGFEV+D IK+ VE AC   VSC DIL +A
Sbjct  73    FVNGCDASLLLDATDS---EKAAAPNLNSARGFEVVDRIKSSVESACSGVVSCADILAIA  129

Query  954   ASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             A  +V +SGG  W+VLLGRRDGL A++  A   LPSPFE+L  I +KF+  GLD+KD+V 
Sbjct  130   ARDSVVLSGGTSWKVLLGRRDGLVANQTGANNGLPSPFETLDVIISKFATVGLDVKDVVS  189

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNV-DGSNTKLAPLDY  601
             LSG H++G A+C TF  RLFN+ G+G PD TLE S L++LQ  CP   DGSN   A  D 
Sbjct  190   LSGGHTIGLAKCSTFSNRLFNFSGTGSPDSTLEQSMLTDLQNLCPRTGDGSNNT-AAFDR  248

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMAN-----PQTADMVKYYSAYPYRFYMDFATSM  436
              S   FDN Y+ NL+N  GLL SDQ L ++       T  +V+ YS+    F  DFA SM
Sbjct  249   NSADLFDNHYFQNLINGKGLLGSDQILFSSDAAVTTNTKSLVQSYSSNSGLFLRDFADSM  308

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             VK+GN+  LTG   G+IRK C  VN
Sbjct  309   VKMGNISPLTGS-AGEIRKNCRLVN  332



>ref|XP_009364156.1| PREDICTED: peroxidase N-like [Pyrus x bretschneideri]
Length=332

 Score =   318 bits (814),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 221/325 (68%), Gaps = 13/325 (4%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             SL +   F    +A++QL   FY+ +CP++  IVR  V +A++++ RMAASL+RLHFHDC
Sbjct  13    SLAMITFFALCFVAKAQLSTDFYNATCPDVLKIVRREVLNAVKSEMRMAASLLRLHFHDC  72

Query  1134  FVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLA  955
             FVNGCD S+LLD   G   EKN  PN NSARGFEV+D IK+ VE +C   VSC DIL +A
Sbjct  73    FVNGCDASLLLD---GNDSEKNARPNLNSARGFEVVDRIKSSVESSCSGVVSCADILAIA  129

Query  954   ASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             A  +V +SGG  W+VLLGRRDGL A++  A   LP+P E+L  I +KF+A GL+++D+V 
Sbjct  130   ARDSVLLSGGTSWKVLLGRRDGLVANQTGANSALPAPTEALDIIISKFAAVGLNIRDVVS  189

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNV-DGSNTKLAPLDY  601
             LSGAH++G A+C TF  RLFN+ G+G PD T+E S  ++LQ  CP   DG+NT  APLD 
Sbjct  190   LSGAHTIGLARCATFSNRLFNFSGTGAPDSTMEQSMQTDLQNRCPQTSDGNNT--APLDR  247

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQ-----TADMVKYYSAYPYRFYMDFATSM  436
              ST  FDN Y+ NL+N  GLL SDQ L ++ +     T  +V+ Y++    F  DFA SM
Sbjct  248   NSTDLFDNHYFQNLINGKGLLGSDQILFSSDEAVTTGTKSLVQSYNSNLNLFLADFANSM  307

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             +K+GN+  LTG   G+IRK C +VN
Sbjct  308   IKMGNISPLTGSA-GEIRKNCRAVN  331



>ref|XP_006373791.1| hypothetical protein POPTR_0016s05860g [Populus trichocarpa]
 ref|XP_006388578.1| This sequence shows homology with Cucumber peroxidase family 
protein [Populus trichocarpa]
 gb|ERP47492.1| This sequence shows homology with Cucumber peroxidase family 
protein [Populus trichocarpa]
 gb|ERP51588.1| hypothetical protein POPTR_0016s05860g [Populus trichocarpa]
 gb|AHL39185.1| class III peroxidase [Populus trichocarpa]
Length=331

 Score =   317 bits (813),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 166/319 (52%), Positives = 213/319 (67%), Gaps = 6/319 (2%)
 Frame = -3

Query  1308  VVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFV  1129
             +V LG +  P +++QL+  FY  +CPN+  IV   V  A ++DSR+ ASLIRLHFHDCFV
Sbjct  14    IVLLGMML-PHSKAQLNATFYANTCPNVSSIVSNVVQQAFQSDSRIGASLIRLHFHDCFV  72

Query  1128  NGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAAS  949
             NGCD S+LLD++     EK   PN NS RGF V+D+IK  VE +CP  VSC DIL LAA 
Sbjct  73    NGCDASILLDNSSSILSEKFAAPNVNSIRGFGVVDNIKTAVENSCPGVVSCADILALAAE  132

Query  948   YAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLS  772
              +V  SGGP W VLLGRRD LTA++  A   +PSPFE L +ITAKFSA GL+  D+V LS
Sbjct  133   SSVSQSGGPSWSVLLGRRDSLTANQAGANTAIPSPFEGLNNITAKFSAVGLNTNDLVALS  192

Query  771   GAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQST  592
             GAH+ G AQC TF  RL+N+  +G PDPTL +++L+ LQ  CP  +GS T LA LD  ++
Sbjct  193   GAHTFGRAQCRTFSNRLYNFSNTGNPDPTLNTTYLTTLQQICPQ-NGSGTALANLDPTTS  251

Query  591   YRFDNSYYTNLVNNTGLLESDQALMANPQTADM--VKYYSAYPYRFYMDFATSMVKLGNL  418
               FDN+Y+TNL NN GLL+SDQ L + P  A +  V  +S+    F+  F  SM+ +GN+
Sbjct  252   DAFDNNYFTNLQNNQGLLQSDQELFSTPGAATITFVNNFSSNQTAFFQSFVQSMINMGNI  311

Query  417   GVLTGKDNGQIRKICGSVN  361
               LTG   G+IR  C  VN
Sbjct  312   SPLTGSS-GEIRSDCKKVN  329



>ref|XP_010520028.1| PREDICTED: peroxidase A2-like [Tarenaya hassleriana]
Length=340

 Score =   317 bits (813),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 207/305 (68%), Gaps = 5/305 (2%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QL+  FY  +CPN   IVR  V  A+++D R+ ASLIRLHFHDCFVNGCD S+LLD +  
Sbjct  36    QLNATFYSGTCPNASSIVRNIVQQALQSDPRIGASLIRLHFHDCFVNGCDASILLDGSGS  95

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
              + EKN  PN NS RGF V+D+IK  +E ACP  VSC DIL  A+  +V +SGGP W VL
Sbjct  96    VQSEKNAGPNANSVRGFGVVDNIKTALENACPGVVSCADILAFASESSVSLSGGPSWTVL  155

Query  906   LGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRDGLTA++  A   +PSPFE L +ITAKFSA GL+  D+V LSGAH+ G AQC  F 
Sbjct  156   LGRRDGLTANQAGANTSIPSPFEGLSNITAKFSAVGLNTSDLVALSGAHTFGRAQCRLFS  215

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
              RL+N+ G+G PDP+L ++FL++LQ  CP  +GS + +  LD Q+   FDN+Y+ NL  N
Sbjct  216   SRLYNFSGTGNPDPSLNTTFLNSLQQLCPR-NGSGSVITNLDLQTPDSFDNAYFANLQTN  274

Query  549   TGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKI  376
              GLL+SDQ L +     T  +V  +++    F+  FA SM+ +GN+  LTG ++G+IR+ 
Sbjct  275   QGLLQSDQELFSTRGAATVAIVASFASNQTLFFQAFAQSMINMGNISPLTG-NSGEIRQD  333

Query  375   CGSVN  361
             C  VN
Sbjct  334   CKKVN  338



>gb|KDP24640.1| hypothetical protein JCGZ_25556 [Jatropha curcas]
Length=337

 Score =   317 bits (813),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 155/319 (49%), Positives = 212/319 (66%), Gaps = 5/319 (2%)
 Frame = -3

Query  1308  VVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFV  1129
             ++ +  +    + +QL   FY+ +CPN+  IV   +  A+++D R+ ASLIRLHFHDCFV
Sbjct  19    IILVAIILQHQSNAQLSATFYNTTCPNVSAIVTNVIQQALQSDPRIGASLIRLHFHDCFV  78

Query  1128  NGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAAS  949
             +GCDGS+LLD+T     EK   PN NSARGF+V+D+IK  VE +CP  VSC DIL LAA 
Sbjct  79    DGCDGSILLDNTSSILSEKFAAPNVNSARGFDVVDNIKTAVENSCPGVVSCADILALAAE  138

Query  948   YAVGMSGGPYWRVLLGRRDGLTASE-EATKQLPSPFESLKDITAKFSAQGLDLKDMVVLS  772
              +V ++GGP W VL+GRRD  TA++  A   +P+PF+ L +IT+KFSA GL+  D+V LS
Sbjct  139   ASVSLAGGPSWTVLVGRRDSQTANQGGANTSIPTPFDGLTNITSKFSAVGLNTNDLVALS  198

Query  771   GAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQST  592
             GAH+ G AQC TF  RLFN+ G+G PDPTL +++L+ LQ  CP   G+ + LA LD  + 
Sbjct  199   GAHTFGRAQCRTFSNRLFNFSGTGNPDPTLNTTYLATLQQICPQ-GGNISALANLDPTTP  257

Query  591   YRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGNL  418
               FD++Y+TNL NN GLL+SDQ L +     T  +V  +S+    F+  F  SM+ +GN+
Sbjct  258   DTFDSNYFTNLQNNQGLLQSDQELFSTSGASTISIVNTFSSNQTAFFQSFVQSMINMGNI  317

Query  417   GVLTGKDNGQIRKICGSVN  361
               LTG  NG+IR  C  VN
Sbjct  318   SPLTGS-NGEIRADCKKVN  335



>emb|CDX92492.1| BnaA10g15310D [Brassica napus]
Length=327

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 210/323 (65%), Gaps = 8/323 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             + L +F   +    A SQL    YD+SCP L  IVR  V  A++ + RMAASLIRLHFHD
Sbjct  8     VLLTIFTLCMICSGARSQLSPGIYDKSCPYLVQIVRKQVNMALKAEIRMAASLIRLHFHD  67

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD SVLLD   G   EK  + N NSARGFEV+D+IKA VE ACP  VSC DILTL
Sbjct  68    CFVNGCDASVLLD---GADSEKLSISNANSARGFEVVDTIKAAVESACPGVVSCADILTL  124

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V M+GGP WRV LGR+DGL A++ +   LPSPFE L  I AKF A GL++ D+V 
Sbjct  125   AARESVYMTGGPMWRVALGRKDGLVANQSSANNLPSPFEPLDAIIAKFQAVGLNVTDVVA  184

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G A+C  F+ RLFN+ G G PD TLE++ LS+L+T CP + G+    APLD  
Sbjct  185   LSGAHTFGQAKCDLFRNRLFNFTGQGSPDATLETTLLSDLRTVCP-IGGNGNVTAPLDRN  243

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             ST  FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS     F+ DF  SM++
Sbjct  244   STDVFDNNYFKNLLQGKGLLSSDQILFSSDLAVNTTKRLVEAYSQSQSLFFRDFTCSMIR  303

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +G +       +G++RK C  +N
Sbjct  304   MGGIMNPINGSSGEVRKNCRVIN  326



>ref|XP_009369457.1| PREDICTED: peroxidase A2-like [Pyrus x bretschneideri]
Length=338

 Score =   317 bits (813),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 166/313 (53%), Positives = 212/313 (68%), Gaps = 6/313 (2%)
 Frame = -3

Query  1281  PMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLL  1102
             P   +QL+  FY  +CPN+  IVR  V  A+++DSR+ ASLIRLHFHDCFVNGCD S+LL
Sbjct  28    PNYNAQLNSTFYSTTCPNVTSIVRTTVQQALQSDSRIGASLIRLHFHDCFVNGCDASILL  87

Query  1101  DDTKGFK-GEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGG  925
             D     +  EK+  PN NS RGF+V+D+IK  +E +CP  VSC D+L LAA  +V +SGG
Sbjct  88    DKNGTIQQSEKDAAPNTNSTRGFDVVDNIKTALENSCPGVVSCADLLALAAEASVSLSGG  147

Query  924   PYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFA  748
             P W VLLGRRD LTA++  A   +PSPFESL +IT+KFSA GL+  D+V LSGAH+ G A
Sbjct  148   PSWNVLLGRRDSLTANQAGANTSIPSPFESLANITSKFSAVGLNTNDLVALSGAHTFGRA  207

Query  747   QCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYY  568
             QC TF  RL+N+  +G PDPTL SS+L+ LQ TCP  +GS T LA LD  +   FDN+Y+
Sbjct  208   QCRTFSNRLYNFNSTGNPDPTLNSSYLTTLQQTCPQ-NGSGTALANLDLSTPDAFDNNYF  266

Query  567   TNLVNNTGLLESDQALM--ANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDN  394
             TNL NN GLL+SDQ L   A   T  +V  +S+    F+  FA SM+ +GN+  L G   
Sbjct  267   TNLQNNQGLLQSDQELFSTAGAATVSIVNSFSSNQSAFFESFARSMINMGNISPLVGTS-  325

Query  393   GQIRKICGSVN*G  355
             G+IR  C +VN G
Sbjct  326   GEIRLDCKNVNGG  338



>gb|AGF25268.1| peroxidase 1 [Pyrus communis]
Length=338

 Score =   317 bits (813),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 166/313 (53%), Positives = 212/313 (68%), Gaps = 6/313 (2%)
 Frame = -3

Query  1281  PMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLL  1102
             P   +QL+  FY  +CPN+  IVR     A+++DSR+ ASLIRLHFHDCFVNGCD S+LL
Sbjct  28    PNYNAQLNSTFYSTTCPNVTSIVRSADQQALQSDSRIGASLIRLHFHDCFVNGCDASILL  87

Query  1101  DDTKGFK-GEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGG  925
             D     +  EK+  PN NS RGF+V+D+IK  +E +CP  VSC D+L LAA  +V +SGG
Sbjct  88    DKNGTIQQSEKDAAPNTNSTRGFDVVDNIKTALENSCPGVVSCADLLALAAEASVSLSGG  147

Query  924   PYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFA  748
             P W VLLGRRD LTA++  A   +PSPFESL +IT+KFSA GL+  D+V LSGAH+ G A
Sbjct  148   PSWNVLLGRRDSLTANQAGANTSIPSPFESLANITSKFSAVGLNTNDLVALSGAHTFGRA  207

Query  747   QCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYY  568
             QC TF  RL+N+ G+G PDPTL SS+L+ LQ TCP  +GS T LA LD  +   FDN+Y+
Sbjct  208   QCRTFSNRLYNFNGTGNPDPTLNSSYLTTLQQTCPQ-NGSGTALANLDLSTPDAFDNNYF  266

Query  567   TNLVNNTGLLESDQALM--ANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDN  394
             TNL NN GLL+SDQ L   A   T  +V  +S+    F+  FA SM+ +GN+  L G   
Sbjct  267   TNLQNNQGLLQSDQELFSTAGAATVSIVNSFSSNQSAFFESFAQSMINMGNISPLVGTS-  325

Query  393   GQIRKICGSVN*G  355
             G+IR  C +VN G
Sbjct  326   GEIRLDCKNVNGG  338



>emb|CAA67092.1| peroxidase [Arabidopsis thaliana]
Length=328

 Score =   317 bits (811),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 211/323 (65%), Gaps = 11/323 (3%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             + L VF   +      +QL    Y +SCPNL  IVR  V  A++ + RMAASLIRLHFHD
Sbjct  12    VLLTVFTLCMLCSGVRAQLSPDIYAKSCPNLVQIVRKQVAIALKAEIRMAASLIRLHFHD  71

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD S+LLD   G   EK  +PN NSARGFEVID+IKA VE ACP  VSC DILTL
Sbjct  72    CFVNGCDASLLLD---GADSEKLAIPNINSARGFEVIDTIKAAVENACPGVVSCADILTL  128

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V +SGGP WRV LGR+DGL A++ +   LPSPFE L  I AKF A  L++ D+V 
Sbjct  129   AARDSVVLSGGPGWRVALGRKDGLVANQNSANNLPSPFEPLDAIIAKFVAVNLNITDVVA  188

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G A+C  F  RLFN+ G+G PD TLE+S LSNLQT CP + G++   APLD  
Sbjct  189   LSGAHTFGQAKCAVFSNRLFNFTGAGNPDATLETSLLSNLQTVCP-LGGNSNITAPLDRS  247

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             +T  FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS     F+ DF  +M++
Sbjct  248   TTDTFDNNYFKNLLEGKGLLSSDQILFSSDLAVNTTKKLVEAYSRSQSLFFRDFTCAMIR  307

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +GN   ++   +G++R  C  +N
Sbjct  308   MGN---ISNGASGEVRTNCRVIN  327



>gb|AAM65571.1| peroxidase ATP N [Arabidopsis thaliana]
Length=328

 Score =   317 bits (811),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 211/323 (65%), Gaps = 11/323 (3%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             + L VF   +      +QL    Y +SCPNL  IVR  V  A++ + RMAASLIRLHFHD
Sbjct  12    VLLTVFTLCMLCSGVRAQLSPDIYAKSCPNLVQIVRKQVAIALKAEIRMAASLIRLHFHD  71

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD S+LLD   G   EK  +PN NSARGFEVID+IKA VE ACP  VSC DILTL
Sbjct  72    CFVNGCDASLLLD---GADSEKLAIPNINSARGFEVIDTIKAAVENACPGVVSCADILTL  128

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V +SGGP WRV LGR+DGL A++ +   LPSPFE L  I AKF A  L++ D+V 
Sbjct  129   AARDSVVLSGGPGWRVALGRKDGLVANQNSANNLPSPFEPLDAIIAKFVAVNLNITDVVA  188

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G A+C  F  RLFN+ G+G PD TLE+S LSNLQT CP + G++   APLD  
Sbjct  189   LSGAHTFGQAKCAVFSNRLFNFTGAGNPDATLETSLLSNLQTVCP-LGGNSNITAPLDRS  247

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             +T  FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS     F+ DF  +M++
Sbjct  248   TTDTFDNNYFKNLLEGKGLLSSDQILFSSDLAVNTTKKLVEAYSRSQSLFFRDFTCAMIR  307

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +GN   ++   +G++R  C  +N
Sbjct  308   MGN---ISNGASGEVRTNCRVIN  327



>gb|AAD43561.1|AF155124_1 bacterial-induced peroxidase precursor [Gossypium hirsutum]
Length=316

 Score =   316 bits (810),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/318 (50%), Positives = 207/318 (65%), Gaps = 10/318 (3%)
 Frame = -3

Query  1311  LVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCF  1132
             + + +  L+   A +QL   FY  SCPNL  IVR  +  A+  ++R+ AS++RL FHDCF
Sbjct  8     VTLLIVMLSCHAANAQLSPNFYASSCPNLQTIVRNAMSRAVNRETRIGASILRLFFHDCF  67

Query  1131  VNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAA  952
             VNGCDGS+LLDDT  F GEKN +PNRNSARGFEVID+IK +VE AC +TVSC DIL LAA
Sbjct  68    VNGCDGSILLDDTATFTGEKNAVPNRNSARGFEVIDTIKTNVEAACSATVSCADILALAA  127

Query  951   SYAVGMSGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVL  775
                V + GGP W+V LGRRD  TAS+ A   Q+PSPF +L  +T+ F+A+GL  +D+  L
Sbjct  128   RDGVALLGGPTWQVPLGRRDARTASQSAANNQIPSPFANLATLTSSFAAKGLSTRDLTAL  187

Query  774   SGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQS  595
             SG H++G A+C TF+ R++N       D  ++++F +  +  CP   G N  LAPLD Q+
Sbjct  188   SGGHTIGLARCTTFRGRIYN-------DTNIDANFAATRRANCPASGGDN-NLAPLDIQT  239

Query  594   TYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLG  415
               RFDN Y+ NLV   GLL SDQ L        +V+ YS  P  F  DFA +MVK+GN+ 
Sbjct  240   PTRFDNDYFRNLVARRGLLHSDQELFNGGSQDALVRTYSNNPATFSADFAAAMVKMGNIS  299

Query  414   VLTGKDNGQIRKICGSVN  361
              LTG   G+IR+ C  VN
Sbjct  300   PLTGTQ-GEIRRNCRVVN  316



>ref|XP_006290154.1| hypothetical protein CARUB_v10003822mg [Capsella rubella]
 gb|EOA23052.1| hypothetical protein CARUB_v10003822mg [Capsella rubella]
Length=329

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 210/323 (65%), Gaps = 11/323 (3%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             + L VF  F+      +QL+   Y +SCP+L  IVR  V  A+  + R+AASLIRLHFHD
Sbjct  13    VLLTVFTLFMLCSGVRAQLNPDIYAKSCPSLVQIVRNQVSIAMNAEKRIAASLIRLHFHD  72

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD S+LLD   G   EK  +PN NS RGFEVID+IKA VEKACP  VSC DILTL
Sbjct  73    CFVNGCDASILLD---GTDSEKLAIPNVNSVRGFEVIDTIKAAVEKACPGVVSCADILTL  129

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V +SGGP WRV LGR+DGL A++ +   LPSPFE L  I AKF A GL+  D+V 
Sbjct  130   AARDSVCLSGGPRWRVALGRKDGLVANQNSANNLPSPFEPLDSIIAKFVAVGLNTTDVVA  189

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G A+C  F  RLFN+ G+G PD TLE+S LSNL++ CP V G+    AP D  
Sbjct  190   LSGAHTFGQAKCDLFSNRLFNFTGAGTPDVTLETSLLSNLRSVCP-VGGNGNITAPFDPN  248

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             S   FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS   Y F+ DF  SM++
Sbjct  249   SVDAFDNNYFKNLLQGKGLLSSDQILFSSDLAVNTTKSLVEAYSRSQYLFFRDFTCSMIR  308

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +GN+       +G++R+ C  +N
Sbjct  309   MGNIA---NGASGEVRRNCRVIN  328



>ref|XP_003535116.1| PREDICTED: peroxidase 53-like [Glycine max]
 gb|KHN35656.1| Peroxidase 53 [Glycine soja]
Length=331

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/327 (50%), Positives = 215/327 (66%), Gaps = 10/327 (3%)
 Frame = -3

Query  1329  VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRL  1150
             ++  I LV+ L F     +E QL   FY  +C N+  IVR  V  A+++DSR+ ASL RL
Sbjct  9     LLATIFLVLTLIF----PSEGQLSSTFYSSTCSNVSSIVRSAVQQALQSDSRIGASLSRL  64

Query  1149  HFHDCFVNGCDGSVLLDDTKGF-KGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCT  973
             HFHDCFVNGCD S+LLD      + EKN  PN NS RGF+V+D+IK+ +E +CP  VSC 
Sbjct  65    HFHDCFVNGCDASILLDQGGNITQSEKNAAPNVNSIRGFDVVDNIKSSLESSCPGVVSCA  124

Query  972   DILTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLD  796
             DIL LAA  +V +SGGP W VLLGRRDGLTA++  A   +PSPFESL ++T+KFSA GLD
Sbjct  125   DILALAAESSVSLSGGPSWNVLLGRRDGLTANQAGANSSIPSPFESLANVTSKFSAVGLD  184

Query  795   LKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKL  616
               D+V LSGAH+ G AQC  F +RLFN+ G+G PDPTL S++L+ LQ  CP   GS + L
Sbjct  185   TTDLVALSGAHTFGRAQCQFFSQRLFNFSGTGSPDPTLNSTYLATLQQNCPQ-SGSGSTL  243

Query  615   APLDYQSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFAT  442
               LD  +   FDN+Y+TNL+ N GLL++DQ L ++    T  +V  ++     F+  F  
Sbjct  244   NNLDPSTPDTFDNNYFTNLLINQGLLQTDQELFSSNGSSTISIVNNFANNQSAFFEAFVQ  303

Query  441   SMVKLGNLGVLTGKDNGQIRKICGSVN  361
             SM+ +GN+  LTG   G+IR  C  +N
Sbjct  304   SMINMGNISPLTGSQ-GEIRTDCKKLN  329



>ref|XP_007029017.1| Peroxidase 2 [Theobroma cacao]
 gb|EOY09519.1| Peroxidase 2 [Theobroma cacao]
Length=331

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 216/331 (65%), Gaps = 9/331 (3%)
 Frame = -3

Query  1344  IHKS*VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAA  1165
             I  S  +++  L+ FL +     +++QL   FY  +CPN   IVR  +  A+++D R+ A
Sbjct  5     IANSSFILSTILLTFLVY----QSKAQLSATFYATTCPNASSIVRSVIQQALQSDIRIGA  60

Query  1164  SLIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPST  985
             SLIRLHFHDCFV+GCD S+LLD++   + EK+  PN NS RGF V+D+IK  +E +CP  
Sbjct  61    SLIRLHFHDCFVDGCDASILLDNSANIQSEKDAAPNTNSTRGFNVVDNIKTALENSCPGI  120

Query  984   VSCTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSA  808
             VSC D+L LAA  +V + GGP W VLLGRRD LTA++  A   +PSPFE L +IT+KFSA
Sbjct  121   VSCADVLALAAESSVSLQGGPSWSVLLGRRDSLTANQAGANSSIPSPFEGLSNITSKFSA  180

Query  807   QGLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGS  628
              GL+  D+V LSGAH+ G AQC  F  RL+N+ G+G PDPTL+SS+L+ L+  CP   GS
Sbjct  181   VGLNTNDLVALSGAHTFGRAQCRLFSNRLYNFSGTGNPDPTLDSSYLTTLRQICPQ-SGS  239

Query  627   NTKLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALM--ANPQTADMVKYYSAYPYRFYM  454
                +A LD  +   FD++Y+TNL NN GLL+SDQ L   A   T  +V  +S     F+ 
Sbjct  240   GFNVANLDPTTPDTFDSNYFTNLQNNQGLLQSDQELFSTAGAPTISIVNTFSGNQTAFFQ  299

Query  453   DFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
              FA SM+ +GN+  LTG  +G+IR  C  VN
Sbjct  300   SFAQSMINMGNISPLTGS-SGEIRADCKKVN  329



>ref|XP_002978872.1| hypothetical protein SELMODRAFT_418626 [Selaginella moellendorffii]
 gb|EFJ19829.1| hypothetical protein SELMODRAFT_418626 [Selaginella moellendorffii]
Length=329

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 207/320 (65%), Gaps = 4/320 (1%)
 Frame = -3

Query  1314  SLVVFLGFLA-APMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             SL++FL  ++   MA  QL   FY  +CPNL  IV   V  A+ ++ RMAASL+RLHFHD
Sbjct  12    SLIIFLFLVSMCGMAFGQLSTTFYASTCPNLVQIVSGVVRRAVASEPRMAASLLRLHFHD  71

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFV GCD S+LLDD  GF GEK+ LPN+NS RGF VID+IK  VE+ CP+ VSC DI+TL
Sbjct  72    CFVQGCDASLLLDDASGFTGEKSALPNQNSVRGFNVIDNIKTAVERQCPNVVSCADIVTL  131

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             AA   V    GP W V+LGRRD  TAS   A   +P+P  S   + +KF A+GL  +D+V
Sbjct  132   AAREGVTALQGPSWPVVLGRRDSTTASLSSANNDIPAPTSSASQLLSKFQAKGLSAQDLV  191

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
               SG H++G A+C TF+ RL+N+  SG+PDP L + FLS LQ  C     S+  L+PLD 
Sbjct  192   ATSGGHTIGQARCVTFRDRLYNFSSSGRPDPNLNALFLSRLQQQCTQSSASDNSLSPLDV  251

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
             +S   FDN+Y+ NL  N GLL SDQ L A   T  +V  Y+    RF+ DFA++MV +GN
Sbjct  252   RSANVFDNAYFVNLQFNRGLLNSDQVLSAG-STQALVNAYAGNNRRFFADFASAMVNMGN  310

Query  420   LGVLTGKDNGQIRKICGSVN  361
             +  LTG   G+IRK C + N
Sbjct  311   ISPLTGSA-GEIRKSCRARN  329



>ref|XP_009610510.1| PREDICTED: peroxidase 15 {ECO:0000303|PubMed:17936696}-like [Nicotiana 
tomentosiformis]
Length=329

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 213/322 (66%), Gaps = 7/322 (2%)
 Frame = -3

Query  1311  LVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCF  1132
             L + L   +   + +QL   FY  +CPN+  IV+  +  A+++DSR+ ASLIRLHFHDCF
Sbjct  10    LCILLAIFSFYESNAQLSANFYSTTCPNVSSIVQNVIQQALQSDSRIGASLIRLHFHDCF  69

Query  1131  VNGCDGSVLLDD--TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             VNGCD S+LLD+  T     EK+  PN NS RGF+V+D+IK+ VE +CP  VSC DIL L
Sbjct  70    VNGCDASLLLDNNSTANIVSEKDAAPNANSVRGFDVVDNIKSAVESSCPGVVSCADILAL  129

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             AA  +V ++GGP W V LGRRD  TA++  A   +PSP E L +ITAKFSA GL++ D+V
Sbjct  130   AAEASVSLAGGPSWNVSLGRRDSRTANQGGANTSIPSPVEGLSNITAKFSAVGLNVTDLV  189

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH+ G AQC  F  RL N+ G+G PDPTL +++L+NL+  CP  +GS T LA LD 
Sbjct  190   ALSGAHTFGRAQCRVFSARLNNFNGTGNPDPTLNTTYLANLRQICPQ-NGSATALANLDP  248

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANP--QTADMVKYYSAYPYRFYMDFATSMVKL  427
              ++  FDN+Y+ NL +N GLL+SDQ L + P   T  +V  +S+    F+  F  SM+ +
Sbjct  249   TTSDSFDNNYFANLQSNQGLLQSDQELFSTPGAATVSIVNTFSSNQNTFFQSFVQSMINM  308

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG  NG+IR  C  VN
Sbjct  309   GNISPLTGT-NGEIRSDCKRVN  329



>ref|XP_004295168.1| PREDICTED: peroxidase N-like [Fragaria vesca subsp. vesca]
Length=335

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 168/324 (52%), Positives = 217/324 (67%), Gaps = 13/324 (4%)
 Frame = -3

Query  1311  LVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCF  1132
             LVV + F  +   ++QL   FY QSCP L  IVR  V +AI+++ RMAASL+RLHFHDCF
Sbjct  17    LVVMILFAFSSAVKAQLSTDFYQQSCPKLLQIVRKEVQNAIKSEMRMAASLLRLHFHDCF  76

Query  1131  VNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAA  952
             VNGCD S+LLD T G   EK+ +PN NSARGFEVID+IK+ VE +C   VSC DILT+AA
Sbjct  77    VNGCDASLLLDLTDG---EKSAIPNVNSARGFEVIDAIKSSVESSCSGVVSCADILTIAA  133

Query  951   SYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVL  775
               +V +SGG  W+VLLGRRDGL A++  A   LPSPF++L  I +KF+  GL++ D+V L
Sbjct  134   RDSVVLSGGNSWKVLLGRRDGLVANQTGANAGLPSPFDTLDAIISKFANVGLNVTDVVSL  193

Query  774   SGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNV-DGSNTKLAPLDYQ  598
             SGAH++G A C TF  RLFN+ G+G PD TL+S+  ++LQ  CP   DG NT  APLD  
Sbjct  194   SGAHTIGLATCRTFSNRLFNFSGTGAPDSTLDSTMATDLQNQCPTTSDGFNT--APLDRN  251

Query  597   STYRFDNSYYTNLVNNTGLLESDQALMA-----NPQTADMVKYYSAYPYRFYMDFATSMV  433
             S   FDN Y+ NL+   GLL SDQ L +        T  +V+ YS+    F  DFA SM+
Sbjct  252   SRDLFDNHYFQNLLTGKGLLSSDQLLFSGDAAETTSTKSLVQSYSSNSNLFLTDFANSMI  311

Query  432   KLGNLGVLTGKDNGQIRKICGSVN  361
             K+G++  LTG   G+IR+ C  +N
Sbjct  312   KMGSISPLTGS-AGEIRQNCRVLN  334



>pdb|1QGJ|A Chain A, Arabidopsis Thaliana Peroxidase N
 pdb|1QGJ|B Chain B, Arabidopsis Thaliana Peroxidase N
Length=300

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/306 (53%), Positives = 205/306 (67%), Gaps = 11/306 (4%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QL    Y +SCPNL  IVR  V  A++ + RMAASLIRLHFHDCFVNGCD S+LLD   G
Sbjct  1     QLSPDIYAKSCPNLVQIVRKQVAIALKAEIRMAASLIRLHFHDCFVNGCDASLLLD---G  57

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
                EK  +PN NSARGFEVID+IKA VE ACP  VSC DILTLAA  +V +SGGP WRV 
Sbjct  58    ADSEKLAIPNINSARGFEVIDTIKAAVENACPGVVSCADILTLAARDSVVLSGGPGWRVA  117

Query  906   LGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKR  727
             LGR+DGL A++ +   LPSPFE L  I AKF A  L++ D+V LSGAH+ G A+C  F  
Sbjct  118   LGRKDGLVANQNSANNLPSPFEPLDAIIAKFVAVNLNITDVVALSGAHTFGQAKCAVFSN  177

Query  726   RLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNT  547
             RLFN+ G+G PD TLE+S LSNLQT CP + G++   APLD  +T  FDN+Y+ NL+   
Sbjct  178   RLFNFTGAGNPDATLETSLLSNLQTVCP-LGGNSNITAPLDRSTTDTFDNNYFKNLLEGK  236

Query  546   GLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             GLL SDQ L    +A   T  +V+ YS     F+ DF  +M+++GN   ++   +G++R 
Sbjct  237   GLLSSDQILFSSDLAVNTTKKLVEAYSRSQSLFFRDFTCAMIRMGN---ISNGASGEVRT  293

Query  378   ICGSVN  361
              C  +N
Sbjct  294   NCRVIN  299



>ref|XP_004497888.1| PREDICTED: peroxidase 53-like [Cicer arietinum]
Length=329

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 213/320 (67%), Gaps = 6/320 (2%)
 Frame = -3

Query  1308  VVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFV  1129
             ++FL       +  QL+  FY  +CPN+  IV+  V  A+++DSR+ ASL RLHFHDCFV
Sbjct  10    LIFLTLTLLYPSNGQLNATFYSNTCPNVSSIVKNIVQQALQSDSRIGASLTRLHFHDCFV  69

Query  1128  NGCDGSVLLDDTKGF-KGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAA  952
             NGCD S+LLD      + EKN  PN NS RGF VID+IK+ +E +C   VSC DI+ LAA
Sbjct  70    NGCDASILLDQGGNITQSEKNAAPNFNSIRGFNVIDNIKSSLESSCSGVVSCADIVALAA  129

Query  951   SYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVL  775
               +V MSGGP W VLLGRRDGLTA++  A   +PSPFESL +IT+KFSA GLD  D+V L
Sbjct  130   ESSVSMSGGPSWNVLLGRRDGLTANQGGANTSIPSPFESLANITSKFSAVGLDTTDLVAL  189

Query  774   SGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQS  595
             SGAH+ G AQC  F +RLFN+ GSG PDPTL S++L+ LQ  CP  +G+ + L  LD  +
Sbjct  190   SGAHTFGRAQCKFFSQRLFNFSGSGSPDPTLNSTYLATLQQNCPQ-NGNGSTLNNLDPST  248

Query  594   TYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
                FDN+Y++NL+ N GLL++DQ L++     T  +V  ++     F+  FA SM+ +GN
Sbjct  249   QDTFDNNYFSNLLINMGLLQTDQELLSTNGSSTISIVNNFANNQTAFFNQFAQSMINMGN  308

Query  420   LGVLTGKDNGQIRKICGSVN  361
             +  LTG + G+IR  C  VN
Sbjct  309   ISPLTG-NQGEIRVDCKKVN  327



>ref|XP_006362277.1| PREDICTED: peroxidase 15-like [Solanum tuberosum]
Length=335

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 216/329 (66%), Gaps = 11/329 (3%)
 Frame = -3

Query  1329  VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRL  1150
             V++ I LVV L F +   + +QL+  FY  +CPN+  IVR  +  A+++D+R+ ASL+RL
Sbjct  12    VIICILLVV-LSFFSK--SNAQLNSNFYQNNCPNVSDIVRCVIQEALQSDARIGASLLRL  68

Query  1149  HFHDCFVNGCDGSVLLDDT--KGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSC  976
             HFHDCFVNGCD S+LLD+        EK+  PN NS RGF V+D+IK  VE  CP  VSC
Sbjct  69    HFHDCFVNGCDASILLDNNAKTNIVSEKDAAPNANSVRGFNVVDNIKVAVENCCPGVVSC  128

Query  975   TDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGL  799
              DIL LAA  +V ++GGP W VLLGRRD   A++  A   +PSPFES+  IT KFSA GL
Sbjct  129   ADILALAAESSVSLAGGPSWNVLLGRRDSRRANQGGANISIPSPFESINKITTKFSAVGL  188

Query  798   DLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTK  619
              + D+V LSGAH+ G AQC  F++RL+N+ G+GKPDPTL +++L+ L   CP   GSNT 
Sbjct  189   SITDLVALSGAHTFGRAQCRLFRQRLYNFNGTGKPDPTLNTNYLAKLMKICPK-KGSNTP  247

Query  618   LAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMAN---PQTADMVKYYSAYPYRFYMDF  448
             LA LD  +  +FDN+Y+ NL NN GLLESDQ L +     +  +++  +S     F+  F
Sbjct  248   LANLDLTTPNKFDNNYFANLQNNKGLLESDQKLFSKNGASEITNIINTFSRDQNVFFQSF  307

Query  447   ATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
               SM+ +GN+  LTG  NG+IR  C  VN
Sbjct  308   VESMINMGNISPLTGT-NGEIRLDCKRVN  335



>ref|XP_010493079.1| PREDICTED: peroxidase 59 [Camelina sativa]
Length=329

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 168/323 (52%), Positives = 210/323 (65%), Gaps = 15/323 (5%)
 Frame = -3

Query  1305  VFLGFLAAPM----AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             V L F A  M      +QL+   Y +SCP+L  IVR  V  A+  + RMAASLIRLHFHD
Sbjct  13    VLLTFFALCMLCSGVRAQLNPDSYAKSCPSLGQIVRDQVTIAMNAEKRMAASLIRLHFHD  72

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD S+LLD   G   EK  +PN NSARGFEV+D+IKA VE ACP  VSC DIL L
Sbjct  73    CFVNGCDASILLD---GTDSEKLAIPNLNSARGFEVVDTIKAAVENACPGVVSCADILAL  129

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V +SGGP WRV LGR+DGL A++ +   LPSPFE L  I AKF A  L++ D+V 
Sbjct  130   AARDSVSLSGGPRWRVALGRKDGLVANQNSANNLPSPFEPLDAIIAKFVAVNLNITDVVA  189

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G A+C  F  RLFN+ G+G PD TLE+S LSNLQ+ CP + G+    APLD  
Sbjct  190   LSGAHTFGQAKCGLFSNRLFNFTGTGTPDATLETSLLSNLQSVCP-LGGNGNITAPLDNG  248

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             ST  FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS   Y F+ DF  SM++
Sbjct  249   STDAFDNNYFKNLLQGKGLLSSDQILFSSDLAVNTTKKLVEAYSRNQYLFFRDFTCSMIR  308

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +GN+       +G++RK C  +N
Sbjct  309   MGNIA---NGASGEVRKNCRVIN  328



>ref|NP_568385.1| peroxidase 59 [Arabidopsis thaliana]
 sp|Q39034.2|PER59_ARATH RecName: Full=Peroxidase 59; Short=Atperox P59; AltName: Full=ATPN; 
AltName: Full=Peroxidase N; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM74498.1| AT5g19890/F28I16_40 [Arabidopsis thaliana]
 gb|AAN18151.1| At5g19890/F28I16_40 [Arabidopsis thaliana]
 gb|AED92762.1| peroxidase 59 [Arabidopsis thaliana]
Length=328

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 210/323 (65%), Gaps = 11/323 (3%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             + L VF   +      +QL    Y +SCPNL  IVR  V  A++ + RMAASLIRLHFHD
Sbjct  12    VLLTVFTLCMLCSGVRAQLSPDIYAKSCPNLVQIVRKQVAIALKAEIRMAASLIRLHFHD  71

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD S+LLD   G   EK  +PN NSARGFEVID+IKA VE ACP  VSC DILTL
Sbjct  72    CFVNGCDASLLLD---GADSEKLAIPNINSARGFEVIDTIKAAVENACPGVVSCADILTL  128

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V +SGGP WRV LGR+DGL A++ +   LPSPFE L  I AKF A  L++ D+V 
Sbjct  129   AARDSVVLSGGPGWRVALGRKDGLVANQNSANNLPSPFEPLDAIIAKFVAVNLNITDVVA  188

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G A+C  F  RLFN+ G G PD TLE+S LSNLQT CP + G++   APLD  
Sbjct  189   LSGAHTFGQAKCAVFSNRLFNFTGLGNPDATLETSLLSNLQTVCP-LGGNSNITAPLDRS  247

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             +T  FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS     F+ DF  +M++
Sbjct  248   TTDTFDNNYFKNLLEGKGLLSSDQILFSSDLAVNTTKKLVEAYSRSQSLFFRDFTCAMIR  307

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +GN   ++   +G++R  C  +N
Sbjct  308   MGN---ISNGASGEVRTNCRVIN  327



>ref|XP_009120848.1| PREDICTED: peroxidase N [Brassica rapa]
Length=328

 Score =   315 bits (807),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 165/323 (51%), Positives = 209/323 (65%), Gaps = 8/323 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             + L +F   +    A SQL    YD+SCP L  IVR  V  A++ + RMAASLIRLHFHD
Sbjct  9     VLLTIFTLCMICSGARSQLSPAIYDKSCPYLVQIVRKQVNMALKAEIRMAASLIRLHFHD  68

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD SVLLD   G   EK  + N NSARGFEV+D+IKA VE ACP  VSC DILTL
Sbjct  69    CFVNGCDASVLLD---GADSEKLSISNANSARGFEVVDTIKAAVESACPGVVSCADILTL  125

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V M+GGP WRV LGR+DGL A++ +   LPSPFE L  I AKF A GL++ D+V 
Sbjct  126   AARESVYMTGGPMWRVALGRKDGLVANQSSANNLPSPFEPLDAIIAKFQAVGLNVTDVVA  185

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+   A+C  F+ RLFN+ G G PD TLE++ LS+L+T CP + G+    APLD  
Sbjct  186   LSGAHTFRQAKCDLFRNRLFNFTGQGSPDATLETTLLSDLRTVCP-IGGNGNVTAPLDRN  244

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             ST  FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS     F+ DF  SM++
Sbjct  245   STDVFDNNYFKNLLQGKGLLSSDQILFSSDLAVNTTKRLVEAYSQSQSLFFRDFTCSMIR  304

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +G +       +G++RK C  +N
Sbjct  305   MGGIMNPINGSSGEVRKNCRVIN  327



>ref|XP_007145698.1| hypothetical protein PHAVU_007G260700g [Phaseolus vulgaris]
 gb|ESW17692.1| hypothetical protein PHAVU_007G260700g [Phaseolus vulgaris]
Length=334

 Score =   315 bits (808),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/309 (52%), Positives = 207/309 (67%), Gaps = 6/309 (2%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLD-  1099
             +E QL   FY  +C N+  IVR  V  A+ +DSR+AASLIRLHFHDCFV+GCDGS+LLD 
Sbjct  26    SEGQLSASFYSSTCSNVSSIVRDSVQQALTSDSRIAASLIRLHFHDCFVDGCDGSILLDV  85

Query  1098  DTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPY  919
             D    + EKN  PN NS RGF+V+DSIK+ +E +CP+ VSC DIL LAA  +V +SGGP 
Sbjct  86    DGNITESEKNAAPNENSVRGFDVVDSIKSTIEASCPAVVSCADILALAAEASVSLSGGPS  145

Query  918   WRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQC  742
             W VLLGR+DGLTA++  A   +PSPF+SL +IT+KFS  GLD  D+V LSGAH+ G AQC
Sbjct  146   WNVLLGRKDGLTANQAGANTSIPSPFQSLANITSKFSDVGLDTTDLVALSGAHTFGRAQC  205

Query  741   FTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTN  562
               F +RL N+ G+G PDPTL +++L  LQ  CP  +G+   L  LD  +   FDN Y+TN
Sbjct  206   QFFSQRLLNFNGTGSPDPTLNTTYLGTLQQNCPQ-NGNGATLNNLDPSTPDTFDNKYFTN  264

Query  561   LVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQ  388
             L+ N GLL++DQ L +     T  +V  ++     F+  FA SM+ +GN+  LTG   GQ
Sbjct  265   LLINQGLLQTDQELFSTDGSSTISIVNNFANNQSAFFEAFAQSMINMGNISPLTGTQ-GQ  323

Query  387   IRKICGSVN  361
             IR  C  VN
Sbjct  324   IRTDCKKVN  332



>gb|KEH41719.1| peroxidase family protein [Medicago truncatula]
Length=328

 Score =   315 bits (806),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 157/323 (49%), Positives = 211/323 (65%), Gaps = 6/323 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             I  ++F   +    +  QL+  FY  +CPN+  IV+  V  A+++DSR+ ASLIRLHFHD
Sbjct  6     IQAIIFFSLILLYPSNGQLNATFYSNTCPNVSSIVKNAVQQALQSDSRIGASLIRLHFHD  65

Query  1137  CFVNGCDGSVLLDDTKGF-KGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILT  961
             CFVNGCD S+LLD      + EKN  PN NS RGF V+D+IK+ +E +C   VSC DIL 
Sbjct  66    CFVNGCDASILLDQGGNITQSEKNAAPNFNSIRGFGVVDTIKSSLESSCSGVVSCADILA  125

Query  960   LAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDM  784
             LAA  +V ++GGP W VLLGRRDGLTA++  A   +PSPFESL ++T+KFSA  LD  DM
Sbjct  126   LAAESSVSLAGGPSWNVLLGRRDGLTANQGGANSSIPSPFESLANVTSKFSAVNLDTTDM  185

Query  783   VVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLD  604
             V LSGAH+ G AQC  F +RLFN+ G+G PDPTL +++L+ LQ  CP  +G+ + L  LD
Sbjct  186   VALSGAHTFGRAQCQFFSQRLFNFNGTGNPDPTLNTTYLATLQQNCPQ-NGNGSTLNNLD  244

Query  603   YQSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVK  430
               +   FDN+Y+TNL+   GLL++DQ L +     T  +V  ++     F+  FA SM+ 
Sbjct  245   PSTQDTFDNNYFTNLLTKMGLLQTDQHLFSTNGSSTVSIVNTFANNQTAFFNQFAQSMIN  304

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +GN+  LTG   G+IR  C  VN
Sbjct  305   MGNISPLTGTQ-GEIRIDCKKVN  326



>ref|XP_011078985.1| PREDICTED: peroxidase 15-like [Sesamum indicum]
Length=332

 Score =   315 bits (806),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 162/324 (50%), Positives = 219/324 (68%), Gaps = 9/324 (3%)
 Frame = -3

Query  1311  LVVFL--GFLAAPM-AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFH  1141
             L++F    FL  P  +++QL+  FY  +CPN+  IV   +  A+++D R+ ASLIRLHFH
Sbjct  9     LLIFTITSFLLLPRPSQAQLNSTFYSSTCPNVSNIVTTVIQQALQSDPRIGASLIRLHFH  68

Query  1140  DCFVNGCDGSVLLDDTKG-FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDIL  964
             DCFV GCDGS+LLDD  G  + EK+  PN NS RGF+V+D+IK  VE +CP  VSC DIL
Sbjct  69    DCFVQGCDGSILLDDNNGSIQSEKDAAPNTNSTRGFDVVDNIKTAVENSCPGVVSCADIL  128

Query  963   TLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKD  787
              LAA  AV ++GGP W VLLGRRD  TA++  A   +P+PFE L ++TAKFSA GL++ D
Sbjct  129   ALAAQSAVSLAGGPSWNVLLGRRDSRTANQAGANTSIPAPFEPLTNLTAKFSAVGLNVTD  188

Query  786   MVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPL  607
             +V LSGAH+ G AQC  F  RL+N+ GSG PDPTL +++L+ L+  CP  +GS   +A L
Sbjct  189   LVALSGAHTFGRAQCRLFINRLYNFSGSGGPDPTLNTTYLATLRQICPQ-NGSGFVVANL  247

Query  606   DYQSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMV  433
             D ++   FDN+YY+NL +N GLL+SDQ L ++    T  +V  +S+    F+  F  SM+
Sbjct  248   DLRTPDTFDNNYYSNLQSNEGLLQSDQELFSSSGAPTIPIVNLFSSNQSAFFESFVQSMI  307

Query  432   KLGNLGVLTGKDNGQIRKICGSVN  361
             K+GN+  LTG  NG+IR  C  VN
Sbjct  308   KMGNITPLTGS-NGEIRANCRRVN  330



>ref|XP_004251296.1| PREDICTED: peroxidase 15-like [Solanum lycopersicum]
Length=327

 Score =   314 bits (805),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 155/324 (48%), Positives = 214/324 (66%), Gaps = 5/324 (2%)
 Frame = -3

Query  1323  VAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHF  1144
             + + + + L   +     +QL   FY  +CPN+  IV+  +  A+++D+R+ ASLIRLHF
Sbjct  6     ILVVICILLSTCSFYETNAQLSANFYSTTCPNVSSIVQNVIQQALQSDARIGASLIRLHF  65

Query  1143  HDCFVNGCDGSVLLDD--TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTD  970
             HDCFVNGCD S+LLD+  T     EK+  PN NS RGF+V+D+IK  +E +CP  VSC D
Sbjct  66    HDCFVNGCDASLLLDNNATTNIVSEKDAAPNTNSTRGFDVVDNIKTALESSCPGVVSCAD  125

Query  969   ILTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDL  793
             IL LAA  +V ++GGP W VLLGRRD  TA++  A   +PSP E L +ITAKF+A GL+L
Sbjct  126   ILALAAESSVSLAGGPSWNVLLGRRDSRTANQAGANTSIPSPTEGLTNITAKFTAVGLNL  185

Query  792   KDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLA  613
              D+V LSGAH+ G AQC  F  RL+N+ G+G PDP+L +++LSNL+  CP  +GS T LA
Sbjct  186   TDLVALSGAHTFGRAQCRVFSARLYNFNGTGNPDPSLNTTYLSNLRQICPQ-NGSATALA  244

Query  612   PLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMV  433
              LD  ++  FDN+Y+ NL NN GLL+SDQ L ++  T  +V  +S+    F+  F  SM+
Sbjct  245   NLDPTTSDGFDNNYFANLQNNQGLLQSDQELFSSATTLSIVNTFSSNQNTFFQSFVQSMI  304

Query  432   KLGNLGVLTGKDNGQIRKICGSVN  361
              +GN+  LTG  NG+I   C  +N
Sbjct  305   NMGNISPLTGT-NGEIHLDCKRIN  327



>ref|XP_009409636.1| PREDICTED: peroxidase A2-like [Musa acuminata subsp. malaccensis]
Length=333

 Score =   315 bits (806),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 201/307 (65%), Gaps = 4/307 (1%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             + +QL   FYD SC N+  +VR  V  A  +D R+ ASL+RLHFHDCFVNGCDGS+LLD+
Sbjct  29    SRAQLSSTFYDSSCSNVSAVVRNVVQQAQSSDVRIVASLLRLHFHDCFVNGCDGSILLDN  88

Query  1095  TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYW  916
             +   + EK+  PN+NS RGF+V+D IK  VE  CP  VSC DIL LAA  +V ++GGP W
Sbjct  89    SDSIQSEKDAAPNKNSVRGFDVVDDIKTAVENVCPGVVSCADILALAAEASVDLAGGPTW  148

Query  915   RVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFT  736
              VLLGRRDG TA+  A   +PSPF+ L  +  KFS  GLD  D+V LSGAH+ G AQC  
Sbjct  149   GVLLGRRDGTTANPTAANNMPSPFDDLDTLKQKFSDVGLDDTDLVALSGAHTFGRAQCRF  208

Query  735   FKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLV  556
             F  RL+N+ G+G PDP+L+S++L+ LQ  CP   G +T L  LD  +   FDN Y+TNL 
Sbjct  209   FSSRLYNFSGTGSPDPSLDSTYLATLQQNCPQ-GGDDTTLNNLDLTTPNTFDNKYFTNLQ  267

Query  555   NNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIR  382
             +N GLL+SDQ L +     T  +V  ++     F+  FA+SM+ +GN+  LTG  NG+IR
Sbjct  268   SNEGLLQSDQELFSTSGASTISIVNSFAGDESTFFQSFASSMINMGNINPLTGS-NGEIR  326

Query  381   KICGSVN  361
               C  VN
Sbjct  327   SDCKKVN  333



>ref|XP_008787874.1| PREDICTED: peroxidase 15 [Phoenix dactylifera]
Length=336

 Score =   315 bits (806),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 162/338 (48%), Positives = 216/338 (64%), Gaps = 7/338 (2%)
 Frame = -3

Query  1368  LESKASFLIHKS*VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAI  1189
             L S A   +  S ++VA+++ + L    +P + +QL   FY+ +C N+  IVR  +  A 
Sbjct  2     LSSIAERRMSSSSLLVALAICLAL---LSPGSRAQLSSSFYNSTCSNVSAIVRSVIQQAQ  58

Query  1188  RNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKAD  1009
              +D R+ ASL RL FHDCFV+GCDGSVLLD +     EK  +PN NSARGF+V+D+IK  
Sbjct  59    SSDVRITASLTRLFFHDCFVDGCDGSVLLDSSSTIVSEKGAVPNNNSARGFDVVDNIKTA  118

Query  1008  VEKACPSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKD  829
             VE ACP  VSC DIL LAA  +V ++GGP W  LLGRRDG TA+      LPSPF+SL  
Sbjct  119   VENACPGVVSCADILALAAEASVNLAGGPSWSALLGRRDGTTANITGANNLPSPFDSLTT  178

Query  828   ITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTT  649
             + +KFSA GL   D+V LSGAH+ G AQC  F  RL+N+ G+G PDP+L SS+L+ LQ  
Sbjct  179   LQSKFSAVGLGDTDLVALSGAHTFGRAQCRFFSNRLYNFSGTGNPDPSLNSSYLTTLQQN  238

Query  648   CPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSA  475
             CP   G  T L  LD  +   FD++Y+TNL NN GLL+SDQ L++     TA +V  +++
Sbjct  239   CPQ-GGDGTTLNNLDPSTPNTFDSNYFTNLQNNRGLLQSDQELLSTSGASTASIVNSFAS  297

Query  474   YPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
                 F+ +F  SM+ +GN+  LTG  +GQIR  C  VN
Sbjct  298   SQSTFFQNFVQSMINMGNISPLTGS-SGQIRSNCRKVN  334



>ref|XP_004138400.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
 ref|XP_004160737.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
Length=322

 Score =   314 bits (804),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 161/304 (53%), Positives = 204/304 (67%), Gaps = 10/304 (3%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QL   FY  SCPNL   V+  V SA+ +++RM AS++RL FHDCFVNGCDGS+LLDDT  
Sbjct  27    QLSTGFYSSSCPNLLSTVKSSVRSAVSSEARMGASILRLFFHDCFVNGCDGSILLDDTSS  86

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
             F GEKN  PNRNSARGF+VID+IK  VEKACP  VSC DIL +AA  +V + GGP W V 
Sbjct  87    FTGEKNANPNRNSARGFDVIDNIKTAVEKACPGVVSCADILAIAARDSVVLLGGPSWNVK  146

Query  906   LGRRDGLTASE-EATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRD  TAS+ +A   +P P  SL  ++++FSA GL   D+V LSG H++G A+C TF+
Sbjct  147   LGRRDSTTASQSQANNDIPGPTSSLSQLSSRFSALGLSSTDLVALSGGHTIGQARCTTFR  206

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGS-NTKLAPLDYQSTYRFDNSYYTNLVN  553
              R+++   +      +ESSF    Q+ CPN  G+ +  LAPLD+  T  FDN+YY NLV 
Sbjct  207   SRIYSNSSN------IESSFARTRQSNCPNTSGTGDNNLAPLDFTPT-SFDNNYYKNLVQ  259

Query  552   NTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKIC  373
             N GLL+SDQ L     T  +V+ Y+  P RF  DFA +MVK+G++  LTG  NGQIRK C
Sbjct  260   NKGLLQSDQVLFNGGSTDSVVQNYANAPARFLSDFAAAMVKMGDIAPLTGS-NGQIRKNC  318

Query  372   GSVN  361
               VN
Sbjct  319   RMVN  322



>ref|XP_008456761.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Cucumis melo]
Length=323

 Score =   314 bits (804),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 212/325 (65%), Gaps = 11/325 (3%)
 Frame = -3

Query  1329  VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRL  1150
              ++ ++L +FL FL    A  QL   FY  SCPNL   V+  V SA+ +++RM AS++RL
Sbjct  8     TVLILTLGIFLLFLGNVSA--QLSTGFYSSSCPNLLSTVKSSVRSAVSSEARMGASILRL  65

Query  1149  HFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTD  970
              FHDCFVNGCDGS+LLDDT  F GEK+  PNRNSARGF+VID+IK  VE ACP  VSC D
Sbjct  66    XFHDCFVNGCDGSILLDDTSSFTGEKSANPNRNSARGFDVIDNIKTAVENACPGVVSCAD  125

Query  969   ILTLAASYAVGMSGGPYWRVLLGRRDGLTASE-EATKQLPSPFESLKDITAKFSAQGLDL  793
             IL +AA  +V   GGP W V LGRRD  TAS+ +A   +P P  SL  ++++FSA GL  
Sbjct  126   ILAIAARDSVVFLGGPSWNVKLGRRDSTTASQSQANNDIPGPNSSLSQLSSRFSALGLSN  185

Query  792   KDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGS-NTKL  616
              D+V LSG H++G A+C TF+ R+++   +      +ES F    Q+ CPN  GS +  L
Sbjct  186   TDLVALSGGHTIGQARCTTFRSRIYSNSSN------IESLFARTRQSNCPNTSGSGDNNL  239

Query  615   APLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSM  436
             APLD Q+   FDN+Y+ NLV N GLL+SDQ L     T  +V+ Y+  P RF  DFA +M
Sbjct  240   APLDLQTPNSFDNNYFKNLVQNKGLLQSDQVLFNGGSTDSVVRNYANAPARFLSDFAAAM  299

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             VK+G++  LTG  NGQIRK C  VN
Sbjct  300   VKMGDIAPLTGS-NGQIRKNCRRVN  323



>ref|XP_003521220.1| PREDICTED: peroxidase 15-like [Glycine max]
Length=330

 Score =   314 bits (805),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 212/322 (66%), Gaps = 7/322 (2%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             ++ + L F   P + +QL   FY  +CPN+  IVR  V  A+++D R+AASL RLHFHDC
Sbjct  10    TIFLVLTFFLYP-SNAQLSSTFYSSTCPNVSSIVRSVVQQALQSDPRIAASLTRLHFHDC  68

Query  1134  FVNGCDGSVLLDDTKGFK-GEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             FVNGCDGS+LLD        EK   PN NSARGF+V+D+IK  +E +CP  VSC DIL L
Sbjct  69    FVNGCDGSILLDVGGNITLSEKTAGPNNNSARGFDVVDNIKTSIENSCPGVVSCADILAL  128

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             AA  +V + GGP W VLLGRRDGL A++  A   +P+P ESL ++TAKF+A GL++ D+V
Sbjct  129   AAEVSVSLGGGPSWNVLLGRRDGLIANQSGANTSIPNPTESLANVTAKFAAVGLNITDLV  188

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAHS G AQC  F +RLFN+ G+G PDPTL +++L+ LQ  CP  +GS   L  LD 
Sbjct  189   ALSGAHSFGRAQCRFFNQRLFNFSGTGSPDPTLNTTYLATLQQNCPQ-NGSGNTLNNLDP  247

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKL  427
              S   FDN+Y+ NL++N GLL++DQ L +     T  +V  ++A    F+  FA SM+ +
Sbjct  248   SSPDTFDNNYFQNLLSNQGLLQTDQELFSTNGAATVSVVNNFAANQTAFFQAFAQSMINM  307

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG   G+IR  C  VN
Sbjct  308   GNISPLTGSQ-GEIRSDCKRVN  328



>emb|CAD92857.1| peroxidase [Picea abies]
Length=340

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/329 (47%), Positives = 223/329 (68%), Gaps = 6/329 (2%)
 Frame = -3

Query  1338  KS*VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASL  1159
             +S ++ A++L++++  L A      L + FY +SCP    I++  V  A++ ++R+AASL
Sbjct  15    QSVLITAVALMLWIQTLDAQSCNG-LSHHFYYKSCPKAQAIIKSMVEDAVKKEARIAASL  73

Query  1158  IRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVS  979
             +RLHFHDCFV GCD S+LLDD   F GEK  +PN+NS RGFEV+D IK+++EKACP  VS
Sbjct  74    LRLHFHDCFVKGCDASLLLDDNASFTGEKTAIPNKNSLRGFEVVDKIKSNLEKACPGVVS  133

Query  978   CTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQG  802
             C DIL +AA  +V +SGGP+W+VLLGRRD  +AS+  A + LP+P  + + +  KF  QG
Sbjct  134   CADILAVAARDSVAISGGPFWKVLLGRRDSRSASKSGANEDLPAPNSTHQTLETKFKLQG  193

Query  801   LDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNT  622
             L++ D+V LSGAH++G A+C +FK+RL+N  G+ KPD TL++++L  L+T CP     N 
Sbjct  194   LNVVDLVALSGAHTIGLARCASFKQRLYNQTGN-KPDQTLDTTYLKQLRTVCPQTGTDNN  252

Query  621   KLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANP--QTADMVKYYSAYPYRFYMDF  448
             +  P D  S  +FD +YY N+V   GLL SD+ L +    +TA  VKYY+   + F+  F
Sbjct  253   QTRPFDPVSPTKFDVNYYKNVVAGKGLLNSDEILYSTKGSRTAGFVKYYTTNTHAFFKQF  312

Query  447   ATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
             A SM+K+GN+  LTG  +G+IRK C  +N
Sbjct  313   AASMIKMGNISPLTGF-HGEIRKNCRRIN  340



>ref|XP_002873275.1| peroxidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49534.1| peroxidase [Arabidopsis lyrata subsp. lyrata]
Length=323

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/289 (52%), Positives = 200/289 (69%), Gaps = 4/289 (1%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             + +QL+  FY  +CPN   IVR  +  A+++D+R+ ASLIRLHFHDCFVNGCD S+LLDD
Sbjct  28    SSAQLNATFYSGTCPNASAIVRSTIQQALQSDARIGASLIRLHFHDCFVNGCDASILLDD  87

Query  1095  TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYW  916
             +   + EKN  PN NSARGF V+D+IK  +E ACP  VSC+D+L LA+  +V ++GGP W
Sbjct  88    SGSIQSEKNAGPNANSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSW  147

Query  915   RVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCF  739
              VLLGRRDGLTA+   A   +PSP ESL +IT+KFSA GL++ D+V LSGAH+ G A+C 
Sbjct  148   TVLLGRRDGLTANLAGANSSIPSPVESLSNITSKFSAVGLNMNDLVALSGAHTFGRARCG  207

Query  738   TFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
              F  RLFN+ G+G PDPTL S+ LS LQ  CP  +GS + +  LD  +   FDN+Y+TNL
Sbjct  208   VFNNRLFNFSGTGNPDPTLNSTLLSTLQQLCPQ-NGSVSTITNLDLSTPDAFDNNYFTNL  266

Query  558   VNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGNL  418
              +N GLL+SDQ L +     T  +V  +++    F+  FA SM+ +GN+
Sbjct  267   QSNNGLLQSDQELFSTTGSSTIAIVTSFASNQTLFFQAFAQSMINMGNI  315



>emb|CDY35842.1| BnaC09g37740D [Brassica napus]
Length=331

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 209/323 (65%), Gaps = 8/323 (2%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             + L +F   +      +QL    YD+SCP L  IVR  V  A++ + RMAASLIRLHFHD
Sbjct  12    VLLTIFTLCMLCSGVRAQLSPGIYDKSCPYLVQIVRKQVTMALKAEIRMAASLIRLHFHD  71

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCD SVLLD   G   EK  +PN NSARGFEV+D+IK  VE ACP  VSC DILTL
Sbjct  72    CFVNGCDASVLLD---GADSEKLSIPNANSARGFEVVDTIKDAVENACPGVVSCADILTL  128

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             AA  +V ++GGP WRV LGR+DGL A++ +   LPSPFE L  I AKF A GL++ D+V 
Sbjct  129   AARESVYLTGGPMWRVALGRKDGLVANQSSANNLPSPFEPLDAIIAKFQAVGLNVTDVVA  188

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH+ G A+C  F+ RLFN+ G G PD TLE++ LS+L+T CP + G+    APLD  
Sbjct  189   LSGAHTFGQAKCDLFRNRLFNFTGQGSPDATLETTLLSDLRTVCP-IGGNGNVTAPLDRN  247

Query  597   STYRFDNSYYTNLVNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             ST  FDN+Y+ NL+   GLL SDQ L    +A   T  +V+ YS     F+ DF  SM++
Sbjct  248   STDVFDNNYFKNLLQGKGLLSSDQILFSSDLAVNTTKRLVEAYSQSQSLFFRDFTCSMIR  307

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +G +       +G++RK C  +N
Sbjct  308   MGGIMNPANGSSGEVRKNCRVIN  330



>gb|KHN07440.1| Peroxidase 15 [Glycine soja]
Length=330

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 212/322 (66%), Gaps = 7/322 (2%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             ++ + L F   P + +QL   FY  +CPN+  IVR  V  A+++D R+AASL RLHFHDC
Sbjct  10    TIFLVLTFFLYP-SNAQLSSTFYSSTCPNVSSIVRSVVQQALQSDPRIAASLTRLHFHDC  68

Query  1134  FVNGCDGSVLLDDTKGFK-GEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             FVNGCDGS+LLD        EK   PN NSARGF+V+D+IK  +E +CP  VSC DIL L
Sbjct  69    FVNGCDGSILLDVGGNITLSEKTAGPNNNSARGFDVVDNIKTSIENSCPGVVSCADILAL  128

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             AA  +V + GGP W VLLGRRDGL A++  A   +P+P ESL ++TAKF+A GL++ D+V
Sbjct  129   AAEVSVSLGGGPSWNVLLGRRDGLIANQSGANTSIPNPTESLANVTAKFAAVGLNITDLV  188

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAHS G AQC  F +RLFN+ G+G PDPTL +++L+ LQ  CP  +GS   L  LD 
Sbjct  189   ALSGAHSFGRAQCRFFNQRLFNFSGTGSPDPTLNATYLATLQQNCPQ-NGSGNTLNNLDP  247

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKL  427
              S   FDN+Y+ NL++N GLL++DQ L +     T  +V  ++A    F+  FA SM+ +
Sbjct  248   SSPDTFDNNYFQNLLSNQGLLQTDQELFSTNGAATVSVVNNFAANQTAFFQAFAQSMINM  307

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  LTG   G+IR  C  VN
Sbjct  308   GNISPLTGSQ-GEIRSDCKRVN  328



>gb|ABG46370.1| rubber peroxidase 1 [Hevea brasiliensis]
Length=346

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/340 (47%), Positives = 223/340 (66%), Gaps = 6/340 (2%)
 Frame = -3

Query  1329  VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRL  1150
             ++VAI+L   L   + P+A +QL   FYDQSCPN+  I+R  +  ++++DSR+ ASLIRL
Sbjct  7     MLVAIALYAILVGSSRPLAYAQLSPTFYDQSCPNVSNIIRGVIQESLQSDSRIGASLIRL  66

Query  1149  HFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTD  970
             HFHDCFVNGCD S+LLD+T   + EK    N NSARGF+V+D++KA +E ACP  VSC D
Sbjct  67    HFHDCFVNGCDASILLDNTDTIESEKQAAANNNSARGFDVVDTMKARLESACPGIVSCAD  126

Query  969   ILTLAASYAVGMSGGPYWRVLLGRRDGLTASE-EATKQLPSPFESLKDITAKFSAQGLDL  793
             ILT++A  +V ++GGP W  LLGRRD LTAS  +A   +P PFE+L  + +KF+A GL+ 
Sbjct  127   ILTVSAQQSVDLAGGPTWTNLLGRRDSLTASRSQANLSIPGPFETLDQLKSKFTAVGLNN  186

Query  792   K-DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKL  616
               D+V LSGAH+ G AQC TF  RL+N+  +  PDPTL +++L  LQ  CP   G+ + +
Sbjct  187   NTDLVALSGAHTFGRAQCRTFSPRLYNFNNTNSPDPTLNTTYLQTLQQICPQ-GGNGSVI  245

Query  615   APLDYQSTYRFDNSYYTNLVNNTGLLESDQALM--ANPQTADMVKYYSAYPYRFYMDFAT  442
               LD  ++  FDN Y++NL+   GLL+SDQ L       T  +V+ +SA    F+  F  
Sbjct  246   TNLDLTTSDTFDNEYFSNLLVGEGLLQSDQELFNTTGADTVAIVQNFSANQTAFFESFVE  305

Query  441   SMVKLGNLGVLTGKDNGQIRKICGSVN*GYGSLKQLLLLS  322
             SM+++GNL VLTG   G+IR  C  VN    +  + LL+S
Sbjct  306   SMLRMGNLSVLTGTI-GEIRLNCSKVNGNSSAGAETLLVS  344



>ref|XP_004249178.1| PREDICTED: peroxidase A2 [Solanum lycopersicum]
Length=338

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 213/329 (65%), Gaps = 11/329 (3%)
 Frame = -3

Query  1329  VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRL  1150
             V++ I LVV   F     + +QL+  FY+ +CPN+  IVR  +  A+++D+R+ ASL+R+
Sbjct  15    VIICILLVVLSIF---SHSNAQLNSNFYENNCPNVSDIVRCVLQEALQSDARIGASLLRI  71

Query  1149  HFHDCFVNGCDGSVLLDDTKGFK--GEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSC  976
             HFHDCFVNGCD S+LLD+    K   EKN  PN NS RGF V+D+IK  VE  CP  VSC
Sbjct  72    HFHDCFVNGCDASILLDNNAKTKIVSEKNAAPNANSLRGFNVVDNIKVAVENCCPGVVSC  131

Query  975   TDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGL  799
              DIL LAA  +V ++GGP W VLLGRRD   A++  A   +PSP E +  IT KFSA GL
Sbjct  132   ADILALAAESSVSLAGGPSWNVLLGRRDSRRANQGGANISIPSPLEDINKITTKFSAVGL  191

Query  798   DLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTK  619
              + D+V LSGAH+ G AQC  F+ RL+N+ G+GKPDPTL +++L+ L   CP   GSNT 
Sbjct  192   TITDLVALSGAHTFGRAQCRLFRERLYNFNGTGKPDPTLNTNYLAKLMKICPK-KGSNTA  250

Query  618   LAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMAN---PQTADMVKYYSAYPYRFYMDF  448
             LA LD  +  +FDN+Y+ NL N  GLLESDQ L +     +  +++K +S     F+  F
Sbjct  251   LANLDLTTPNKFDNNYFANLQNKKGLLESDQKLFSKNSASEITNIIKTFSRDQNVFFQSF  310

Query  447   ATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
               SM+ +GN+  LTG  NG+IR  C  VN
Sbjct  311   VESMINMGNISPLTGT-NGEIRLDCKRVN  338



>gb|KDO70903.1| hypothetical protein CISIN_1g019976mg [Citrus sinensis]
Length=333

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/310 (51%), Positives = 210/310 (68%), Gaps = 7/310 (2%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             +++QL+  FY  +CPN+  IVR  +  A+++D R+ ASLIRLHFHDCFVNGCDGSVLLD 
Sbjct  24    SQAQLNSSFYATTCPNVTTIVRNALQQAMQSDIRIGASLIRLHFHDCFVNGCDGSVLLDR  83

Query  1095  TKGF-KGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPY  919
                  + EK+G PN NSARGF V+D+IK  VE +CP  VSC DIL LAA  +V ++GGP 
Sbjct  84    GGNITQSEKDGGPNTNSARGFGVVDNIKTAVENSCPGVVSCADILALAAESSVSLAGGPS  143

Query  918   WRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQC  742
             W VLLGRRDGL A++  A   +P+P +SL ++T+KFSA GLD  D+V LSGAH+ G AQC
Sbjct  144   WNVLLGRRDGLRANQSGANSSIPAPIDSLSNLTSKFSAVGLDTTDLVALSGAHTFGRAQC  203

Query  741   FTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTN  562
               F  RL+N+ G+G PDPT+  ++L+ L+  CP  +G+ + LA LD  +   FDN+YYTN
Sbjct  204   RVFSGRLYNFNGTGNPDPTVNGTYLTTLRQICPQ-NGNGSALANLDPTTADTFDNNYYTN  262

Query  561   LVNNTGLLESDQALMANPQTADMVKY---YSAYPYRFYMDFATSMVKLGNLGVLTGKDNG  391
             L NN GLL+SDQ L +    A +V     +++    F+  F  SM+ +GN+  LTG  NG
Sbjct  263   LQNNQGLLQSDQELFSTNGPAAIVAIVNNFASNQTAFFQQFVQSMINMGNISPLTGS-NG  321

Query  390   QIRKICGSVN  361
             +IR  C  VN
Sbjct  322   EIRADCKKVN  331



>ref|XP_008361464.1| PREDICTED: peroxidase N-like [Malus domestica]
Length=332

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 217/325 (67%), Gaps = 13/325 (4%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             SL +   F    + ++QL   FY  +CP++  IVR  V +A++++ RMAASL+RLHFHDC
Sbjct  13    SLAMITFFALCFVXKAQLSTDFYKATCPDVLKIVRREVLNAVKSEMRMAASLLRLHFHDC  72

Query  1134  FVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLA  955
             FVNGCD S+LLD   G   EKN  PN NSARGFEV+D IK+ VE +C   VSC DIL +A
Sbjct  73    FVNGCDASLLLD---GTDSEKNARPNLNSARGFEVVDRIKSSVESSCSGVVSCADILAIA  129

Query  954   ASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             A  +V +SGG  W+VLLGRRDGL A++  A   LP+P E+L  I +KF+A GL++ D+V 
Sbjct  130   ARDSVLLSGGTSWKVLLGRRDGLVANQSGANSGLPAPTEALDIIISKFAAVGLNITDVVS  189

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNV-DGSNTKLAPLDY  601
             LSGAH++G A+C TF  RLFN+ G+G PD TLE S L++LQ  CP   DG+NT  APLD 
Sbjct  190   LSGAHTIGLARCATFSNRLFNFSGTGAPDSTLEQSMLTDLQNQCPQTSDGNNT--APLDR  247

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQ-----TADMVKYYSAYPYRFYMDFATSM  436
              ST  FDN Y+ NL+N  GLL SDQ L ++       T  +V+ Y++    F  DFA SM
Sbjct  248   NSTDLFDNHYFQNLINGKGLLGSDQILFSSDAAVTTGTKSLVQSYNSNLNLFLADFANSM  307

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             +K+GN+  LTG   G+IR  C +VN
Sbjct  308   IKMGNISPLTGSA-GEIRLNCRAVN  331



>ref|XP_011039460.1| PREDICTED: peroxidase A2-like [Populus euphratica]
Length=331

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 164/319 (51%), Positives = 212/319 (66%), Gaps = 6/319 (2%)
 Frame = -3

Query  1308  VVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFV  1129
             +V LG +  P +++QL+  FY  +CPN+  IV   V  A ++DSR+ ASLIRLHFHDCFV
Sbjct  14    IVLLGMML-PQSKAQLNTTFYANTCPNVSSIVSNVVQQAFQSDSRIGASLIRLHFHDCFV  72

Query  1128  NGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAAS  949
             NGCD S+LLD++     EK   PN NS RGF V+D+IK  VE +CP  VSC DIL LAA 
Sbjct  73    NGCDASILLDNSSSILSEKFAAPNVNSTRGFGVVDNIKTAVENSCPGVVSCADILALAAE  132

Query  948   YAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLS  772
              +V  SGGP W VLLGRRD LTA++  A   +PSPFE L +ITAKFSA GL+  D+V LS
Sbjct  133   SSVSQSGGPSWSVLLGRRDSLTANQAGANTSIPSPFEGLNNITAKFSAVGLNTNDLVALS  192

Query  771   GAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQST  592
             GAH+ G AQC TF  RL+N+  +G PD TL +++L+ LQ  CP  +GS T LA LD  ++
Sbjct  193   GAHTFGRAQCRTFSNRLYNFSNTGNPDSTLNTTYLTTLQQICPQ-NGSGTALANLDPTTS  251

Query  591   YRFDNSYYTNLVNNTGLLESDQALMANPQTA--DMVKYYSAYPYRFYMDFATSMVKLGNL  418
               FDN+Y+TNL NN GLL+SDQ L +   +A   +V  +S+    F+  F  SM+ +GN+
Sbjct  252   DAFDNNYFTNLQNNQGLLQSDQELFSTSGSATITLVNNFSSNQTAFFQSFVQSMINMGNI  311

Query  417   GVLTGKDNGQIRKICGSVN  361
               LTG   G+IR  C  VN
Sbjct  312   SPLTGSS-GEIRSDCKKVN  329



>ref|XP_003625275.1| Peroxidase [Medicago truncatula]
 gb|AES81493.1| peroxidase family protein [Medicago truncatula]
Length=373

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 208/322 (65%), Gaps = 6/322 (2%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             S+   L FL    + +QL   FY  +CP++  IVR  V  A++ND R+ ASL RLHFHDC
Sbjct  52    SIFTVLIFLLLNPSHAQLTSTFYSNTCPSVSSIVRNVVQQALQNDPRITASLTRLHFHDC  111

Query  1134  FVNGCDGSVLLDDTKGFK-GEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             FVNGCD S+LLD        EKN +PN NSARGF+V+D IK  VE +CPS VSC DIL L
Sbjct  112   FVNGCDASLLLDQGGNITLSEKNAVPNNNSARGFDVVDKIKTSVENSCPSVVSCADILAL  171

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             AA  +V +SGGP W VLLGRRDGL A++  A   +P+P ESL ++TAKF+A GL+  D+V
Sbjct  172   AAEASVSLSGGPSWNVLLGRRDGLIANQSGANTSIPNPTESLANVTAKFAAVGLNTSDLV  231

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH+ G  QC  F +RLFN+ G+GKPDPTL S++L+ LQ  CP  +GS   L  LD 
Sbjct  232   ALSGAHTFGRGQCRFFNQRLFNFSGTGKPDPTLNSTYLATLQQNCPQ-NGSGNTLNNLDP  290

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKL  427
              S   FDN+Y+ NL+ N GLL++DQ L +     T  +V  +++    F+  F  SM+ +
Sbjct  291   SSPNNFDNNYFKNLLKNQGLLQTDQELFSTNGAATISIVNNFASNQTAFFEAFVQSMINM  350

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             GN+  L G   G+IR  C  VN
Sbjct  351   GNISPLIGSQ-GEIRSDCKKVN  371



>ref|XP_003602463.1| Peroxidase [Medicago truncatula]
 gb|AES72714.1| horseradish peroxidase-like protein [Medicago truncatula]
Length=322

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 165/320 (52%), Positives = 212/320 (66%), Gaps = 12/320 (4%)
 Frame = -3

Query  1326  MVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLH  1147
             +  ISLV+F+  + +  A +QL   FY  SCP L   V+  V SAI N++RM AS++RL 
Sbjct  9     LTMISLVLFVLIIGS--ANAQLSTSFYSSSCPKLSSTVQSTVQSAISNEARMGASILRLF  66

Query  1146  FHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             FHDCFVNGCDGS+LLDDT  F GEKN  PNRNSARGF+VID+IK  VE  CP  VSC DI
Sbjct  67    FHDCFVNGCDGSILLDDTSNFTGEKNANPNRNSARGFDVIDNIKTAVENVCPGVVSCADI  126

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQ-LPSPFESLKDITAKFSAQGLDLK  790
             L +AA+ +V + GGP W V LGRRD  TAS+ A    +P+P  +L  +T+ FSA GL  K
Sbjct  127   LAIAAADSVAILGGPTWNVKLGRRDAKTASQSAANTAIPAPTSNLNTLTSMFSAVGLSSK  186

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGS-NTKLA  613
             D+V LSGAH++G A+C TF+ R++N       +  +++SF S  Q+ CPN  GS +  LA
Sbjct  187   DLVTLSGAHTIGQARCTTFRARIYN-------ETNIDTSFASTRQSNCPNTSGSGDNNLA  239

Query  612   PLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMV  433
             PLD Q+   FDN+Y+ NLV N GLL SDQ L     T  +V  YS  P  F  DFAT+M+
Sbjct  240   PLDLQTPTSFDNNYFKNLVQNKGLLHSDQQLFNGGSTNSIVSGYSTNPSSFSSDFATAMI  299

Query  432   KLGNLGVLTGKDNGQIRKIC  373
             K+G++  LTG  NG+IRK C
Sbjct  300   KMGDISPLTGS-NGEIRKNC  318



>gb|EAY77487.1| hypothetical protein OsI_32530 [Oryza sativa Indica Group]
Length=326

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 170/327 (52%), Positives = 215/327 (66%), Gaps = 15/327 (5%)
 Frame = -3

Query  1326  MVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLH  1147
             M+  S++V    L    A  QL   FYD  CP++  +V+  V++A+R + RM ASL+RLH
Sbjct  10    MLVCSVLVLC--LNTRGARCQLSDDFYDYICPDVYTVVQQHVYAAMRTEMRMGASLLRLH  67

Query  1146  FHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             FHDCFVNGCDGS+LLD   G  GEK  LPN+NS RGFEVID+IK D+E  CP  VSC DI
Sbjct  68    FHDCFVNGCDGSILLD---GDDGEKFALPNKNSVRGFEVIDAIKEDLENICPEVVSCADI  124

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLK  790
             + LAA Y V  SGGPY+ VLLGRRDGL A++  A   LPSPFE +K I  KF+  GLD  
Sbjct  125   VALAAGYGVLFSGGPYYDVLLGRRDGLVANQSGADNGLPSPFEPIKSIIQKFNDVGLDTT  184

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             D+VVLSG H++G A+C  F  RL     S   DPTL+++  +NLQ+ C   DG+ T +  
Sbjct  185   DVVVLSGGHTIGRARCTLFSNRL--STTSSSADPTLDATMAANLQSLCAGGDGNETTV--  240

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALMAN----PQTADMVKYYSAYPYRFYMDFAT  442
             LD  S Y FDN YY NL+N  GLL SDQ L ++      T ++V+ YSA  ++F+ DF  
Sbjct  241   LDITSAYVFDNRYYQNLLNQKGLLSSDQGLFSSDDGIANTKELVETYSANAHKFFWDFGR  300

Query  441   SMVKLGNLGVLTGKDNGQIRKICGSVN  361
             SMVK+GN+  LTG D+GQIRK C  VN
Sbjct  301   SMVKMGNISPLTG-DDGQIRKNCRVVN  326



>ref|XP_009759099.1| PREDICTED: peroxidase N [Nicotiana sylvestris]
Length=332

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 169/320 (53%), Positives = 214/320 (67%), Gaps = 11/320 (3%)
 Frame = -3

Query  1299  LGFLAAPMA-ESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNG  1123
             L FL   +A +SQL   FY ++CPN+  +VR  V +AI+N+ RMAASL+RLHFHDCFV+G
Sbjct  14    LTFLILFIAVDSQLTTDFYSKTCPNVLKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVSG  73

Query  1122  CDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYA  943
             CD S+LLD       EK    N NSARGFEVID+IK  VE AC   VSC DIL +AA  +
Sbjct  74    CDASLLLDGNST-TSEKFTPANLNSARGFEVIDNIKTAVENACSGVVSCADILAIAARDS  132

Query  942   VGMSGGPYWRVLLGRRDGLTASEEATKQ-LPSPFESLKDITAKFSAQGLDLKDMVVLSGA  766
             V +SGGP+W+VLLGRRDGL A+   +   LP+PF+ L  I +KF A GL++ D+V LSGA
Sbjct  133   VLLSGGPFWKVLLGRRDGLAANFSGSNTALPAPFDPLNTIISKFDAVGLNVTDVVSLSGA  192

Query  765   HSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCP-NVDGSNTKLAPLDYQSTY  589
             H++G A+C TF  RL N+ G+G PDPTL+++ +S LQ  CP   DG+NT  APLD  ST 
Sbjct  193   HTIGLAKCATFDNRLRNFSGTGAPDPTLDTTLVSELQNLCPLTSDGNNT--APLDRNSTD  250

Query  588   RFDNSYYTNLVNNTGLLESDQALM----ANPQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
              FDN Y+ NL+N  GLLESDQ L     A   T  +V+ YS     F+ DF  SM+K+GN
Sbjct  251   LFDNHYFKNLINGRGLLESDQVLFSSDDAIQTTKTLVETYSNSSKFFFSDFVNSMIKMGN  310

Query  420   LGVLTGKDNGQIRKICGSVN  361
             +  L G D G+IRK C  VN
Sbjct  311   ISPLVGSD-GEIRKNCRVVN  329



>ref|XP_006353885.1| PREDICTED: peroxidase 52-like [Solanum tuberosum]
Length=319

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 160/318 (50%), Positives = 206/318 (65%), Gaps = 12/318 (4%)
 Frame = -3

Query  1311  LVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCF  1132
             L V LGF+    + +QL   FY  SC NL  IVR G+  A++ ++R+ AS++RL FHDCF
Sbjct  13    LCVLLGFVC--FSNAQLSDNFYGTSCRNLQTIVRNGMIQAVKREARLGASILRLFFHDCF  70

Query  1131  VNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAA  952
             VNGCD S+LLDDT  F GEKN  PNRNSARG+EVID+IKA VE ACP+ VSC DIL LAA
Sbjct  71    VNGCDASILLDDTSTFTGEKNANPNRNSARGYEVIDTIKAQVESACPNVVSCADILALAA  130

Query  951   SYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVL  775
                  + GGP W V LGRRD  TAS+ A   Q+P+PF SL  + + FSA+GL+ +DM  L
Sbjct  131   RQGTVLLGGPSWAVPLGRRDARTASQSAANTQIPAPFSSLSTLLSMFSAKGLNARDMTAL  190

Query  774   SGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQS  595
             SG+H++G A+C TF+ R++N       D  +++ F +  + TCP   G +  LAPLD Q+
Sbjct  191   SGSHTIGQARCTTFRNRIYN-------DTNIDTQFAATRRATCP-ASGGDANLAPLDIQT  242

Query  594   TYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLG  415
               RFDN YY NLV   GLL SDQ L        +V+ YS     F  DFA +MVK+GN+ 
Sbjct  243   PNRFDNDYYQNLVVRRGLLHSDQELFNGGSQDALVRSYSNNVASFRSDFAAAMVKMGNIS  302

Query  414   VLTGKDNGQIRKICGSVN  361
              LTG  NG+IR  C ++N
Sbjct  303   PLTGT-NGEIRTNCRAIN  319



>ref|XP_009620838.1| PREDICTED: peroxidase N [Nicotiana tomentosiformis]
Length=332

 Score =   312 bits (800),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 215/323 (67%), Gaps = 13/323 (4%)
 Frame = -3

Query  1311  LVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCF  1132
             L++ + F+A     SQL   FY ++CPN+  +VR  V +AI+N+ RMAASL+RLHFHDCF
Sbjct  14    LILLILFVAV---NSQLTTDFYSKTCPNVLKVVRKEVQNAIKNEMRMAASLLRLHFHDCF  70

Query  1131  VNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAA  952
             V+GCD SVLLD       EK    N NSARGFEVID+IK  VE AC   VSC DIL +AA
Sbjct  71    VSGCDASVLLDGNST-TSEKFTPANLNSARGFEVIDNIKTAVENACGGVVSCADILAIAA  129

Query  951   SYAVGMSGGPYWRVLLGRRDGLTASEEATKQ-LPSPFESLKDITAKFSAQGLDLKDMVVL  775
               +V +SGGP+W+VLLGRRDGL A+   +   LP+PF+ L  I +KF A GL++ D+V L
Sbjct  130   RDSVLLSGGPFWKVLLGRRDGLAANISGSNTALPAPFDPLNTIISKFEAVGLNVTDVVSL  189

Query  774   SGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCP-NVDGSNTKLAPLDYQ  598
             SGAH++G A+C TF  RL N+ G+G PD TL+++ +S LQ  CP   DG+NT  APLD  
Sbjct  190   SGAHTIGLAKCATFDNRLRNFSGTGAPDTTLDTTLVSELQNLCPLTSDGNNT--APLDRN  247

Query  597   STYRFDNSYYTNLVNNTGLLESDQALMAN----PQTADMVKYYSAYPYRFYMDFATSMVK  430
             ST  FDN Y+ NL+N  GLLESDQ L ++      T  +V+ YS     F+ DF  SM+K
Sbjct  248   STDLFDNHYFKNLINGRGLLESDQVLFSSDDAIQTTKTLVETYSNSSQFFFSDFVNSMIK  307

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +GN+  L G D G+IRK C  VN
Sbjct  308   MGNISPLVGSD-GEIRKNCRVVN  329



>ref|XP_006363346.1| PREDICTED: peroxidase 15-like [Solanum tuberosum]
Length=326

 Score =   312 bits (800),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/307 (50%), Positives = 207/307 (67%), Gaps = 5/307 (2%)
 Frame = -3

Query  1272  ESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD-  1096
              +QL   FY  +CPN+  IV+  +  A+++D+R+ ASLIRLHFHDCFVNGCD S+LLD+ 
Sbjct  22    NAQLSANFYSTTCPNVSSIVQNVIQQALQSDARIGASLIRLHFHDCFVNGCDASLLLDNN  81

Query  1095  -TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPY  919
              T     EK+  PN NS RGF+V+D+IK  +E +CP  VSC DIL LAA  +V  +GGP 
Sbjct  82    ATTNIVSEKDAAPNTNSTRGFDVVDNIKTALETSCPGVVSCADILALAAESSVSQAGGPS  141

Query  918   WRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQC  742
             W VLLGRRD  TA++  A   +PSP E L +ITAKF+A GL++ D+V LSGAH+ G AQC
Sbjct  142   WNVLLGRRDSRTANQAGANTSIPSPTEGLTNITAKFTAVGLNITDLVALSGAHTFGRAQC  201

Query  741   FTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTN  562
               F  RL+N+ G+G PDP+L +++L+NL+  CP  +GS T LA LD  ++  FDN+YY N
Sbjct  202   RVFSARLYNFNGTGNPDPSLNTTYLANLRQICPQ-NGSATALANLDPTTSDGFDNNYYAN  260

Query  561   LVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIR  382
             L NN GLL+SDQ L ++  T  +V  +S+    F+  F  SM+ +GN+  LTG  NG+I 
Sbjct  261   LQNNQGLLQSDQELFSSGTTLSIVNTFSSNQNTFFQSFVQSMINMGNISPLTGT-NGEIH  319

Query  381   KICGSVN  361
               C  +N
Sbjct  320   SDCKRIN  326



>ref|NP_001064031.1| Os10g0109600 [Oryza sativa Japonica Group]
 gb|AAM08519.1|AC068654_21 Putative peroxidase [Oryza sativa Japonica Group]
 gb|AAP51824.1| Peroxidase N precursor, putative, expressed [Oryza sativa Japonica 
Group]
 tpe|CAH69368.1| TPA: class III peroxidase 126 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF25945.1| Os10g0109600 [Oryza sativa Japonica Group]
 gb|EAZ15083.1| hypothetical protein OsJ_30495 [Oryza sativa Japonica Group]
 dbj|BAG87793.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94135.1| unnamed protein product [Oryza sativa Japonica Group]
 prf||2114377A peroxidase:ISOTYPE=RPA
Length=326

 Score =   312 bits (800),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 170/327 (52%), Positives = 215/327 (66%), Gaps = 15/327 (5%)
 Frame = -3

Query  1326  MVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLH  1147
             M+  S++V    L    A  QL   FYD  CP++  +V+  V++A+R + RM ASL+RLH
Sbjct  10    MLVCSVLVLC--LNTRGARCQLSDDFYDYICPDVYTVVQQHVYAAMRTEMRMGASLLRLH  67

Query  1146  FHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             FHDCFVNGCDGS+LLD   G  GEK  LPN+NS RGFEVID+IK D+E  CP  VSC DI
Sbjct  68    FHDCFVNGCDGSILLD---GDDGEKFALPNKNSVRGFEVIDAIKEDLENICPEVVSCADI  124

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLK  790
             + LAA Y V  SGGPY+ VLLGRRDGL A++  A   LPSPFE +K I  KF+  GLD  
Sbjct  125   VALAAGYGVLFSGGPYYDVLLGRRDGLVANQSGADNGLPSPFEPIKSIIQKFNDVGLDTT  184

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             D+VVLSG H++G A+C  F  RL     S   DPTL+++  +NLQ+ C   DG+ T +  
Sbjct  185   DVVVLSGGHTIGRARCTLFSNRL--STTSSSADPTLDATMAANLQSLCAGGDGNETTV--  240

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALMAN----PQTADMVKYYSAYPYRFYMDFAT  442
             LD  S Y FDN YY NL+N  GLL SDQ L ++      T ++V+ YSA  ++F+ DF  
Sbjct  241   LDITSAYVFDNRYYQNLLNQKGLLSSDQGLFSSDDGIANTKELVETYSADAHKFFWDFGR  300

Query  441   SMVKLGNLGVLTGKDNGQIRKICGSVN  361
             SMVK+GN+  LTG D+GQIRK C  VN
Sbjct  301   SMVKMGNISPLTG-DDGQIRKNCRVVN  326



>gb|ABW82528.1| class III peroxidase [Gossypium hirsutum]
Length=330

 Score =   312 bits (800),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 172/336 (51%), Positives = 214/336 (64%), Gaps = 9/336 (3%)
 Frame = -3

Query  1362  SKASFLIHKS*VMVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRN  1183
             +K S L+    VMV+I++   +           L    Y  SCP  + I+   V +A+  
Sbjct  2     AKCSVLLFLCLVMVSINVANTMNETCVDDISIVLQIDLYKNSCPEAESIIYSWVENAVSQ  61

Query  1182  DSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVE  1003
             DSRMAASL+RLHFHDCFVNGCDGSVLLDDT+ F GEK  LPN NS RGFEVID+IK+++E
Sbjct  62    DSRMAASLLRLHFHDCFVNGCDGSVLLDDTEDFTGEKTALPNLNSLRGFEVIDAIKSELE  121

Query  1002  KACPSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDI  826
               CP TVSC DIL  AA  +V +SGGP W V +GR+D L AS+E AT  +P P  ++  +
Sbjct  122   SVCPQTVSCADILATAARDSVVISGGPSWEVEMGRKDSLGASKEAATNNIPGPNSTVPML  181

Query  825   TAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTC  646
              AKF   GL   DM+ LSGAH++G A+C TF  RL   QGS  PD  L+  FL NLQ  C
Sbjct  182   VAKFQNVGLSFNDMIALSGAHTLGMARCSTFSSRL---QGSNGPDINLD--FLQNLQQLC  236

Query  645   PNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANP-QTADMVKYYSAYP  469
                DG N++LA LD  S   FDN YY NL++  GLL SDQAL+ +  QT  +V  Y+  P
Sbjct  237   SQTDG-NSRLARLDLVSPATFDNQYYINLLSGEGLLPSDQALVTDDYQTRQLVLSYAEDP  295

Query  468   YRFYMDFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
               F+ DF  SM+K+G+LGVLTG D GQIR  C  VN
Sbjct  296   LAFFEDFKNSMLKMGSLGVLTGTD-GQIRGNCRVVN  330



>ref|XP_006492847.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 53-like [Citrus sinensis]
Length=333

 Score =   312 bits (800),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 157/310 (51%), Positives = 209/310 (67%), Gaps = 7/310 (2%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             +++QL+  FY  +CPN+  IVR  +  A+ +D R+ ASLIRLHFHDCFVNGCDGSVLLD 
Sbjct  24    SQAQLNSSFYATTCPNVTTIVRNALQQAMXSDIRIGASLIRLHFHDCFVNGCDGSVLLDR  83

Query  1095  TKGF-KGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPY  919
                  + EK+G PN NSARGF V+D+IK  VE +CP  VSC DIL LAA  +V ++GGP 
Sbjct  84    GGNITQSEKDGGPNTNSARGFGVVDNIKTAVENSCPGVVSCADILALAAESSVSLAGGPS  143

Query  918   WRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQC  742
             W VLLGRRDGL A++  A   +P+P +SL ++T+KFSA GLD  D+V LSGAH+ G AQC
Sbjct  144   WNVLLGRRDGLRANQSGANSSIPAPIDSLSNLTSKFSAVGLDTTDLVALSGAHTFGRAQC  203

Query  741   FTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTN  562
               F  RL+N+ G+G PDPT+  ++L+ L+  CP  +G+ + LA LD  +   FDN+YYTN
Sbjct  204   RVFSGRLYNFNGTGNPDPTVNGTYLTTLRQICPQ-NGNGSALANLDPTTADTFDNNYYTN  262

Query  561   LVNNTGLLESDQALMANPQTADMVKY---YSAYPYRFYMDFATSMVKLGNLGVLTGKDNG  391
             L NN GLL+SDQ L +    A +V     +++    F+  F  SM+ +GN+  LTG  NG
Sbjct  263   LQNNQGLLQSDQELFSTNGPAAIVAIVNNFASNQTAFFQQFVQSMINMGNISPLTGS-NG  321

Query  390   QIRKICGSVN  361
             +IR  C  VN
Sbjct  322   EIRADCKKVN  331



>dbj|BAJ93823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=334

 Score =   312 bits (800),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 209/307 (68%), Gaps = 7/307 (2%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QL+  +YD+SCP++   VR  V  A   D R+ ASL+RL FHDCFVNGCDGS+LLDD   
Sbjct  28    QLNPAYYDESCPHVYDTVRRVVQEARTADPRILASLVRLQFHDCFVNGCDGSLLLDDGPA  87

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
                EK   PN NSARGF V+D IKA +E ACP TVSC DI+ LAA  +V ++GGPYWRVL
Sbjct  88    VNSEKKAAPNSNSARGFPVVDGIKAALESACPGTVSCADIVALAAEVSVELAGGPYWRVL  147

Query  906   LGRRDGLTASEEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKR  727
             LGRRDG+TA+ +A   LP P ++L  +  KF+  GLD  D V L GAH++G +QC  F+ 
Sbjct  148   LGRRDGMTANFDAADNLPGPTDALNVLRQKFAGLGLDDTDFVALQGAHTIGRSQCRFFQD  207

Query  726   RLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNT  547
             RL N+ G+G+PDPTL+ ++LS LQ +CP   G++ +L  LD  +   FDNSYY NL+ N 
Sbjct  208   RLNNFAGTGQPDPTLDGAYLSALQQSCPAA-GADMRLNNLDPATPDAFDNSYYHNLLRNR  266

Query  546   GLLESDQALMANPQ-----TADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIR  382
             GLL SDQ +++ P+     TA +V+ ++A    F+  FAT+M+K+GN+  LTG + G++R
Sbjct  267   GLLRSDQVMLSAPEGAATSTAPIVERFAASQADFFRSFATAMIKMGNIAPLTG-NMGEVR  325

Query  381   KICGSVN  361
             + C  VN
Sbjct  326   RNCRVVN  332



>ref|XP_002320417.1| peroxidase family protein [Populus trichocarpa]
 gb|EEE98732.1| peroxidase family protein [Populus trichocarpa]
 gb|AHL39181.1| class III peroxidase [Populus trichocarpa]
Length=316

 Score =   311 bits (798),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 162/312 (52%), Positives = 201/312 (64%), Gaps = 11/312 (4%)
 Frame = -3

Query  1293  FLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDG  1114
              LA+    +QL   FY  +CPNL  IVR  +  A+    R+AAS++RL FHDCFVNGCDG
Sbjct  15    LLASSFCSAQLSATFYASTCPNLQTIVRNAMTGAVNGQPRLAASILRLFFHDCFVNGCDG  74

Query  1113  SVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGM  934
             S+LLDDT  F GEKN  PNRNSARGFEVID+IK  VE AC +TVSC DIL LAA   V +
Sbjct  75    SILLDDTATFTGEKNANPNRNSARGFEVIDTIKTRVEAACNATVSCADILALAARDGVVL  134

Query  933   SGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSV  757
              GGP W V LGRRD  TAS+ A   Q+PSP  SL  + + FSA+GL   DM  LSG H++
Sbjct  135   RGGPSWTVPLGRRDARTASQSAANSQIPSPASSLATLISMFSAKGLSAGDMTALSGGHTI  194

Query  756   GFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDN  577
             GFA+C TF+ R++N       D  +++SF +  + +CP   G +  LAPLD   T RFDN
Sbjct  195   GFARCTTFRNRIYN-------DTNIDASFATTRRASCP-ASGGDATLAPLDGTQT-RFDN  245

Query  576   SYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKD  397
             +YYTNLV   GLL SDQ L        +V+ YS     F  DFA +MVK+GN+  LTG+ 
Sbjct  246   NYYTNLVARRGLLHSDQELFNGGSQDALVRTYSTNGATFARDFAAAMVKMGNISPLTGR-  304

Query  396   NGQIRKICGSVN  361
             NG+IR+ C  VN
Sbjct  305   NGEIRRNCRVVN  316



>ref|XP_008351692.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 59-like [Malus domestica]
Length=332

 Score =   312 bits (800),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 165/325 (51%), Positives = 219/325 (67%), Gaps = 13/325 (4%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             SLV+   F    +A++QL   FY  +CP+L  IVR  V +A++ + RM  SL+RLHFHDC
Sbjct  13    SLVLITFFAFCFVAKAQLSTDFYKATCPDLFKIVRREVQNAVKFEMRMXCSLLRLHFHDC  72

Query  1134  FVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLA  955
              VNGCD S+LLD   G   EK+  PN NSARGFEV+D IK+ VE +C   VSC DIL +A
Sbjct  73    LVNGCDASLLLD---GTGSEKDAGPNLNSARGFEVVDRIKSSVESSCSGVVSCADILAIA  129

Query  954   ASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             A  +V +SGG  W+VLLGRRDGL A++  A + LP+PFE+L  I +KF+A GL++ D+V 
Sbjct  130   ARDSVLLSGGTSWKVLLGRRDGLVANQTGANRALPAPFEALDSIISKFAAVGLNVNDVVS  189

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCP-NVDGSNTKLAPLDY  601
             LSGAH++G A+C TF+ RLFN+ G+G PD TLE S L++LQ  CP   DGS T  AP D 
Sbjct  190   LSGAHTIGLARCGTFRDRLFNFAGTGAPDITLEQSMLTDLQHLCPLTADGSIT--APFDR  247

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQ-----TADMVKYYSAYPYRFYMDFATSM  436
             +S   FDN Y+ NL+N  GL+ SDQ L ++       T  +V+ Y++   RF+ DFA SM
Sbjct  248   KSADLFDNHYFQNLINGKGLISSDQILFSSDTAVTTGTKSLVQSYNSNINRFFADFANSM  307

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             +K+GN+  LTG   G+IRK C +VN
Sbjct  308   IKMGNISPLTGS-AGEIRKNCRAVN  331



>ref|XP_004307713.1| PREDICTED: peroxidase 4-like [Fragaria vesca subsp. vesca]
Length=323

 Score =   312 bits (799),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 159/321 (50%), Positives = 208/321 (65%), Gaps = 10/321 (3%)
 Frame = -3

Query  1326  MVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLH  1147
             +  I+++ F+  L    + +QL   FY +SCP L  IV+  V  AIRN+ RM AS++RLH
Sbjct  6     LSCIAILTFVHLLFMGTSTAQLSSNFYSKSCPRLFSIVKSTVQPAIRNEPRMGASILRLH  65

Query  1146  FHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             FHDCFVNGCDGSVLLDDT  F GEKN +PN+NS RGF VID+IK+ VE  CP  VSC DI
Sbjct  66    FHDCFVNGCDGSVLLDDTANFTGEKNAVPNKNSLRGFNVIDNIKSAVENVCPGVVSCADI  125

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQ-LPSPFESLKDITAKFSAQGLDLK  790
             L + A  +V + GGP W V LGRRD  TAS+ A    +P P  +L  + ++F+A GL  K
Sbjct  126   LAITARDSVAILGGPSWNVKLGRRDARTASQAAANNSIPPPTSNLNQLISRFNALGLSTK  185

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGS-NTKLA  613
             DMV LSG+H++G A+C +F+ R++N   +      L+SS     Q+ CP   GS +  LA
Sbjct  186   DMVALSGSHTIGQARCTSFRARVYNETNN------LDSSLAQTRQSNCPRTTGSGDNNLA  239

Query  612   PLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTAD-MVKYYSAYPYRFYMDFATSM  436
             PLD QS   FDN+YY NL+ N GLL SDQ L  N  + D +V+ YS+    F  DFA +M
Sbjct  240   PLDLQSPTAFDNNYYNNLIKNRGLLHSDQQLFLNGGSTDSIVRGYSSSQSTFTSDFAAAM  299

Query  435   VKLGNLGVLTGKDNGQIRKIC  373
             +K+GN+  LTG  NG+IRK C
Sbjct  300   IKMGNINPLTGS-NGEIRKNC  319



>ref|XP_010548306.1| PREDICTED: peroxidase 49 [Tarenaya hassleriana]
Length=332

 Score =   312 bits (799),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 216/325 (66%), Gaps = 5/325 (2%)
 Frame = -3

Query  1326  MVAISLVVFLGF-LAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRL  1150
             ++ ++LV FL   L       +L   FYD SCP  + IVR  V  A+  ++RMAASL+RL
Sbjct  9     LIVLALVCFLPLRLCNQSYGGKLYPGFYDHSCPKAEEIVRSIVAKAVARETRMAASLMRL  68

Query  1149  HFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTD  970
             HFHDCFV GCDGSVLLD +     EKN  PNR SARGFEV+D IKA +EK CP+TVSC D
Sbjct  69    HFHDCFVQGCDGSVLLDSSGRITSEKNSNPNRRSARGFEVVDEIKAALEKECPNTVSCAD  128

Query  969   ILTLAASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDL  793
              LTLAA  +  ++GGP W+V LGRRD   AS   +   +P+P  + + I +KF+ QGLD 
Sbjct  129   ALTLAARDSSVLTGGPTWKVPLGRRDSRGASLSGSNNNIPAPNNTFQTILSKFNRQGLDT  188

Query  792   KDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLA  613
              D+V LSG+H++GF++C +F++RL+N  G+ +PD TL+ SF ++L+  CP   G +  L 
Sbjct  189   TDLVALSGSHTIGFSRCTSFRQRLYNQSGNARPDSTLDQSFAASLRPRCPR-SGGDQNLF  247

Query  612   PLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTA-DMVKYYSAYPYRFYMDFATSM  436
              LD  S  +FDNSY+ NL++N GLL SDQ L ++ Q A ++VK Y+     F+  FA SM
Sbjct  248   VLDIISAAKFDNSYFKNLIDNKGLLNSDQVLFSSSQQARELVKKYAEDQEEFFEQFAESM  307

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             VK+GN+  LTG  NG+IRK C  +N
Sbjct  308   VKMGNISPLTG-SNGEIRKNCRKIN  331



>ref|XP_006661598.1| PREDICTED: peroxidase N-like [Oryza brachyantha]
Length=328

 Score =   311 bits (798),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 170/327 (52%), Positives = 215/327 (66%), Gaps = 15/327 (5%)
 Frame = -3

Query  1326  MVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLH  1147
             M+  S++V     +      QL   FYD +CP++  IV+  V+SA+R + RM ASL+RLH
Sbjct  12    MLVCSVLVLCA--STRCVRCQLSDDFYDYTCPHVYNIVQHHVYSAMRTEMRMGASLLRLH  69

Query  1146  FHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             FHDCFVNGCDGS+LLD   G  GEK  +PN+NS RG+EVID+IK D+E  CP  VSC DI
Sbjct  70    FHDCFVNGCDGSILLD---GDDGEKFAIPNKNSVRGYEVIDAIKEDLENICPEVVSCADI  126

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLK  790
             + LAA Y V  SGGPY+ VLLGRRDGL A++  A   LPSPFE++  I  KF   GLD  
Sbjct  127   VALAAGYGVLFSGGPYYDVLLGRRDGLLANQSGANNGLPSPFENITSIIGKFGDVGLDTT  186

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             D+VVLSGAH++G A+C  F  RL     S   DPTL+++  +NLQ+ C   DG+ T    
Sbjct  187   DVVVLSGAHTIGRARCKLFSNRL--STTSSSADPTLDATMAANLQSLCNGGDGNQT--TA  242

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALMAN----PQTADMVKYYSAYPYRFYMDFAT  442
             LD  S   FDN YY NL+N  GLL SDQ L ++      T D+V+ YSA  +RF+ DFA 
Sbjct  243   LDITSADVFDNRYYQNLLNQRGLLSSDQGLFSSVDGVANTKDLVQTYSANGHRFFWDFAR  302

Query  441   SMVKLGNLGVLTGKDNGQIRKICGSVN  361
             SMVK+GN+  LTG D+GQIRK C +VN
Sbjct  303   SMVKMGNISPLTG-DDGQIRKNCRAVN  328



>sp|P80679.1|PERA2_ARMRU RecName: Full=Peroxidase A2 [Armoracia rusticana]
Length=305

 Score =   311 bits (796),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 204/305 (67%), Gaps = 5/305 (2%)
 Frame = -3

Query  1266  QLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKG  1087
             QL+  FY  +CPN   IVR  +  A ++D+R+ ASLIRLHFHDCFV+GCD S+LLDD+  
Sbjct  1     QLNATFYSGTCPNASAIVRSTIQQAFQSDTRIGASLIRLHFHDCFVDGCDASILLDDSGS  60

Query  1086  FKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVL  907
              + EKN  PN NSARGF V+D+IK  +E  CP  VSC+DIL LA+  +V ++GGP W VL
Sbjct  61    IQSEKNAGPNANSARGFNVVDNIKTALENTCPGVVSCSDILALASEASVSLTGGPSWTVL  120

Query  906   LGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFK  730
             LGRRD LTA+   A   +PSPFE L +IT+KFSA GL+  D+V LSGAH+ G A+C  F 
Sbjct  121   LGRRDSLTANLAGANSAIPSPFEGLSNITSKFSAVGLNTNDLVALSGAHTFGRARCGVFN  180

Query  729   RRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNN  550
              RLFN+ G+  PDPTL S+ LS+LQ  CP  +GS + +  LD  +   FDN+Y+ NL +N
Sbjct  181   NRLFNFSGTNGPDPTLNSTLLSSLQQLCPQ-NGSASTITNLDLSTPDAFDNNYFANLQSN  239

Query  549   TGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKI  376
              GLL+SDQ L +     T  +V  +++    F+  FA SM+ +GN+  LTG  NG+IR  
Sbjct  240   NGLLQSDQELFSTLGSATIAVVTSFASNQTLFFQAFAQSMINMGNISPLTGS-NGEIRLD  298

Query  375   CGSVN  361
             C  V+
Sbjct  299   CKKVD  303



>dbj|BAA03373.1| putative peroxidase [Oryza sativa Japonica Group]
Length=335

 Score =   312 bits (799),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 171/325 (53%), Positives = 211/325 (65%), Gaps = 15/325 (5%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             ++VV LG LAA     QL   +YD  CP +  IVR  V +A++ + RM ASL+RLHFHDC
Sbjct  19    NIVVLLG-LAAAAGSGQLTDDYYDYCCPQVYRIVRSRVAAAMKAEMRMGASLLRLHFHDC  77

Query  1134  FVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLA  955
             FVNGCD S+LLD   G   EK  LPN+NS RG+EVID+IKAD+E ACP  VSC DI+ LA
Sbjct  78    FVNGCDASILLD---GTNSEKFALPNKNSVRGYEVIDAIKADLEGACPGVVSCADIVALA  134

Query  954   ASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             A Y V +SGGP + VLLGRRDGL A++  A   LPSPF+S+  ITA+F   GL+  D+VV
Sbjct  135   AKYGVLLSGGPDYDVLLGRRDGLVANQTGANSNLPSPFDSISVITARFKDVGLNATDVVV  194

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH++G ++C  F  RL N+  +   DPTL+SS  S+LQ  C    G   +LA LD  
Sbjct  195   LSGAHTIGRSRCLLFSNRLANFSATNSVDPTLDSSLASSLQQVCR---GGADQLAALDVN  251

Query  597   STYRFDNSYYTNLVNNTGLLESDQALM------ANPQTADMVKYYSAYPYRFYMDFATSM  436
             S   FDN YY NL+ N GLL SDQ L+      A   T  +V+ YSA   RF  DF  SM
Sbjct  252   SADAFDNHYYQNLLANKGLLASDQGLVSSSGDPAVAATKALVQAYSANGQRFSCDFGNSM  311

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             VK+GN+  LTG   GQIRK C +VN
Sbjct  312   VKMGNISPLTGS-AGQIRKNCRAVN  335



>ref|XP_003549220.1| PREDICTED: peroxidase N isoform X1 [Glycine max]
Length=331

 Score =   311 bits (798),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 214/317 (68%), Gaps = 11/317 (3%)
 Frame = -3

Query  1293  FLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDG  1114
             FL      SQL   FY  SCPNL  IVR  V  A+ N+ RMAASL+RLHFHDCFVNGCDG
Sbjct  18    FLLLLPVRSQLTTDFYKSSCPNLSKIVRREVQKALMNEIRMAASLLRLHFHDCFVNGCDG  77

Query  1113  SVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGM  934
             S+LLD   G  GEK+  PN NSARG+EV+D+IK+ VE AC   VSC DIL +AA  +V +
Sbjct  78    SILLD--GGDDGEKSAAPNLNSARGYEVVDTIKSSVESACSGVVSCADILAIAARDSVFL  135

Query  933   SGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSV  757
             SGGP+W+V LGRRDG  ++   AT+ LP+PF+ L  I +KF+  GL+L D+V LSGAH++
Sbjct  136   SGGPFWKVPLGRRDGTVSNGTLATEVLPAPFDPLNTIISKFTNMGLNLTDVVSLSGAHTI  195

Query  756   GFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCP-NVDGSNTKLAPLDYQSTYRFD  580
             G A+C  F  RLFN+ G+G PD TLE+  LS+LQ+ CP N DG+ T +  LD  S+  FD
Sbjct  196   GRARCTLFSNRLFNFSGTGAPDSTLETGMLSDLQSLCPQNGDGNVTTV--LDRNSSDLFD  253

Query  579   NSYYTNLVNNTGLLESDQALM----ANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGV  412
               Y+ NL++  GLL SDQ L     AN  T  +V+ YS    +F+ DFA SM+K+GN+ +
Sbjct  254   IHYFKNLLSGKGLLSSDQILFSSDEANSTTKPLVQSYSNDSGQFFGDFANSMIKMGNINI  313

Query  411   LTGKDNGQIRKICGSVN  361
              TG D G+IRK C  +N
Sbjct  314   KTGTD-GEIRKNCRVIN  329



>ref|XP_009614894.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=321

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 207/322 (64%), Gaps = 10/322 (3%)
 Frame = -3

Query  1320  AISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFH  1141
             AI L +F+  L    + +QL   FY +SCP L   V+  V SAI+ ++RM ASL+RL FH
Sbjct  8     AIVLFIFVSLLIG-NSSAQLSTGFYSKSCPKLYQTVKSAVQSAIKKETRMGASLLRLFFH  66

Query  1140  DCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILT  961
             DCFVNGCDGS+LLDDT  F GEK   PN NSARGFEVID+IK+ VEK CP  VSC DIL 
Sbjct  67    DCFVNGCDGSLLLDDTSSFTGEKRAAPNVNSARGFEVIDNIKSAVEKVCPGVVSCADILA  126

Query  960   LAASYAVGMSGGPYWRVLLGRRDGLTASE-EATKQLPSPFESLKDITAKFSAQGLDLKDM  784
             + A  +V + GGP W V LGRRD  TAS+  A + +P P  +L  + + FSA GL  KDM
Sbjct  127   VTARDSVVILGGPNWNVKLGRRDARTASQAAANRSIPPPTSNLNRLISSFSAVGLSTKDM  186

Query  783   VVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGS-NTKLAPL  607
             V LSGAH++G A+C TF+ R++N   +      L++SF    Q+ CP   GS +  LAPL
Sbjct  187   VALSGAHTIGQARCTTFRARIYNETNN------LDASFARTRQSNCPRSSGSGDNSLAPL  240

Query  606   DYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKL  427
             D Q+  +FDN+Y+ NLVN  GLL SDQ L        +V  YS  P  F  DF T+M+K+
Sbjct  241   DLQTPNKFDNNYFKNLVNKKGLLHSDQQLFNGGSADSIVTSYSNNPRSFSSDFVTAMIKM  300

Query  426   GNLGVLTGKDNGQIRKICGSVN  361
             G++  LTG  NG+IRK CG +N
Sbjct  301   GDIRPLTG-SNGEIRKNCGRIN  321



>dbj|BAA84764.1| peroxidase [Oryza sativa Japonica Group]
Length=326

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 215/327 (66%), Gaps = 15/327 (5%)
 Frame = -3

Query  1326  MVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLH  1147
             M+  S++V    L    A  QL   FYD  CP++  +++  V++A+R + RM ASL+RLH
Sbjct  10    MLVCSVLVLC--LNTRGARCQLSDDFYDYICPDVYTVLQQHVYAAMRTEMRMGASLLRLH  67

Query  1146  FHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             FHDCFVNGCDGS+LLD   G  GEK  LPN+NS RGFEVID+IK D+E  CP  VSC DI
Sbjct  68    FHDCFVNGCDGSILLD---GDDGEKFALPNKNSVRGFEVIDAIKEDLENICPEVVSCADI  124

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLK  790
             + LAA Y V  SGGPY+ VLLGRRDGL A++  A   LPSPFE +K I  KF+  GLD  
Sbjct  125   VALAAGYGVLFSGGPYYDVLLGRRDGLVANQSGADNGLPSPFEPIKSIIQKFNDVGLDTT  184

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             D+VVLSG H++G A+C  F  RL     S   DPTL+++  +NLQ+ C   DG+ T +  
Sbjct  185   DVVVLSGGHTIGRARCTLFSNRL--STTSSSADPTLDATMAANLQSLCAGGDGNETTV--  240

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALMAN----PQTADMVKYYSAYPYRFYMDFAT  442
             LD  S Y FDN YY NL+N  GLL SDQ L ++      T ++V+ YSA  ++F+ DF  
Sbjct  241   LDITSAYVFDNRYYQNLLNQKGLLSSDQGLFSSDDGIANTKELVETYSADAHKFFWDFGR  300

Query  441   SMVKLGNLGVLTGKDNGQIRKICGSVN  361
             SMVK+GN+  LTG D+GQIRK C  VN
Sbjct  301   SMVKMGNISPLTG-DDGQIRKNCRVVN  326



>ref|XP_002988477.1| hypothetical protein SELMODRAFT_235541 [Selaginella moellendorffii]
 gb|EFJ10567.1| hypothetical protein SELMODRAFT_235541 [Selaginella moellendorffii]
Length=310

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 198/309 (64%), Gaps = 3/309 (1%)
 Frame = -3

Query  1284  APMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVL  1105
             A     Q D  FY  +CPNL  IV   V  A+ ++ RMAASL+RLHFHDCFV GCD S+L
Sbjct  4     ASKGRRQGDTTFYASTCPNLVQIVSGVVRRAVASEPRMAASLLRLHFHDCFVQGCDASLL  63

Query  1104  LDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGG  925
             LDD  GF GEK+ LPN+NS RGF VID+IK  VE+ CP+ VSC DI+TLAA   V    G
Sbjct  64    LDDASGFTGEKSALPNQNSVRGFNVIDNIKTAVERQCPNVVSCADIVTLAAREGVTALQG  123

Query  924   PYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFA  748
             P W V+LGRRD  TAS   A   +P+P  S   + +KF A+GL  +D+V  SG H++G A
Sbjct  124   PSWPVVLGRRDSTTASLSSANNDIPAPTSSASQLLSKFQAKGLSAQDLVATSGGHTIGQA  183

Query  747   QCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYY  568
             +C TF+ RL+N+  SG+PDP L + FLS LQ  C     S+  L+PLD +S   FDN+Y+
Sbjct  184   RCVTFRDRLYNFSNSGRPDPNLNALFLSRLQQQCTQSSASDNNLSPLDVRSANVFDNAYF  243

Query  567   TNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQ  388
              NL  N GLL SDQ L A   T  +V  Y+    RF+ DFA++MV +GN+  LTG   G+
Sbjct  244   VNLQFNRGLLNSDQVLSAG-STQALVNAYAGNNRRFFADFASAMVNMGNISPLTGSA-GE  301

Query  387   IRKICGSVN  361
             IRK C + N
Sbjct  302   IRKSCRARN  310



>emb|CAL25299.1| properoxidase [Picea abies]
Length=341

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/304 (49%), Positives = 205/304 (67%), Gaps = 4/304 (1%)
 Frame = -3

Query  1263  LDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGF  1084
             L + FY +SCP    I++  V  A+R ++RMAASL+RLHFHDCFV GCDGS+LLDDT  F
Sbjct  39    LSHHFYYKSCPKAQAIIKSVVEDAVRKEARMAASLLRLHFHDCFVKGCDGSILLDDTSSF  98

Query  1083  KGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVLL  904
              GEK   PNRNS RGF V+D IK+++EKACP  VSC DIL +AA  +VG SGGP+W+VLL
Sbjct  99    TGEKTANPNRNSVRGFGVVDQIKSELEKACPGVVSCADILAVAARDSVGFSGGPFWKVLL  158

Query  903   GRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKR  727
             GRRD  +AS+  A   +P P  + + +  KF  QGL++ D+V LSGAH++G A+C +FK 
Sbjct  159   GRRDSRSASKSGANNDIPGPNSTHQTLETKFKRQGLNVVDLVALSGAHTIGLARCSSFKA  218

Query  726   RLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNT  547
             RL+N   +GK DPTL++++L +L+  CP     + +  PLD  +  +FD  YY N+V   
Sbjct  219   RLYNQTVNGKSDPTLDTTYLKHLRAVCPQTGTDDNQTTPLDPVTPIKFDIDYYDNVVAGK  278

Query  546   GLLESDQALMANP--QTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKIC  373
             GLL SDQ L +    +T  +V+ YS   + F+  FA SM+K+GN+  LTG  +G+IRK C
Sbjct  279   GLLASDQILYSTKGSRTVGLVESYSTSMHAFFKQFAASMIKMGNINPLTG-SHGEIRKNC  337

Query  372   GSVN  361
               +N
Sbjct  338   RRMN  341



>ref|XP_006412001.1| hypothetical protein EUTSA_v10025683mg [Eutrema salsugineum]
 gb|ESQ53454.1| hypothetical protein EUTSA_v10025683mg [Eutrema salsugineum]
Length=330

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 205/299 (69%), Gaps = 4/299 (1%)
 Frame = -3

Query  1251  FYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEK  1072
             FY +SCP  + IVR  V  A+  ++RMAASL+RLHFHDCFV GCDGS+LLD + G   EK
Sbjct  33    FYARSCPQAEEIVRSVVAKAVARETRMAASLLRLHFHDCFVQGCDGSLLLDSSGGIVSEK  92

Query  1071  NGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRD  892
             +  PN  SARGFEV+D IKA +EK CP  VSC D+LTLAA  +  +SGGP W V LGRRD
Sbjct  93    SSNPNSKSARGFEVVDQIKAQLEKECPGIVSCADVLTLAARDSTVISGGPSWVVPLGRRD  152

Query  891   GLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFN  715
               +AS   +   +P+P  + + I ++F+ QGLD+ D+V LSG+H++GF++C +F++RL+N
Sbjct  153   SRSASLSGSNNNIPAPNNTFQTILSRFNRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYN  212

Query  714   YQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLE  535
               G G+PD TLE SF +NL+  CP   G +  L+ LD  S  RFDNSY+ NLV N GLL 
Sbjct  213   QNGDGRPDMTLEQSFAANLRQRCPR-SGGDQILSKLDMVSAARFDNSYFRNLVQNMGLLN  271

Query  534   SDQALM-ANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
             SDQ L  +N Q+ ++VK Y+     F+  FA SM+K+GN+  LTG  +G+IRK C  +N
Sbjct  272   SDQVLFSSNDQSRELVKKYAEDQGEFFRQFAQSMIKMGNISPLTG-SSGEIRKNCRKIN  329



>gb|ABK21983.1| unknown [Picea sitchensis]
Length=341

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/304 (49%), Positives = 204/304 (67%), Gaps = 4/304 (1%)
 Frame = -3

Query  1263  LDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGF  1084
             L + FY +SCP    I++  V  A+R ++RMAASL+RLHFHDCFV GCDGS+LLDDT  F
Sbjct  39    LSHHFYYKSCPKAQAIIKSVVEDAVRKEARMAASLLRLHFHDCFVKGCDGSILLDDTSSF  98

Query  1083  KGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVLL  904
              GEK   PN+NS RGF V+D IK ++EKACP  VSC DIL +AA  +VG SGGP+W+VLL
Sbjct  99    TGEKTANPNKNSVRGFGVVDQIKCELEKACPGVVSCADILAVAARDSVGFSGGPFWKVLL  158

Query  903   GRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKR  727
             GRRD  +AS+  A   +P P  + + +  KF  QGL++ D+V LSGAH++G A+C +FK 
Sbjct  159   GRRDSRSASKSGANNDIPGPNSTHQTLETKFKRQGLNVVDLVALSGAHTIGLARCSSFKA  218

Query  726   RLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNT  547
             RL+N   +GKPDPTL++++L  L+  CP     + +  PLD  +  +FD  YY N+V   
Sbjct  219   RLYNQTVNGKPDPTLDTTYLKQLRAVCPQTGTDDNQTTPLDPVTPIKFDIDYYDNVVAGK  278

Query  546   GLLESDQALMANP--QTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKIC  373
             GLL SD+ L +    +T  +V+ YS   + F+  FA SM+K+GN+  LTG  +G+IRK C
Sbjct  279   GLLASDEILYSTKGSRTVGLVESYSTSTHAFFKQFAASMIKMGNINPLTG-SHGEIRKNC  337

Query  372   GSVN  361
               +N
Sbjct  338   RRMN  341



>ref|XP_002311022.2| hypothetical protein POPTR_0008s02340g [Populus trichocarpa]
 gb|EEE88389.2| hypothetical protein POPTR_0008s02340g [Populus trichocarpa]
Length=319

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 206/316 (65%), Gaps = 10/316 (3%)
 Frame = -3

Query  1305  VFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVN  1126
             +F+ FL     ++QL   FYD SCPN    +R  + SAI +D RMAASLIRLHFHDCFV 
Sbjct  12    MFMLFLLNIACQAQLSPAFYDSSCPNAISAIRTAIRSAIASDRRMAASLIRLHFHDCFVQ  71

Query  1125  GCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASY  946
             GCD S+LLD+T   + EK  L N NSARG+ VID  K +VEK CP  VSC DI+ +AA  
Sbjct  72    GCDASILLDETLSIQSEKTALGNLNSARGYNVIDKAKTEVEKICPGVVSCADIIAVAARD  131

Query  945   AVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSG  769
             A    GGP + V LGRRD  TAS   A  +LP+ FESL+ + ++F  +GL  +DMV LSG
Sbjct  132   ASAYVGGPSYAVKLGRRDSTTASRTLANAELPAFFESLESLISRFQKKGLTARDMVALSG  191

Query  768   AHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTY  589
             +H++G AQCFTF+ R++N+         +++ F S  +  CP V GSN+ LAPLD  +  
Sbjct  192   SHTLGQAQCFTFRERIYNHS-------NIDAGFASTRRRRCPRV-GSNSTLAPLDLVTPN  243

Query  588   RFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVL  409
              FDN+Y+ NL+ N GLL+SDQ L     T  +V  YS  P RF  DF ++M+K+G++G+L
Sbjct  244   SFDNNYFKNLMQNKGLLQSDQVLFNGGSTDSIVSEYSRNPARFKSDFGSAMIKMGDIGLL  303

Query  408   TGKDNGQIRKICGSVN  361
             TG   GQIR+IC +VN
Sbjct  304   TGSA-GQIRRICSAVN  318



>ref|NP_001240914.1| uncharacterized protein LOC100787073 precursor [Glycine max]
 gb|ACU20812.1| unknown [Glycine max]
Length=330

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 166/317 (52%), Positives = 213/317 (67%), Gaps = 11/317 (3%)
 Frame = -3

Query  1293  FLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDG  1114
             FL      SQL   FY  SCPN+  IVR  V  A+ N+ RMAASL+RLHFHDCFVNGCDG
Sbjct  18    FLLLLAVRSQLTTDFYKSSCPNVSKIVRREVQKALMNEIRMAASLLRLHFHDCFVNGCDG  77

Query  1113  SVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGM  934
             S+LLD   G  GEK+  PN NSARG+EV+D+IK+ VE AC   VSC DIL +AA  +V +
Sbjct  78    SILLD--GGDDGEKSAAPNLNSARGYEVVDTIKSSVESACSGVVSCADILAIAARDSVFL  135

Query  933   SGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSV  757
             SGGP W+VLLGRRDG  ++   A + LPSPF+ L  I +KF+  GL+L D+V LSGAH++
Sbjct  136   SGGPSWKVLLGRRDGTVSNGTLANEALPSPFDPLDTIISKFTNMGLNLTDVVSLSGAHTI  195

Query  756   GFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCP-NVDGSNTKLAPLDYQSTYRFD  580
             G A+C  F  RLFN+ G+G PD TL++  LS+LQ+ CP N DG+ T +  LD  S+  FD
Sbjct  196   GRARCTLFGNRLFNFSGTGAPDSTLDTDMLSDLQSLCPQNGDGNVTTV--LDRNSSDLFD  253

Query  579   NSYYTNLVNNTGLLESDQALM----ANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGV  412
             + Y+ NL++  GLL SDQ L     AN  T  +V+ YS     F+ DFA SM+K+GN+ +
Sbjct  254   SHYFKNLLSGMGLLSSDQILFSSDEANSTTKPLVQSYSNDSGLFFGDFANSMIKMGNINI  313

Query  411   LTGKDNGQIRKICGSVN  361
              TG  NG+IRK C  +N
Sbjct  314   KTGT-NGEIRKNCRVIN  329



>gb|ABW82529.1| class III peroxidase [Gossypium hirsutum]
Length=330

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 172/337 (51%), Positives = 217/337 (64%), Gaps = 16/337 (5%)
 Frame = -3

Query  1344  IHKS*VMVAISLVVFLGFLAAPMAESQLDYL-------FYDQSCPNLDMIVRWGVWSAIR  1186
             + K  V++ + LV+    +A  M E+ +D +        Y  SCP  + I+   V +A+ 
Sbjct  1     MAKCFVLLFLCLVMVSINVANTMNETCVDDISIVLQIDLYKNSCPEAESIIYSWVENAVS  60

Query  1185  NDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADV  1006
              DSRMAASL+RLHFHDCFVNGCDGSVLLDDT+ F GEK  LPN NS RGFEVID+IK+++
Sbjct  61    QDSRMAASLLRLHFHDCFVNGCDGSVLLDDTEDFTGEKTALPNLNSLRGFEVIDAIKSEL  120

Query  1005  EKACPSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKD  829
             E  CP TVSC DIL  AA  +V +SGGP W V +GR+D L AS+E AT  +P P  ++  
Sbjct  121   ESVCPQTVSCADILATAARDSVVISGGPSWEVEMGRKDSLGASKEAATNNIPGPNSTVPM  180

Query  828   ITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTT  649
             + AKF   GL   DM+ LSGAH++G A+C TF  RL   QGS  PD  L+  FL NLQ  
Sbjct  181   LVAKFQNVGLSFNDMIALSGAHTLGMARCSTFSSRL---QGSNGPDINLD--FLQNLQQL  235

Query  648   CPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANP-QTADMVKYYSAY  472
             C   DG N++LA LD  S   FDN YY NL++  GLL SDQAL+ +  QT  +V  Y+  
Sbjct  236   CSQTDG-NSRLARLDLVSPATFDNQYYINLLSGEGLLPSDQALVTDDYQTRQLVLSYAED  294

Query  471   PYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
             P  F+ DF  SM+K+G+LGVLTG D GQIR  C  VN
Sbjct  295   PLAFFEDFKNSMLKMGSLGVLTGTD-GQIRGNCRVVN  330



>dbj|BAA03372.1| putative peroxidase [Oryza sativa Japonica Group]
Length=326

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 214/327 (65%), Gaps = 15/327 (5%)
 Frame = -3

Query  1326  MVAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLH  1147
             M+  S++V    L    A  QL   FYD  CP++  +V+  V++A+R + RM ASL+RLH
Sbjct  10    MLVCSVLVLC--LNTRGARCQLSDDFYDYICPDVYTVVQQHVYAAMRTEMRMGASLLRLH  67

Query  1146  FHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDI  967
             FHDCFVNGCDGS+LLD   G  GEK  LPN+ S RGFEVID+IK D+E  CP  VSC DI
Sbjct  68    FHDCFVNGCDGSILLD---GDDGEKFALPNKTSVRGFEVIDAIKEDLENICPEVVSCADI  124

Query  966   LTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLK  790
             + LAA Y V  SGGPY+ VLLGRRDGL A++  A   LPSPFE +K I  KF+  GLD  
Sbjct  125   VALAAGYGVLFSGGPYYDVLLGRRDGLVANQSGADNGLPSPFEPIKSIIQKFNDVGLDTT  184

Query  789   DMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAP  610
             D+VVLSG H++G A+C  F  RL     S   DPTL+++  +NLQ+ C   DG+ T +  
Sbjct  185   DVVVLSGGHTIGRARCTLFSNRLSTTSSSA--DPTLDATMAANLQSLCAGGDGNETTV--  240

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALMAN----PQTADMVKYYSAYPYRFYMDFAT  442
             LD  S Y FDN YY NL+N  GLL SDQ L ++      T ++V+ YSA  ++F+ DF  
Sbjct  241   LDITSAYVFDNRYYQNLLNQKGLLSSDQGLFSSDDGIANTKELVETYSADAHKFFWDFGR  300

Query  441   SMVKLGNLGVLTGKDNGQIRKICGSVN  361
             SMVK+GN+  LTG D+GQIRK C  VN
Sbjct  301   SMVKMGNISPLTG-DDGQIRKNCRVVN  326



>ref|XP_011033755.1| PREDICTED: peroxidase P7-like [Populus euphratica]
Length=316

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 161/312 (52%), Positives = 201/312 (64%), Gaps = 11/312 (4%)
 Frame = -3

Query  1293  FLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDG  1114
              LA+    +QL   FY  +CPNL  IVR  +  A+    R+AAS++RL FHDCFVNGCDG
Sbjct  15    LLASSFCSAQLSATFYASTCPNLQTIVRNAMTGAVNGQPRLAASILRLFFHDCFVNGCDG  74

Query  1113  SVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGM  934
             S+LLDDT  F GEKN  PNRNSARGFEVID+IK  VE AC +TVSC DIL LAA   V +
Sbjct  75    SILLDDTATFTGEKNANPNRNSARGFEVIDTIKTRVEAACNATVSCADILALAARDGVVL  134

Query  933   SGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSV  757
              GGP W V LGRRD  TAS+ A   Q+PSP  SL  + + FSA+GL   DM  LSG H++
Sbjct  135   LGGPSWTVPLGRRDARTASQSAANSQIPSPASSLATLISMFSAKGLSASDMTALSGGHTI  194

Query  756   GFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDN  577
             GFA+C +F+ R++N       D  +++SF +  + +CP   G +  LAPLD   T RFDN
Sbjct  195   GFARCTSFRNRIYN-------DTNIDASFATTRRASCP-ASGGDANLAPLDGTQT-RFDN  245

Query  576   SYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKD  397
             +YYTNLV   GLL SDQ L        +V+ YS     F  DFA +MVK+GN+  LTG+ 
Sbjct  246   NYYTNLVARRGLLHSDQELFNGGSQDALVRTYSTNGATFARDFAAAMVKMGNISPLTGR-  304

Query  396   NGQIRKICGSVN  361
             NG+IR+ C  VN
Sbjct  305   NGEIRRNCRVVN  316



>emb|CBI25854.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 177/220 (80%), Gaps = 5/220 (2%)
 Frame = -3

Query  1323  VAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHF  1144
             V +  ++FLG   +     QLDY FYD SCPNL  IVR GV SA+  ++RMAASL+RLHF
Sbjct  36    VPLFCLLFLGHFVS----GQLDYNFYDHSCPNLTGIVRNGVASAVAKETRMAASLLRLHF  91

Query  1143  HDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDIL  964
             HDCFVNGCD S+LLD++  FKGEKN LPNRNS RGFEVID+IKADVE+ACPSTVSC DIL
Sbjct  92    HDCFVNGCDASILLDESSAFKGEKNALPNRNSVRGFEVIDAIKADVERACPSTVSCADIL  151

Query  963   TLAASYAVGMSGGPYWRVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKD  787
             TLA   A+ + GGP+W V +GRRDGLTA+E A  +QLPSP E L++ITAKF+++GL LKD
Sbjct  152   TLAVREAIYLVGGPFWLVAMGRRDGLTANETAANEQLPSPIEPLENITAKFTSKGLTLKD  211

Query  786   MVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFL  667
             +VVLSGAH++GFAQCFTFK RLFN+  +G PDPTL++S L
Sbjct  212   VVVLSGAHTIGFAQCFTFKSRLFNFDNTGNPDPTLDASLL  251



>ref|XP_010673530.1| PREDICTED: peroxidase N-like [Beta vulgaris subsp. vulgaris]
Length=330

 Score =   310 bits (793),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 159/310 (51%), Positives = 205/310 (66%), Gaps = 10/310 (3%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
              + QL   FY  +CPNL  IVR  V  A+ N+ RMAASL+RLHFHDCFVNGCDGSVLLD 
Sbjct  25    VKCQLTADFYATTCPNLFHIVRRQVQIAVMNEMRMAASLLRLHFHDCFVNGCDGSVLLD-  83

Query  1095  TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYW  916
               G   EK   PN+NS RGFEV+D+IK  VE +C   VSC DIL +AA  ++ +SGG  +
Sbjct  84    --GSDSEKLAFPNQNSLRGFEVVDTIKTAVESSCSGVVSCADILAIAARDSIVLSGGHSY  141

Query  915   RVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCF  739
             RVL+GRRDG+ A++  A   LPSPF+ L  + ++F+ QGL+L D+V L GAH++G A+C 
Sbjct  142   RVLVGRRDGMMANQTGANTNLPSPFDPLDIVISRFADQGLNLTDVVALQGAHTIGLARCA  201

Query  738   TFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
              F  RLFN+ GSG  D T++SS +S LQ+ CP V+G   +   LD  ST  FDN Y+ NL
Sbjct  202   VFSSRLFNFSGSGAADSTIDSSLVSQLQSLCP-VNGDGNQTTALDQNSTDVFDNHYFKNL  260

Query  558   VNNTGLLESDQAL----MANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNG  391
             +NN G+L SDQ L    MAN  T  +V+ YS  P  F  DF  SM+K+GN+  +TG  +G
Sbjct  261   INNKGILLSDQDLYSSDMANTTTKSIVESYSTNPQLFLTDFIKSMIKMGNVNPITGS-SG  319

Query  390   QIRKICGSVN  361
             QIR  C  +N
Sbjct  320   QIRTNCRVIN  329



>ref|XP_002285642.1| PREDICTED: peroxidase N isoform X2 [Vitis vinifera]
Length=332

 Score =   310 bits (793),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 212/324 (65%), Gaps = 11/324 (3%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMA-ESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             S +  + FL   +   SQL   FY++SCPNL  IVR  V +AI+ ++RMAASL+RLHFHD
Sbjct  13    SCLFMISFLMVCLGVRSQLTTDFYNESCPNLLTIVRKAVKNAIKTETRMAASLVRLHFHD  72

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCDGSVLLD   G  GEK+ LPN NS RGF+V+D+IK+ VE ACP  VSC DIL +
Sbjct  73    CFVNGCDGSVLLD---GSDGEKSALPNLNSVRGFDVVDTIKSSVESACPGVVSCADILAI  129

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMV  781
             AA  +V +SGG  W+V LGRRDGL A++  A   LP P +SL  IT KF+  GL+  D+V
Sbjct  130   AARDSVLLSGGNTWKVFLGRRDGLVANQTGANNGLPFPTDSLDTITQKFANVGLNQTDVV  189

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
              LSGAH++G A+C TF  RLFN+ G+G  D T+++  +S+LQT CP     NT  + LD 
Sbjct  190   SLSGAHTIGLARCTTFSSRLFNFSGTGAADSTMDTEMVSDLQTLCPQSGDGNTTTS-LDQ  248

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALM----ANPQTADMVKYYSAYPYRFYMDFATSMV  433
              ST  FDN Y+ NL+   GLL SDQ L     A   T  +V+ YS+    F+ DF  SM+
Sbjct  249   NSTDLFDNHYFKNLLVGKGLLSSDQILFTGDAAASTTKSLVQNYSSDSGLFFSDFTNSMI  308

Query  432   KLGNLGVLTGKDNGQIRKICGSVN  361
             K+GN+   TG  NG+IR  C  VN
Sbjct  309   KMGNINPKTGS-NGEIRTNCRVVN  331



>ref|XP_010246464.1| PREDICTED: peroxidase P7-like [Nelumbo nucifera]
Length=319

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 200/306 (65%), Gaps = 10/306 (3%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             A +QL   FY  +CPNL  IVR G+  A+  + R+ AS++RL FHDCFVNGCD S+LLDD
Sbjct  23    AHAQLSTNFYANTCPNLPTIVRNGMRQAVNRERRLGASILRLFFHDCFVNGCDASILLDD  82

Query  1095  TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYW  916
             T  F GEKN  PNRNSARGFEVIDSIK+ VE +C +TVSC DIL LAA   V + GGP W
Sbjct  83    TATFTGEKNAAPNRNSARGFEVIDSIKSQVEASCNATVSCADILALAARDGVVLLGGPTW  142

Query  915   RVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCF  739
              V LGRRD  TAS+  A  Q+P P E+L  + +KF+A+GL  +DM VLSGAH++G AQC 
Sbjct  143   NVPLGRRDARTASQSGANSQIPGPSENLSSLISKFAAKGLSARDMTVLSGAHTIGQAQCR  202

Query  738   TFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             TF+ R++N       D  ++++F +  +  CP   G +  LAPLD Q+  RFDN+YY NL
Sbjct  203   TFRNRIYN-------DTNIDANFAATRRANCP-ATGGDANLAPLDIQTPARFDNNYYGNL  254

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             V   GLL SDQ L        +V+ YS     F  DF+ +MV++GN+  LTG  NG+IR 
Sbjct  255   VARRGLLHSDQELFNGGSQDSLVRSYSTDGTSFARDFSAAMVRMGNISPLTGT-NGEIRL  313

Query  378   ICGSVN  361
              C  VN
Sbjct  314   NCRRVN  319



>ref|XP_009405166.1| PREDICTED: peroxidase 59-like [Musa acuminata subsp. malaccensis]
Length=329

 Score =   309 bits (792),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 160/309 (52%), Positives = 205/309 (66%), Gaps = 10/309 (3%)
 Frame = -3

Query  1272  ESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDT  1093
              S L   FY +SCPN+  +VR  V  A++ ++RMAASL+RLHFHDCFVNGCDGSVLLD  
Sbjct  26    RSHLSTNFYAESCPNVFKVVRGEVADALKKEARMAASLLRLHFHDCFVNGCDGSVLLD--  83

Query  1092  KGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWR  913
              G  GEK   PNRNS RGF+V+DSIK  VE  C  TVSC DIL +AA  AV +SGGP W+
Sbjct  84    -GSDGEKFAFPNRNSVRGFDVVDSIKTAVENECSETVSCADILAIAARDAVVLSGGPSWK  142

Query  912   VLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFT  736
             V LGRRDGL A++  A   LP+PF S+  I  KF+A GLD+ D+V LSG H++G A+C  
Sbjct  143   VPLGRRDGLVANQTGANTNLPAPFHSINTIKNKFAAVGLDITDVVALSGGHTIGRARCLA  202

Query  735   FKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLV  556
             F+ RL ++  +   DP+L+S+  S LQ+ CP  D  +T  A LD  S   FDN Y++NL+
Sbjct  203   FRSRLLSFSPTSSADPSLDSTMASELQSLCPQDDDGSTA-AALDRSSVNAFDNHYFSNLL  261

Query  555   NNTGLLESDQALMANPQ----TADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQ  388
             N  GLL SDQ L ++ +    T D+V+ YS     F+ DFA SM+K+GN+  LTG   G+
Sbjct  262   NQRGLLPSDQGLFSSDEGVATTKDLVEAYSKDAGLFFKDFANSMIKMGNISPLTGS-VGE  320

Query  387   IRKICGSVN  361
             IRK C  VN
Sbjct  321   IRKNCRVVN  329



>gb|AAX53172.1| peroxidase [Populus alba x Populus glandulosa]
Length=316

 Score =   308 bits (790),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 161/312 (52%), Positives = 200/312 (64%), Gaps = 11/312 (4%)
 Frame = -3

Query  1293  FLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDG  1114
              LA+    +QL   FY  +CPNL  IVR  +  A+    R+AAS++RL FHDCFVNGCDG
Sbjct  15    LLASSFCSAQLSATFYASTCPNLQTIVRNAMTGAVNGQPRLAASILRLFFHDCFVNGCDG  74

Query  1113  SVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGM  934
             S+LLDDT  F GEKN  PNRNSARGFEVID+IK  VE AC +TVSC DIL LAA   V +
Sbjct  75    SILLDDTATFTGEKNANPNRNSARGFEVIDTIKTRVEAACNATVSCADILALAARDGVVL  134

Query  933   SGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSV  757
              GGP W V LGRRD  TAS+ A   Q+PSP  SL  + + FSA+GL   DM  LSG H++
Sbjct  135   LGGPSWTVPLGRRDARTASQSAANSQIPSPASSLATLISMFSAKGLSAGDMTALSGGHTI  194

Query  756   GFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDN  577
             GFA+C TF+ R++N       D  +++SF +  + +CP   G +  LAPLD   T RFDN
Sbjct  195   GFARCTTFRNRIYN-------DTNIDASFATTRRASCP-ASGGDATLAPLDGTQT-RFDN  245

Query  576   SYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKD  397
             +YYTNLV   GLL SDQ L        +V+ YS     F  DFA +MV++GN+  LTG  
Sbjct  246   NYYTNLVARRGLLHSDQELFNGGSQDALVRTYSTNGATFARDFAAAMVRMGNISPLTGT-  304

Query  396   NGQIRKICGSVN  361
             NG+IR+ C  VN
Sbjct  305   NGEIRRNCRVVN  316



>dbj|BAA08499.1| peroxidase [Oryza sativa Japonica Group]
Length=335

 Score =   309 bits (792),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 209/325 (64%), Gaps = 15/325 (5%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             ++VV LG LAA     QL   +YD  CP +  IVR  V +A++ + RM ASL+RLHFHDC
Sbjct  19    NIVVLLG-LAAAAGSGQLTDDYYDYCCPQVYRIVRSRVAAAMKAEMRMGASLLRLHFHDC  77

Query  1134  FVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLA  955
             FVNGCD S+LLD   G   EK   PN NS RG+EVID+IKAD+E ACP  VSC DI+ LA
Sbjct  78    FVNGCDASILLD---GTNSEKFAAPNNNSVRGYEVIDAIKADLESACPGVVSCADIVALA  134

Query  954   ASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             A Y V +SGGP + VLLGRRDGL A++  A   LPSPF+S+  ITA+F   GL+  D+VV
Sbjct  135   AKYGVLLSGGPDYDVLLGRRDGLVANQTGANSNLPSPFDSISVITARFKDVGLNATDVVV  194

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH++G ++C  F  RL N+  +   DPTL+SS  S+LQ  C    G   +LA LD  
Sbjct  195   LSGAHTIGRSRCLLFSNRLANFSATNSVDPTLDSSLASSLQQVCR---GGADQLAALDVN  251

Query  597   STYRFDNSYYTNLVNNTGLLESDQALM------ANPQTADMVKYYSAYPYRFYMDFATSM  436
             S   FDN YY NL+ N GLL SDQ L+      A   T  +V+ YSA   RF  DF  SM
Sbjct  252   SADAFDNHYYQNLLANKGLLASDQGLVSSSGDPAVAATKALVQAYSANGQRFSCDFGNSM  311

Query  435   VKLGNLGVLTGKDNGQIRKICGSVN  361
             VK+GN+  LTG   GQIRK C +VN
Sbjct  312   VKMGNISPLTGS-AGQIRKNCRAVN  335



>ref|XP_010695722.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   309 bits (791),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 164/324 (51%), Positives = 203/324 (63%), Gaps = 17/324 (5%)
 Frame = -3

Query  1323  VAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHF  1144
             VA  LVV +G      + +QL   FY  SCPNL   V+  V SA+ N++RM ASL+RL F
Sbjct  14    VAYLLVVSIG-----NSNAQLSTNFYSSSCPNLLSTVKSVVQSAVNNEARMGASLLRLFF  68

Query  1143  HDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDIL  964
             HDCFVNGCDGSVLLDDT  F GEKN  PN  S RGF+V+D IK  VEKACP  VSC DIL
Sbjct  69    HDCFVNGCDGSVLLDDTSSFTGEKNAFPNAGSLRGFDVVDQIKTAVEKACPGVVSCADIL  128

Query  963   TLAASYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKD  787
              ++A  +V + GGP W V LGRRD  TAS+ A    +P+P  SL  +   FS QGL   D
Sbjct  129   AISARDSVVILGGPTWNVKLGRRDATTASQSAANTNIPAPTASLSALIKSFSDQGLSTTD  188

Query  786   MVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCP--NVDGSNTKLA  613
             MV LSGAH++G A+C TF+ R++N       +  +++SF    Q  CP  +  GSN  LA
Sbjct  189   MVALSGAHTIGQARCTTFRTRIYN-------ESNIDASFAKTRQANCPSASTSGSN-NLA  240

Query  612   PLDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMV  433
             PLD Q+   FDN YY NLVN  GLL SDQ L +   T  +V+ YS+ P RF  DF  +M+
Sbjct  241   PLDIQTPNTFDNKYYNNLVNQKGLLHSDQQLFSGGSTNALVQTYSSNPSRFNTDFVAAMI  300

Query  432   KLGNLGVLTGKDNGQIRKICGSVN  361
              +G++  LTG  NGQIRK C   N
Sbjct  301   NMGDVKPLTGS-NGQIRKNCRKTN  323



>emb|CDP13933.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 160/323 (50%), Positives = 208/323 (64%), Gaps = 9/323 (3%)
 Frame = -3

Query  1323  VAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHF  1144
             V+ SL + + FL      +QL   FY  SCPNL   V+  V SAI  ++RM ASL+RL F
Sbjct  6     VSSSLTICVLFLVIGSTSAQLSTNFYYHSCPNLFSTVKSTVQSAISKEARMGASLLRLFF  65

Query  1143  HDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDIL  964
             HDCFVNGCDGSVLLDDT  F+GEK   PN NSARGFEV+D+IK+ VE+ACP  VSC D+L
Sbjct  66    HDCFVNGCDGSVLLDDTSSFRGEKRAAPNFNSARGFEVVDNIKSAVERACPGVVSCADVL  125

Query  963   TLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQ-LPSPFESLKDITAKFSAQGLDLKD  787
              +AA  +V + GGP W V LGRRD  TAS+ A    +P P  +L  + ++FSA GL  +D
Sbjct  126   AIAARDSVEILGGPRWDVKLGRRDARTASQAAANNSIPPPTTNLNALISRFSAVGLSARD  185

Query  786   MVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGS-NTKLAP  610
             +V LSG+H++G A+C  F+ R++N   +      L+SS     Q+ CP+V GS +  LAP
Sbjct  186   LVALSGSHTIGLARCTNFRARIYNETNN------LDSSLARTRQSNCPSVSGSGDNNLAP  239

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             LD Q+   FDN+Y+ NLVN  GLL SDQ L     T   V+ YS  P  F  DFA +M+K
Sbjct  240   LDLQTPTNFDNNYFKNLVNRRGLLHSDQQLFNGGSTDSAVRAYSNNPGSFASDFAAAMIK  299

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +G++  LTG  NG+IRK C  +N
Sbjct  300   MGDIKPLTGS-NGEIRKNCRRIN  321



>ref|XP_010087404.1| Peroxidase 59 [Morus notabilis]
 gb|EXB29014.1| Peroxidase 59 [Morus notabilis]
Length=334

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 209/311 (67%), Gaps = 12/311 (4%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             A SQL   FY ++CP L MIVR G+++A++ + RMAASLIRLHFHDCFVNGCD S+LLD 
Sbjct  28    ARSQLTTDFYYKTCPKLGMIVRKGLFNALKTEMRMAASLIRLHFHDCFVNGCDASLLLD-  86

Query  1095  TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYW  916
               G   EK   PN NSARGFEVID+IK+ VE  C   VSC DIL LAA  +V +SGG  W
Sbjct  87    --GEDSEKLAGPNLNSARGFEVIDTIKSAVESECSGVVSCADILALAARDSVLLSGGRSW  144

Query  915   RVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCF  739
             RVLLGRRDGL A++  A   LPSPF+SL+ I  KF   GL++ D+V LSGAH++G A+C 
Sbjct  145   RVLLGRRDGLVANKTGANILLPSPFDSLETIITKFLNPGLNITDVVALSGAHTIGQAKCA  204

Query  738   TFKRRLFNYQGSGKPDPTLESSFLSNLQTTCP-NVDGSNTKLAPLDYQSTYRFDNSYYTN  562
              F  RLFN+ G+G  DPTLE++ L++LQ+ CP N DG+ T    LD  ST  FDN Y+TN
Sbjct  205   FFNNRLFNFSGTGAGDPTLETTMLNDLQSLCPLNEDGNKT--TALDRNSTDLFDNHYFTN  262

Query  561   LVNNTGLLESDQALMANP----QTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDN  394
             L+   GLL SDQ L ++      T  +V+ YS  P  F  DF  SM K+GN+  LTG   
Sbjct  263   LLVGKGLLSSDQILFSSAAAVNTTKSLVESYSTNPDLFLEDFVNSMRKMGNISPLTGSA-  321

Query  393   GQIRKICGSVN  361
             G+IRK C  VN
Sbjct  322   GEIRKNCRVVN  332



>ref|XP_007137608.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
 gb|ESW09602.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
Length=320

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/323 (50%), Positives = 207/323 (64%), Gaps = 12/323 (4%)
 Frame = -3

Query  1323  VAISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHF  1144
             + IS V+FL  L    A +QL   FY  SCP L   V+  + SAI  ++R+ ASL+RL F
Sbjct  8     LTISFVLFLLVLGC--ANAQLSTNFYYTSCPKLLSTVKSSMQSAISKETRIGASLLRLFF  65

Query  1143  HDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDIL  964
             HDCFVNGCDGS+LLDDT  F GEKN  PNRNSARG+EVIDSIK+ VEK CP  VSC DIL
Sbjct  66    HDCFVNGCDGSILLDDTSSFTGEKNANPNRNSARGYEVIDSIKSAVEKVCPGVVSCADIL  125

Query  963   TLAASYAVGMSGGPYWRVLLGRRDGLTASEEATKQ-LPSPFESLKDITAKFSAQGLDLKD  787
              +AA  +VG+ GGP W V LGRRD  TAS+ A    +P P  +L  + +KFSA GL  KD
Sbjct  126   AIAARDSVGILGGPTWDVKLGRRDARTASQSAANSAIPPPTSNLNQLISKFSAVGLSTKD  185

Query  786   MVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGS-NTKLAP  610
             MV LSG H++G ++C +F+ R++N       +  +++SF    Q++CP   GS +  LAP
Sbjct  186   MVALSGGHTIGQSRCTSFRARIYN-------ESNIDTSFARTRQSSCPRTSGSGDNNLAP  238

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             LD Q+   FDN Y+ NLV   GLL SDQ L     T  +V+ YS  P  F  DF T+M+K
Sbjct  239   LDLQTPTSFDNYYFKNLVQKKGLLHSDQQLFNGGSTDSIVRGYSTNPSSFSSDFVTAMIK  298

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +G++  LTG   G++RK C  +N
Sbjct  299   MGDITPLTGS-KGEVRKNCRRIN  320



>emb|CCJ34831.1| horseradish peroxidase isoenzyme HRP_1350 [Armoracia rusticana]
Length=324

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/323 (49%), Positives = 209/323 (65%), Gaps = 14/323 (4%)
 Frame = -3

Query  1311  LVVFLGFLAA----PMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHF  1144
             LV+ + FL       + E+QL   FY  SCPNL   V+  V SA+ +++RM AS++RL F
Sbjct  10    LVLVVTFLVQGNYNNVVEAQLTPNFYSTSCPNLLSTVQSAVKSAVNSEARMGASIVRLFF  69

Query  1143  HDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDIL  964
             HDCFVNGCDGS+LLDDT  F GE+N  PNRNSARGF VID+IKA VEKACP  VSC DIL
Sbjct  70    HDCFVNGCDGSILLDDTSSFTGEQNANPNRNSARGFNVIDNIKAAVEKACPGVVSCADIL  129

Query  963   TLAASYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKD  787
              +AA  +V + GGP W V +GRRD  TAS+ A    +P+P  SL  + + FSA GL  +D
Sbjct  130   AIAARDSVVVLGGPNWTVKVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRD  189

Query  786   MVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGS-NTKLAP  610
             MV LSGAH++G ++C +F+ R++N       +  + ++F +  Q TCP   GS +  LAP
Sbjct  190   MVALSGAHTIGQSRCTSFRTRIYN-------ETNINAAFATTRQRTCPRTSGSGDGNLAP  242

Query  609   LDYQSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVK  430
             LD  +   FDN+Y+ NL+   GLL SDQ L     T  +V+ YS  P  F  DFA +M+K
Sbjct  243   LDVTTAASFDNNYFKNLMTQRGLLHSDQELFNGGSTDSIVRGYSNNPSSFSSDFAAAMIK  302

Query  429   LGNLGVLTGKDNGQIRKICGSVN  361
             +G++  LTG  +G+IRK+CG  N
Sbjct  303   MGDISPLTGS-SGEIRKVCGRTN  324



>ref|XP_003561850.1| PREDICTED: peroxidase N-like [Brachypodium distachyon]
Length=334

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 168/328 (51%), Positives = 210/328 (64%), Gaps = 17/328 (5%)
 Frame = -3

Query  1311  LVVFLGFLAAPM------AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRL  1150
             L   LG +AA +      A  +L   FYD  CPNLD IVR  V +A++ + RM ASL+RL
Sbjct  13    LCCLLGVVAAVLLCLGTAASGELTDDFYDDCCPNLDRIVRARVSAAMKAEPRMGASLLRL  72

Query  1149  HFHDCFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTD  970
             HFHDCFVNGCDGS+LLD   G   EK   PN NSARGFEV+D+IKAD+E+ACP  VSC D
Sbjct  73    HFHDCFVNGCDGSILLD---GSNSEKLAAPNLNSARGFEVVDAIKADIERACPGHVSCAD  129

Query  969   ILTLAASYAVGMSGGPYWRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDL  793
             +L LAA Y V +SGGP + VLLGRRDGL A++  A   LP P +S+ DIT +F   GL+ 
Sbjct  130   VLALAAKYGVLLSGGPDYDVLLGRRDGLVANQSGADSNLPGPDDSISDITKRFKDVGLNT  189

Query  792   KDMVVLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLA  613
              DMVVLSG H++G ++C  F  RL N+  +   DPTL+S+  S+LQ  C   DG+ T  A
Sbjct  190   TDMVVLSGGHTIGRSRCALFSNRLANFSATNSVDPTLDSALASSLQQVCRGGDGNQT--A  247

Query  612   PLDYQSTYRFDNSYYTNLVNNTGLLESDQALMAN----PQTADMVKYYSAYPYRFYMDFA  445
              LD  S   FDN Y+ NL+   GLL SDQ L ++      T  +V+ Y A   RF+ DF 
Sbjct  248   ALDDGSADAFDNHYFKNLLAKKGLLSSDQILFSSADAAAATKALVQAYGADSQRFFCDFG  307

Query  444   TSMVKLGNLGVLTGKDNGQIRKICGSVN  361
              SMVK+GN+  LTG   GQIRK C +VN
Sbjct  308   NSMVKMGNIAPLTGS-AGQIRKKCRAVN  334



>ref|XP_006468993.1| PREDICTED: peroxidase 52-like [Citrus sinensis]
Length=319

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 204/320 (64%), Gaps = 11/320 (3%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ++L++ +  L A  + +QL   FY  SCPN   I R  +  A+    R AAS++RL FHD
Sbjct  10    VTLILSIISLLACTSNAQLSPTFYATSCPNFQRIARDEMTKAVNRQPRNAASILRLFFHD  69

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCDGSVLLDDT  F GEKN  PNRNSARGFEVID+IK  +E AC +TVSC DIL +
Sbjct  70    CFVNGCDGSVLLDDTATFTGEKNAGPNRNSARGFEVIDAIKTRLEAACNATVSCADILAV  129

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMV  781
             AA   V + GGP W V LGRRD  TAS+ A   Q+P P  SL  + + F+A+GL  +DM 
Sbjct  130   AARDGVALLGGPTWTVPLGRRDARTASQSAANSQIPGPSSSLATLISMFAAKGLTAQDMT  189

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
             VLSG H++GFA+C  F+ R++N       D  ++ +F +  +TTCP   G +  LAPLD 
Sbjct  190   VLSGGHAIGFARCAAFRNRIYN-------DTNIDPAFATTRRTTCP-ATGGDANLAPLD-  240

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
             Q+  RFDNSYY NLVN  GLL SDQ L         V+ YS  P  F  DFA +MVK+GN
Sbjct  241   QTPNRFDNSYYQNLVNRRGLLHSDQELFNGGSQDATVRGYSTNPASFARDFAAAMVKMGN  300

Query  420   LGVLTGKDNGQIRKICGSVN  361
             +  LTG D G+IR+ C  VN
Sbjct  301   ISPLTGTD-GEIRRNCRVVN  319



>gb|KDO63401.1| hypothetical protein CISIN_1g020966mg [Citrus sinensis]
Length=319

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 204/320 (64%), Gaps = 11/320 (3%)
 Frame = -3

Query  1317  ISLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHD  1138
             ++L++ +  L A  + +QL   FY  SCPN   I R  +  A+    R AAS++RL FHD
Sbjct  10    VTLILTIISLLACTSNAQLSPTFYATSCPNFQRIARDEMTKAVNRQPRNAASILRLFFHD  69

Query  1137  CFVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTL  958
             CFVNGCDGSVLLDDT  F GEKN  PNRNSARGFEVID+IK  +E AC +TVSC DIL +
Sbjct  70    CFVNGCDGSVLLDDTATFTGEKNAGPNRNSARGFEVIDAIKTRLEAACNATVSCADILAV  129

Query  957   AASYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMV  781
             AA   V + GGP W V LGRRD  TAS+ A   Q+P P  SL  + + F+A+GL  +DM 
Sbjct  130   AARDGVALLGGPTWTVPLGRRDARTASQSAANSQIPGPSSSLATLISMFAAKGLTAQDMT  189

Query  780   VLSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDY  601
             VLSG H++GFA+C  F+ R++N       D  ++ +F +  +TTCP   G +  LAPLD 
Sbjct  190   VLSGGHAIGFARCAAFRNRIYN-------DTNIDPAFATTRRTTCP-ATGGDPNLAPLD-  240

Query  600   QSTYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGN  421
             Q+  RFDNSYY NLVN  GLL SDQ L         V+ YS  P  F  DFA +MVK+GN
Sbjct  241   QTPNRFDNSYYQNLVNRRGLLHSDQELFNGGSQDATVRGYSTNPASFARDFAAAMVKMGN  300

Query  420   LGVLTGKDNGQIRKICGSVN  361
             +  LTG  NG+IR+ C  VN
Sbjct  301   ISPLTGT-NGEIRRNCRVVN  319



>emb|CAL25298.1| properoxidase [Picea abies]
Length=341

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/304 (49%), Positives = 204/304 (67%), Gaps = 4/304 (1%)
 Frame = -3

Query  1263  LDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGF  1084
             L + FY +SCP    I++  V  A+R ++ MAASL+RLHFHDCFV GCDGS+LLDDT  F
Sbjct  39    LSHHFYYKSCPKAQAIIKSVVEDAVRKEAGMAASLLRLHFHDCFVKGCDGSILLDDTSSF  98

Query  1083  KGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVLL  904
               EK   PNRNS RGF V+D IK ++EKACP  VSC DIL +AA  +VG SGGP+W+VLL
Sbjct  99    TREKTANPNRNSVRGFGVVDQIKCELEKACPGVVSCADILAVAARDSVGFSGGPFWKVLL  158

Query  903   GRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKR  727
             GRRD  +AS+  A   +P P  + + +  KF  QGL++ D+V LSGAH++G A+C +FK 
Sbjct  159   GRRDSRSASKSGANNDIPGPNSTHQTLETKFKRQGLNVVDLVALSGAHTIGLARCSSFKA  218

Query  726   RLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNT  547
             RL+N   +GKPDPTL++++L +L+  CP     + +  PLD  +  RFD +YY N+V   
Sbjct  219   RLYNQTVNGKPDPTLDTTYLKHLRAVCPQTGTDDNQTTPLDPVTPIRFDINYYDNVVAGK  278

Query  546   GLLESDQALMANP--QTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKIC  373
             GLL SD+ L +    +T  +V+ YS   + F+  FA SM+K+GN+  LTG  +G+IRK C
Sbjct  279   GLLASDEILYSTKGSRTVGLVESYSTSTHAFFKQFAASMIKMGNINPLTG-SHGEIRKNC  337

Query  372   GSVN  361
               +N
Sbjct  338   RRMN  341



>gb|KFK30268.1| hypothetical protein AALP_AA7G239300 [Arabis alpina]
Length=331

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/299 (51%), Positives = 204/299 (68%), Gaps = 4/299 (1%)
 Frame = -3

Query  1251  FYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEK  1072
             +Y  SCP    IVR  V  A+  ++RMAASL+RLHFHDCFV GCDGS+LLD +   K EK
Sbjct  34    YYAHSCPQAGEIVRSVVAKAVAKETRMAASLVRLHFHDCFVQGCDGSLLLDTSGRIKSEK  93

Query  1071  NGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRD  892
             +  PN  SARGF+V+D IKA++EK CP TVSC D+LTLAA  +  +SGGP W V LGRRD
Sbjct  94    SSNPNSKSARGFDVVDQIKAELEKQCPGTVSCADVLTLAARDSSVLSGGPSWVVPLGRRD  153

Query  891   GLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFN  715
               +AS   +   +P+P  + + I  KF+ QGLD+ D+V LSG+H++GF++C +F++RL+N
Sbjct  154   SRSASLSGSNNNIPAPNNTFQTILTKFNRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYN  213

Query  714   YQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLE  535
               G+G PD TLE SF +NL+  CP   G +  L+ LD  S  RFDNSY+ NL+ N GLL 
Sbjct  214   QSGNGSPDMTLEQSFAANLRQRCPR-SGGDQILSVLDIISAARFDNSYFKNLIENKGLLN  272

Query  534   SDQALM-ANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
             SDQ L  +N ++ ++VK Y+     F+  FA SM+K+GN+  LTG  NG+IRK C  +N
Sbjct  273   SDQVLFSSNEKSRELVKKYAEDQEEFFEQFAESMIKMGNISPLTG-SNGEIRKNCRKIN  330



>ref|XP_009138426.1| PREDICTED: peroxidase 49 [Brassica rapa]
Length=331

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 202/299 (68%), Gaps = 4/299 (1%)
 Frame = -3

Query  1251  FYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEK  1072
             FY  SCP    IVR  V  A+  ++RMAASLIRLHFHDCFV GCDGS+LLD +     EK
Sbjct  34    FYAHSCPQAGEIVRSVVAKAVARETRMAASLIRLHFHDCFVQGCDGSLLLDSSGRITSEK  93

Query  1071  NGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRD  892
             N  PNR SARGF+V+D IKA +EK CP TVSC D LTLAA  +  ++GGP W V LGRRD
Sbjct  94    NSNPNRKSARGFDVVDQIKAQLEKECPGTVSCADALTLAARDSSVLTGGPSWMVPLGRRD  153

Query  891   GLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFN  715
               +AS   +   +P+P  + + I  KF  QGLD+ D+V LSG+H++GF++C +F++RL+N
Sbjct  154   SRSASLSGSNNNIPAPNNTFQTILTKFKRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYN  213

Query  714   YQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLE  535
               G+G+PD TLE SF +NL+  CP   G +  L+ LD  S  +FDNSY+ NLV N GLL 
Sbjct  214   QSGNGRPDMTLEQSFAANLRQKCPR-SGGDQILSVLDKVSPAKFDNSYFKNLVENMGLLN  272

Query  534   SDQALM-ANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
             SDQ L  +N ++ ++VK Y+     F+  FA SM+K+GN+  LTG  +G+IRK C  +N
Sbjct  273   SDQVLFSSNDKSRELVKKYAEDQGEFFEQFAESMIKMGNISPLTG-SSGEIRKNCRKIN  330



>ref|XP_002520835.1| Peroxidase 52 precursor, putative [Ricinus communis]
 gb|EEF41544.1| Peroxidase 52 precursor, putative [Ricinus communis]
Length=318

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 156/319 (49%), Positives = 203/319 (64%), Gaps = 10/319 (3%)
 Frame = -3

Query  1314  SLVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDC  1135
             ++V     L   ++ +QL   FY +SCPNL   V+  V SAI  + RM ASL+RL FHDC
Sbjct  9     TIVTLSLLLVVSISNAQLSTNFYSKSCPNLFSTVKPVVQSAINQEKRMGASLVRLFFHDC  68

Query  1134  FVNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLA  955
             FVNGCDGS+LLDDT  F GE+  +PNRNS RGFEVIDSIK+ VEKACP  VSC DIL +A
Sbjct  69    FVNGCDGSILLDDTSSFTGEQTAVPNRNSVRGFEVIDSIKSAVEKACPGVVSCADILAIA  128

Query  954   ASYAVGMSGGPYWRVLLGRRDGLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMVV  778
             A  +  + GGP W V LGRRD  TAS   A   +P+P  +L  + ++FSA GL  +D+V 
Sbjct  129   ARDSTAILGGPSWNVKLGRRDARTASLSAANNGIPAPTSNLNQLISRFSALGLSTRDLVA  188

Query  777   LSGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQ  598
             LSGAH++G A+C  F+ R++N       D  ++SSF    ++ CP+  G N  LAPLD Q
Sbjct  189   LSGAHTIGQARCTNFRTRIYN-------DTNIDSSFAQTRRSNCPSTGGDN-NLAPLDLQ  240

Query  597   STYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNL  418
             +   FDN+Y+ NL+   GLL SDQ L  N  T  +V+ YS     F+ DF   M+K+G++
Sbjct  241   TPTSFDNNYFKNLLVQKGLLHSDQELFNNGSTDSIVRTYSNGQSTFFSDFVAGMIKMGDI  300

Query  417   GVLTGKDNGQIRKICGSVN  361
               LTG   G+IRK CG VN
Sbjct  301   SPLTGSQ-GEIRKNCGKVN  318



>ref|XP_007145699.1| hypothetical protein PHAVU_007G260800g [Phaseolus vulgaris]
 gb|AAD37430.1|AF149280_1 peroxidase 5 precursor [Phaseolus vulgaris]
 gb|ESW17693.1| hypothetical protein PHAVU_007G260800g [Phaseolus vulgaris]
Length=334

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 205/309 (66%), Gaps = 6/309 (2%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             +E QL   FY  +C N+  IVR  V  A+ +DSR+AASLIRLHFHDCFV+GCDGS+LLD 
Sbjct  26    SEGQLSASFYSSTCSNVSSIVRDSVQQALTSDSRIAASLIRLHFHDCFVDGCDGSILLDV  85

Query  1095  TKGF-KGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPY  919
                  + EKN  PN NS RGF+V+DSIK+ +E +CP+ VSC DIL LAA  +V +S GP 
Sbjct  86    GGNITESEKNAAPNENSVRGFDVVDSIKSTIEASCPAVVSCADILALAAEASVSLSQGPS  145

Query  918   WRVLLGRRDGLTASEE-ATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQC  742
             W VLLGRRD +TA++  A   LPSPFE+L ++++KFSA GLD  D+V LSGAH+ G +QC
Sbjct  146   WTVLLGRRDSVTANQGGANTSLPSPFENLTNVSSKFSAVGLDTTDLVALSGAHTFGRSQC  205

Query  741   FTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTN  562
               F +RL N+ G+G PDPTL +++L  LQ  CP  +G+   L  LD  +   FDN Y+TN
Sbjct  206   QFFSQRLLNFNGTGSPDPTLNTTYLGTLQQNCPQ-NGNGATLNNLDPSTPDTFDNKYFTN  264

Query  561   LVNNTGLLESDQALMAN--PQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQ  388
             L+ N GLL++DQ L +     T  +V  ++     F+  FA SM+ +GN+  LTG   GQ
Sbjct  265   LLINQGLLQTDQELFSTDGSSTISIVNNFANNQSAFFEAFAQSMINMGNISPLTGTQ-GQ  323

Query  387   IRKICGSVN  361
             IR  C  VN
Sbjct  324   IRTDCKKVN  332



>ref|XP_009593782.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=319

 Score =   307 bits (786),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 203/318 (64%), Gaps = 12/318 (4%)
 Frame = -3

Query  1311  LVVFLGFLAAPMAESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCF  1132
             L V LGF  A  + +QL   FY  SC NL  IV   +  A+  +SR+ AS++RL FHDCF
Sbjct  13    LCVLLGF--ACFSNAQLSANFYGTSCRNLQTIVSSAMRQAVNRESRLGASILRLFFHDCF  70

Query  1131  VNGCDGSVLLDDTKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAA  952
             VNGCD S+LLDDT  F GEKN  PNRNSARGFEVID+IK  VE ACP+ VSC DIL LAA
Sbjct  71    VNGCDASILLDDTATFTGEKNANPNRNSARGFEVIDTIKTQVEAACPNAVSCADILALAA  130

Query  951   SYAVGMSGGPYWRVLLGRRDGLTASEEATK-QLPSPFESLKDITAKFSAQGLDLKDMVVL  775
                V + GGP W V LGRRD  TAS+ A   Q+P+P  SL  + + FSA+GL+ +DM  L
Sbjct  131   REGVVLLGGPSWAVPLGRRDARTASQSAANTQIPAPTSSLSTLLSMFSAKGLNARDMTAL  190

Query  774   SGAHSVGFAQCFTFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQS  595
             SG H++G A+C TF+ R++N       D  +++ F +  + TCP+  G +  LAPLD Q+
Sbjct  191   SGGHTIGQARCTTFRTRIYN-------DTNIDAQFATTRRATCPS-SGGDANLAPLDIQT  242

Query  594   TYRFDNSYYTNLVNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLG  415
               RFDN YY NLV   GLL SDQ L        +V+ YS     F  DFA +MV++GN+ 
Sbjct  243   PNRFDNDYYQNLVARRGLLHSDQELFNGGSQDALVRSYSTNGAAFRSDFAAAMVRMGNIS  302

Query  414   VLTGKDNGQIRKICGSVN  361
              LTG  NG+IR+ C ++N
Sbjct  303   PLTGT-NGEIRRNCRAIN  319



>ref|XP_007048724.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOX92881.1| Peroxidase superfamily protein [Theobroma cacao]
Length=320

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 156/306 (51%), Positives = 198/306 (65%), Gaps = 10/306 (3%)
 Frame = -3

Query  1275  AESQLDYLFYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDD  1096
             A +QL   FY  SCPNL  IVR  +  A+  ++R+ AS++RL FHDCFVNGCD S+LLDD
Sbjct  24    ANAQLSPKFYANSCPNLQTIVRNAMTQAVNRETRIGASILRLFFHDCFVNGCDASILLDD  83

Query  1095  TKGFKGEKNGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYW  916
             T  F GEKN  PNRNSARGFEVID+IK  VE AC +TVSC DIL LAA   V +  GP W
Sbjct  84    TATFTGEKNAAPNRNSARGFEVIDTIKTSVEAACSATVSCADILALAARDGVVLLKGPSW  143

Query  915   RVLLGRRDGLTASEEAT-KQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCF  739
             +V LGRRD  TAS+ A   QLPSPF +L  +T+ F+A+GL  +D+  LSG H++G A+C 
Sbjct  144   QVPLGRRDARTASQSAANNQLPSPFSNLSALTSSFAAKGLSARDLTALSGGHTIGLARCT  203

Query  738   TFKRRLFNYQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNL  559
             TF+ R++N       D  ++ +F +N +  CP   G N  LAPLD Q+  RFDN Y+ NL
Sbjct  204   TFRGRIYN-------DTNIDPNFAANRRANCPASGGDN-NLAPLDIQTPTRFDNYYFRNL  255

Query  558   VNNTGLLESDQALMANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRK  379
             V   GLL SDQ L        +V+ YS  P  F  DFA +MV++GN+  LTG   G+IR+
Sbjct  256   VAQRGLLHSDQELFNGGSQDALVRTYSTNPEVFSSDFAAAMVRMGNISPLTGT-RGEIRR  314

Query  378   ICGSVN  361
              C  VN
Sbjct  315   NCRVVN  320



>ref|XP_006409192.1| hypothetical protein EUTSA_v10022774mg [Eutrema salsugineum]
 gb|ESQ50645.1| hypothetical protein EUTSA_v10022774mg [Eutrema salsugineum]
Length=336

 Score =   308 bits (788),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/299 (51%), Positives = 203/299 (68%), Gaps = 4/299 (1%)
 Frame = -3

Query  1251  FYDQSCPNLDMIVRWGVWSAIRNDSRMAASLIRLHFHDCFVNGCDGSVLLDDTKGFKGEK  1072
             FY  SCP  + IV+  V  A+  ++RMAASL+RLHFHDCFV GCDGS+LLD +     EK
Sbjct  39    FYSSSCPKAEEIVKSVVAQAVARETRMAASLMRLHFHDCFVQGCDGSLLLDTSGSIVTEK  98

Query  1071  NGLPNRNSARGFEVIDSIKADVEKACPSTVSCTDILTLAASYAVGMSGGPYWRVLLGRRD  892
             +  PN  SARGFEV+D IKA +E  CP TVSC D+LTLAA  +  ++GGP W V LGRRD
Sbjct  99    SSNPNSRSARGFEVVDQIKAALENECPGTVSCADVLTLAARDSSVLTGGPSWMVPLGRRD  158

Query  891   GLTAS-EEATKQLPSPFESLKDITAKFSAQGLDLKDMVVLSGAHSVGFAQCFTFKRRLFN  715
               TAS   +   +P+P  +   I ++F+ QGLDL D+V LSG+H++GF++C +F++RL+N
Sbjct  159   STTASLSGSNNNIPAPNNTFNTILSRFTNQGLDLTDLVALSGSHTIGFSRCTSFRQRLYN  218

Query  714   YQGSGKPDPTLESSFLSNLQTTCPNVDGSNTKLAPLDYQSTYRFDNSYYTNLVNNTGLLE  535
               G+G PD TLE S+ +NL+  CP   G +  L+ LD  S  RFDNSY+ NL+ N GLL 
Sbjct  219   QSGNGSPDSTLEQSYAANLRQMCPR-SGGDQNLSELDINSAGRFDNSYFKNLIENMGLLN  277

Query  534   SDQALM-ANPQTADMVKYYSAYPYRFYMDFATSMVKLGNLGVLTGKDNGQIRKICGSVN  361
             SDQ L  +N +++++VK Y+     F+  FA SMVK+GN+  LTG  +G+IRK C  VN
Sbjct  278   SDQVLFSSNEESSELVKKYAEDQEEFFEQFAESMVKMGNISPLTGS-SGEIRKNCRKVN  335



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3796438806888