BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84841_g1_i1 len=553 path=[531:0-552]

Length=553
                                                                      Score     E

ref|XP_010096873.1|  Aspartic proteinase                                157   6e-42   
gb|AEJ76922.1|  aspartic protease                                       148   8e-41   
ref|XP_009764301.1|  PREDICTED: aspartic proteinase A1-like             151   1e-40   
gb|KHG05834.1|  Asparticase                                             153   3e-40   
ref|XP_009600571.1|  PREDICTED: cyprosin-like                           152   8e-40   
gb|ABG37021.1|  aspartic protease                                       151   9e-40   Nicotiana tabacum [American tobacco]
ref|XP_009776125.1|  PREDICTED: aspartic proteinase-like                144   1e-39   
ref|XP_007049085.1|  Aspartic protease isoform 2                        150   2e-39   
gb|KCW46980.1|  hypothetical protein EUGRSUZ_K00787                     150   2e-39   
ref|XP_004243484.1|  PREDICTED: cyprosin-like                           150   2e-39   
ref|XP_007049084.1|  Aspartic proteinase A1 isoform 1                   150   3e-39   
gb|KDP39159.1|  hypothetical protein JCGZ_00916                         150   3e-39   
ref|XP_010035554.1|  PREDICTED: aspartic proteinase A1-like             150   5e-39   
ref|XP_006348142.1|  PREDICTED: aspartic proteinase-like                149   6e-39   
emb|CDP10762.1|  unnamed protein product                                149   8e-39   
ref|XP_006364164.1|  PREDICTED: aspartic proteinase-like                149   1e-38   
ref|XP_004232695.1|  PREDICTED: aspartic proteinase                     148   1e-38   
ref|XP_009629448.1|  PREDICTED: aspartic proteinase-like                147   2e-38   
ref|XP_008366438.1|  PREDICTED: aspartic proteinase A1-like isofo...    147   3e-38   
ref|XP_002298827.2|  aspartic protease family protein                   147   3e-38   Populus trichocarpa [western balsam poplar]
gb|KDO62074.1|  hypothetical protein CISIN_1g010230mg                   145   3e-38   
gb|AFB73927.2|  preprocirsin                                            147   4e-38   
ref|XP_011046729.1|  PREDICTED: aspartic proteinase A1-like             147   5e-38   
ref|XP_008366439.1|  PREDICTED: aspartic proteinase A1-like isofo...    147   6e-38   
ref|XP_011100273.1|  PREDICTED: cyprosin-like                           146   7e-38   
ref|XP_008380299.1|  PREDICTED: aspartic proteinase A1-like             145   1e-37   
gb|KHG04193.1|  Asparticase                                             145   1e-37   
gb|KDO62073.1|  hypothetical protein CISIN_1g010230mg                   145   1e-37   
emb|CAA57510.1|  cyprosin                                               145   2e-37   Cynara cardunculus [cardoon]
emb|CDP04424.1|  unnamed protein product                                145   3e-37   
gb|KDO62072.1|  hypothetical protein CISIN_1g010230mg                   144   3e-37   
gb|KDO62069.1|  hypothetical protein CISIN_1g010230mg                   144   3e-37   
ref|XP_006452415.1|  hypothetical protein CICLE_v10008027mg             144   3e-37   
ref|XP_006475035.1|  PREDICTED: aspartic proteinase-like                144   3e-37   
gb|KDO62068.1|  hypothetical protein CISIN_1g010230mg                   144   3e-37   
ref|XP_006449766.1|  hypothetical protein CICLE_v10014941mg             144   4e-37   
gb|KDO78302.1|  hypothetical protein CISIN_1g010233mg                   144   5e-37   
ref|XP_009587050.1|  PREDICTED: aspartic proteinase-like                144   6e-37   
ref|XP_007211824.1|  hypothetical protein PRUPE_ppa004375mg             144   6e-37   
ref|XP_004294396.1|  PREDICTED: aspartic proteinase A1-like             144   6e-37   
ref|XP_002529926.1|  Aspartic proteinase precursor, putative            143   8e-37   Ricinus communis
gb|KDO78303.1|  hypothetical protein CISIN_1g010233mg                   143   8e-37   
ref|XP_006467405.1|  PREDICTED: aspartic proteinase-like isoform X2     143   9e-37   
ref|XP_006467404.1|  PREDICTED: aspartic proteinase-like isoform X1     144   9e-37   
ref|XP_008226860.1|  PREDICTED: aspartic proteinase A1-like             143   1e-36   
gb|KCW88767.1|  hypothetical protein EUGRSUZ_A01109                     142   1e-36   
gb|AGE15494.1|  preprosilpepsin 1                                       142   2e-36   
ref|XP_009797823.1|  PREDICTED: aspartic proteinase                     142   2e-36   
ref|XP_010046321.1|  PREDICTED: aspartic proteinase A1-like             142   3e-36   
ref|XP_009361022.1|  PREDICTED: aspartic proteinase A1-like             142   3e-36   
gb|ACX55830.1|  aspartic proteinase 2                                   141   4e-36   Castanea mollissima
emb|CAA70340.1|  aspartic proteinase                                    141   4e-36   Centaurea calcitrapa
gb|ACX55829.1|  aspartic proteinase 1                                   141   5e-36   Castanea mollissima
dbj|BAB20971.1|  aspartic proteinase 3                                  141   5e-36   Nepenthes alata
gb|AHB32105.1|  aspartic proteinase                                     141   5e-36   
ref|XP_010252464.1|  PREDICTED: aspartic proteinase A1-like             141   6e-36   
gb|EYU27762.1|  hypothetical protein MIMGU_mgv1a004712mg                141   6e-36   
ref|XP_006303952.1|  hypothetical protein CARUB_v10008798mg             141   7e-36   
ref|XP_011046961.1|  PREDICTED: aspartic proteinase-like                140   1e-35   
ref|XP_006350474.1|  PREDICTED: aspartic proteinase-like                140   1e-35   
gb|KDP20718.1|  hypothetical protein JCGZ_21189                         140   2e-35   
ref|XP_006383885.1|  hypothetical protein POPTR_0004s00900g             140   2e-35   
gb|KDP24853.1|  hypothetical protein JCGZ_24447                         139   2e-35   
gb|KHG11144.1|  Aspartic proteinase                                     139   2e-35   
emb|CAC86003.1|  aspartic proteinase                                    139   2e-35   Theobroma cacao [chocolate]
ref|XP_007020768.1|  Aspartic proteinase A1                             139   2e-35   
gb|KHG11143.1|  Aspartic proteinase                                     139   3e-35   
dbj|BAA76870.1|  aspartic proteinase                                    139   3e-35   Helianthus annuus
emb|CAA56373.1|  putative aspartic protease                             135   3e-35   Brassica oleracea
ref|XP_011096039.1|  PREDICTED: aspartic proteinase-like                139   4e-35   
ref|XP_010476135.1|  PREDICTED: aspartic proteinase A1-like             139   4e-35   
ref|XP_008229973.1|  PREDICTED: aspartic proteinase A1-like             138   5e-35   
gb|AFH58568.1|  aspartic acid protease                                  138   5e-35   
ref|XP_002524837.1|  Aspartic proteinase precursor, putative            138   5e-35   Ricinus communis
ref|XP_007215237.1|  hypothetical protein PRUPE_ppa004349mg             138   6e-35   
ref|XP_009390744.1|  PREDICTED: aspartic proteinase oryzasin-1-like     138   7e-35   
ref|XP_010686810.1|  PREDICTED: aspartic proteinase A1-like             138   7e-35   
ref|XP_006389579.1|  aspartic endopeptidase family protein              138   7e-35   
ref|XP_007153978.1|  hypothetical protein PHAVU_003G0808000g            130   8e-35   
ref|XP_004231616.1|  PREDICTED: aspartic proteinase                     138   8e-35   
ref|XP_009395027.1|  PREDICTED: aspartic proteinase oryzasin-1-like     137   9e-35   
ref|XP_003567869.1|  PREDICTED: phytepsin                               137   9e-35   
ref|XP_008342027.1|  PREDICTED: aspartic proteinase A1-like             137   1e-34   
gb|KDO54711.1|  hypothetical protein CISIN_1g009634mg                   137   1e-34   
gb|KHG16917.1|  Asparticase                                             137   2e-34   
ref|XP_010458606.1|  PREDICTED: aspartic proteinase A1                  136   2e-34   
ref|XP_007026133.1|  Saposin-like aspartyl protease family protein      136   2e-34   
ref|XP_011008023.1|  PREDICTED: aspartic proteinase-like                136   2e-34   
gb|KGN56078.1|  hypothetical protein Csa_3G066750                       136   4e-34   
gb|EYU33885.1|  hypothetical protein MIMGU_mgv1a004716mg                136   4e-34   
gb|KDO54713.1|  hypothetical protein CISIN_1g009634mg                   135   4e-34   
ref|XP_010493478.1|  PREDICTED: aspartic proteinase A1-like             135   6e-34   
gb|KDO54714.1|  hypothetical protein CISIN_1g009634mg                   135   6e-34   
ref|XP_002279049.1|  PREDICTED: aspartic proteinase A1                  135   7e-34   Vitis vinifera
ref|XP_009353298.1|  PREDICTED: aspartic proteinase A1-like             135   7e-34   
ref|XP_009347130.1|  PREDICTED: aspartic proteinase A1-like             135   8e-34   
ref|XP_006447588.1|  hypothetical protein CICLE_v10017754mg             135   8e-34   
ref|XP_006469663.1|  PREDICTED: aspartic proteinase-like                135   9e-34   
ref|XP_009123365.1|  PREDICTED: aspartic proteinase A2 isoform X1       135   9e-34   
ref|XP_010455729.1|  PREDICTED: aspartic proteinase A3 isoform X2       135   9e-34   
emb|CDY24888.1|  BnaA03g59920D                                          135   9e-34   
gb|AFX73039.1|  preprogaline A                                          134   1e-33   
ref|XP_010455726.1|  PREDICTED: aspartic proteinase A3 isoform X1       134   1e-33   
ref|XP_008797519.1|  PREDICTED: aspartic proteinase oryzasin-1-like     134   1e-33   
ref|XP_003632941.1|  PREDICTED: aspartic proteinase A1                  134   2e-33   
ref|XP_010244477.1|  PREDICTED: aspartic proteinase A1-like isofo...    134   2e-33   
ref|XP_010926216.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    134   2e-33   
dbj|BAA06876.1|  aspartic protease                                      134   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010244475.1|  PREDICTED: aspartic proteinase A1-like isofo...    134   2e-33   
ref|XP_002872693.1|  aspartyl protease family protein                   134   2e-33   
ref|XP_010271042.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    133   2e-33   
gb|AAN60347.1|  unknown                                                 125   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010546667.1|  PREDICTED: aspartic proteinase A1-like             134   2e-33   
emb|CDY08632.1|  BnaC04g19410D                                          134   2e-33   
ref|XP_010926197.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    133   3e-33   
ref|NP_001056348.1|  Os05g0567100                                       133   3e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004287958.1|  PREDICTED: aspartic proteinase A1-like             133   3e-33   
ref|XP_010271040.1|  PREDICTED: aspartic proteinase-like isoform X1     133   3e-33   
ref|XP_010271041.1|  PREDICTED: aspartic proteinase-like isoform X2     133   3e-33   
ref|XP_006654801.1|  PREDICTED: aspartic proteinase oryzasin-1-like     133   3e-33   
dbj|BAB20969.1|  aspartic proteinase 1                                  133   3e-33   Nepenthes alata
ref|XP_002302872.2|  aspartic endopeptidase family protein              133   4e-33   Populus trichocarpa [western balsam poplar]
sp|P42210.1|ASPR_HORVU  RecName: Full=Phytepsin; AltName: Full=As...    132   5e-33   Hordeum vulgare [barley]
ref|NP_172655.1|  aspartic proteinase A1                                132   5e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CAC86004.1|  aspartic proteinase                                    132   5e-33   Theobroma cacao [chocolate]
dbj|BAE20413.1|  aspartic proteinase                                    132   6e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009118162.1|  PREDICTED: aspartic proteinase A1                  132   6e-33   
ref|XP_011006459.1|  PREDICTED: cyprosin-like isoform X2                132   6e-33   
ref|XP_010060310.1|  PREDICTED: aspartic proteinase A1-like             132   6e-33   
gb|AGP76185.1|  aspartic proteinase                                     132   6e-33   
ref|XP_010432806.1|  PREDICTED: aspartic proteinase A3-like isofo...    132   7e-33   
gb|AAC49730.1|  aspartic proteinase                                     132   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190671.1|  aspartic proteinase A3                             132   7e-33   
ref|NP_192355.1|  aspartic proteinase A3                                132   7e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CAM12780.1|  aspartic proteinase                                    132   7e-33   Fagopyrum esculentum
ref|XP_010553449.1|  PREDICTED: aspartic proteinase A1                  132   7e-33   
ref|XP_010432791.1|  PREDICTED: aspartic proteinase A3-like isofo...    132   7e-33   
emb|CDY34819.1|  BnaA09g47450D                                          133   8e-33   
ref|XP_011006458.1|  PREDICTED: cyprosin-like isoform X1                132   8e-33   
ref|XP_008440898.1|  PREDICTED: aspartic proteinase                     132   9e-33   
ref|XP_004151126.1|  PREDICTED: aspartic proteinase-like                132   9e-33   
ref|XP_004161880.1|  PREDICTED: aspartic proteinase-like                132   1e-32   
ref|XP_010496363.1|  PREDICTED: aspartic proteinase A3-like             132   1e-32   
ref|XP_006391910.1|  hypothetical protein EUTSA_v10023414mg             132   1e-32   
gb|AAB60773.1|  Strong similarity to Brassica aspartic protease (...    131   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAV84085.2|  aspartic proteinase 9                                   131   1e-32   Fagopyrum esculentum
ref|XP_008800700.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    131   1e-32   
ref|XP_008800699.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    131   1e-32   
ref|XP_002518445.1|  Aspartic proteinase precursor, putative            131   2e-32   Ricinus communis
dbj|BAB20970.1|  aspartic proteinase 2                                  131   2e-32   Nepenthes alata
ref|XP_007207363.1|  hypothetical protein PRUPE_ppa004505mg             131   2e-32   
ref|XP_004961190.1|  PREDICTED: aspartic proteinase oryzasin-1-like     131   2e-32   
ref|NP_176419.2|  aspartic proteinase A2                                131   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004173866.1|  PREDICTED: aspartic proteinase-like                128   2e-32   
gb|AAB03108.1|  aspartic protease                                       130   3e-32   Brassica napus [oilseed rape]
ref|XP_010924299.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    130   3e-32   
ref|XP_002892661.1|  aspartyl protease family protein                   130   3e-32   
ref|XP_006417290.1|  hypothetical protein EUTSA_v10007418mg             130   3e-32   
gb|ADE74632.1|  aspartic protease 1                                     130   4e-32   
ref|NP_001148782.1|  aspartic proteinase oryzasin-1 precursor           130   4e-32   Zea mays [maize]
ref|XP_008647844.1|  PREDICTED: aspartic proteinase oryzasin-1 is...    130   4e-32   
ref|XP_009608676.1|  PREDICTED: cyprosin-like                           129   7e-32   
ref|XP_008371074.1|  PREDICTED: aspartic proteinase                     129   7e-32   
ref|XP_006286432.1|  hypothetical protein CARUB_v10003637mg             129   7e-32   
ref|XP_010099183.1|  Aspartic proteinase                                129   1e-31   
ref|XP_010418214.1|  PREDICTED: aspartic proteinase A2 isoform X2       129   1e-31   
ref|XP_004145121.1|  PREDICTED: aspartic proteinase-like                129   1e-31   
ref|XP_010418210.1|  PREDICTED: aspartic proteinase A2 isoform X1       129   1e-31   
gb|KGN64503.1|  Aspartic proteinase                                     129   1e-31   
ref|XP_009415269.1|  PREDICTED: aspartic proteinase oryzasin-1-like     129   1e-31   
gb|ACN24614.1|  aspartic acid protease                                  129   1e-31   
gb|EPS66177.1|  hypothetical protein M569_08599                         127   2e-31   
gb|KDO45248.1|  hypothetical protein CISIN_1g010486mg                   127   2e-31   
ref|XP_010241437.1|  PREDICTED: cyprosin-like                           128   2e-31   
ref|XP_011087560.1|  PREDICTED: aspartic proteinase-like isoform X1     128   2e-31   
ref|XP_011087561.1|  PREDICTED: aspartic proteinase-like isoform X2     128   2e-31   
pdb|1QDM|A  Chain A, Crystal Structure Of Prophytepsin, A Zymogen...    128   2e-31   
emb|CDY16668.1|  BnaA09g20460D                                          127   3e-31   
ref|XP_009114571.1|  PREDICTED: aspartic proteinase A3 isoform X1       127   3e-31   
emb|CDX94554.1|  BnaC09g22820D                                          127   3e-31   
ref|XP_002886481.1|  aspartyl protease family protein                   127   4e-31   
ref|XP_009394234.1|  PREDICTED: aspartic proteinase oryzasin-1-like     127   4e-31   
emb|CAA48939.1|  cyprosin                                               127   4e-31   Cynara cardunculus [cardoon]
ref|XP_008246320.1|  PREDICTED: aspartic proteinase-like                127   4e-31   
ref|XP_009801963.1|  PREDICTED: cyprosin-like                           127   4e-31   
ref|XP_011039044.1|  PREDICTED: aspartic proteinase-like                127   5e-31   
ref|XP_009134301.1|  PREDICTED: aspartic proteinase A3-like             127   5e-31   
ref|XP_003529645.1|  PREDICTED: aspartic proteinase-like isoform X1     127   5e-31   
emb|CDX90864.1|  BnaA03g25440D                                          127   5e-31   
gb|KHN35722.1|  Aspartic proteinase                                     127   5e-31   
sp|P40782.2|CYPR1_CYNCA  RecName: Full=Cyprosin; Flags: Precursor       127   5e-31   Cynara cardunculus [cardoon]
gb|KDO45247.1|  hypothetical protein CISIN_1g010486mg                   127   5e-31   
gb|KDO45246.1|  hypothetical protein CISIN_1g010486mg                   127   6e-31   
ref|XP_010430270.1|  PREDICTED: aspartic proteinase A2-like             127   6e-31   
emb|CDY21302.1|  BnaC03g29860D                                          127   7e-31   
ref|XP_009416572.1|  PREDICTED: aspartic proteinase-like isoform X2     126   7e-31   
dbj|BAB20973.1|  aspartic proteinase 5                                  125   8e-31   Nepenthes alata
ref|XP_009416564.1|  PREDICTED: aspartic proteinase-like isoform X1     126   8e-31   
gb|ADM73842.1|  aspartyl protease-like protein                          120   9e-31   
gb|AAB03843.2|  aspartic proteinase                                     126   9e-31   Vigna unguiculata
ref|XP_002319454.2|  aspartic proteinase 2                              126   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_010052871.1|  PREDICTED: aspartic proteinase                     126   1e-30   
gb|KCW77002.1|  hypothetical protein EUGRSUZ_D01351                     126   1e-30   
ref|XP_010539208.1|  PREDICTED: aspartic proteinase A3-like isofo...    126   1e-30   
ref|XP_008800325.1|  PREDICTED: aspartic proteinase-like isoform X1     126   1e-30   
ref|XP_009358756.1|  PREDICTED: aspartic proteinase-like                126   1e-30   
ref|XP_008800328.1|  PREDICTED: aspartic proteinase-like isoform X2     126   1e-30   
ref|XP_010539213.1|  PREDICTED: aspartic proteinase A3-like isofo...    126   1e-30   
ref|XP_010659762.1|  PREDICTED: aspartic proteinase A1 isoform X2       126   1e-30   
gb|ADM73810.1|  aspartyl protease-like protein                          119   1e-30   
gb|ADM73798.1|  aspartyl protease-like protein                          119   1e-30   
gb|ADM73795.1|  aspartyl protease-like protein                          119   1e-30   
ref|XP_009421489.1|  PREDICTED: aspartic proteinase oryzasin-1-like     126   1e-30   
ref|XP_002276363.3|  PREDICTED: aspartic proteinase A1 isoform X1       126   1e-30   Vitis vinifera
ref|XP_006428328.1|  hypothetical protein CICLE_v10011525mg             125   2e-30   
ref|XP_011023864.1|  PREDICTED: aspartic proteinase-like                125   2e-30   
ref|XP_004134774.1|  PREDICTED: aspartic proteinase-like                125   2e-30   
ref|XP_008649363.1|  PREDICTED: aspartic proteinase oryzasin-1-like     121   2e-30   
dbj|BAB20972.1|  aspartic proteinase 4                                  125   2e-30   Nepenthes alata
ref|XP_006396693.1|  hypothetical protein EUTSA_v10028587mg             125   2e-30   
gb|AAC34854.1|  senescence-associated protein 4                         125   2e-30   Hemerocallis hybrid cultivar
ref|XP_006396692.1|  hypothetical protein EUTSA_v10028587mg             125   2e-30   
ref|XP_008784384.1|  PREDICTED: aspartic proteinase oryzasin-1-like     125   3e-30   
ref|XP_006428329.1|  hypothetical protein CICLE_v10011525mg             124   3e-30   
ref|XP_010042427.1|  PREDICTED: aspartic proteinase-like isoform X2     124   4e-30   
ref|XP_009419881.1|  PREDICTED: aspartic proteinase oryzasin-1-like     124   4e-30   
ref|XP_006838131.1|  hypothetical protein AMTR_s00106p00075970          124   4e-30   
ref|XP_010529449.1|  PREDICTED: aspartic proteinase A3                  124   4e-30   
ref|XP_009771336.1|  PREDICTED: aspartic proteinase A1-like isofo...    124   5e-30   
ref|XP_011086197.1|  PREDICTED: aspartic proteinase A1-like isofo...    124   5e-30   
ref|XP_009771335.1|  PREDICTED: aspartic proteinase A1-like isofo...    124   5e-30   
emb|CDY21021.1|  BnaA08g25040D                                          124   6e-30   
ref|XP_009110686.1|  PREDICTED: aspartic proteinase A1-like             124   6e-30   
ref|XP_010042419.1|  PREDICTED: aspartic proteinase-like isoform X1     124   6e-30   
ref|XP_006840365.1|  hypothetical protein AMTR_s00045p00122510          124   6e-30   
ref|XP_011086196.1|  PREDICTED: aspartic proteinase A1-like isofo...    124   6e-30   
ref|XP_004507671.1|  PREDICTED: aspartic proteinase-like isoform X1     124   7e-30   
gb|KDP28021.1|  hypothetical protein JCGZ_19101                         124   7e-30   
sp|Q9XFX3.1|CARDA_CYNCA  RecName: Full=Procardosin-A; Contains: R...    124   7e-30   Cynara cardunculus [cardoon]
ref|XP_010649704.1|  PREDICTED: aspartic proteinase                     124   8e-30   
ref|XP_010926196.1|  PREDICTED: aspartic proteinase oryzasin-1-like     124   9e-30   
ref|XP_006301275.1|  hypothetical protein CARUB_v10021675mg             123   1e-29   
gb|KHN03495.1|  Aspartic proteinase                                     123   1e-29   
ref|NP_001237064.1|  aspartic proteinase 1 precursor                    123   1e-29   
gb|ABI78942.1|  aspartic protease                                       123   1e-29   Ipomoea batatas [batate]
gb|KHN33009.1|  Aspartic proteinase                                     123   1e-29   
ref|XP_006600236.1|  PREDICTED: aspartic proteinase 1 isoform X1        123   1e-29   
ref|XP_003546159.1|  PREDICTED: aspartic proteinase-like                123   1e-29   
gb|KDP23334.1|  hypothetical protein JCGZ_23167                         123   1e-29   
ref|XP_010038033.1|  PREDICTED: cyprosin-like                           123   1e-29   
ref|XP_009410967.1|  PREDICTED: aspartic proteinase oryzasin-1-like     123   1e-29   
ref|XP_007036022.1|  Aspartic proteinase, putative isoform 5            122   1e-29   
ref|XP_008355757.1|  PREDICTED: aspartic proteinase-like                122   1e-29   
ref|XP_010094903.1|  Aspartic proteinase                                122   2e-29   
gb|AFX73040.1|  preprofigain A                                          122   2e-29   
emb|CDP15176.1|  unnamed protein product                                122   2e-29   
ref|XP_010909333.1|  PREDICTED: aspartic proteinase-like                122   2e-29   
ref|XP_007036021.1|  Aspartic proteinase, putative isoform 4            122   2e-29   
ref|XP_007036019.1|  Aspartic proteinase A1, putative isoform 2         122   2e-29   
ref|XP_010916100.1|  PREDICTED: aspartic proteinase oryzasin-1-like     122   2e-29   
ref|XP_007036020.1|  Aspartic proteinase, putative isoform 3            122   2e-29   
ref|XP_008370344.1|  PREDICTED: aspartic proteinase-like                122   3e-29   
ref|NP_001275049.1|  Asp precursor                                      122   3e-29   
ref|XP_007036018.1|  Aspartic proteinase, putative isoform 1            122   3e-29   
ref|XP_004293311.1|  PREDICTED: aspartic proteinase A1-like             122   3e-29   
ref|XP_004302331.1|  PREDICTED: aspartic proteinase-like                121   5e-29   
gb|ABR18322.1|  unknown                                                 121   6e-29   Picea sitchensis
ref|XP_003534602.1|  PREDICTED: aspartic proteinase                     121   7e-29   
dbj|BAG16519.1|  putative aspartic protease                             121   7e-29   Capsicum chinense [bonnet pepper]
ref|XP_009357472.1|  PREDICTED: aspartic proteinase-like                120   1e-28   
emb|CDY31221.1|  BnaC08g15160D                                          121   1e-28   
gb|EMT30725.1|  Phytepsin                                               115   1e-28   
gb|ABR16259.1|  unknown                                                 120   1e-28   Picea sitchensis
ref|XP_002314336.2|  aspartic proteinase 2                              120   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_008224698.1|  PREDICTED: aspartic proteinase-like                120   1e-28   
ref|XP_010999327.1|  PREDICTED: aspartic proteinase-like                120   1e-28   
ref|XP_009123370.1|  PREDICTED: aspartic proteinase A2 isoform X2       120   2e-28   
ref|NP_001150729.1|  aspartic proteinase oryzasin-1 precursor           120   2e-28   Zea mays [maize]
gb|AAK48494.1|AF259982_1  putative aspartic protease                    119   2e-28   Ipomoea batatas [batate]
ref|XP_009366025.1|  PREDICTED: aspartic proteinase-like isoform X3     119   3e-28   
ref|XP_009366023.1|  PREDICTED: aspartic proteinase-like isoform X1     119   3e-28   
ref|XP_009366024.1|  PREDICTED: aspartic proteinase-like isoform X2     119   3e-28   
ref|XP_007211538.1|  hypothetical protein PRUPE_ppa003924mg             119   4e-28   
ref|XP_008349314.1|  PREDICTED: aspartic proteinase-like                119   4e-28   
ref|XP_010473444.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    119   4e-28   
gb|AAT77954.1|  Asp                                                     119   4e-28   
gb|EYU19381.1|  hypothetical protein MIMGU_mgv1a004925mg                118   5e-28   
ref|XP_002512581.1|  Aspartic proteinase precursor, putative            117   1e-27   
gb|KHN04670.1|  Aspartic proteinase oryzasin-1                          117   1e-27   
gb|AFW79472.1|  hypothetical protein ZEAMMB73_587615                    117   1e-27   
ref|XP_006600421.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    117   1e-27   
ref|XP_003546541.1|  PREDICTED: aspartic proteinase A1-like isofo...    117   1e-27   
ref|NP_001152501.1|  retrotransposon protein SINE subclass precursor    117   1e-27   
gb|AGE15495.1|  preprosilpepsin 2                                       117   1e-27   
ref|XP_008440022.1|  PREDICTED: aspartic proteinase-like isoform X2     117   1e-27   
gb|ACF87177.1|  unknown                                                 117   2e-27   
gb|ACL54337.1|  unknown                                                 117   2e-27   
ref|XP_007147707.1|  hypothetical protein PHAVU_006G147900g             117   2e-27   
gb|KEH32400.1|  fungal proteinase A, aspartic proteinase superfam...    117   2e-27   
ref|XP_008440021.1|  PREDICTED: aspartic proteinase-like isoform X1     117   2e-27   
ref|XP_002519342.1|  Aspartic proteinase oryzasin-1 precursor, pu...    117   2e-27   
ref|XP_008655134.1|  PREDICTED: retrotransposon protein SINE subc...    117   2e-27   
ref|XP_010674482.1|  PREDICTED: aspartic proteinase-like                116   4e-27   
sp|O04057.1|ASPR_CUCPE  RecName: Full=Aspartic proteinase; Flags:...    116   5e-27   
ref|XP_007154514.1|  hypothetical protein PHAVU_003G125000g             115   5e-27   
gb|EMS45962.1|  Aspartic proteinase                                     115   5e-27   
ref|XP_004967621.1|  PREDICTED: aspartic proteinase-like isoform X1     115   6e-27   
ref|XP_003567538.1|  PREDICTED: aspartic proteinase-like                115   8e-27   
ref|NP_001234702.1|  aspartic protease precursor                        115   8e-27   
ref|XP_009619375.1|  PREDICTED: cyprosin-like isoform X2                115   9e-27   
ref|XP_009619374.1|  PREDICTED: cyprosin-like isoform X1                115   1e-26   
ref|XP_003633616.1|  PREDICTED: cyprosin-like isoform X2                115   1e-26   
emb|CAN65745.1|  hypothetical protein VITISV_037763                     115   1e-26   
ref|XP_010324003.1|  PREDICTED: aspartic protease precursor isofo...    115   1e-26   
gb|KEH36904.1|  fungal proteinase A, aspartic proteinase superfam...    115   1e-26   
ref|XP_010659757.1|  PREDICTED: cyprosin-like isoform X1                115   1e-26   
ref|XP_007031269.1|  Aspartic proteinase                                114   1e-26   
gb|AFK46704.1|  unknown                                                 114   1e-26   
ref|NP_001054586.1|  Os05g0137400                                       114   1e-26   
dbj|BAA02242.1|  aspartic proteinase                                    114   1e-26   
gb|KHN45025.1|  Aspartic proteinase oryzasin-1                          114   1e-26   
ref|XP_003541325.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    114   1e-26   
gb|EMT30433.1|  Aspartic proteinase                                     114   2e-26   
gb|EMS45559.1|  Aspartic proteinase                                     114   2e-26   
emb|CAL07969.1|  aspartic proteinase                                    114   2e-26   
ref|XP_006654022.1|  PREDICTED: aspartic proteinase-like                114   2e-26   
ref|XP_003521645.1|  PREDICTED: aspartic proteinase oryzasin-1 is...    114   2e-26   
gb|EEE62252.1|  hypothetical protein OsJ_17039                          114   2e-26   
ref|XP_010667516.1|  PREDICTED: aspartic proteinase A1-like             114   2e-26   
ref|NP_001043786.1|  Os01g0663400                                       114   2e-26   
dbj|BAE20414.1|  aspartic proteinase                                    114   3e-26   
ref|NP_001042785.1|  Os01g0290000                                       114   3e-26   
ref|XP_003595434.1|  Aspartic proteinase                                114   3e-26   
gb|EEC70447.1|  hypothetical protein OsI_01478                          114   3e-26   
ref|XP_003555776.1|  PREDICTED: aspartic proteinase isoform X1          114   3e-26   
gb|KHN26195.1|  Aspartic proteinase                                     114   3e-26   
gb|KEH37701.1|  fungal proteinase A, aspartic proteinase superfam...    114   4e-26   
ref|XP_003610462.1|  Aspartic proteinase                                113   4e-26   
gb|KEH37702.1|  fungal proteinase A, aspartic proteinase superfam...    114   4e-26   
dbj|BAJ91748.1|  predicted protein                                      112   4e-26   
ref|XP_007138576.1|  hypothetical protein PHAVU_009G220600g             113   5e-26   
gb|EMS54428.1|  Aspartic proteinase oryzasin-1                          113   5e-26   
ref|XP_004508063.1|  PREDICTED: aspartic proteinase oryzasin-1-like     113   5e-26   
gb|AFX73038.1|  preprogaline A                                          113   5e-26   
ref|XP_010271044.1|  PREDICTED: aspartic proteinase A1-like             113   7e-26   
gb|EPS69682.1|  hypothetical protein M569_05082                         112   7e-26   
sp|Q9XFX4.1|CARDB_CYNCA  RecName: Full=Procardosin-B; Contains: R...    112   7e-26   
dbj|BAJ85473.1|  predicted protein                                      112   7e-26   
ref|XP_007020767.1|  Aspartic proteinase A1                             112   7e-26   
ref|XP_006603753.1|  PREDICTED: aspartic proteinase 2 isoform X1        112   1e-25   
gb|KHG02139.1|  hypothetical protein F383_24995                         112   1e-25   
ref|XP_007163289.1|  hypothetical protein PHAVU_001G222100g             112   1e-25   
gb|KHN43373.1|  Aspartic proteinase                                     112   1e-25   
ref|XP_004969436.1|  PREDICTED: aspartic proteinase oryzasin-1-like     112   1e-25   
gb|KHG03187.1|  Asparticase                                             112   1e-25   
ref|XP_009778400.1|  PREDICTED: cyprosin-like isoform X1                112   1e-25   
ref|XP_009778402.1|  PREDICTED: cyprosin-like isoform X2                112   2e-25   
ref|XP_010549203.1|  PREDICTED: aspartic proteinase A1-like isofo...    111   2e-25   
gb|KHN19190.1|  Aspartic proteinase oryzasin-1                          111   2e-25   
ref|XP_010549201.1|  PREDICTED: aspartic proteinase A1-like isofo...    111   2e-25   
ref|XP_006586640.1|  PREDICTED: uncharacterized protein LOC100500...    111   2e-25   
ref|XP_004488184.1|  PREDICTED: aspartic proteinase-like isoform X1     111   2e-25   
ref|XP_003536026.1|  PREDICTED: aspartic proteinase-like isoform X1     111   2e-25   
ref|XP_004488185.1|  PREDICTED: aspartic proteinase-like isoform X2     111   2e-25   
ref|XP_006644474.1|  PREDICTED: aspartic proteinase oryzasin-1-like     111   3e-25   
ref|XP_008378420.1|  PREDICTED: aspartic proteinase-like isoform X1     111   3e-25   
gb|KDO72242.1|  hypothetical protein CISIN_1g010195mg                   109   4e-25   
ref|NP_001237345.1|  aspartic proteinase 2                              110   4e-25   
ref|XP_006419205.1|  hypothetical protein CICLE_v10004801mg             110   5e-25   
ref|XP_004486175.1|  PREDICTED: aspartic proteinase-like isoform X1     110   5e-25   
ref|XP_009616098.1|  PREDICTED: cyprosin-like                           110   5e-25   
gb|KDO72241.1|  hypothetical protein CISIN_1g010195mg                   110   7e-25   
ref|XP_007036023.1|  Aspartic proteinase oryzasin-1 isoform 1           110   7e-25   
gb|KDO72240.1|  hypothetical protein CISIN_1g010195mg                   110   7e-25   
ref|XP_006419206.1|  hypothetical protein CICLE_v10004801mg             110   7e-25   
ref|XP_006488712.1|  PREDICTED: aspartic proteinase A2-like             110   8e-25   
ref|XP_007036024.1|  Aspartic proteinase oryzasin-1 isoform 2           110   9e-25   
gb|KDO72239.1|  hypothetical protein CISIN_1g010195mg                   110   9e-25   
ref|XP_009114573.1|  PREDICTED: aspartic proteinase A3 isoform X2       109   1e-24   
ref|XP_007223268.1|  hypothetical protein PRUPE_ppa004486mg             109   1e-24   
gb|AES82361.2|  fungal proteinase A, aspartic proteinase superfam...    108   1e-24   
ref|XP_007145043.1|  hypothetical protein PHAVU_007G205100g             109   1e-24   
ref|XP_004494508.1|  PREDICTED: aspartic proteinase-like isoform X1     109   1e-24   
gb|EPS68187.1|  aspartic protease                                       109   1e-24   
ref|XP_010241436.1|  PREDICTED: cardosin-F-like isoform X5              109   2e-24   
ref|XP_010241434.1|  PREDICTED: aspartic proteinase-like isoform X4     109   2e-24   
ref|XP_010241433.1|  PREDICTED: aspartic proteinase-like isoform X3     109   2e-24   
ref|XP_004495808.1|  PREDICTED: aspartic proteinase-like                108   2e-24   
ref|XP_010241432.1|  PREDICTED: aspartic proteinase-like isoform X2     109   2e-24   
ref|XP_010241431.1|  PREDICTED: aspartic proteinase-like isoform X1     109   2e-24   
ref|XP_003626142.1|  Aspartic proteinase                                108   2e-24   
gb|AES82362.2|  fungal proteinase A, aspartic proteinase superfam...    108   3e-24   
ref|XP_010098748.1|  Aspartic proteinase                                108   3e-24   
ref|XP_004297063.1|  PREDICTED: aspartic proteinase A2-like             108   3e-24   
ref|XP_009353444.1|  PREDICTED: aspartic proteinase oryzasin-1-like     107   4e-24   
ref|XP_001769293.1|  predicted protein                                  107   5e-24   
ref|XP_003626144.1|  Aspartic proteinase                                106   6e-24   
ref|XP_001767404.1|  predicted protein                                  107   7e-24   
emb|CAE52913.1|  putative vacuaolar aspartic proteinase                 107   7e-24   
ref|XP_010694065.1|  PREDICTED: cyprosin-like                           107   8e-24   
ref|XP_008223613.1|  PREDICTED: aspartic proteinase-like                107   9e-24   
ref|XP_003626143.1|  Aspartic proteinase                                106   1e-23   
gb|KCW61403.1|  hypothetical protein EUGRSUZ_H04133                     102   1e-23   
gb|KEH43130.1|  fungal proteinase A, aspartic proteinase superfam...    106   2e-23   
ref|XP_008390340.1|  PREDICTED: aspartic proteinase-like                106   2e-23   
ref|XP_009769839.1|  PREDICTED: aspartic proteinase A1-like             105   2e-23   
ref|XP_008348384.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    105   2e-23   
emb|CDO98683.1|  unnamed protein product                                105   2e-23   
ref|XP_006356104.1|  PREDICTED: aspartic proteinase A1-like             105   3e-23   
gb|AIE76946.1|  procardosin B                                           104   3e-23   
ref|XP_003568979.1|  PREDICTED: aspartic proteinase                     105   4e-23   
ref|XP_008378421.1|  PREDICTED: aspartic proteinase-like isoform X2     105   6e-23   
ref|XP_008378422.1|  PREDICTED: aspartic proteinase-like isoform X3     104   7e-23   
gb|AFW81160.1|  hypothetical protein ZEAMMB73_034789                  97.1    9e-23   
ref|XP_006302162.1|  hypothetical protein CARUB_v10020172mg             103   1e-22   
ref|XP_010232061.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    104   1e-22   
ref|XP_002108510.1|  expressed hypothetical protein                     102   2e-22   
ref|XP_010232062.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    104   2e-22   
ref|XP_004969250.1|  PREDICTED: aspartic proteinase oryzasin-1-like     103   2e-22   
gb|EMT14628.1|  Aspartic proteinase oryzasin-1                          103   2e-22   
ref|XP_004247609.1|  PREDICTED: cyprosin                                103   2e-22   
ref|XP_004960420.1|  PREDICTED: aspartic proteinase-like                103   3e-22   
gb|EEE55036.1|  hypothetical protein OsJ_02714                          101   3e-22   
ref|XP_010511324.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    102   3e-22   
emb|CDM83463.1|  unnamed protein product                                103   3e-22   
ref|XP_010511323.1|  PREDICTED: aspartic proteinase-like isoform X1     102   3e-22   
ref|XP_010024880.1|  PREDICTED: cyprosin-like                           102   5e-22   
gb|EMS55205.1|  Aspartic proteinase oryzasin-1                          102   1e-21   
ref|XP_010511325.1|  PREDICTED: aspartic proteinase A1-like isofo...    100   1e-21   
gb|EEC71139.1|  hypothetical protein OsI_02961                          101   1e-21   
ref|XP_002891994.1|  hypothetical protein ARALYDRAFT_314946             101   1e-21   
ref|NP_001043650.1|  Os01g0631900                                       101   1e-21   
ref|XP_004234022.1|  PREDICTED: aspartic proteinase A1                  100   2e-21   
ref|XP_010480289.1|  PREDICTED: aspartic proteinase A1-like isofo...    100   2e-21   
ref|XP_008673210.1|  PREDICTED: uncharacterized protein LOC100383...    101   2e-21   
ref|XP_008666656.1|  PREDICTED: aspartic proteinase oryzasin-1-like   94.7    2e-21   
ref|NP_001169605.1|  uncharacterized protein LOC100383486 precursor     101   2e-21   
ref|XP_008673209.1|  PREDICTED: uncharacterized protein LOC100383...    101   2e-21   
ref|XP_008673208.1|  PREDICTED: uncharacterized protein LOC100383...    101   2e-21   
ref|XP_010480288.1|  PREDICTED: aspartic proteinase A1-like isofo...    100   2e-21   
gb|AGT17264.1|  aspartic proteinase                                     100   2e-21   
emb|CAA08878.1|  Cathepsin D                                          99.0    3e-21   
ref|XP_010511326.1|  PREDICTED: aspartic proteinase A1-like isofo...    100   3e-21   
ref|XP_010480290.1|  PREDICTED: aspartic proteinase A1-like             100   3e-21   
gb|AGT16793.1|  aspartic protease                                       100   3e-21   
gb|AGT16815.1|  aspartic proteinase                                     100   3e-21   
ref|XP_010415029.1|  PREDICTED: aspartic proteinase-like                100   3e-21   
ref|XP_006644404.1|  PREDICTED: aspartic proteinase oryzasin-1-like     100   5e-21   
ref|XP_010415027.1|  PREDICTED: aspartic proteinase-like              97.8    5e-21   
ref|XP_002456011.1|  hypothetical protein SORBIDRAFT_03g028820          100   5e-21   
ref|XP_006363462.1|  PREDICTED: aspartic proteinase oryzasin-1-like   99.4    6e-21   
ref|XP_003468394.1|  PREDICTED: cathepsin D                           97.4    1e-20   
ref|XP_010233477.1|  PREDICTED: aspartic proteinase oryzasin-1-like   98.6    1e-20   
gb|AGH70121.1|  aspartyl protease                                     96.3    2e-20   
ref|XP_006860869.1|  PREDICTED: cathepsin D                           96.3    3e-20   
ref|XP_010271045.1|  PREDICTED: cyprosin-like                         97.4    3e-20   
ref|XP_005643881.1|  putative aspartic protease                       97.1    4e-20   
emb|CDY67019.1|  BnaCnng53170D                                        95.1    5e-20   
ref|XP_010793424.1|  PREDICTED: cathepsin D                           94.4    1e-19   
gb|ETE59474.1|  hypothetical protein L345_14796                       90.1    1e-19   
ref|XP_005938014.1|  PREDICTED: cathepsin D-like                      94.4    1e-19   
ref|XP_004566434.1|  PREDICTED: cathepsin D-like                      94.4    1e-19   
ref|XP_011177915.1|  PREDICTED: lysosomal aspartic protease           94.0    1e-19   
ref|XP_006804626.1|  PREDICTED: cathepsin D-like                      94.4    2e-19   
sp|O93428.2|CATD_CHIHA  RecName: Full=Cathepsin D; Flags: Precursor   94.0    2e-19   
gb|ADP89523.1|  cathepsin D                                           94.0    2e-19   
ref|XP_011208854.1|  PREDICTED: lysosomal aspartic protease           94.0    2e-19   
ref|XP_008252175.1|  PREDICTED: napsin-A                              94.0    2e-19   
gb|AHZ34283.1|  cathepsin Db                                          94.0    2e-19   
ref|NP_001072052.1|  cathepsin D1 precursor                           93.6    2e-19   
ref|XP_003798425.1|  PREDICTED: cathepsin D                           93.6    2e-19   
ref|XP_007435358.1|  PREDICTED: cathepsin D-like                      93.6    2e-19   
ref|XP_005843817.1|  hypothetical protein CHLNCDRAFT_59800            94.7    3e-19   
ref|XP_003452633.1|  PREDICTED: cathepsin D-like                      93.2    3e-19   
ref|XP_005499288.1|  PREDICTED: cathepsin D                           92.8    3e-19   
ref|XP_001768042.1|  predicted protein                                94.0    3e-19   
emb|CBI23210.3|  unnamed protein product                              93.6    4e-19   
emb|CDY65926.1|  BnaC09g51660D                                        92.8    4e-19   
ref|XP_008303322.1|  PREDICTED: cathepsin D                           92.8    4e-19   
gb|EMC88033.1|  Cathepsin D                                           92.8    5e-19   
ref|XP_009048525.1|  hypothetical protein LOTGIDRAFT_173095           92.8    6e-19   
ref|XP_003214815.1|  PREDICTED: cathepsin D                           92.4    6e-19   
ref|XP_006278899.1|  PREDICTED: cathepsin D                           92.4    6e-19   
ref|XP_007066674.1|  PREDICTED: cathepsin D                           92.4    7e-19   
ref|XP_002992068.1|  hypothetical protein SELMODRAFT_186535           93.2    8e-19   
gb|EDL22738.1|  napsin A aspartic peptidase, isoform CRA_b            90.5    8e-19   
ref|XP_004904968.1|  PREDICTED: cathepsin D                           92.4    8e-19   
ref|XP_002964099.1|  hypothetical protein SELMODRAFT_142401           93.2    8e-19   
ref|XP_010011434.1|  PREDICTED: cathepsin D                           91.7    9e-19   
gb|KFQ42311.1|  Cathepsin D                                           91.7    9e-19   
ref|XP_006134990.1|  PREDICTED: cathepsin D                           92.0    9e-19   
ref|XP_006642526.1|  PREDICTED: cathepsin D-like                      92.0    9e-19   
ref|XP_005149264.1|  PREDICTED: cathepsin D isoform X2                92.0    1e-18   
ref|XP_005149263.1|  PREDICTED: cathepsin D isoform X1                92.0    1e-18   
ref|XP_009873028.1|  PREDICTED: cathepsin D                           91.7    1e-18   
gb|KFP91444.1|  Cathepsin D                                           91.7    1e-18   
ref|XP_008843359.1|  PREDICTED: napsin-A                              92.0    1e-18   
ref|XP_010191309.1|  PREDICTED: cathepsin D                           91.3    1e-18   
gb|KFW06830.1|  Cathepsin D                                           91.3    1e-18   
emb|CDS05348.1|  hypothetical protein LRAMOSA07877                    91.3    1e-18   



>ref|XP_010096873.1| Aspartic proteinase [Morus notabilis]
 gb|EXB66327.1| Aspartic proteinase [Morus notabilis]
Length=514

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 97/130 (75%), Gaps = 10/130 (8%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRY---  358
            MGTQ ++    L + LLL P VFS SNDGL+RIGLKKRK D+ N +A  I SKEG     
Sbjct  1    MGTQNKSVPATLFICLLLFPLVFSASNDGLVRIGLKKRKFDQNNRVAAQIESKEGEAFKA  60

Query  359  -ARNYR-----GDPS-ADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAK  517
              R YR     GDP   DI+ALKNYM+AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPSAK
Sbjct  61   SIRKYRLRGNLGDPEDTDIVALKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSAK  120

Query  518  CYLSIACYFH  547
            CY S+ACYFH
Sbjct  121  CYFSVACYFH  130



>gb|AEJ76922.1| aspartic protease [Dimocarpus longan]
Length=222

 Score =   148 bits (374),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 85/113 (75%), Gaps = 9/113 (8%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYR---GDPSADI  394
            SPT FS   DGL+RIGLKK+KLD+I+ ++  I S EG   R      N R   GD   DI
Sbjct  19   SPTAFSAPKDGLVRIGLKKKKLDQISRVSGQINSNEGEAIRAPIKKYNLRSNLGDSDTDI  78

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++LKNYM+AQYFG++GIG+P Q FTV+FDTGSSNLWVPS+KCY S+ACYFHSK
Sbjct  79   VSLKNYMDAQYFGEVGIGTPSQTFTVIFDTGSSNLWVPSSKCYFSVACYFHSK  131



>ref|XP_009764301.1| PREDICTED: aspartic proteinase A1-like [Nicotiana sylvestris]
Length=339

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 93/127 (73%), Gaps = 5/127 (4%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT   T L AL L LLLSP  FSVSNDGLIR+G+KKRKLD+IN     I S     AR 
Sbjct  1    MGTTYGTYLTALCLLLLLSPMAFSVSNDGLIRVGIKKRKLDQINQAFGGIDSNGANSART  60

Query  368  YR-----GDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSI  532
            Y      GD   DI+ALKNY++AQYFG+I IGSPPQKFTV+FDTGSSNLWVPSA+CY S+
Sbjct  61   YHLVGNIGDSDTDIVALKNYLDAQYFGEICIGSPPQKFTVIFDTGSSNLWVPSARCYFSL  120

Query  533  ACYFHSK  553
            ACY H K
Sbjct  121  ACYLHPK  127



>gb|KHG05834.1| Asparticase [Gossypium arboreum]
Length=511

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 83/112 (74%), Gaps = 9/112 (8%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR---------NYRGDPSADII  397
            P VFS SNDGL RIGLKKRK DR N LA  + SKEG   R         N +     DI+
Sbjct  19   PIVFSTSNDGLFRIGLKKRKFDRNNLLAAQLDSKEGEALRGSFRKYLHGNLQESKDIDIV  78

Query  398  ALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ALKNYM+AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY SIACYFHS+
Sbjct  79   ALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSR  130



>ref|XP_009600571.1| PREDICTED: cyprosin-like [Nicotiana tomentosiformis]
Length=508

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 94/127 (74%), Gaps = 5/127 (4%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT+    L AL L LLLSP VFSVSNDGLIR+G+KKRKLD+IN     I S     AR 
Sbjct  1    MGTRYGACLSALCLLLLLSPMVFSVSNDGLIRVGIKKRKLDQINQAFGGIDSNGANSART  60

Query  368  YR-----GDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSI  532
            Y      GD   DIIALKNY++AQYFG+I IGSPPQKFTV+FDTGSSNLWVPSA+CY S+
Sbjct  61   YHLGGNIGDSDTDIIALKNYLDAQYFGEICIGSPPQKFTVIFDTGSSNLWVPSARCYFSL  120

Query  533  ACYFHSK  553
            ACY H K
Sbjct  121  ACYLHPK  127



>gb|ABG37021.1| aspartic protease [Nicotiana tabacum]
Length=508

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 94/127 (74%), Gaps = 5/127 (4%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT+    L AL L LLLSP VFSVSNDGLIR+G+KKRKLD+IN     I S     AR 
Sbjct  1    MGTRYGACLSALCLLLLLSPMVFSVSNDGLIRVGIKKRKLDQINQAFGGIDSNGANSART  60

Query  368  YR-----GDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSI  532
            Y      GD   DIIALKNY++AQYFG+I IGSPPQKFTV+FDTGSSNLWVPSA+CY S+
Sbjct  61   YHLGGNIGDSDTDIIALKNYLDAQYFGEICIGSPPQKFTVIFDTGSSNLWVPSARCYFSL  120

Query  533  ACYFHSK  553
            ACY H K
Sbjct  121  ACYLHPK  127



>ref|XP_009776125.1| PREDICTED: aspartic proteinase-like [Nicotiana sylvestris]
Length=162

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 82/109 (75%), Gaps = 10/109 (9%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRGD----PSADIIALK  406
            S SNDGL+RIGLKK K D+ N LA  I SKEG   R      N+RG        DI+ALK
Sbjct  21   SSSNDGLMRIGLKKMKFDQNNRLAARIESKEGDVLRGSIRKYNFRGKLGDFEDTDIVALK  80

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NYM+AQYFG+IG+G+PPQKFTV+FDTGSSNLWVPS+KCY S+ C+FHSK
Sbjct  81   NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSK  129



>ref|XP_007049085.1| Aspartic protease isoform 2 [Theobroma cacao]
 gb|EOX93242.1| Aspartic protease isoform 2 [Theobroma cacao]
Length=514

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 99/132 (75%), Gaps = 10/132 (8%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR-  364
            MGT+  T  + LLL LLLSP VFSV N+G++RIGL K+KLD+IN +A  I SKEG+ +R 
Sbjct  1    MGTKFNTIRVTLLLVLLLSPAVFSVPNEGMVRIGLIKKKLDQINRVAGDIDSKEGKLSRT  60

Query  365  ---------NYRGDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAK  517
                     N      ++I+ALKNYM+AQYFG+IGIG+P Q FTV+FDTGSSNLWVPS+K
Sbjct  61   PLRKYHLQGNLGASDDSEIVALKNYMDAQYFGEIGIGTPSQTFTVIFDTGSSNLWVPSSK  120

Query  518  CYLSIACYFHSK  553
            CY S+ACYFHSK
Sbjct  121  CYFSVACYFHSK  132



>gb|KCW46980.1| hypothetical protein EUGRSUZ_K00787 [Eucalyptus grandis]
Length=462

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 87/114 (76%), Gaps = 10/114 (9%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEG---------RYARNYRGDPS-AD  391
            SP + S S+DG++RIGLKKRKLD +N +AE   SKEG          Y  N  GD    D
Sbjct  19   SPMLISSSSDGMVRIGLKKRKLDHVNRVAEQGNSKEGGTPRGPLRKYYLHNNLGDSEDID  78

Query  392  IIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            I++LKNYM+AQYFG+IGIG+P QKFTV+FDTGSSNLWVPS+KCYLS+ACYFHSK
Sbjct  79   IVSLKNYMDAQYFGEIGIGTPSQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSK  132



>ref|XP_004243484.1| PREDICTED: cyprosin-like [Solanum lycopersicum]
Length=508

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 96/127 (76%), Gaps = 5/127 (4%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT+    L+A+ L LLLSP VFSVSNDGL+R+ +KKRKLD+ NH+   I S     AR 
Sbjct  1    MGTRYGACLIAVCLLLLLSPLVFSVSNDGLVRVEIKKRKLDQTNHVFGGIDSNGVHSARK  60

Query  368  YR-----GDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSI  532
            YR     GD  + IIALKNY++AQYFG+I IGSPPQKFTV+FDTGSSNLWVPSAKC+ S+
Sbjct  61   YRLGGNVGDSDSGIIALKNYLDAQYFGEISIGSPPQKFTVIFDTGSSNLWVPSAKCHFSL  120

Query  533  ACYFHSK  553
            ACY H K
Sbjct  121  ACYLHPK  127



>ref|XP_007049084.1| Aspartic proteinase A1 isoform 1 [Theobroma cacao]
 gb|EOX93241.1| Aspartic proteinase A1 isoform 1 [Theobroma cacao]
Length=550

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 99/132 (75%), Gaps = 10/132 (8%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR-  364
            MGT+  T  + LLL LLLSP VFSV N+G++RIGL K+KLD+IN +A  I SKEG+ +R 
Sbjct  1    MGTKFNTIRVTLLLVLLLSPAVFSVPNEGMVRIGLIKKKLDQINRVAGDIDSKEGKLSRT  60

Query  365  ---------NYRGDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAK  517
                     N      ++I+ALKNYM+AQYFG+IGIG+P Q FTV+FDTGSSNLWVPS+K
Sbjct  61   PLRKYHLQGNLGASDDSEIVALKNYMDAQYFGEIGIGTPSQTFTVIFDTGSSNLWVPSSK  120

Query  518  CYLSIACYFHSK  553
            CY S+ACYFHSK
Sbjct  121  CYFSVACYFHSK  132



>gb|KDP39159.1| hypothetical protein JCGZ_00916 [Jatropha curcas]
Length=514

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADI  394
            P VF+ SNDGL+RIGLKKRK D+ N +A    SKEG   R          N   +   DI
Sbjct  20   PFVFAASNDGLVRIGLKKRKFDQNNRVAAQFESKEGEALRASIRKYHLHGNLGDEEDIDI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++LKNYM+AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY S+ACYFHSK
Sbjct  80   VSLKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSK  132



>ref|XP_010035554.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010035555.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW46979.1| hypothetical protein EUGRSUZ_K00787 [Eucalyptus grandis]
Length=514

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 87/114 (76%), Gaps = 10/114 (9%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEG---------RYARNYRGDPS-AD  391
            SP + S S+DG++RIGLKKRKLD +N +AE   SKEG          Y  N  GD    D
Sbjct  19   SPMLISSSSDGMVRIGLKKRKLDHVNRVAEQGNSKEGGTPRGPLRKYYLHNNLGDSEDID  78

Query  392  IIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            I++LKNYM+AQYFG+IGIG+P QKFTV+FDTGSSNLWVPS+KCYLS+ACYFHSK
Sbjct  79   IVSLKNYMDAQYFGEIGIGTPSQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSK  132



>ref|XP_006348142.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=511

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 84/113 (74%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRGDPSA----DI  394
            P  FS SNDGL+RIGLKK K D+ N LA  + SKE    R      N+RGD  A    DI
Sbjct  18   PLAFSTSNDGLVRIGLKKIKYDQNNRLAARLESKEAEALRASIRKYNFRGDLGASEDTDI  77

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNYM+AQYFG+IG+G+PPQKFTV+FDTGSSNLWVPSAKCY S+ C FHSK
Sbjct  78   VALKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSVPCLFHSK  130



>emb|CDP10762.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 96/127 (76%), Gaps = 5/127 (4%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR-  364
            MGT+   + +  +L LLLSP VFS SND LIR+ LKK KLD+I+  + ++   EG +AR 
Sbjct  1    MGTKCGATAVTFVLLLLLSPAVFSASNDKLIRVALKKTKLDQISRFSGNVDLTEGGFARI  60

Query  365  -NYRGD---PSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSI  532
               RG+      DIIALKNYM+AQY+G+IG+G+PPQKFTV+FDTGSSNLWVPS KCY S+
Sbjct  61   NRRRGNVVQSDTDIIALKNYMDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSVKCYFSV  120

Query  533  ACYFHSK  553
            ACYFHSK
Sbjct  121  ACYFHSK  127



>ref|XP_006364164.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=508

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 82/106 (77%), Gaps = 5/106 (5%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-----GDPSADIIALKNYM  415
            VFSVSNDGL+R+G+KKRKLD+ N +   I S     AR YR     GD   DIIALKNY+
Sbjct  22   VFSVSNDGLVRVGIKKRKLDQTNQVFGGIDSNGVHSARKYRLGGNVGDSDTDIIALKNYL  81

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +AQYFG+I IGSPPQKFTV+FDTGSSNLWVPSAKC+ S+ACY H K
Sbjct  82   DAQYFGEISIGSPPQKFTVIFDTGSSNLWVPSAKCHFSLACYLHPK  127



>ref|XP_004232695.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
 ref|XP_010316578.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
Length=511

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 83/113 (73%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRGD----PSADI  394
            P  FS SNDGL+RIGLKK K D+ N LA  + SKE    R      N+RGD       DI
Sbjct  18   PLAFSTSNDGLVRIGLKKIKYDQNNRLAARLESKEAEALRASIRKYNFRGDLGVSEDTDI  77

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNYM+AQYFG+IG+G+PPQKFTV+FDTGSSNLWVPSAKCY S+ C FHSK
Sbjct  78   VALKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSVPCLFHSK  130



>ref|XP_009629448.1| PREDICTED: aspartic proteinase-like [Nicotiana tomentosiformis]
Length=512

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 84/114 (74%), Gaps = 11/114 (10%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR-------NYRGDPSA----D  391
            P   S SNDGL+RIGLKK K D+ N LA  + SKEG   R       N+ G+  A    D
Sbjct  18   PLALSTSNDGLVRIGLKKIKFDQNNRLAARVESKEGEAVRASIRKYNNFHGNLGASEDTD  77

Query  392  IIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            I+ALKNYM+AQYFG+IGIGSPPQKFTV+FDTGSSNLWVPS+KCY S+ C+FHSK
Sbjct  78   IVALKNYMDAQYFGEIGIGSPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSK  131



>ref|XP_008366438.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Malus domestica]
Length=518

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 91/134 (68%), Gaps = 10/134 (7%)
 Frame = +2

Query  182  FNMGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYA  361
             NM T+L++    L L   L P VF  SNDGL+RIGLKKRKLD+ N +A  I S EG   
Sbjct  3    LNMETKLKSVTATLFLCFFLCPLVFCESNDGLLRIGLKKRKLDQNNRVASQIDSNEGEAL  62

Query  362  R----------NYRGDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPS  511
            R          N       DI++LKNYM+AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS
Sbjct  63   RAALQKYRLGGNLADSEDIDIVSLKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPS  122

Query  512  AKCYLSIACYFHSK  553
            +KCY SIACY H K
Sbjct  123  SKCYFSIACYLHPK  136



>ref|XP_002298827.2| aspartic protease family protein [Populus trichocarpa]
 gb|EEE83632.2| aspartic protease family protein [Populus trichocarpa]
Length=515

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 83/109 (76%), Gaps = 7/109 (6%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR------YARNYRGDPS-ADIIALK  406
            +  S  NDGLIRIGLKKRK +R N LA  + SKEG         RN  GD    DI++LK
Sbjct  25   SALSPPNDGLIRIGLKKRKYERNNRLAAKLESKEGESIKKYHLLRNLGGDAEDTDIVSLK  84

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NYM+AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY S+ACYFHSK
Sbjct  85   NYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSK  133



>gb|KDO62074.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=359

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 83/113 (73%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRGD----PSADI  394
            P VFS  N GL RIGLKKRK D  N +A  + SKEG   R      + RG+      ADI
Sbjct  20   PVVFSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLGESGDADI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNYM+AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY SIACYFHSK
Sbjct  80   VALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSK  132



>gb|AFB73927.2| preprocirsin [Cirsium vulgare]
Length=509

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 98/124 (79%), Gaps = 5/124 (4%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT ++ SL+AL L  LLSPT  SVSNDGLIR+GLKKRK+D+IN L+    S EG+  ++
Sbjct  1    MGTSIKASLLALFLLFLLSPTAISVSNDGLIRVGLKKRKVDQINQLSGHGASMEGKARKD  60

Query  368  Y-----RGDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSI  532
            +       D  +DIIALKNYM+AQY+G+IGIG+PPQKFTV+FDTGSSNLWVPSAKCY S+
Sbjct  61   FGFGGTLRDSDSDIIALKNYMDAQYYGEIGIGAPPQKFTVIFDTGSSNLWVPSAKCYFSV  120

Query  533  ACYF  544
            AC F
Sbjct  121  ACLF  124



>ref|XP_011046729.1| PREDICTED: aspartic proteinase A1-like [Populus euphratica]
 ref|XP_011046731.1| PREDICTED: aspartic proteinase A1-like [Populus euphratica]
Length=515

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 83/109 (76%), Gaps = 7/109 (6%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEG------RYARNYRGDPS-ADIIALK  406
            +  S  NDGLIRIGLKKRK +R N LA  + SKEG         RN  GD    DI++LK
Sbjct  25   STLSPPNDGLIRIGLKKRKYERNNRLAAKLESKEGDSIKKYHLLRNLGGDAEDTDIVSLK  84

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NYM+AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY S+ACYFHSK
Sbjct  85   NYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSK  133



>ref|XP_008366439.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Malus domestica]
Length=514

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 81/113 (72%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADI  394
            P VF  SNDGL+RIGLKKRKLD+ N +A  I S EG   R          N       DI
Sbjct  20   PLVFCESNDGLLRIGLKKRKLDQNNRVASQIDSNEGEALRAALQKYRLGGNLADSEDIDI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++LKNYM+AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY SIACY H K
Sbjct  80   VSLKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACYLHPK  132



>ref|XP_011100273.1| PREDICTED: cyprosin-like [Sesamum indicum]
Length=504

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 86/105 (82%), Gaps = 4/105 (4%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRGD---PSADIIALKNYMN  418
            TVFS   DGL+RIGLKKRKL++IN  +E++GSK+G  + N  G       DII+LKNY++
Sbjct  19   TVFSARADGLLRIGLKKRKLNQINRFSETLGSKQGG-SNNLGGVNEVSGTDIISLKNYLD  77

Query  419  AQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY S+AC FHSK
Sbjct  78   AQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACLFHSK  122



>ref|XP_008380299.1| PREDICTED: aspartic proteinase A1-like [Malus domestica]
Length=513

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 82/113 (73%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADI  394
            P VF  SNDGL+RIGLKKRKLD+ N +A  I SKEG   R          N       DI
Sbjct  20   PLVFCESNDGLLRIGLKKRKLDQNNXVASQIDSKEGESLRATLQKYRLGGNLADSQDIDI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++LKNYM+AQYFG+IGIG+PPQKFTV+FDTGS+NLWVPS+KC+ SIACY H K
Sbjct  80   VSLKNYMDAQYFGEIGIGTPPQKFTVIFDTGSANLWVPSSKCFFSIACYLHPK  132



>gb|KHG04193.1| Asparticase [Gossypium arboreum]
Length=514

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 83/113 (73%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR----YARNYR------GDPSADI  394
            P VFS  ND L+RIGLKKRK+DR N +A  + SKEG+    + R YR           DI
Sbjct  20   PIVFSTPNDRLVRIGLKKRKIDRNNRMAAHLESKEGKASEAFLRKYRLHGNLGESEDIDI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNYM+AQYFG+IGIG+P Q FTV+FDTGSSNLWVPS+KCY SIACYFH K
Sbjct  80   VALKNYMDAQYFGEIGIGTPTQNFTVIFDTGSSNLWVPSSKCYFSIACYFHPK  132



>gb|KDO62073.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=458

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 83/113 (73%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRGD----PSADI  394
            P VFS  N GL RIGLKKRK D  N +A  + SKEG   R      + RG+      ADI
Sbjct  20   PVVFSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLGESGDADI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNYM+AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY SIACYFHSK
Sbjct  80   VALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSK  132



>emb|CAA57510.1| cyprosin [Cynara cardunculus]
Length=509

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 98/124 (79%), Gaps = 5/124 (4%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT ++ S++AL LF LLSPT FSVSN GL+R+GLKKRK+D+IN L+    S E +  ++
Sbjct  1    MGTAIKASVLALFLFFLLSPTAFSVSNGGLLRVGLKKRKVDQINQLSGHGVSMEAKARKD  60

Query  368  Y-----RGDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSI  532
            +       D  +DIIALKNYM+AQY+G+IGIGSPPQKFTV+FDTGSSNLWVPSAKCY S+
Sbjct  61   FGFGGALRDSGSDIIALKNYMDAQYYGEIGIGSPPQKFTVIFDTGSSNLWVPSAKCYFSV  120

Query  533  ACYF  544
            AC F
Sbjct  121  ACLF  124



>emb|CDP04424.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 86/110 (78%), Gaps = 10/110 (9%)
 Frame = +2

Query  254  FSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRG---DPS-ADIIAL  403
            FS SNDGL+RIGLKK K D+ N LA  + SK+G   R      ++RG   DP+  DI+AL
Sbjct  23   FSSSNDGLVRIGLKKIKFDQNNRLASRLESKDGETLRSSIRKYHFRGKLGDPADTDIVAL  82

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            KNYM+AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY S+ C+FHSK
Sbjct  83   KNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSK  132



>gb|KDO62072.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=492

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 83/113 (73%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRGD----PSADI  394
            P VFS  N GL RIGLKKRK D  N +A  + SKEG   R      + RG+      ADI
Sbjct  20   PVVFSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLGESGDADI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNYM+AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY SIACYFHSK
Sbjct  80   VALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSK  132



>gb|KDO62069.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=505

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 83/113 (73%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRGD----PSADI  394
            P VFS  N GL RIGLKKRK D  N +A  + SKEG   R      + RG+      ADI
Sbjct  20   PVVFSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLGESGDADI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNYM+AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY SIACYFHSK
Sbjct  80   VALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSK  132



>ref|XP_006452415.1| hypothetical protein CICLE_v10008027mg [Citrus clementina]
 gb|ESR65655.1| hypothetical protein CICLE_v10008027mg [Citrus clementina]
Length=514

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 83/113 (73%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRGD----PSADI  394
            P VFS  N GL RIGLKKRK D  N +A  + SKEG   R      + RG+      ADI
Sbjct  20   PVVFSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLGESGDADI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNYM+AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY SIACYFHSK
Sbjct  80   VALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSK  132



>ref|XP_006475035.1| PREDICTED: aspartic proteinase-like [Citrus sinensis]
 gb|KDO62070.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
 gb|KDO62071.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=514

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 83/113 (73%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRGD----PSADI  394
            P VFS  N GL RIGLKKRK D  N +A  + SKEG   R      + RG+      ADI
Sbjct  20   PVVFSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLGESGDADI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNYM+AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY SIACYFHSK
Sbjct  80   VALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSK  132



>gb|KDO62068.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=510

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 83/113 (73%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRGD----PSADI  394
            P VFS  N GL RIGLKKRK D  N +A  + SKEG   R      + RG+      ADI
Sbjct  20   PVVFSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLGESGDADI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNYM+AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY SIACYFHSK
Sbjct  80   VALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSK  132



>ref|XP_006449766.1| hypothetical protein CICLE_v10014941mg [Citrus clementina]
 gb|ESR63006.1| hypothetical protein CICLE_v10014941mg [Citrus clementina]
Length=514

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 79/108 (73%), Gaps = 10/108 (9%)
 Frame = +2

Query  260  VSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIALKN  409
            VSNDGL+RIGLKK KLD  N LA  + SK G   R          N R     DI+ALKN
Sbjct  25   VSNDGLVRIGLKKMKLDPNNRLAARLESKHGEALRASVKKYGFPNNLRDSEDTDIVALKN  84

Query  410  YMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            YM+AQY+G+IGIG+PPQKFTV+FDTGSSNLWVPS KCY S+ACYFHSK
Sbjct  85   YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACYFHSK  132



>gb|KDO78302.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
Length=471

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 80/111 (72%), Gaps = 10/111 (9%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIA  400
            V SVSNDGL+RIGLKK KLD  N LA  + S+ G   R          N R     DI+A
Sbjct  22   VASVSNDGLVRIGLKKMKLDPNNRLAARLESEHGEALRASVKKYGFPNNLRDSEDTDIVA  81

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNYM+AQY+G+IGIG+PPQKFTV+FDTGSSNLWVPS  CY S+ACYFHSK
Sbjct  82   LKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTNCYFSVACYFHSK  132



>ref|XP_009587050.1| PREDICTED: aspartic proteinase-like [Nicotiana tomentosiformis]
Length=510

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 82/109 (75%), Gaps = 10/109 (9%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRG----DPSADIIALK  406
            S SNDGL+RIGLKK K D+ N LA  I SKEG   R      N+RG        DI+ALK
Sbjct  21   SSSNDGLMRIGLKKMKFDQNNRLAARIESKEGDVLRASIRKYNFRGKLGDSEDTDIVALK  80

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NYM+AQYFG+IG+G+PPQKFTV+FDTGSSNLWVPS+KCY S+ C+FHSK
Sbjct  81   NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSK  129



>ref|XP_007211824.1| hypothetical protein PRUPE_ppa004375mg [Prunus persica]
 gb|EMJ13023.1| hypothetical protein PRUPE_ppa004375mg [Prunus persica]
Length=514

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 79/109 (72%), Gaps = 10/109 (9%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIALK  406
            S SNDGL+R+GLKKRK D+ N +A  I SKEG   R          N       DI++LK
Sbjct  24   SESNDGLVRVGLKKRKFDQNNRVAAQIESKEGEALRASLLKYRLRGNLADSQDTDIVSLK  83

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NYM+AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPSAKCY SIACY H K
Sbjct  84   NYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHPK  132



>ref|XP_004294396.1| PREDICTED: aspartic proteinase A1-like [Fragaria vesca subsp. 
vesca]
Length=516

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 83/111 (75%), Gaps = 10/111 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRG----DPSADI  394
            P VF  SNDGL+R+GLKK+K D+ N +A ++ +K G   R      N RG    D   DI
Sbjct  20   PLVFCASNDGLLRVGLKKKKFDQNNRVAANLQAKNGDAVRAVIHKYNLRGTYGDDQDIDI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            ++LKNYM+AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY SIACY H
Sbjct  80   VSLKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACYLH  130



>ref|XP_002529926.1| Aspartic proteinase precursor, putative [Ricinus communis]
 gb|EEF32480.1| Aspartic proteinase precursor, putative [Ricinus communis]
Length=514

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 82/109 (75%), Gaps = 10/109 (9%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR---------YARNYRGDPS-ADIIALK  406
            S SNDGL+RIGLKKRK D+ N +A    SKEG          + R   GD    DI++LK
Sbjct  24   SSSNDGLVRIGLKKRKFDQNNRVAAQFESKEGEAFRASIKKYHIRGNLGDAEDIDIVSLK  83

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NYM+AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY S+ACYFHSK
Sbjct  84   NYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSK  132



>gb|KDO78303.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
Length=491

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 80/111 (72%), Gaps = 10/111 (9%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIA  400
            V SVSNDGL+RIGLKK KLD  N LA  + S+ G   R          N R     DI+A
Sbjct  22   VASVSNDGLVRIGLKKMKLDPNNRLAARLESEHGEALRASVKKYGFPNNLRDSEDTDIVA  81

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNYM+AQY+G+IGIG+PPQKFTV+FDTGSSNLWVPS  CY S+ACYFHSK
Sbjct  82   LKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTNCYFSVACYFHSK  132



>ref|XP_006467405.1| PREDICTED: aspartic proteinase-like isoform X2 [Citrus sinensis]
 ref|XP_006467406.1| PREDICTED: aspartic proteinase-like isoform X3 [Citrus sinensis]
 gb|KDO78299.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
 gb|KDO78300.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
 gb|KDO78301.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
Length=514

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 80/111 (72%), Gaps = 10/111 (9%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIA  400
            V SVSNDGL+RIGLKK KLD  N LA  + S+ G   R          N R     DI+A
Sbjct  22   VASVSNDGLVRIGLKKMKLDPNNRLAARLESEHGEALRASVKKYGFPNNLRDSEDTDIVA  81

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNYM+AQY+G+IGIG+PPQKFTV+FDTGSSNLWVPS  CY S+ACYFHSK
Sbjct  82   LKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTNCYFSVACYFHSK  132



>ref|XP_006467404.1| PREDICTED: aspartic proteinase-like isoform X1 [Citrus sinensis]
Length=598

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 80/111 (72%), Gaps = 10/111 (9%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIA  400
            V SVSNDGL+RIGLKK KLD  N LA  + S+ G   R          N R     DI+A
Sbjct  106  VASVSNDGLVRIGLKKMKLDPNNRLAARLESEHGEALRASVKKYGFPNNLRDSEDTDIVA  165

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNYM+AQY+G+IGIG+PPQKFTV+FDTGSSNLWVPS  CY S+ACYFHSK
Sbjct  166  LKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTNCYFSVACYFHSK  216



>ref|XP_008226860.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
 ref|XP_008226861.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
Length=514

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 79/109 (72%), Gaps = 10/109 (9%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIALK  406
            S SNDGL+R+GLKKRK D+ N +A  I SKEG   R          N       DI++LK
Sbjct  24   SESNDGLVRVGLKKRKFDQNNRVAAQIESKEGEALRASLLKYRLRGNLADSQDIDIVSLK  83

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NYM+AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPSAKCY SIACY H K
Sbjct  84   NYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHPK  132



>gb|KCW88767.1| hypothetical protein EUGRSUZ_A01109 [Eucalyptus grandis]
Length=426

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 84/112 (75%), Gaps = 10/112 (9%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKE----GRYARNYR------GDPSAD  391
            SP VFS S++GLIR+GLKKRKLD++N +A    SKE    G   R Y+       D   D
Sbjct  19   SPAVFSSSDNGLIRVGLKKRKLDQLNRVAAQRYSKERETLGGLGRKYKFHGYNGEDDDTD  78

Query  392  IIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            I++LKNYM+AQY+G+IGIG+P QKFTVVFDTGSSNLWVPS+KCY SIACY H
Sbjct  79   IVSLKNYMDAQYYGEIGIGTPAQKFTVVFDTGSSNLWVPSSKCYFSIACYLH  130



>gb|AGE15494.1| preprosilpepsin 1 [Silybum marianum]
Length=506

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 82/105 (78%), Gaps = 5/105 (5%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNY-----RGDPSADIIALKN  409
            PT FSVSN GL+R+GLKKRK+D+IN L+    S EG+  +++       D  +DIIALKN
Sbjct  20   PTAFSVSNGGLVRVGLKKRKVDQINQLSGHGASMEGKARKDFGFGSTLRDSDSDIIALKN  79

Query  410  YMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYF  544
            YM+AQY+G+IGIG P QKFTV+FDTGSSNLWVPSAKCY S+AC F
Sbjct  80   YMDAQYYGEIGIGEPAQKFTVIFDTGSSNLWVPSAKCYFSVACLF  124



>ref|XP_009797823.1| PREDICTED: aspartic proteinase [Nicotiana sylvestris]
 ref|XP_009797831.1| PREDICTED: aspartic proteinase [Nicotiana sylvestris]
Length=512

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 81/108 (75%), Gaps = 11/108 (10%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR-------NYRGDPSA----DIIALKN  409
            SNDGL+RIGLKK K D+ N LA  + SKEG   R       N RG+  A    DI+ALKN
Sbjct  24   SNDGLVRIGLKKIKFDQNNRLAARVESKEGEALRASFRKYNNLRGNLGASEDTDIVALKN  83

Query  410  YMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            YM+AQYFG+IGIGSPPQKFTV+FDTGSSNLWVPS+KCY S+ C FHSK
Sbjct  84   YMDAQYFGEIGIGSPPQKFTVIFDTGSSNLWVPSSKCYFSVPCLFHSK  131



>ref|XP_010046321.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010046325.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW88765.1| hypothetical protein EUGRSUZ_A01109 [Eucalyptus grandis]
 gb|KCW88766.1| hypothetical protein EUGRSUZ_A01109 [Eucalyptus grandis]
Length=514

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 84/112 (75%), Gaps = 10/112 (9%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKE----GRYARNYR------GDPSAD  391
            SP VFS S++GLIR+GLKKRKLD++N +A    SKE    G   R Y+       D   D
Sbjct  19   SPAVFSSSDNGLIRVGLKKRKLDQLNRVAAQRYSKERETLGGLGRKYKFHGYNGEDDDTD  78

Query  392  IIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            I++LKNYM+AQY+G+IGIG+P QKFTVVFDTGSSNLWVPS+KCY SIACY H
Sbjct  79   IVSLKNYMDAQYYGEIGIGTPAQKFTVVFDTGSSNLWVPSSKCYFSIACYLH  130



>ref|XP_009361022.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=513

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 79/107 (74%), Gaps = 10/107 (9%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIALKNY  412
            SNDGL+RIGLKKRKLD+ N +A  I SKEG   R          N       DI++LKNY
Sbjct  26   SNDGLLRIGLKKRKLDQNNRVAAQIDSKEGESLRAVLQKYRLGGNLADSQDIDIVSLKNY  85

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            M+AQYFG+IGIG+PPQKFTV+FDTGS+NLWVPS+KCY SIACY H K
Sbjct  86   MDAQYFGEIGIGTPPQKFTVIFDTGSANLWVPSSKCYFSIACYLHPK  132



>gb|ACX55830.1| aspartic proteinase 2 [Castanea mollissima]
Length=513

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 81/107 (76%), Gaps = 10/107 (9%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR---------YARNYRGDPS-ADIIALK  406
            S SN GL+RIGLKK KLD+ N +A  + SK+G          Y R   GDP   DI++LK
Sbjct  24   SASNGGLVRIGLKKMKLDKNNRVAAQLESKDGEVRSASIRKYYLRGNSGDPEDIDIVSLK  83

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            NYM+AQYFG+IG+G+PPQKFTV+FDTGSSNLWVPS+KCY S+ACYFH
Sbjct  84   NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFH  130



>emb|CAA70340.1| aspartic proteinase [Centaurea calcitrapa]
Length=509

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 96/124 (77%), Gaps = 5/124 (4%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT ++ SL+AL LF+LLSPT FS SN GL+R+GLKKRK+D+IN L     S EG+  ++
Sbjct  1    MGTAIKASLLALFLFVLLSPTAFSASNGGLLRVGLKKRKVDQINQLRNHGASMEGKARKD  60

Query  368  Y-----RGDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSI  532
            +       D  +DII LKNYM+AQY+G+IGIGSP QKFTV+FDTGSSNLWVPSAKCY S+
Sbjct  61   FGFGGSLRDSDSDIIELKNYMDAQYYGEIGIGSPAQKFTVIFDTGSSNLWVPSAKCYFSV  120

Query  533  ACYF  544
            AC F
Sbjct  121  ACLF  124



>gb|ACX55829.1| aspartic proteinase 1 [Castanea mollissima]
Length=513

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 81/107 (76%), Gaps = 10/107 (9%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR---------YARNYRGDPS-ADIIALK  406
            S SN GL+RIGLKK KLD+ N +A  + SK+G          Y R   GDP   DI++LK
Sbjct  24   SASNGGLVRIGLKKMKLDKNNRVAAQLESKDGEVRSASIRKYYLRGNSGDPEDIDIVSLK  83

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            NYM+AQYFG+IG+G+PPQKFTV+FDTGSSNLWVPS+KCY S+ACYFH
Sbjct  84   NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFH  130



>dbj|BAB20971.1| aspartic proteinase 3 [Nepenthes alata]
Length=507

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 83/112 (74%), Gaps = 10/112 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR---------YARNYRGDPS-ADI  394
            P VFS SNDGL+RIGLKK+  D+ N +A  + ++EG          Y     G+P   DI
Sbjct  12   PLVFSDSNDGLLRIGLKKKIFDQNNRIAARLETEEGEARRSSLRKYYLHGNLGNPEETDI  71

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHS  550
            +ALKNYM+AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY S+ CYFH+
Sbjct  72   VALKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCYFHA  123



>gb|AHB32105.1| aspartic proteinase [Camellia sinensis]
Length=507

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 93/125 (74%), Gaps = 7/125 (6%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT+   +L+ALL+F LLS T FS S++ LIR+GLKKRKLD+I  L E      G   RN
Sbjct  1    MGTKFGANLIALLVFFLLSQTSFSASDNRLIRVGLKKRKLDQIKRLGEE--GFSGASERN  58

Query  368  YR-----GDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSI  532
            YR      D   DII+LKNYMNAQYFG+IGIG+P QKFTV+FDTGSSNLWVPSAKCY S+
Sbjct  59   YRLRGNFEDSDTDIISLKNYMNAQYFGEIGIGTPSQKFTVIFDTGSSNLWVPSAKCYFSV  118

Query  533  ACYFH  547
            ACY H
Sbjct  119  ACYLH  123



>ref|XP_010252464.1| PREDICTED: aspartic proteinase A1-like [Nelumbo nucifera]
 ref|XP_010252465.1| PREDICTED: aspartic proteinase A1-like [Nelumbo nucifera]
Length=514

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 83/109 (76%), Gaps = 10/109 (9%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR----YARNYR-----GDP-SADIIALK  406
            S SNDGL+RIGLKKRK D+ N LA  + S+ G       R YR     GD    D+++LK
Sbjct  24   SASNDGLLRIGLKKRKFDQNNLLAARLESEGGEPLKASIRKYRLRGNLGDSGDTDMVSLK  83

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NYM+AQYFG+IG+G+PPQKFTV+FDTGSSNLWVPSAKCY S+ACYFHSK
Sbjct  84   NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSVACYFHSK  132



>gb|EYU27762.1| hypothetical protein MIMGU_mgv1a004712mg [Erythranthe guttata]
Length=513

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 80/107 (75%), Gaps = 10/107 (9%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRGD----PSADIIALKNY  412
            SNDGL+RIGLKK KLD  N LA  + SKE +  R      N+RG        DI+ALKNY
Sbjct  26   SNDGLLRIGLKKLKLDHNNGLAARLESKEAKDLRASIRKYNFRGKLGDGSDTDIVALKNY  85

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            M+AQYFG+IG+G+PPQKFTV+FDTGSSNLWVPS KCY S+ CYFHSK
Sbjct  86   MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSTKCYFSVPCYFHSK  132



>ref|XP_006303952.1| hypothetical protein CARUB_v10008798mg, partial [Capsella rubella]
 gb|EOA36850.1| hypothetical protein CARUB_v10008798mg, partial [Capsella rubella]
Length=538

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRGDP-SADIIALKNYMNAQ  424
            + FS  +DG +R+GLKK KLD  N LA  +GSK+ +  R Y GD   AD++ALKNY++AQ
Sbjct  54   SAFSERSDGTVRVGLKKLKLDSKNRLAARVGSKQDKPLRGYSGDSGDADVVALKNYLDAQ  113

Query  425  YFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            Y+G+I IG+PPQKFTVVFDTGSSNLWVPS+KCY SIAC  H K
Sbjct  114  YYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPK  156



>ref|XP_011046961.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011046962.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=512

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 82/110 (75%), Gaps = 8/110 (7%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR--------NYRGDPSADIIAL  403
             V S SNDGL+RIGLKK KLD+ N +A  + SKE   A         N       DI+AL
Sbjct  21   VVSSASNDGLLRIGLKKVKLDKNNRIAARLDSKETLRASIRKYNLCSNLGESEDTDIVAL  80

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            KNY+++QY+G+IG+GSPPQKFTV+FDTGSSNLWVPS+KCYLS+ACYFHSK
Sbjct  81   KNYLDSQYYGEIGVGSPPQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSK  130



>ref|XP_006350474.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=510

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 80/109 (73%), Gaps = 10/109 (9%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRG----DPSADIIALK  406
            S SNDG +RIGLKK K D  N LA  + SKEG   R      N+RG        DI+ALK
Sbjct  21   SSSNDGFVRIGLKKMKFDHNNRLAARLESKEGDLLRPSIRKYNFRGKLGDSEDTDIVALK  80

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NYM+AQYFG+IG+G+PPQKFTV+FDTGSSNLWVPS+KCY S+ C+FH+K
Sbjct  81   NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHAK  129



>gb|KDP20718.1| hypothetical protein JCGZ_21189 [Jatropha curcas]
Length=512

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 86/109 (79%), Gaps = 8/109 (7%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYA--RNY--RGD----PSADIIALK  406
            V+SV NDGL+RIGLKK KLD+ + +A  + SKE   A  R Y  RG+       DI+ALK
Sbjct  22   VYSVPNDGLVRIGLKKIKLDQNSRIAAQLESKEASRASVRKYGLRGNLGDSEDLDIVALK  81

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NYM+AQY+G+I +G+PPQKFTV+FDTGSSNLWVPS+KC+LSIACYFHSK
Sbjct  82   NYMDAQYYGEIDVGTPPQKFTVIFDTGSSNLWVPSSKCFLSIACYFHSK  130



>ref|XP_006383885.1| hypothetical protein POPTR_0004s00900g [Populus trichocarpa]
 gb|ERP61682.1| hypothetical protein POPTR_0004s00900g [Populus trichocarpa]
Length=552

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 82/110 (75%), Gaps = 8/110 (7%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR--------NYRGDPSADIIAL  403
             V S SNDGL+RIGLKK KLD+ N +A  + SKE   A         N       DI+AL
Sbjct  61   VVSSASNDGLLRIGLKKVKLDKNNRIAARLDSKETLRASIRKYNLCGNLGESEDTDIVAL  120

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            KNY+++QY+G+IG+GSPPQKFTV+FDTGSSNLWVPS+KCYLS+ACYFHSK
Sbjct  121  KNYLDSQYYGEIGVGSPPQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSK  170



>gb|KDP24853.1| hypothetical protein JCGZ_24447 [Jatropha curcas]
Length=512

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADI  394
            P   SV N GLIRIGLKKRK+D++N  A +I SKEG   R          + R    A+ 
Sbjct  17   PVALSVHNVGLIRIGLKKRKMDQVNRPAGTIDSKEGESMRTATKKYHFRNDLRDSGDAEF  76

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            + LKNY++AQYFG+IGIG+P Q FTV+FDTGSSNLWVPS+KCY S+ACYFHS+
Sbjct  77   VTLKNYLDAQYFGEIGIGTPSQTFTVIFDTGSSNLWVPSSKCYFSLACYFHSR  129



>gb|KHG11144.1| Aspartic proteinase [Gossypium arboreum]
Length=514

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 83/113 (73%), Gaps = 11/113 (10%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKE-----GRYARNYR-----GD-PSADI  394
            +V   SNDGL+RIGLKK KLD  N LA  + SK+        A+ YR     GD    DI
Sbjct  20   SVVLASNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIAKKYRFRNDLGDSEETDI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNYM+AQY+G+IGIG+PPQKFTV+FDTGSSNLWVPS KCY S+AC+FHSK
Sbjct  80   VALKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSK  132



>emb|CAC86003.1| aspartic proteinase [Theobroma cacao]
Length=514

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 81/113 (72%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADI  394
            P VFS+SN+ L+RIGLKKRK D+   LA  + SKE    R          N +     DI
Sbjct  20   PIVFSISNERLVRIGLKKRKFDQNYRLAAHLDSKEREAFRASLKKYRLQGNLQESEDIDI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNY++AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY SIACY HS+
Sbjct  80   VALKNYLDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYLHSR  132



>ref|XP_007020768.1| Aspartic proteinase A1 [Theobroma cacao]
 gb|EOY12293.1| Aspartic proteinase A1 [Theobroma cacao]
Length=514

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 81/113 (72%), Gaps = 10/113 (9%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADI  394
            P VFS+SN+ L+RIGLKKRK D+   LA  + SKE    R          N +     DI
Sbjct  20   PIVFSISNERLVRIGLKKRKFDQNYRLAAHLDSKEREAFRASLKKYRLQGNLQESEDIDI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNY++AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY SIACY HS+
Sbjct  80   VALKNYLDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYLHSR  132



>gb|KHG11143.1| Aspartic proteinase [Gossypium arboreum]
Length=520

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 83/113 (73%), Gaps = 11/113 (10%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKE-----GRYARNYR-----GD-PSADI  394
            +V   SNDGL+RIGLKK KLD  N LA  + SK+        A+ YR     GD    DI
Sbjct  20   SVVLASNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIAKKYRFRNDLGDSEETDI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNYM+AQY+G+IGIG+PPQKFTV+FDTGSSNLWVPS KCY S+AC+FHSK
Sbjct  80   VALKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSK  132



>dbj|BAA76870.1| aspartic proteinase [Helianthus annuus]
Length=509

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 82/109 (75%), Gaps = 5/109 (5%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNY-----RGDPSADIIALK  406
            SPT FS +  GL+R+GLKKRK ++ N ++E   S EG   RN+       +   D+I LK
Sbjct  19   SPTAFSSTKGGLLRVGLKKRKTNQFNRVSEHGLSMEGTDRRNFGFYDTLRNSEGDVIVLK  78

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NYM+AQYFG+IGIG+PPQKFTVVFDTGS+NLWVPS+KC+LS+AC FH K
Sbjct  79   NYMDAQYFGEIGIGTPPQKFTVVFDTGSANLWVPSSKCFLSVACLFHQK  127



>emb|CAA56373.1| putative aspartic protease [Brassica oleracea]
Length=255

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNY-RGDP-SADIIALKNYMNAQYFGDI  439
            NDG  R+GLKK KLDR + +A  +GSK+ +  R Y  GD   ADI+ LKNY++AQY+G+I
Sbjct  27   NDGTFRVGLKKLKLDRKSRIAARVGSKQLKPLRGYGLGDSGDADIVTLKNYLDAQYYGEI  86

Query  440  GIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
             IG+PPQKFTVVFDTGSSNLWVPS+KCY SIAC FHSK
Sbjct  87   AIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLFHSK  124



>ref|XP_011096039.1| PREDICTED: aspartic proteinase-like [Sesamum indicum]
Length=511

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 80/105 (76%), Gaps = 8/105 (8%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGRYA-------RNYRGDP-SADIIALKNYMN  418
            SNDGL+RIGLK+ KLD+ N +A  + SKE   A       R   GD    DI+ALKNYM+
Sbjct  26   SNDGLVRIGLKRLKLDQNNRVATRLESKEALRASIRKYNLRGKLGDAVDTDIVALKNYMD  85

Query  419  AQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPSAKCY S+ C+FHSK
Sbjct  86   AQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSAKCYFSVPCFFHSK  130



>ref|XP_010476135.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
Length=506

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 78/104 (75%), Gaps = 2/104 (2%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-GDP-SADIIALKNYMNA  421
            T FS  NDG  R+GLKK KLD  N LA   GSK+G+  R Y  GD   AD++ LKNY++A
Sbjct  21   TAFSERNDGTFRVGLKKLKLDPKNRLAAHAGSKQGKLLRGYNLGDSGDADVVVLKNYLDA  80

Query  422  QYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            QY+G+I IG+PPQKFTVVFDTGSSNLWVPS+KCY SIAC  H K
Sbjct  81   QYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPK  124



>ref|XP_008229973.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
Length=515

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 98/133 (74%), Gaps = 11/133 (8%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHL---AESIGSKE--G  352
            MGT+   SL+   LFLLLS  VFS +NDGL+RIGLKK K+D+  H+   + +I  +E  G
Sbjct  1    MGTKFGASLVTPFLFLLLSHVVFSTTNDGLVRIGLKKMKIDQKCHMNRRSNTIEQEETPG  60

Query  353  RYARNY--RGD----PSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSA  514
               R Y  RG+       DI+ALKNYM+AQYFG+IGIGSP QKFTV+FDTGSSNLWVPSA
Sbjct  61   GPIRKYHLRGNLGDSEDTDIVALKNYMDAQYFGEIGIGSPAQKFTVIFDTGSSNLWVPSA  120

Query  515  KCYLSIACYFHSK  553
            KCY S+AC+FHSK
Sbjct  121  KCYFSVACFFHSK  133



>gb|AFH58568.1| aspartic acid protease [Ananas comosus]
Length=514

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 93/132 (70%), Gaps = 10/132 (8%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEG---RY  358
            MGT+     +A+LL +LL  ++   S DGL+RIGLKKR +D  N +A  +  KE      
Sbjct  1    MGTRGGALAVAILLSVLLHQSILLASADGLVRIGLKKRPIDENNRIAARLVEKEEGPLLA  60

Query  359  ARNY--RGDP-----SADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAK  517
            AR Y  RG P       DIIALKNYMNAQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS+K
Sbjct  61   ARRYGLRGAPLKEGEETDIIALKNYMNAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSK  120

Query  518  CYLSIACYFHSK  553
            CY SIAC FH+K
Sbjct  121  CYFSIACLFHTK  132



>ref|XP_002524837.1| Aspartic proteinase precursor, putative [Ricinus communis]
 gb|EEF37557.1| Aspartic proteinase precursor, putative [Ricinus communis]
Length=456

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 79/110 (72%), Gaps = 7/110 (6%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN-------YRGDPSADIIAL  403
            P VFS+ ND L+R+GLKK+K D++N  A ++  KEG   R               DI+ L
Sbjct  17   PVVFSLHNDALVRVGLKKKKFDQVNIPAGTVDFKEGEAMRAATKKYNLVENSDDVDIVEL  76

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            KNY++AQY+G+I IG+PPQ FTV+FDTGSSNLW+PS+KCY S+ACYFHSK
Sbjct  77   KNYLDAQYYGEIAIGTPPQTFTVIFDTGSSNLWIPSSKCYFSVACYFHSK  126



>ref|XP_007215237.1| hypothetical protein PRUPE_ppa004349mg [Prunus persica]
 gb|EMJ16436.1| hypothetical protein PRUPE_ppa004349mg [Prunus persica]
Length=515

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 93/133 (70%), Gaps = 11/133 (8%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR----  355
            MGT+   SL+   LFLLLS  VFS +NDGL+RIGLKK K+D+  H+     + E      
Sbjct  1    MGTKFGASLVTPFLFLLLSHVVFSTTNDGLVRIGLKKMKIDQKCHMNRRSNANEQEETPG  60

Query  356  ------YARNYRGDPS-ADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSA  514
                  + R   GD    DI+ALKNYM+AQYFG+IGIGSP QKFTV+FDTGSSNLWVPSA
Sbjct  61   GPIRKYHLRGNLGDSEDTDIVALKNYMDAQYFGEIGIGSPAQKFTVIFDTGSSNLWVPSA  120

Query  515  KCYLSIACYFHSK  553
            KCY S+AC+FHSK
Sbjct  121  KCYFSVACFFHSK  133



>ref|XP_009390744.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 82/121 (68%), Gaps = 21/121 (17%)
 Frame = +2

Query  254  FSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYA---RNY---------RGDP-----  382
            F+VS DGL+RIGLKKR LD+   LA  +   EG  A   R Y         R DP     
Sbjct  23   FAVSADGLVRIGLKKRPLDQNGRLATRLSRDEGLLAPAARKYGLPLHRDGLRLDPGLDGP  82

Query  383  ----SADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHS  550
                + D++ALKNYMNAQYFG+IGIGSPPQ FTVVFDTGSSNLWVPS+KCY S+ACYFH 
Sbjct  83   AGPDAGDVVALKNYMNAQYFGEIGIGSPPQNFTVVFDTGSSNLWVPSSKCYFSVACYFHP  142

Query  551  K  553
            K
Sbjct  143  K  143



>ref|XP_010686810.1| PREDICTED: aspartic proteinase A1-like [Beta vulgaris subsp. 
vulgaris]
Length=516

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 80/108 (74%), Gaps = 9/108 (8%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR---------NYRGDPSADIIALKN  409
            S SNDGL+R+GLKK+K D+ + +A  +GSKE    R         N      ADI+ALKN
Sbjct  26   SSSNDGLLRVGLKKKKFDQNSRIASRLGSKEREALRSSFEKYLLGNSEDLEGADIVALKN  85

Query  410  YMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            YM+AQYFGDIG+G+PPQ FTV+FDTGSSNLWVPS+KCY SI C+FH+K
Sbjct  86   YMDAQYFGDIGVGTPPQTFTVIFDTGSSNLWVPSSKCYFSIPCFFHAK  133



>ref|XP_006389579.1| aspartic endopeptidase family protein [Populus trichocarpa]
 gb|ERP48493.1| aspartic endopeptidase family protein [Populus trichocarpa]
Length=512

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 80/110 (73%), Gaps = 8/110 (7%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR--------NYRGDPSADIIAL  403
             V S SNDGL+RIGLKK K D+ N +A  + S+E   A         N       DI+AL
Sbjct  21   VVLSESNDGLLRIGLKKVKFDKNNRIAARLDSQEALRASIRKYNLLGNLGESEDTDIVAL  80

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            KNY +AQY+G+IG+G+PPQKFTV+FDTGSSNLWVPS+KCYLS+ACYFHSK
Sbjct  81   KNYFDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSK  130



>ref|XP_007153978.1| hypothetical protein PHAVU_003G0808000g, partial [Phaseolus vulgaris]
 gb|ESW25972.1| hypothetical protein PHAVU_003G0808000g, partial [Phaseolus vulgaris]
Length=143

 Score =   130 bits (328),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 76/105 (72%), Gaps = 9/105 (9%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRY---------ARNYRGDPSADIIALKNYMN  418
            NDGL RIGLKK KLD  N LA  IGSK+  +           N+ G    DI+ALKNY++
Sbjct  27   NDGLRRIGLKKIKLDPNNRLAARIGSKDDSFRASIRKFHLQNNFGGTEDTDIVALKNYLD  86

Query  419  AQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            AQYFG+I IG+ PQKFTV+FDTGSSNLWVPS++C  S+ACYFH+K
Sbjct  87   AQYFGEIAIGTSPQKFTVIFDTGSSNLWVPSSRCTFSVACYFHAK  131



>ref|XP_004231616.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
Length=510

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 80/109 (73%), Gaps = 10/109 (9%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRG----DPSADIIALK  406
            S SNDG +RIGLKK K D+ N LA  + SKE    R      N+RG        DI+ALK
Sbjct  21   SSSNDGFVRIGLKKMKFDQNNRLAARLESKERDLMRPSIRKYNFRGKLGDSEDTDIVALK  80

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NYM+AQYFG+IG+G+PPQKFTV+FDTGSSNLWVPS+KCY S+ C+FH+K
Sbjct  81   NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHAK  129



>ref|XP_009395027.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395028.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 79/108 (73%), Gaps = 9/108 (8%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR---------GDPSADIIALKN  409
            S + DGLIRIGL+K+ LD  + LA  +  KEG+     R          D  ADII+LKN
Sbjct  26   SAAADGLIRIGLRKKALDENSRLAGRLLEKEGKALMGPRYGLRGGLESNDEDADIISLKN  85

Query  410  YMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            YMNAQYFG+IGIG+P QKFTV+FDTGSSNLWVPS+KCY SIACYFHSK
Sbjct  86   YMNAQYFGEIGIGTPAQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSK  133



>ref|XP_003567869.1| PREDICTED: phytepsin [Brachypodium distachyon]
Length=505

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 79/98 (81%), Gaps = 3/98 (3%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSKEGRY---ARNYRGDPSADIIALKNYMNAQYFGDI  439
            +GL+RI LKKR +D+ N +A  +  +EG++   A +   +   DI+AL+NYMNAQYFG+I
Sbjct  26   EGLVRIALKKRPIDQNNRVATRLSGEEGQHLGGANSLGSEDEGDIVALQNYMNAQYFGEI  85

Query  440  GIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            G+G+PPQKFTV+FDTGSSNLWVPSAKCY SIACYFHS+
Sbjct  86   GVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYFHSR  123



>ref|XP_008342027.1| PREDICTED: aspartic proteinase A1-like [Malus domestica]
Length=538

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 101/153 (66%), Gaps = 15/153 (10%)
 Frame = +2

Query  140  SILSLLFPWPAY-SAF--------NMGTQlrtslmalllflllSPTVFSVSNDGLIRIGL  292
            +++SLLF +P+  S F         MGTQ R  L+   LFLLLS  V S  +DGL+RIGL
Sbjct  4    TLVSLLFQFPSDPSQFVVIRKISPKMGTQFRAGLVTSFLFLLLSHVVISTPSDGLVRIGL  63

Query  293  KKRKLDRINHLAESIGSKEGRYARNY--RGD----PSADIIALKNYMNAQYFGDIGIGSP  454
            KK K+D+  HL        G   R Y  RG+       DI+ALKNYM+AQYFG+IGIG+P
Sbjct  64   KKMKIDQTCHLNRRNNGTPGGPIRKYHLRGNLGESEDTDIVALKNYMDAQYFGEIGIGTP  123

Query  455  PQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
             QKFTV+FDTGSSNLWVPSAKCY S+ACY H K
Sbjct  124  AQKFTVIFDTGSSNLWVPSAKCYFSVACYLHPK  156



>gb|KDO54711.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=530

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 9/133 (7%)
 Frame = +2

Query  173  YSAFNMGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEG  352
            ++  +MGT+     +AL LFL+LSP  F++ NDGL+RIGL+K+KLD+IN L     SKE 
Sbjct  12   FTVVDMGTKFTAIRVALFLFLILSPAAFALPNDGLVRIGLRKKKLDQINRLVGQTVSKEE  71

Query  353  RYARN---------YRGDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWV  505
               R            GD   DI+AL N+M+AQYFG++ IG+P Q FTV+FDTGSSNLWV
Sbjct  72   ETMRTPVRRYNLHGSLGDSDTDIVALNNFMDAQYFGEVSIGTPSQTFTVIFDTGSSNLWV  131

Query  506  PSAKCYLSIACYF  544
            PSAKCY S++CYF
Sbjct  132  PSAKCYFSVSCYF  144



>gb|KHG16917.1| Asparticase [Gossypium arboreum]
Length=551

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 83/113 (73%), Gaps = 11/113 (10%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAES---------IGSKEGRYA-RNYRGD-PSADI  394
            +V + S+DGL+RIGLKK+K D  N LA           I S + +Y   N  GD    DI
Sbjct  68   SVMTASDDGLVRIGLKKKKFDPNNRLASRLESEDRQALIASMQEKYGLHNNHGDHEDTDI  127

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +ALKNYM+AQY+G+IG+G+PPQKFTV+FDTGSSNLWVPS+KCY S+ACYFHSK
Sbjct  128  VALKNYMDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSK  180



>ref|XP_010458606.1| PREDICTED: aspartic proteinase A1 [Camelina sativa]
 ref|XP_010458607.1| PREDICTED: aspartic proteinase A1 [Camelina sativa]
Length=506

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 77/104 (74%), Gaps = 2/104 (2%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-GDP-SADIIALKNYMNA  421
            T FS  NDG  R+GLKK KLD  N LA   GSK+G   R Y  GD   AD++ LKNY++A
Sbjct  21   TAFSERNDGTFRVGLKKLKLDPKNRLAAHAGSKQGEPLRAYTLGDSGDADVVVLKNYLDA  80

Query  422  QYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            QY+G+I IG+PPQKFTVVFDTGSSNLWVPS+KCY SIAC  H K
Sbjct  81   QYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPK  124



>ref|XP_007026133.1| Saposin-like aspartyl protease family protein [Theobroma cacao]
 gb|EOY28755.1| Saposin-like aspartyl protease family protein [Theobroma cacao]
Length=514

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 78/106 (74%), Gaps = 10/106 (9%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGR---------YARNYRGD-PSADIIALKNYM  415
            NDGL+RIGLKK KLD  N LA  + SK+G          + RN  GD    DI+ALKNYM
Sbjct  27   NDGLVRIGLKKMKLDPNNRLAARLDSKDGEALRASIKKYHFRNNLGDSEETDIVALKNYM  86

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +AQY+G+IGIG+P QKFTV+FDTGSSNLWVPS KCY S+ACYFH K
Sbjct  87   DAQYYGEIGIGTPTQKFTVIFDTGSSNLWVPSTKCYFSVACYFHEK  132



>ref|XP_011008023.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011008024.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=512

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 79/110 (72%), Gaps = 8/110 (7%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR--------NYRGDPSADIIAL  403
             V S SNDG++RIGLKK K D+ N +A    S+E   A         N       DI+AL
Sbjct  21   VVLSESNDGMLRIGLKKVKFDKNNRIAARFDSQEALRASIRKYNLLGNLGESEDTDIVAL  80

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            KNY +AQY+G+IG+G+PPQKFTV+FDTGSSNLWVPS+KCYLS+ACYFHSK
Sbjct  81   KNYFDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSK  130



>gb|KGN56078.1| hypothetical protein Csa_3G066750 [Cucumis sativus]
Length=535

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 94/137 (69%), Gaps = 11/137 (8%)
 Frame = +2

Query  173  YSAFNMGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEG  352
            YS  NMGT+L+  +  L +   + P VF  SNDG +RIGLK+RK  + N +A  I +KEG
Sbjct  56   YSVSNMGTRLKLFIAVLFICFFMFPMVFCASNDGKVRIGLKRRKFGQNNRVASKIATKEG  115

Query  353  RYARN--YRGDPSA--------DIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLW  502
               +N   +  PSA        DI+ LKNY+NAQYFG+IGIG+PPQKF V+FDTGSSNLW
Sbjct  116  ISLKNSVEKYQPSANLGDSDDFDIVGLKNYLNAQYFGEIGIGTPPQKFAVIFDTGSSNLW  175

Query  503  VPSAKCYLSIACYFHSK  553
            VPS+KC+ S+AC  HSK
Sbjct  176  VPSSKCF-SVACLLHSK  191



>gb|EYU33885.1| hypothetical protein MIMGU_mgv1a004716mg [Erythranthe guttata]
Length=513

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 81/110 (74%), Gaps = 10/110 (9%)
 Frame = +2

Query  254  FSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRG----DPSADIIAL  403
             S  +DGLIRIGLKK  LD+ N LA  + SKEG   R      + RG    +   DI+AL
Sbjct  23   ISEPDDGLIRIGLKKLNLDQNNRLAARLESKEGEELRASIRRYSPRGKTVNNAETDIVAL  82

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            KNYM+AQYFG+IG+G+PPQKFTV+FDTGSSNLWVPS KCY S++C+FH+K
Sbjct  83   KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSTKCYFSVSCFFHTK  132



>gb|KDO54713.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=432

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 89/128 (70%), Gaps = 9/128 (7%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT+     +AL LFL+LSP  F++ NDGL+RIGL+K+KLD+IN L     SKE    R 
Sbjct  1    MGTKFTAIRVALFLFLILSPAAFALPNDGLVRIGLRKKKLDQINRLVGQTVSKEEETMRT  60

Query  368  ---------YRGDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKC  520
                       GD   DI+AL N+M+AQYFG++ IG+P Q FTV+FDTGSSNLWVPSAKC
Sbjct  61   PVRRYNLHGSLGDSDTDIVALNNFMDAQYFGEVSIGTPSQTFTVIFDTGSSNLWVPSAKC  120

Query  521  YLSIACYF  544
            Y S++CYF
Sbjct  121  YFSVSCYF  128



>ref|XP_010493478.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
 ref|XP_010493486.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
Length=506

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 77/104 (74%), Gaps = 2/104 (2%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-GDPS-ADIIALKNYMNA  421
            T FS  NDG  R+GLKK KLD  N LA   GSK+G+  R Y  GD   AD + LKNY++A
Sbjct  21   TAFSERNDGTFRVGLKKFKLDPKNRLAAHAGSKQGKPLRAYTLGDSEDADAVVLKNYLDA  80

Query  422  QYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            QY+G+I IG+PPQKFTVVFDTGSSNLWVPS+KCY SIAC  H K
Sbjct  81   QYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPK  124



>gb|KDO54714.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=492

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 89/128 (70%), Gaps = 9/128 (7%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT+     +AL LFL+LSP  F++ NDGL+RIGL+K+KLD+IN L     SKE    R 
Sbjct  1    MGTKFTAIRVALFLFLILSPAAFALPNDGLVRIGLRKKKLDQINRLVGQTVSKEEETMRT  60

Query  368  ---------YRGDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKC  520
                       GD   DI+AL N+M+AQYFG++ IG+P Q FTV+FDTGSSNLWVPSAKC
Sbjct  61   PVRRYNLHGSLGDSDTDIVALNNFMDAQYFGEVSIGTPSQTFTVIFDTGSSNLWVPSAKC  120

Query  521  YLSIACYF  544
            Y S++CYF
Sbjct  121  YFSVSCYF  128



>ref|XP_002279049.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 emb|CBI26663.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 77/110 (70%), Gaps = 10/110 (9%)
 Frame = +2

Query  254  FSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR----------YARNYRGDPSADIIAL  403
            FS S+ GL+RIGLKKR  D+ N LA  I SK+G              N  G     ++AL
Sbjct  23   FSASDGGLVRIGLKKRAFDQTNRLAARIESKQGEALGTSIRKYNLHGNAAGSKHTYVVAL  82

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
             NYM+AQYFG+I IG+PPQKFTV+FDTGSSNLWVPS+KCY S+ACYFHSK
Sbjct  83   HNYMDAQYFGEISIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSK  132



>ref|XP_009353298.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=510

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 86/128 (67%), Gaps = 6/128 (5%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT+ R  L+   LFLLLS  V S  NDGL+RIGLKK K+D+  HL        G   R 
Sbjct  1    MGTEFRAGLVTSFLFLLLSHVVISTPNDGLVRIGLKKMKIDQTCHLNRRSNGTPGGTIRK  60

Query  368  YR------GDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLS  529
            Y            DI+ALKNYM+AQYFG+IGIG+P QKFTV+FDTGSSNLWVPSAKCY S
Sbjct  61   YHLRSNLGESEDTDIVALKNYMDAQYFGEIGIGTPAQKFTVIFDTGSSNLWVPSAKCYFS  120

Query  530  IACYFHSK  553
            +ACY H K
Sbjct  121  VACYLHPK  128



>ref|XP_009347130.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=512

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 86/128 (67%), Gaps = 6/128 (5%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT+ R  L+   LFLLLS  V S  NDGL+RIGLKK K+D+  HL        G   R 
Sbjct  1    MGTEFRAGLVTSFLFLLLSHVVISTPNDGLVRIGLKKMKIDQTCHLNRRSNGTPGGTIRK  60

Query  368  YR------GDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLS  529
            Y            DI+ALKNYM+AQYFG+IGIG+P QKFTV+FDTGSSNLWVPSAKCY S
Sbjct  61   YHLRSNLGESEDTDIVALKNYMDAQYFGEIGIGTPAQKFTVIFDTGSSNLWVPSAKCYFS  120

Query  530  IACYFHSK  553
            +ACY H K
Sbjct  121  VACYLHPK  128



>ref|XP_006447588.1| hypothetical protein CICLE_v10017754mg [Citrus clementina]
 gb|ESR60828.1| hypothetical protein CICLE_v10017754mg [Citrus clementina]
Length=486

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 89/128 (70%), Gaps = 9/128 (7%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT+     +AL LFL+LSP  F++ NDGL+RIGL+K+KLD+IN L     SKE    R 
Sbjct  1    MGTKFTAIRVALFLFLILSPAAFALPNDGLVRIGLRKKKLDQINRLVGQTVSKEEETMRT  60

Query  368  ---------YRGDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKC  520
                       GD   DI+AL N+M+AQYFG++ IG+P Q FTV+FDTGSSNLWVPSAKC
Sbjct  61   PVRRYNLHGSLGDSDTDIVALNNFMDAQYFGEVSIGTPSQTFTVIFDTGSSNLWVPSAKC  120

Query  521  YLSIACYF  544
            Y S++CYF
Sbjct  121  YFSVSCYF  128



>ref|XP_006469663.1| PREDICTED: aspartic proteinase-like [Citrus sinensis]
 gb|KDO54712.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=514

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 89/128 (70%), Gaps = 9/128 (7%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT+     +AL LFL+LSP  F++ NDGL+RIGL+K+KLD+IN L     SKE    R 
Sbjct  1    MGTKFTAIRVALFLFLILSPAAFALPNDGLVRIGLRKKKLDQINRLVGQTVSKEEETMRT  60

Query  368  ---------YRGDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKC  520
                       GD   DI+AL N+M+AQYFG++ IG+P Q FTV+FDTGSSNLWVPSAKC
Sbjct  61   PVRRYNLHGSLGDSDTDIVALNNFMDAQYFGEVSIGTPSQTFTVIFDTGSSNLWVPSAKC  120

Query  521  YLSIACYF  544
            Y S++CYF
Sbjct  121  YFSVSCYF  128



>ref|XP_009123365.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123366.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123367.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123369.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
Length=509

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 79/107 (74%), Gaps = 8/107 (7%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR--------NYRGDPSADIIALKNY  412
            S SNDG +R+GLKK KLD  N LA   GSK+ +  R        N +    ADI+ALKNY
Sbjct  21   SESNDGTLRVGLKKLKLDPTNRLATRFGSKQEKAFRSSLKEFRSNDKNAGDADIVALKNY  80

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++AQY+G+I IG+PPQKFTV+FDTGSSNLWVPS KCY S++C+FHSK
Sbjct  81   LDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFSLSCFFHSK  127



>ref|XP_010455729.1| PREDICTED: aspartic proteinase A3 isoform X2 [Camelina sativa]
Length=504

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSK---EGRYARNY--RGDPSADIIALKNYMNAQYFG  433
            DG IRIGLKKRKLDR N LA  +  K   E  + +++    D +AD++ LKNY++AQY+G
Sbjct  30   DGTIRIGLKKRKLDRSNRLASQLFLKNRGESWFPKDHFRLNDANADMVPLKNYLDAQYYG  89

Query  434  DIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            DI IG+PPQKFTV+FDTGSSNLW+PS KCYLS+ACYFHSK
Sbjct  90   DITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSK  129



>emb|CDY24888.1| BnaA03g59920D [Brassica napus]
Length=511

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 79/107 (74%), Gaps = 8/107 (7%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR--------NYRGDPSADIIALKNY  412
            S SNDG +R+GLKK KLD  N LA   GSK+ +  R        N +    ADI+ALKNY
Sbjct  21   SESNDGTLRVGLKKLKLDPTNRLATRFGSKQEKAFRSSLKEFRSNDKNAGDADIVALKNY  80

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++AQY+G+I IG+PPQKFTV+FDTGSSNLWVPS KCY S++C+FHSK
Sbjct  81   LDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFSLSCFFHSK  127



>gb|AFX73039.1| preprogaline A [Galium verum]
Length=506

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 77/106 (73%), Gaps = 2/106 (2%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNY--RGDPSADIIALKNYM  415
            S  + S S   L+R+ LKK KLD++N LA S+     R  R Y   G   +DIIALKNYM
Sbjct  19   SAALLSASETKLVRVSLKKAKLDQVNRLAGSVPRGSARINRLYGNMGSSDSDIIALKNYM  78

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +AQY+G+IGIG+P QKFTV+FDTGSSNLWVPS KCY S ACYFHSK
Sbjct  79   DAQYYGEIGIGTPAQKFTVIFDTGSSNLWVPSTKCYFSPACYFHSK  124



>ref|XP_010455726.1| PREDICTED: aspartic proteinase A3 isoform X1 [Camelina sativa]
 ref|XP_010455728.1| PREDICTED: aspartic proteinase A3 isoform X1 [Camelina sativa]
Length=508

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSK---EGRYARNY--RGDPSADIIALKNYMNAQYFG  433
            DG IRIGLKKRKLDR N LA  +  K   E  + +++    D +AD++ LKNY++AQY+G
Sbjct  30   DGTIRIGLKKRKLDRSNRLASQLFLKNRGESWFPKDHFRLNDANADMVPLKNYLDAQYYG  89

Query  434  DIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            DI IG+PPQKFTV+FDTGSSNLW+PS KCYLS+ACYFHSK
Sbjct  90   DITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSK  129



>ref|XP_008797519.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797520.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797521.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797522.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797523.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
Length=512

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 10/111 (9%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR--YARNY-------RGDPSADIIA  400
            +V     DGLIRIGLKK+ +D+ + LA  +  KEG+   A  Y        GD + DII+
Sbjct  21   SVVLAEGDGLIRIGLKKKPMDQNSRLAARLVEKEGKPLVAGKYGLRGGLENGDET-DIIS  79

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNYMNAQYFG+IG+G+PPQKFTV+FDTGSSNLWVPS+KCY S+AC+FHS+
Sbjct  80   LKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACFFHSR  130



>ref|XP_003632941.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 ref|XP_002262915.2| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 ref|XP_010655376.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
Length=514

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 75/107 (70%), Gaps = 10/107 (9%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIALKNY  412
            + DGL RIGLKK KLD+ + LA  + SKEG   R          N       DI+ LKNY
Sbjct  26   TTDGLFRIGLKKMKLDQNDQLAARLESKEGESLRASIRKYFRHGNLGDSQDTDIVGLKNY  85

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            M+AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY S+ CYFHSK
Sbjct  86   MDAQYFGEIGIGTPPQTFTVIFDTGSSNLWVPSSKCYFSVPCYFHSK  132



>ref|XP_010244477.1| PREDICTED: aspartic proteinase A1-like isoform X3 [Nelumbo nucifera]
Length=514

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 79/106 (75%), Gaps = 10/106 (9%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLA--------ESIGSKEGRY--ARNYRGDPSADIIALKNYM  415
            NDGL RIGLKK KLD+ N LA        E + +   +Y    N+    + DII+LKNYM
Sbjct  27   NDGLFRIGLKKMKLDQNNRLAALLKPEGEEPLRASTRKYHLGGNHEDSGATDIISLKNYM  86

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY S+ACYFHSK
Sbjct  87   DAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSK  132



>ref|XP_010926216.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X2 [Elaeis 
guineensis]
Length=457

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 81/111 (73%), Gaps = 10/111 (9%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR--YARNY-------RGDPSADIIA  400
            +V     DGLIRIGLKK+ +D  + LA  +  KEG+   A  Y        GD + DII+
Sbjct  21   SVVLAEGDGLIRIGLKKKPMDENSRLAARLAEKEGKPLVAGKYGLRGGLDNGDET-DIIS  79

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNYMNAQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY S+ C+FHS+
Sbjct  80   LKNYMNAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSR  130



>dbj|BAA06876.1| aspartic protease [Oryza sativa]
 dbj|BAA06875.1| aspartic protease [Oryza sativa]
Length=509

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 77/104 (74%), Gaps = 7/104 (7%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRGDPS-------ADIIALKNYMNA  421
            + +GL+RI LKKR +D  + +A  +  +EG      RG  S        DI+ALKNYMNA
Sbjct  24   AEEGLVRIALKKRPIDENSRVAARLSGEEGARRLGLRGANSLGGGGGEGDIVALKNYMNA  83

Query  422  QYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            QYFG+IG+G+PPQKFTV+FDTGSSNLWVPSAKCY SIAC+FHS+
Sbjct  84   QYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACFFHSR  127



>ref|XP_010244475.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010244476.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Nelumbo nucifera]
Length=517

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 79/106 (75%), Gaps = 10/106 (9%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLA--------ESIGSKEGRY--ARNYRGDPSADIIALKNYM  415
            NDGL RIGLKK KLD+ N LA        E + +   +Y    N+    + DII+LKNYM
Sbjct  30   NDGLFRIGLKKMKLDQNNRLAALLKPEGEEPLRASTRKYHLGGNHEDSGATDIISLKNYM  89

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +AQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY S+ACYFHSK
Sbjct  90   DAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSK  135



>ref|XP_002872693.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48952.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 80/99 (81%), Gaps = 4/99 (4%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSK-EGRYA-RNY--RGDPSADIIALKNYMNAQYFGD  436
            DG IRIGLKKRKLDR N LA  +  K  G ++ ++Y    D +AD++ LKNY++AQY+GD
Sbjct  30   DGTIRIGLKKRKLDRSNRLASQLFLKNRGSWSPKDYFRLNDANADMVPLKNYLDAQYYGD  89

Query  437  IGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            I IG+PPQKFTV+FDTGSSNLW+PS KCYLS+ACYFHSK
Sbjct  90   ITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSK  128



>ref|XP_010271042.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X3 [Nelumbo 
nucifera]
Length=468

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 75/103 (73%), Gaps = 6/103 (6%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRGDP------SADIIALKNYMNAQ  424
            SN GL+RIGLKK++LD  +  A     K GRYA      P        DI++LKNYM+AQ
Sbjct  25   SNGGLVRIGLKKKQLDPTSINAARHAKKLGRYADGLENLPRNLDSSDVDIVSLKNYMDAQ  84

Query  425  YFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            YFG+IGIGSPPQ FTV+FDTGSSNLWVPS KCY SI+CYFHSK
Sbjct  85   YFGEIGIGSPPQNFTVIFDTGSSNLWVPSVKCYFSISCYFHSK  127



>gb|AAN60347.1| unknown [Arabidopsis thaliana]
Length=110

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-GDP-SADIIALKNYMNAQYFGDI  439
             DG  R+GLKK KLD  N LA  + SK+ +  R YR GD   AD++ LKNY++AQY+G+I
Sbjct  3    KDGTFRVGLKKLKLDSKNRLAARVESKQEKPLRAYRLGDSGDADVVVLKNYLDAQYYGEI  62

Query  440  GIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
             IG+PPQKFTVV DTGSSNLWVPS+KCY S+AC  H K
Sbjct  63   AIGTPPQKFTVVXDTGSSNLWVPSSKCYFSLACLLHPK  100



>ref|XP_010546667.1| PREDICTED: aspartic proteinase A1-like [Tarenaya hassleriana]
 ref|XP_010546675.1| PREDICTED: aspartic proteinase A1-like [Tarenaya hassleriana]
Length=508

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 79/110 (72%), Gaps = 11/110 (10%)
 Frame = +2

Query  257  SVSNDG-LIRIGLKKRKLDRINHLAESIGS----------KEGRYARNYRGDPSADIIAL  403
            SVSNDG   RIGLKK KLD     AE IGS          KE    +N       DI+AL
Sbjct  22   SVSNDGRTFRIGLKKLKLDPNKRFAERIGSRQEDALRASLKEFHLQKNLGDSGDTDIVAL  81

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            KNY++AQY+G+IGIG+PPQKFTV+FDTGSSNLWVPS+KCYLS+AC+FHSK
Sbjct  82   KNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYLSVACFFHSK  131



>emb|CDY08632.1| BnaC04g19410D [Brassica napus]
Length=511

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 79/107 (74%), Gaps = 8/107 (7%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR--------NYRGDPSADIIALKNY  412
            S SNDG +R+GLKK KLD  N LA   GSK+ +  R        N +    ADI+ALKNY
Sbjct  21   SESNDGTLRVGLKKLKLDPNNRLATRFGSKQEKAFRSSLKEFRSNDKNAGDADIVALKNY  80

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++AQY+G+I IG+PPQKFTV+FDTGSSNLWVPS KCY S++C+FHSK
Sbjct  81   LDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFSLSCFFHSK  127



>ref|XP_010926197.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010926203.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010926209.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
Length=512

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 81/111 (73%), Gaps = 10/111 (9%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR--YARNY-------RGDPSADIIA  400
            +V     DGLIRIGLKK+ +D  + LA  +  KEG+   A  Y        GD + DII+
Sbjct  21   SVVLAEGDGLIRIGLKKKPMDENSRLAARLAEKEGKPLVAGKYGLRGGLDNGDET-DIIS  79

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNYMNAQYFG+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY S+ C+FHS+
Sbjct  80   LKNYMNAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSR  130



>ref|NP_001056348.1| Os05g0567100 [Oryza sativa Japonica Group]
 sp|Q42456.2|ASPR1_ORYSJ RecName: Full=Aspartic proteinase oryzasin-1; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAU10663.1| aspartic proteinase oryzasin 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF18262.1| Os05g0567100 [Oryza sativa Japonica Group]
 gb|EAY99059.1| hypothetical protein OsI_21016 [Oryza sativa Indica Group]
 gb|ACA50495.1| aspartic proteinase oryzasin 1 [Oryza sativa Japonica Group]
 dbj|BAG90572.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96074.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96985.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64719.1| hypothetical protein OsJ_19575 [Oryza sativa Japonica Group]
Length=509

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 76/102 (75%), Gaps = 7/102 (7%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRGDPS-------ADIIALKNYMNAQY  427
            +GL+RI LKKR +D  + +A  +  +EG      RG  S        DI+ALKNYMNAQY
Sbjct  26   EGLVRIALKKRPIDENSRVAARLSGEEGARRLGLRGANSLGGGGGEGDIVALKNYMNAQY  85

Query  428  FGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            FG+IG+G+PPQKFTV+FDTGSSNLWVPSAKCY SIAC+FHS+
Sbjct  86   FGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACFFHSR  127



>ref|XP_004287958.1| PREDICTED: aspartic proteinase A1-like [Fragaria vesca subsp. 
vesca]
Length=515

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 92/131 (70%), Gaps = 13/131 (10%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGS--------  343
            MGT++R  L+ L  FLLL+  V S SNDGL+RIGLKK KLD+ + +     +        
Sbjct  1    MGTKIRVCLVTLFQFLLLTHVVLSTSNDGLVRIGLKKVKLDQTSQIHRDTNAQNAQGSVR  60

Query  344  ---KEGRYARNYRGDPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSA  514
               KE R   +Y GD   DI+ LKNYM+AQYFG+IGIG+P QKFTV+FDTGSSNLWVPSA
Sbjct  61   APLKEYRLRGDYSGD--TDIVELKNYMDAQYFGEIGIGTPVQKFTVIFDTGSSNLWVPSA  118

Query  515  KCYLSIACYFH  547
            KCY S+AC+FH
Sbjct  119  KCYFSVACFFH  129



>ref|XP_010271040.1| PREDICTED: aspartic proteinase-like isoform X1 [Nelumbo nucifera]
Length=511

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 75/103 (73%), Gaps = 6/103 (6%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRGDP------SADIIALKNYMNAQ  424
            SN GL+RIGLKK++LD  +  A     K GRYA      P        DI++LKNYM+AQ
Sbjct  25   SNGGLVRIGLKKKQLDPTSINAARHAKKLGRYADGLENLPRNLDSSDVDIVSLKNYMDAQ  84

Query  425  YFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            YFG+IGIGSPPQ FTV+FDTGSSNLWVPS KCY SI+CYFHSK
Sbjct  85   YFGEIGIGSPPQNFTVIFDTGSSNLWVPSVKCYFSISCYFHSK  127



>ref|XP_010271041.1| PREDICTED: aspartic proteinase-like isoform X2 [Nelumbo nucifera]
Length=508

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 75/103 (73%), Gaps = 6/103 (6%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRGDP------SADIIALKNYMNAQ  424
            SN GL+RIGLKK++LD  +  A     K GRYA      P        DI++LKNYM+AQ
Sbjct  25   SNGGLVRIGLKKKQLDPTSINAARHAKKLGRYADGLENLPRNLDSSDVDIVSLKNYMDAQ  84

Query  425  YFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            YFG+IGIGSPPQ FTV+FDTGSSNLWVPS KCY SI+CYFHSK
Sbjct  85   YFGEIGIGSPPQNFTVIFDTGSSNLWVPSVKCYFSISCYFHSK  127



>ref|XP_006654801.1| PREDICTED: aspartic proteinase oryzasin-1-like [Oryza brachyantha]
Length=509

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 76/102 (75%), Gaps = 7/102 (7%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRGDPS-------ADIIALKNYMNAQY  427
            +GL+RI LKKR +D  + +A  +  +EG      RG  S        DI+ALKNYMNAQY
Sbjct  26   EGLVRIALKKRPIDENSRVAAQLSGEEGARRLGLRGANSLGGGGSEGDIVALKNYMNAQY  85

Query  428  FGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            FG+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY SIAC+FHS+
Sbjct  86   FGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACFFHSR  127



>dbj|BAB20969.1| aspartic proteinase 1 [Nepenthes alata]
Length=514

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 10/104 (10%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLA--------ESIGSKEGRYAR-NYRGDPS-ADIIALKNYM  415
            ND L+R+GLKKRKLD+IN  +        ESI     +Y   N  G+   ADII+LKNYM
Sbjct  27   NDRLLRVGLKKRKLDQINRFSSLYGCKGKESINPAIRKYGLGNGLGNSDDADIISLKNYM  86

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            NAQYFG+IGIG+PPQKFT++FDTGSSNLWVPSAKCY SIACYFH
Sbjct  87   NAQYFGEIGIGTPPQKFTLIFDTGSSNLWVPSAKCYFSIACYFH  130



>ref|XP_002302872.2| aspartic endopeptidase family protein [Populus trichocarpa]
 gb|EEE82145.2| aspartic endopeptidase family protein [Populus trichocarpa]
Length=514

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 81/116 (70%), Gaps = 13/116 (11%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDR---------INHLAESIGSKEGRYARNYR----GDPS  385
            P V S  +DGL+RIGLKK+KLD          +N + E  G    + A   +    G+  
Sbjct  17   PVVLSARDDGLMRIGLKKKKLDHLGRRVVPGSVNFIPEEEGGGASKPAATKKYYNIGETE  76

Query  386  ADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ADI+ALKNY++AQY+G+I IG+PPQ FTV+FDTGSSNLWVPS+KCY S+ACYFHSK
Sbjct  77   ADIVALKNYLDAQYYGEITIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACYFHSK  132



>sp|P42210.1|ASPR_HORVU RecName: Full=Phytepsin; AltName: Full=Aspartic proteinase; Contains: 
RecName: Full=Phytepsin 32 kDa subunit; Contains: RecName: 
Full=Phytepsin 29 kDa subunit; Contains: RecName: Full=Phytepsin 
16 kDa subunit; Contains: RecName: Full=Phytepsin 
11 kDa subunit; Flags: Precursor [Hordeum vulgare]
 emb|CAA39602.1| aspartic proteinase [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 75/99 (76%), Gaps = 4/99 (4%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSKEGRY----ARNYRGDPSADIIALKNYMNAQYFGD  436
            +GL+RI LKKR +DR + +A  +   E +     A   R +   DI+ALKNYMNAQYFG+
Sbjct  28   EGLVRIALKKRPIDRNSRVATGLSGGEEQPLLSGANPLRSEEEGDIVALKNYMNAQYFGE  87

Query  437  IGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            IG+G+PPQKFTV+FDTGSSNLWVPSAKCY SIACY HS+
Sbjct  88   IGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHSR  126



>ref|NP_172655.1| aspartic proteinase A1 [Arabidopsis thaliana]
 sp|O65390.1|APA1_ARATH RecName: Full=Aspartic proteinase A1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC17620.1| Identical to aspartic proteinase cDNA gb|U51036 from A. thaliana. 
ESTs gb|N96313, gb|T21893, gb|R30158, gb|T21482, gb|T43650, 
gb|R64749, gb|R65157, gb|T88269, gb|T44552, gb|T22542, 
gb|T76533, gb|T44350, gb|Z34591, gb|AA728734, gb|T46003, gb|R65157, 
gb|N38290, gb|AA395468, gb|T20815 and gb|Z34173 come 
from this gene [Arabidopsis thaliana]
 gb|AAL08243.1| At1g11910/F12F1_24 [Arabidopsis thaliana]
 gb|AAL08259.1| At1g11910/F12F1_24 [Arabidopsis thaliana]
 gb|AAL36330.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AAM66979.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AAN71979.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AEE28813.1| aspartic proteinase A1 [Arabidopsis thaliana]
Length=506

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 78/104 (75%), Gaps = 2/104 (2%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-GDP-SADIIALKNYMNA  421
            + F+  NDG  R+GLKK KLD  N LA  + SK+ +  R YR GD   AD++ LKNY++A
Sbjct  21   SAFAERNDGTFRVGLKKLKLDSKNRLAARVESKQEKPLRAYRLGDSGDADVVVLKNYLDA  80

Query  422  QYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            QY+G+I IG+PPQKFTVVFDTGSSNLWVPS+KCY S+AC  H K
Sbjct  81   QYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSLACLLHPK  124



>emb|CAC86004.1| aspartic proteinase [Theobroma cacao]
Length=514

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 75/106 (71%), Gaps = 10/106 (9%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEG----------RYARNYRGDPSADIIALKNYM  415
            NDGL+RIGLKK KLD  N LA  + SK+G          R+  N       DI+ALKNYM
Sbjct  27   NDGLVRIGLKKMKLDPNNRLAARLDSKDGEALRAFIKKYRFRNNLGDSEETDIVALKNYM  86

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +AQY+G+IGIG+P QKFTV+FDTGSSNLWV S KCY S+ACYFH K
Sbjct  87   DAQYYGEIGIGTPTQKFTVIFDTGSSNLWVSSTKCYFSVACYFHEK  132



>dbj|BAE20413.1| aspartic proteinase [Triticum aestivum]
Length=508

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 77/100 (77%), Gaps = 5/100 (5%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSKE-----GRYARNYRGDPSADIIALKNYMNAQYFG  433
            +GL+RI LKKR +DR + +A+S+  +E     G  +     +   DI++LKNYMNAQYFG
Sbjct  26   EGLVRIALKKRAIDRNSRVAKSLSDREEVHLLGGASNTLPSEEEGDIVSLKNYMNAQYFG  85

Query  434  DIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +IG+G+PPQKFTV+FDTGSSNLWVPSAKCY SIACY H++
Sbjct  86   EIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHAR  125



>ref|XP_009118162.1| PREDICTED: aspartic proteinase A1 [Brassica rapa]
Length=506

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNY-RGDP-SADIIALKNYMNAQYFGDI  439
            NDG  R+GLKK KLD  + +A  +GSK+ +  R Y  GD   ADI+ LKNY++AQY+G+I
Sbjct  27   NDGTFRVGLKKLKLDPKSRIAARVGSKQLKPLRGYGLGDSGDADIVTLKNYLDAQYYGEI  86

Query  440  GIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
             IG+PPQKFTVVFDTGSSNLWVPS+KCY SIAC FHSK
Sbjct  87   AIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLFHSK  124



>ref|XP_011006459.1| PREDICTED: cyprosin-like isoform X2 [Populus euphratica]
Length=514

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 82/116 (71%), Gaps = 13/116 (11%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDR---------INHLAESIGSKEGRYARNYR----GDPS  385
            P V S  +DGL+RIGLKK+KLD+         +N + +  G    + A   +    G+  
Sbjct  17   PVVLSARDDGLMRIGLKKKKLDQLGRRVVPGPVNFIPKEEGGGASKPAATKKYYNLGETE  76

Query  386  ADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ADI+ALKNY++AQY+G+I IG+PPQ FTV+FDTGSSNLWVPS+KCY S+ACYFHSK
Sbjct  77   ADIVALKNYLDAQYYGEIAIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACYFHSK  132



>ref|XP_010060310.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010060311.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW66975.1| hypothetical protein EUGRSUZ_F00741 [Eucalyptus grandis]
 gb|KCW66976.1| hypothetical protein EUGRSUZ_F00741 [Eucalyptus grandis]
Length=515

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 80/114 (70%), Gaps = 11/114 (10%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR-----------NYRGDPSAD  391
            P V S S+DGL+RIGLK+R+LD+ +  A  +   EG+              N R    +D
Sbjct  20   PLVLSASDDGLMRIGLKRRRLDKNSWNAARLDLNEGKLLMRPSAGMHNLNGNLRDSGDSD  79

Query  392  IIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++ALKNYM+AQYFG+IG+GSPPQ FTV+FDTGSSNLWVPSAKC+ S+ACY H +
Sbjct  80   VVALKNYMDAQYFGEIGVGSPPQNFTVIFDTGSSNLWVPSAKCHFSLACYMHPR  133



>gb|AGP76185.1| aspartic proteinase [Brassica rapa subsp. chinensis]
Length=506

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNY-RGDP-SADIIALKNYMNAQYFGDI  439
            NDG  R+GLKK KLD  + +A  +GSK+ +  R Y  GD   ADI+ LKNY++AQY+G+I
Sbjct  27   NDGTFRVGLKKLKLDPKSRIAARVGSKQLKPLRGYGLGDSGDADIVTLKNYLDAQYYGEI  86

Query  440  GIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
             IG+PPQKFTVVFDTGSSNLWVPS+KCY SIAC FHSK
Sbjct  87   AIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLFHSK  124



>ref|XP_010432806.1| PREDICTED: aspartic proteinase A3-like isoform X2 [Camelina sativa]
Length=504

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSKE--GRY--ARNYR-GDPSADIIALKNYMNAQYFG  433
            DG IRIGLKKRKLDR N LA  +  K   G +    ++R  D +AD++ LKNY++AQY+G
Sbjct  30   DGTIRIGLKKRKLDRSNRLASQLFLKNRGGSWFPKDHFRLNDANADMVPLKNYLDAQYYG  89

Query  434  DIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            DI IG+PPQKFTV+FDTGSSNLW+PS KCYLS+ACYFHSK
Sbjct  90   DITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSK  129



>gb|AAC49730.1| aspartic proteinase [Arabidopsis thaliana]
Length=486

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 77/102 (75%), Gaps = 2/102 (2%)
 Frame = +2

Query  254  FSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-GDP-SADIIALKNYMNAQY  427
            F+  NDG  R+GLKK KLD  N LA  + SK+ +  R YR GD   AD++ LKNY++AQY
Sbjct  3    FAERNDGTFRVGLKKLKLDSKNRLAARVESKQEKPLRAYRLGDSGDADVVVLKNYLDAQY  62

Query  428  FGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +G+I IG+PPQKFTVVFDTGSSNLWVPS+KCY S+AC  H K
Sbjct  63   YGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSLACLLHPK  104



>ref|NP_001190671.1| aspartic proteinase A3 [Arabidopsis thaliana]
 gb|AEE82391.1| aspartic proteinase A3 [Arabidopsis thaliana]
Length=504

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 75/100 (75%), Gaps = 5/100 (5%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESI-----GSKEGRYARNYRGDPSADIIALKNYMNAQYFG  433
            DG IRIGLKKRKLDR N LA  +     GS           D +AD++ LKNY++AQY+G
Sbjct  30   DGTIRIGLKKRKLDRSNRLASQLFLKNRGSHWSPKHYFRLNDENADMVPLKNYLDAQYYG  89

Query  434  DIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            DI IG+PPQKFTV+FDTGSSNLW+PS KCYLS+ACYFHSK
Sbjct  90   DITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSK  129



>ref|NP_192355.1| aspartic proteinase A3 [Arabidopsis thaliana]
 sp|Q9XEC4.1|APA3_ARATH RecName: Full=Aspartic proteinase A3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD29758.1|AF076243_5 putative aspartic protease [Arabidopsis thaliana]
 gb|AAK50111.1|AF372974_1 AT4g04460/T26N6_7 [Arabidopsis thaliana]
 emb|CAB77914.1| putative aspartic protease [Arabidopsis thaliana]
 gb|AEE82390.1| aspartic proteinase A3 [Arabidopsis thaliana]
Length=508

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 75/100 (75%), Gaps = 5/100 (5%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESI-----GSKEGRYARNYRGDPSADIIALKNYMNAQYFG  433
            DG IRIGLKKRKLDR N LA  +     GS           D +AD++ LKNY++AQY+G
Sbjct  30   DGTIRIGLKKRKLDRSNRLASQLFLKNRGSHWSPKHYFRLNDENADMVPLKNYLDAQYYG  89

Query  434  DIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            DI IG+PPQKFTV+FDTGSSNLW+PS KCYLS+ACYFHSK
Sbjct  90   DITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSK  129



>emb|CAM12780.1| aspartic proteinase [Fagopyrum esculentum]
Length=506

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 76/106 (72%), Gaps = 4/106 (4%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----NYRGDPSADIIALKN  409
            SP   SV+N+ L+R+GLKKRKLD  N  A   G K+    +    N  GD    II+LKN
Sbjct  17   SPIALSVANNDLVRVGLKKRKLDPTNRPASRFGCKKHLMQKYGLGNGFGDDDTGIISLKN  76

Query  410  YMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            YM+AQYFG+I IG+P Q FTV+FDTGSSNLWVPS KCYLSIAC+FH
Sbjct  77   YMDAQYFGEIAIGTPSQTFTVIFDTGSSNLWVPSGKCYLSIACFFH  122



>ref|XP_010553449.1| PREDICTED: aspartic proteinase A1 [Tarenaya hassleriana]
Length=518

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 79/109 (72%), Gaps = 10/109 (9%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSK----------EGRYARNYRGDPSADIIALK  406
            S  +DG  RIGLKK KLD  N LA  +GSK          E R+  N       D++ALK
Sbjct  24   SERSDGTFRIGLKKLKLDPNNRLASRLGSKQEEALRASLKEFRFHNNLGDSGDTDVVALK  83

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NY++AQY+G+IGIG+PPQKFTV+FDTGSSNLW+PS+KCYLS+AC+FH+K
Sbjct  84   NYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWIPSSKCYLSVACFFHNK  132



>ref|XP_010432791.1| PREDICTED: aspartic proteinase A3-like isoform X1 [Camelina sativa]
 ref|XP_010432799.1| PREDICTED: aspartic proteinase A3-like isoform X1 [Camelina sativa]
Length=508

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSKE--GRY--ARNYR-GDPSADIIALKNYMNAQYFG  433
            DG IRIGLKKRKLDR N LA  +  K   G +    ++R  D +AD++ LKNY++AQY+G
Sbjct  30   DGTIRIGLKKRKLDRSNRLASQLFLKNRGGSWFPKDHFRLNDANADMVPLKNYLDAQYYG  89

Query  434  DIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            DI IG+PPQKFTV+FDTGSSNLW+PS KCYLS+ACYFHSK
Sbjct  90   DITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSK  129



>emb|CDY34819.1| BnaA09g47450D [Brassica napus]
Length=615

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNY-RGDP-SADIIALKNYMNAQYFGDI  439
            NDG  R+GLKK KLD  + +A  +GSK+ +  R Y  GD   ADI+ LKNY++AQY+G+I
Sbjct  136  NDGTFRVGLKKLKLDPKSRIAARVGSKQLKPLRGYGLGDSGDADIVTLKNYLDAQYYGEI  195

Query  440  GIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
             IG+PPQKFTVVFDTGSSNLWVPS+KCY SIAC FHSK
Sbjct  196  AIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLFHSK  233



>ref|XP_011006458.1| PREDICTED: cyprosin-like isoform X1 [Populus euphratica]
Length=536

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 82/116 (71%), Gaps = 13/116 (11%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDR---------INHLAESIGSKEGRYARNYR----GDPS  385
            P V S  +DGL+RIGLKK+KLD+         +N + +  G    + A   +    G+  
Sbjct  17   PVVLSARDDGLMRIGLKKKKLDQLGRRVVPGPVNFIPKEEGGGASKPAATKKYYNLGETE  76

Query  386  ADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ADI+ALKNY++AQY+G+I IG+PPQ FTV+FDTGSSNLWVPS+KCY S+ACYFHSK
Sbjct  77   ADIVALKNYLDAQYYGEIAIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACYFHSK  132



>ref|XP_008440898.1| PREDICTED: aspartic proteinase [Cucumis melo]
Length=514

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 79/111 (71%), Gaps = 10/111 (9%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIA  400
            V SVSNDGL+R+GLKK KLD  N LA  + SK+    +          N       DI+A
Sbjct  22   VSSVSNDGLLRVGLKKIKLDPENRLAARLESKDAEILKAAFRKYNPNGNLEESSDTDIVA  81

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNY++AQY+G+I IG+PPQKFTV+FDTGSSNLWVPSAKC  S+AC+FH++
Sbjct  82   LKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSAKCLFSVACHFHAR  132



>ref|XP_004151126.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
Length=513

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 11/113 (10%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN--YRGDPSA--------DI  394
            P VF  SNDG +RIGLK+RK  + N +A  I +KEG   +N   +  PSA        DI
Sbjct  20   PMVFCASNDGKVRIGLKRRKFGQNNRVASKIATKEGISLKNSVEKYQPSANLGDSDDFDI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            + LKNY+NAQYFG+IGIG+PPQKF V+FDTGSSNLWVPS+KC+ S+AC  HSK
Sbjct  80   VGLKNYLNAQYFGEIGIGTPPQKFAVIFDTGSSNLWVPSSKCF-SVACLLHSK  131



>ref|XP_004161880.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
Length=516

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 11/113 (10%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN--YRGDPSA--------DI  394
            P VF  SNDG +RIGLK+RK  + N +A  I +KEG   +N   +  PSA        DI
Sbjct  20   PMVFCASNDGKVRIGLKRRKFGQNNRVASKIATKEGISLKNSVEKYQPSANLGDSDDFDI  79

Query  395  IALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            + LKNY+NAQYFG+IGIG+PPQKF V+FDTGSSNLWVPS+KC+ S+AC  HSK
Sbjct  80   VGLKNYLNAQYFGEIGIGTPPQKFAVIFDTGSSNLWVPSSKCF-SVACLLHSK  131



>ref|XP_010496363.1| PREDICTED: aspartic proteinase A3-like [Camelina sativa]
Length=512

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSKE--GRY--ARNYR-GDPSADIIALKNYMNAQYFG  433
            DG IRIGLKKRKLDR N LA  +  K   G +    ++R  D +AD++ LKNY++AQY+G
Sbjct  34   DGTIRIGLKKRKLDRGNRLASQLFLKNRGGSWFPKDHFRLNDANADMVPLKNYLDAQYYG  93

Query  434  DIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            DI IG+PPQKFTV+FDTGSSNLW+PS KCYLS+ACYFHSK
Sbjct  94   DITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSK  133



>ref|XP_006391910.1| hypothetical protein EUTSA_v10023414mg [Eutrema salsugineum]
 gb|ESQ29196.1| hypothetical protein EUTSA_v10023414mg [Eutrema salsugineum]
Length=511

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 76/102 (75%), Gaps = 6/102 (6%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSK-----EGRYARNYRGDP-SADIIALKNYMNAQY  427
            NDG  RIGLKK KLD  N LA   GSK     E R   N  GD   ADI+ALKNY++AQY
Sbjct  28   NDGTFRIGLKKLKLDPNNRLAARFGSKQEELKEIRSNNNLLGDSGDADIVALKNYLDAQY  87

Query  428  FGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +G+I IG+PPQKFTV+FDTGSSNLWVPS KCY S++C+FH+K
Sbjct  88   YGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFSLSCFFHAK  129



>gb|AAB60773.1| Strong similarity to Brassica aspartic protease (gb|X77260) [Arabidopsis 
thaliana]
Length=433

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 78/111 (70%), Gaps = 9/111 (8%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR--------YARNYRGDP-SADIIA  400
            T +S  NDG  R+GLKK KLD  N LA   GSK+          Y  N  GD   ADI+ 
Sbjct  21   TAYSKRNDGTFRVGLKKLKLDPNNRLATRFGSKQEEALRSSLRSYNNNLGGDSGDADIVP  80

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNY++AQY+G+I IG+PPQKFTV+FDTGSSNLWVPS KC+ S++CYFH+K
Sbjct  81   LKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFFSLSCYFHAK  131



>gb|AAV84085.2| aspartic proteinase 9 [Fagopyrum esculentum]
Length=506

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 76/106 (72%), Gaps = 4/106 (4%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----NYRGDPSADIIALKN  409
            SP   SV+N+ L+R+GLKKRKLD  N  A   G K+    +    N  GD    II+LKN
Sbjct  17   SPISLSVANNDLVRVGLKKRKLDPTNRPASRFGCKKHLMQKYGLGNGFGDDDTGIISLKN  76

Query  410  YMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            YM+AQYFG+I IG+P Q FTV+FDTGSSNLWVPS KCYLSIAC+FH
Sbjct  77   YMDAQYFGEIAIGTPSQTFTVIFDTGSSNLWVPSGKCYLSIACFFH  122



>ref|XP_008800700.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X2 [Phoenix 
dactylifera]
Length=512

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 81/111 (73%), Gaps = 10/111 (9%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR--YARNY-------RGDPSADIIA  400
            TV S   DGLIR+GLKK+ +D+ +  A  +  KEG+   A  Y        GD + DI++
Sbjct  21   TVVSAEGDGLIRVGLKKKPMDQNSRPAARLVEKEGKPLVAGKYGLRGGLGNGDET-DIVS  79

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNYMNAQYFG+I IG+PPQKFTV+FDTGSSNLWVPS+KCY SIAC FHS+
Sbjct  80   LKNYMNAQYFGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACLFHSR  130



>ref|XP_008800699.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Phoenix 
dactylifera]
Length=547

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 81/111 (73%), Gaps = 10/111 (9%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR--YARNY-------RGDPSADIIA  400
            TV S   DGLIR+GLKK+ +D+ +  A  +  KEG+   A  Y        GD + DI++
Sbjct  56   TVVSAEGDGLIRVGLKKKPMDQNSRPAARLVEKEGKPLVAGKYGLRGGLGNGDET-DIVS  114

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNYMNAQYFG+I IG+PPQKFTV+FDTGSSNLWVPS+KCY SIAC FHS+
Sbjct  115  LKNYMNAQYFGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACLFHSR  165



>ref|XP_002518445.1| Aspartic proteinase precursor, putative [Ricinus communis]
 gb|EEF43832.1| Aspartic proteinase precursor, putative [Ricinus communis]
Length=511

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 77/103 (75%), Gaps = 7/103 (7%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR------NYRGDP-SADIIALKNYMNAQ  424
            NDGL+R+GLKK KLD  + LA  + SK     R        RGD    DI+ALKNY++AQ
Sbjct  27   NDGLVRLGLKKMKLDENSRLAARLESKNAEALRASVRKYGLRGDSKDTDIVALKNYLDAQ  86

Query  425  YFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            Y+G+IGIG+PPQKFTVVFDTGSSNLWVPS+KC  S+AC+FHS+
Sbjct  87   YYGEIGIGTPPQKFTVVFDTGSSNLWVPSSKCIFSVACFFHSR  129



>dbj|BAB20970.1| aspartic proteinase 2 [Nepenthes alata]
Length=514

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 74/105 (70%), Gaps = 10/105 (10%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSK----------EGRYARNYRGDPSADIIALKNYMN  418
            D L+R+GLKKRKLD+IN L+   G K          +            ADII+LKNYM+
Sbjct  28   DRLLRVGLKKRKLDQINRLSSHYGCKGKGSTSPSIWKHGLGNGLGNSDDADIISLKNYMD  87

Query  419  AQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            AQYFG+IGIGSPPQKFTV+FDTGSSNLWVPSAKCY SIACY H K
Sbjct  88   AQYFGEIGIGSPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHPK  132



>ref|XP_007207363.1| hypothetical protein PRUPE_ppa004505mg [Prunus persica]
 gb|EMJ08562.1| hypothetical protein PRUPE_ppa004505mg [Prunus persica]
Length=506

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 73/101 (72%), Gaps = 7/101 (7%)
 Frame = +2

Query  272  GLIRIGLKKRKLD-------RINHLAESIGSKEGRYARNYRGDPSADIIALKNYMNAQYF  430
            GL+RIGLKKR LD       R   LA   GS +G    +Y G    DI+ L NYM+AQY+
Sbjct  24   GLVRIGLKKRPLDLQTIKAARAERLANYRGSLKGMNQNHYLGSSDEDIVPLNNYMDAQYY  83

Query  431  GDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            G+IGIGSPPQ FTV+FDTGSSNLWVPS+KCY SIACYFH+K
Sbjct  84   GEIGIGSPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHTK  124



>ref|XP_004961190.1| PREDICTED: aspartic proteinase oryzasin-1-like [Setaria italica]
Length=507

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 77/99 (78%), Gaps = 4/99 (4%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSKEG----RYARNYRGDPSADIIALKNYMNAQYFGD  436
            +GL+RI LKKR +D+ + +AE + ++E     R A +       DIIALKNYMNAQYFG+
Sbjct  26   EGLVRIALKKRAIDQNSRVAERLSAEEKQRLLRGANSLGSGGEGDIIALKNYMNAQYFGE  85

Query  437  IGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            IG+G+P QKFTV+FDTGSSNLWVPS+KCY SIACYFHS+
Sbjct  86   IGVGTPAQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSR  124



>ref|NP_176419.2| aspartic proteinase A2 [Arabidopsis thaliana]
 ref|NP_001031219.1| aspartic proteinase A2 [Arabidopsis thaliana]
 sp|Q8VYL3.1|APA2_ARATH RecName: Full=Aspartic proteinase A2; AltName: Full=Aspartic 
protease 57; Short=AtASP57; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL49856.1| putative aspartic protease [Arabidopsis thaliana]
 gb|AAN13225.1| putative aspartic protease [Arabidopsis thaliana]
 dbj|BAH19961.1| AT1G62290 [Arabidopsis thaliana]
 gb|AEE33946.1| aspartic proteinase A2 [Arabidopsis thaliana]
 gb|AEE33947.1| aspartic proteinase A2 [Arabidopsis thaliana]
Length=513

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 78/111 (70%), Gaps = 9/111 (8%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR--------YARNYRGDP-SADIIA  400
            T +S  NDG  R+GLKK KLD  N LA   GSK+          Y  N  GD   ADI+ 
Sbjct  21   TAYSKRNDGTFRVGLKKLKLDPNNRLATRFGSKQEEALRSSLRSYNNNLGGDSGDADIVP  80

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNY++AQY+G+I IG+PPQKFTV+FDTGSSNLWVPS KC+ S++CYFH+K
Sbjct  81   LKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFFSLSCYFHAK  131



>ref|XP_004173866.1| PREDICTED: aspartic proteinase-like, partial [Cucumis sativus]
Length=290

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 78/111 (70%), Gaps = 10/111 (9%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIA  400
            V SVSNDGL+R+GLKK  LD  N LA  + SK+    +          N       DI+A
Sbjct  22   VSSVSNDGLLRVGLKKINLDPENRLAARLESKDAEILKAAFRKYSPNGNLGESSDTDIVA  81

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNY++AQY+G+I IG+PPQKFTV+FDTGSSNLWVPSAKC  S+AC+FH++
Sbjct  82   LKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSAKCLFSVACHFHAR  132



>gb|AAB03108.1| aspartic protease [Brassica napus]
 emb|CDY34613.1| BnaC08g41720D [Brassica napus]
Length=506

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNY-RGDP-SADIIALKNYMNAQYFGDI  439
            NDG  R+GLKK K D  + +A  +GSK+ +  R Y  GD   ADI+ LKNY++AQY+G+I
Sbjct  27   NDGTFRVGLKKLKFDPRSRIAAPVGSKQLKPLRGYGLGDSGDADIVTLKNYLDAQYYGEI  86

Query  440  GIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
             IG+PPQKFTVVFDTGSSNLWVPS+KCY SIAC FHSK
Sbjct  87   AIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLFHSK  124



>ref|XP_010924299.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase oryzasin-1-like 
[Elaeis guineensis]
Length=546

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 84/112 (75%), Gaps = 10/112 (9%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR--YARNY--RGDPS----ADII  397
            S  VF+   DGLIRIGLKK+ +D+ + LA  +  +EG+   A  Y  RG P      DII
Sbjct  55   SSVVFA-EGDGLIRIGLKKKPMDQNSRLAARL-VEEGKPLMAGKYGLRGGPENGDETDII  112

Query  398  ALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +LKNYMNAQYFG+I IG+PPQKFTV+FDTGSSNLWVPS+KCY SIAC+FHS+
Sbjct  113  SLKNYMNAQYFGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACFFHSR  164



>ref|XP_002892661.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68920.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 2/104 (2%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR--GDPSADIIALKNYMNA  421
            + FS  NDG  R+GLKK KLD  N LA  + SK+ +  R Y       AD++ LKNY++A
Sbjct  21   SAFSERNDGTFRVGLKKLKLDSKNRLAARVESKQDKPLRAYSLGNSEDADVVVLKNYLDA  80

Query  422  QYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            QY+G+I IG+PPQKFTVVFDTGSSNLWVPS+KCY S+AC  H K
Sbjct  81   QYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSLACLLHPK  124



>ref|XP_006417290.1| hypothetical protein EUTSA_v10007418mg [Eutrema salsugineum]
 dbj|BAJ34217.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35643.1| hypothetical protein EUTSA_v10007418mg [Eutrema salsugineum]
Length=506

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-GDP-SADIIALKNYMNAQYF  430
            S  NDG +R+GLKK KLD  N LA  I S++ +  R +  GD   ADI+ALKNY++AQY+
Sbjct  24   SERNDGTVRVGLKKLKLDPKNRLAARISSEQEKPLRAFSLGDSGDADIVALKNYLDAQYY  83

Query  431  GDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            G+I IG+PPQKFTVVFDTGSSNLWVPS+KCY SIAC  H K
Sbjct  84   GEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPK  124



>gb|ADE74632.1| aspartic protease 1 [Nicotiana tabacum]
Length=506

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRG------DPSADIIALKNY  412
            V  VS+D L+R+GLKK+ LD  +  A  +   + RY +N  G      D   DI++LKNY
Sbjct  19   VLPVSSDNLLRVGLKKQSLDVNSINAARVARLQDRYGKNVNGIEKKLGDSDLDIVSLKNY  78

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++AQY+G+IG+GSPPQKF V+FDTGSSNLWVPS++CY SIAC+FHSK
Sbjct  79   LDAQYYGEIGVGSPPQKFKVIFDTGSSNLWVPSSRCYFSIACWFHSK  125



>ref|NP_001148782.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
 gb|ACG32889.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
Length=510

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 78/104 (75%), Gaps = 7/104 (7%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKE-------GRYARNYRGDPSADIIALKNYMNA  421
            S++GL+R+ LKK  +D+   +A  + ++E       G  A    GD  +D+IALKNYMNA
Sbjct  24   SSEGLVRVALKKLPVDQNGRVAARLSAEERQRLLLRGSNALGSGGDDDSDVIALKNYMNA  83

Query  422  QYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            QYFG+IG+GSP QKFTV+FDTGSSNLWVPS+KCY SIACYFHS+
Sbjct  84   QYFGEIGVGSPQQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSR  127



>ref|XP_008647844.1| PREDICTED: aspartic proteinase oryzasin-1 isoform X1 [Zea mays]
 gb|ACN27572.1| unknown [Zea mays]
 gb|ACR38429.1| unknown [Zea mays]
 gb|AFW79205.1| aspartic proteinase oryzasin-1 isoform 1 [Zea mays]
 gb|AFW79206.1| aspartic proteinase oryzasin-1 isoform 2 [Zea mays]
Length=510

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 78/104 (75%), Gaps = 7/104 (7%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKE-------GRYARNYRGDPSADIIALKNYMNA  421
            S++GL+R+ LKK  +D+   +A  + ++E       G  A    GD  +D+IALKNYMNA
Sbjct  24   SSEGLVRVALKKLPVDQNGRVAARLSAEERQRLLLRGANALGSGGDDDSDVIALKNYMNA  83

Query  422  QYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            QYFG+IG+GSP QKFTV+FDTGSSNLWVPS+KCY SIACYFHS+
Sbjct  84   QYFGEIGVGSPQQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSR  127



>ref|XP_009608676.1| PREDICTED: cyprosin-like [Nicotiana tomentosiformis]
Length=506

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRG------DPSADIIALKNY  412
            V  VS+D L+R+GLKK+ LD  +  A  +   + RY +N  G      D   D+++LKNY
Sbjct  19   VLPVSSDNLLRVGLKKQPLDVNSINAARVARLQDRYGKNVNGIEKKLGDSDLDVVSLKNY  78

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++AQY+G+IG+GSPPQKF V+FDTGSSNLWVPS++CY SIAC+FHSK
Sbjct  79   LDAQYYGEIGVGSPPQKFKVIFDTGSSNLWVPSSRCYFSIACWFHSK  125



>ref|XP_008371074.1| PREDICTED: aspartic proteinase [Malus domestica]
Length=508

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 82/109 (75%), Gaps = 10/109 (9%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-----GDPSA---DIIALK  406
            V S  NDGL RIGLKK KLD  + +A  + SK G   R YR     G+P +   DI++LK
Sbjct  19   VSSAPNDGLSRIGLKKVKLDSNDWVAAQLESKNG--LRKYRLPSNLGEPESGDVDIVSLK  76

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NYM+AQY+G+I IG+PPQ FTV+FDTGSSNLWVPS+KCY+S+AC+FH+K
Sbjct  77   NYMDAQYYGEIAIGTPPQPFTVIFDTGSSNLWVPSSKCYVSLACFFHAK  125



>ref|XP_006286432.1| hypothetical protein CARUB_v10003637mg [Capsella rubella]
 gb|EOA19330.1| hypothetical protein CARUB_v10003637mg [Capsella rubella]
Length=503

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSKE--GRYA--RNYR-GDPSADIIALKNYMNAQYFG  433
            DG IRIGLKKRKLDR N LA  +  K   G ++   ++R    +AD++ LKNY++AQY+G
Sbjct  30   DGTIRIGLKKRKLDRSNRLASQLFLKNRGGSWSPKDHFRLNGANADMVPLKNYLDAQYYG  89

Query  434  DIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            DI IG+PPQKFTV+FDTGSSNLW+PS KCYLS+ACYFH+K
Sbjct  90   DITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHTK  129



>ref|XP_010099183.1| Aspartic proteinase [Morus notabilis]
 gb|EXB77055.1| Aspartic proteinase [Morus notabilis]
Length=513

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 82/111 (74%), Gaps = 10/111 (9%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN----YR-----GD-PSADIIA  400
            V S + D L+RIGLKK K D  + +A  +  K+G   R+    YR     GD P  DI+A
Sbjct  22   VSSATGDSLLRIGLKKVKRDPNDRIAAQLDFKKGESLRDSIRKYRPRGRLGDAPETDIVA  81

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNY++AQY+G+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY S++CYFH+K
Sbjct  82   LKNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVSCYFHAK  132



>ref|XP_010418214.1| PREDICTED: aspartic proteinase A2 isoform X2 [Camelina sativa]
Length=479

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 78/106 (74%), Gaps = 9/106 (8%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGR--------YARNYRGDP-SADIIALKNYM  415
            ++DG IR+GLKK KLD  N LA   GS +          Y  N  GD   ADI+ALKNY+
Sbjct  27   NDDGTIRVGLKKLKLDPNNRLATRFGSSQEEALRSSFRSYNNNLGGDSGDADIVALKNYL  86

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +AQY+G+I IG+PPQKFTV+FDTGS+NLWVPS KC+LSI+C+FH+K
Sbjct  87   DAQYYGEIAIGTPPQKFTVIFDTGSANLWVPSGKCFLSISCFFHAK  132



>ref|XP_004145121.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
 ref|XP_004153558.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
Length=514

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 78/111 (70%), Gaps = 10/111 (9%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIA  400
            V SVSNDGL+R+GLKK  LD  N LA  + SK+    +          N       DI+A
Sbjct  22   VSSVSNDGLLRVGLKKINLDPENRLAARLESKDAEILKAAFRKYNPNGNLGESSDTDIVA  81

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNY++AQY+G+I IG+PPQKFTV+FDTGSSNLWVPSAKC  S+AC+FH++
Sbjct  82   LKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSAKCLFSVACHFHAR  132



>ref|XP_010418210.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418211.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418212.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418213.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
Length=514

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 78/106 (74%), Gaps = 9/106 (8%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGR--------YARNYRGDP-SADIIALKNYM  415
            ++DG IR+GLKK KLD  N LA   GS +          Y  N  GD   ADI+ALKNY+
Sbjct  27   NDDGTIRVGLKKLKLDPNNRLATRFGSSQEEALRSSFRSYNNNLGGDSGDADIVALKNYL  86

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +AQY+G+I IG+PPQKFTV+FDTGS+NLWVPS KC+LSI+C+FH+K
Sbjct  87   DAQYYGEIAIGTPPQKFTVIFDTGSANLWVPSGKCFLSISCFFHAK  132



>gb|KGN64503.1| Aspartic proteinase [Cucumis sativus]
Length=489

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 78/111 (70%), Gaps = 10/111 (9%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIA  400
            V SVSNDGL+R+GLKK  LD  N LA  + SK+    +          N       DI+A
Sbjct  35   VSSVSNDGLLRVGLKKINLDPENRLAARLESKDAEILKAAFRKYNPNGNLGESSDTDIVA  94

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNY++AQY+G+I IG+PPQKFTV+FDTGSSNLWVPSAKC  S+AC+FH++
Sbjct  95   LKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSAKCLFSVACHFHAR  145



>ref|XP_009415269.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=514

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 74/105 (70%), Gaps = 8/105 (8%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLDRINHLAESIGSKEGR--YARNY------RGDPSADIIALKNY  412
            S   DG IRIGLKK+ LD  + LA  I  KE +    R Y        +  AD I+LKNY
Sbjct  26   SAEEDGFIRIGLKKKPLDESSRLASRIMDKERKSLMGRKYGLGDGLEDEGDADYISLKNY  85

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            MNAQYFG+IG+G+P QKFTV+FDTGSSNLWVPSAKCY S+ACYFH
Sbjct  86   MNAQYFGEIGVGTPAQKFTVIFDTGSSNLWVPSAKCYFSLACYFH  130



>gb|ACN24614.1| aspartic acid protease [Phaseolus vulgaris]
Length=513

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 75/105 (71%), Gaps = 9/105 (9%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRY---------ARNYRGDPSADIIALKNYMN  418
            NDGL RIGLKK KLD  N LA  IGSK+  +           N+ G    DI+ALKNY++
Sbjct  27   NDGLRRIGLKKIKLDPNNRLAARIGSKDDSFRASIRKFHLQNNFGGTEDTDIVALKNYLD  86

Query  419  AQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            AQYFG+I IG+ PQKFTV+FDTGSSNLWVPS+ C  S+ACYFH+K
Sbjct  87   AQYFGEIAIGTSPQKFTVIFDTGSSNLWVPSSLCTFSVACYFHAK  131



>gb|EPS66177.1| hypothetical protein M569_08599, partial [Genlisea aurea]
Length=361

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 9/109 (8%)
 Frame = +2

Query  254  FSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN--------YRGDPS-ADIIALK  406
            FS  +D  IRIGLK+ +LD+ + +A  +GSK     RN        + G+ +  DI+ALK
Sbjct  21   FSSPDDEFIRIGLKRLRLDQNDDIAARLGSKNVEELRNLFRRQTLRFAGNSADTDIVALK  80

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NYM+AQYFG+I IG+PPQKFTV+FDTGSSNLW+PS++C+ SIAC FHSK
Sbjct  81   NYMDAQYFGEIAIGTPPQKFTVIFDTGSSNLWIPSSRCHFSIACLFHSK  129



>gb|KDO45248.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=392

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 80/112 (71%), Gaps = 9/112 (8%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRY--------ARNYRGDPSADII  397
            S  +   S++GL RIGLKKR+LD  +  A  I  KE RY         R+  GD   DI+
Sbjct  17   SCLLLPASSNGLRRIGLKKRRLDLHSLNAARITRKE-RYMGGAGVSGVRHRLGDSDEDIL  75

Query  398  ALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
             LKN+M+AQYFG+IGIGSPPQ F+V+FDTGSSNLWVPS+KCY SI+CYFHS+
Sbjct  76   PLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSR  127



>ref|XP_010241437.1| PREDICTED: cyprosin-like [Nelumbo nucifera]
Length=507

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 78/102 (76%), Gaps = 6/102 (6%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRYA------RNYRGDPSADIIALKNYMNAQY  427
            ++GL+RIGLKKR LD  +  A  + +K  +YA       +   D + DI++LKNY+NAQY
Sbjct  25   SNGLVRIGLKKRPLDPTSLNAMKLVNKVSKYAGGLWDIHHNLHDFNEDIVSLKNYLNAQY  84

Query  428  FGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +G+IGIGSPPQ FTV+FDTGSSNLWVPS+KCY SIACYFHSK
Sbjct  85   YGEIGIGSPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSK  126



>ref|XP_011087560.1| PREDICTED: aspartic proteinase-like isoform X1 [Sesamum indicum]
Length=521

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 73/103 (71%), Gaps = 6/103 (6%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGRYA------RNYRGDPSADIIALKNYMNAQ  424
            S+DGL RIGLKKR LD     A    + EG+Y       R   GD   DI+ LKNYM+AQ
Sbjct  37   SSDGLRRIGLKKRLLDLSRFKAARQATLEGKYGTILKDRRIKLGDSDEDIVYLKNYMDAQ  96

Query  425  YFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            Y+G I IGSPPQ FTV+FDTGSSNLWVPS+KCY SIACYFHS+
Sbjct  97   YYGQISIGSPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSR  139



>ref|XP_011087561.1| PREDICTED: aspartic proteinase-like isoform X2 [Sesamum indicum]
 ref|XP_011087562.1| PREDICTED: aspartic proteinase-like isoform X2 [Sesamum indicum]
 ref|XP_011087563.1| PREDICTED: aspartic proteinase-like isoform X2 [Sesamum indicum]
Length=506

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 73/103 (71%), Gaps = 6/103 (6%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGRYA------RNYRGDPSADIIALKNYMNAQ  424
            S+DGL RIGLKKR LD     A    + EG+Y       R   GD   DI+ LKNYM+AQ
Sbjct  22   SSDGLRRIGLKKRLLDLSRFKAARQATLEGKYGTILKDRRIKLGDSDEDIVYLKNYMDAQ  81

Query  425  YFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            Y+G I IGSPPQ FTV+FDTGSSNLWVPS+KCY SIACYFHS+
Sbjct  82   YYGQISIGSPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSR  124



>pdb|1QDM|A Chain A, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley 
Vacuolar Aspartic Proteinase.
 pdb|1QDM|B Chain B, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley 
Vacuolar Aspartic Proteinase.
 pdb|1QDM|C Chain C, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley 
Vacuolar Aspartic Proteinase.
Length=478

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 72/96 (75%), Gaps = 4/96 (4%)
 Frame = +2

Query  278  IRIGLKKRKLDRINHLAESIGSKEGRY----ARNYRGDPSADIIALKNYMNAQYFGDIGI  445
            +RI LKKR +DR + +A  +   E +     A   R +   DI+ALKNYMNAQYFG+IG+
Sbjct  1    VRIALKKRPIDRNSRVATGLSGGEEQPLLSGANPLRSEEEGDIVALKNYMNAQYFGEIGV  60

Query  446  GSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            G+PPQKFTV+FDTGSSNLWVPSAKCY SIACY HS+
Sbjct  61   GTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHSR  96



>emb|CDY16668.1| BnaA09g20460D [Brassica napus]
Length=507

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 78/99 (79%), Gaps = 4/99 (4%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSK-EGRYA-RNY--RGDPSADIIALKNYMNAQYFGD  436
            DG +RIGLKKRKLDR N LA  +  K  G ++ ++Y    D ++DI+ LKNY++AQY+G+
Sbjct  30   DGTLRIGLKKRKLDRANRLASQLFLKNRGSWSPKDYFRLNDANSDIVPLKNYLDAQYYGE  89

Query  437  IGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            I IG+PPQKFT +FDTGSSNLWVPS+ CY SIACYFHSK
Sbjct  90   ITIGTPPQKFTAIFDTGSSNLWVPSSNCYFSIACYFHSK  128



>ref|XP_009114571.1| PREDICTED: aspartic proteinase A3 isoform X1 [Brassica rapa]
Length=507

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 78/99 (79%), Gaps = 4/99 (4%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSK-EGRYA-RNY--RGDPSADIIALKNYMNAQYFGD  436
            DG +RIGLKKRKLDR N LA  +  K  G ++ ++Y    D ++DI+ LKNY++AQY+G+
Sbjct  30   DGTLRIGLKKRKLDRANRLASQLFLKNRGSWSPKDYFRLNDANSDIVPLKNYLDAQYYGE  89

Query  437  IGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            I IG+PPQKFT +FDTGSSNLWVPS+ CY SIACYFHSK
Sbjct  90   ITIGTPPQKFTAIFDTGSSNLWVPSSNCYFSIACYFHSK  128



>emb|CDX94554.1| BnaC09g22820D [Brassica napus]
Length=507

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 78/99 (79%), Gaps = 4/99 (4%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSK-EGRYA-RNY--RGDPSADIIALKNYMNAQYFGD  436
            DG +RIGLKKRKLDR N LA  +  K  G ++ ++Y    D ++DI+ LKNY++AQY+G+
Sbjct  30   DGTLRIGLKKRKLDRANRLASQLFLKNRGSWSPKDYFCLNDANSDIVPLKNYLDAQYYGE  89

Query  437  IGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            I IG+PPQKFT +FDTGSSNLWVPS+ CY SIACYFHSK
Sbjct  90   ITIGTPPQKFTAIFDTGSSNLWVPSSNCYFSIACYFHSK  128



>ref|XP_002886481.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62740.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=513

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 78/111 (70%), Gaps = 9/111 (8%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR-------NYRGDPS--ADIIA  400
            TV S  NDG  R+GLKK KLD  N LA   GSK+    R       N  G  S  ADI+ 
Sbjct  21   TVSSQRNDGTFRVGLKKLKLDPNNRLATRFGSKQEEALRSSLPSYNNNLGSDSGDADIVP  80

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            LKNY++AQY+G+I IG+PPQKFTV+FDTGSSNLWVPS KC+ S++C+FH+K
Sbjct  81   LKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFFSLSCFFHAK  131



>ref|XP_009394234.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 76/103 (74%), Gaps = 7/103 (7%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGR------YARNYRGDPSADIIALKNYMNAQ  424
            S DGL+RIGLKK+ LD  +  A  +  ++GR      +    +     DII+LKNYMNAQ
Sbjct  26   SADGLVRIGLKKKPLDENDRFAARL-VQDGRRSISREHGFRLKNGEDVDIISLKNYMNAQ  84

Query  425  YFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            YFG++GIGSP QKFTV+FDTGSSNLWVPS+KCY SIAC+FHS+
Sbjct  85   YFGEVGIGSPSQKFTVIFDTGSSNLWVPSSKCYFSIACFFHSR  127



>emb|CAA48939.1| cyprosin [Cynara cardunculus]
Length=474

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 5/93 (5%)
 Frame = +2

Query  290  LKKRKLDRINHLAESIGSKEGRYARNY--RG---DPSADIIALKNYMNAQYFGDIGIGSP  454
            LKKRK++ +NH  E  GS +    R Y  RG   D   ++IALKNYM+AQYFG+IGIG+P
Sbjct  1    LKKRKVNILNHPGEHAGSNDANARRKYGVRGNFRDSDGELIALKNYMDAQYFGEIGIGTP  60

Query  455  PQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            PQKFTV+FDTGSSNLWVPS+KCY S+AC FHSK
Sbjct  61   PQKFTVIFDTGSSNLWVPSSKCYFSVACLFHSK  93



>ref|XP_008246320.1| PREDICTED: aspartic proteinase-like [Prunus mume]
Length=506

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 72/101 (71%), Gaps = 7/101 (7%)
 Frame = +2

Query  272  GLIRIGLKKRKLD-------RINHLAESIGSKEGRYARNYRGDPSADIIALKNYMNAQYF  430
            GL+RIGLKKR LD       R    A   GS +G    +Y G    DI+ L NYM+AQY+
Sbjct  24   GLVRIGLKKRPLDLQTIKAARAEREANYRGSLKGMNQNHYLGSSDEDIVPLNNYMDAQYY  83

Query  431  GDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            G+IGIGSPPQ FTV+FDTGSSNLWVPS+KCY SIACYFH++
Sbjct  84   GEIGIGSPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHTR  124



>ref|XP_009801963.1| PREDICTED: cyprosin-like [Nicotiana sylvestris]
Length=506

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 79/108 (73%), Gaps = 6/108 (6%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRG------DPSADIIALKN  409
            +V S S + L+R+GLKK+ LD  +  A  +  ++ RY +N  G      D   DI++LKN
Sbjct  18   SVLSASCENLLRVGLKKQPLDVNSINAARVARQQDRYGKNMNGIEKKLGDSDLDIVSLKN  77

Query  410  YMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            Y++AQY+G+IG+GSPPQKF V+FDTGSSNLWVPS++CY SIAC+ HSK
Sbjct  78   YLDAQYYGEIGVGSPPQKFKVIFDTGSSNLWVPSSRCYFSIACWIHSK  125



>ref|XP_011039044.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011039045.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011039046.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=506

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 75/107 (70%), Gaps = 6/107 (6%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR------GDPSADIIALKNY  412
            +   ++ GL+RIGLKKR++D     A  I  +EG+            G   ADII LKNY
Sbjct  19   LLPANSSGLVRIGLKKRRIDLDTIKAARIARQEGKSGAGANSLFHDLGTSDADIIPLKNY  78

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++AQY G+IGIGSPPQ FTV+FDTGSSNLWVPS+KCY SIACYFHSK
Sbjct  79   LDAQYVGEIGIGSPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSK  125



>ref|XP_009134301.1| PREDICTED: aspartic proteinase A3-like [Brassica rapa]
Length=503

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 4/99 (4%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSK-EGRYARN---YRGDPSADIIALKNYMNAQYFGD  436
            DG +RIGLKKRKL+R N LA  +  K  G ++     +  D ++D + LKNY++AQY+GD
Sbjct  30   DGTLRIGLKKRKLNRANRLASQLFLKNRGSWSSKGFFHLNDGNSDAVPLKNYLDAQYYGD  89

Query  437  IGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            I IG+PPQKFT +FDTGSSNLW+PS+KCYLS+ACYFHSK
Sbjct  90   ITIGTPPQKFTAIFDTGSSNLWMPSSKCYLSVACYFHSK  128



>ref|XP_003529645.1| PREDICTED: aspartic proteinase-like isoform X1 [Glycine max]
 ref|XP_006584085.1| PREDICTED: aspartic proteinase-like isoform X2 [Glycine max]
Length=514

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 76/109 (70%), Gaps = 10/109 (9%)
 Frame = +2

Query  254  FSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIAL  403
            +   NDGL RIGLKK KLD  N LA  IGSK+    R          N+ G    DI+AL
Sbjct  23   YCAPNDGLRRIGLKKIKLDPKNRLAARIGSKDVDSFRASIRKFHLQNNFGGSEETDIVAL  82

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHS  550
            KNY++AQY+G+I IG+ PQKFTV+FDTGSSNLWVPS+KC  S+ACYFH+
Sbjct  83   KNYLDAQYYGEIAIGTSPQKFTVIFDTGSSNLWVPSSKCTFSVACYFHA  131



>emb|CDX90864.1| BnaA03g25440D [Brassica napus]
Length=503

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 4/99 (4%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSK-EGRYARN---YRGDPSADIIALKNYMNAQYFGD  436
            DG +RIGLKKRKL+R N LA  +  K  G ++     +  D ++D + LKNY++AQY+GD
Sbjct  30   DGTLRIGLKKRKLNRANRLASQLFLKNRGSWSSKGFFHLNDGNSDAVPLKNYLDAQYYGD  89

Query  437  IGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            I IG+PPQKFT +FDTGSSNLW+PS+KCYLS+ACYFHSK
Sbjct  90   ITIGTPPQKFTAIFDTGSSNLWMPSSKCYLSVACYFHSK  128



>gb|KHN35722.1| Aspartic proteinase [Glycine soja]
Length=514

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 76/109 (70%), Gaps = 10/109 (9%)
 Frame = +2

Query  254  FSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIAL  403
            +   NDGL RIGLKK KLD  N LA  IGSK+    R          N+ G    DI+AL
Sbjct  23   YCAPNDGLRRIGLKKIKLDPKNRLAARIGSKDVDSFRASIRKFHLQNNFGGSEETDIVAL  82

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHS  550
            KNY++AQY+G+I IG+ PQKFTV+FDTGSSNLWVPS+KC  S+ACYFH+
Sbjct  83   KNYLDAQYYGEIAIGTSPQKFTVIFDTGSSNLWVPSSKCTFSVACYFHA  131



>sp|P40782.2|CYPR1_CYNCA RecName: Full=Cyprosin; Flags: Precursor, partial [Cynara cardunculus]
 prf||2124255A cyprosin
Length=473

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 5/93 (5%)
 Frame = +2

Query  290  LKKRKLDRINHLAESIGSKEGRYARNY--RG---DPSADIIALKNYMNAQYFGDIGIGSP  454
            LKKRK++ +NH  E  GS +    R Y  RG   D   ++IALKNYM+AQYFG+IGIG+P
Sbjct  1    LKKRKVNILNHPGEHAGSNDANARRKYGVRGNFRDSDGELIALKNYMDAQYFGEIGIGTP  60

Query  455  PQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            PQKFTV+FDTGSSNLWVPS+KCY S+AC FHSK
Sbjct  61   PQKFTVIFDTGSSNLWVPSSKCYFSVACLFHSK  93



>gb|KDO45247.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=506

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 80/112 (71%), Gaps = 9/112 (8%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRY--------ARNYRGDPSADII  397
            S  +   S++GL RIGLKKR+LD  +  A  I  KE RY         R+  GD   DI+
Sbjct  17   SCLLLPASSNGLRRIGLKKRRLDLHSLNAARITRKE-RYMGGAGVSGVRHRLGDSDEDIL  75

Query  398  ALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
             LKN+M+AQYFG+IGIGSPPQ F+V+FDTGSSNLWVPS+KCY SI+CYFHS+
Sbjct  76   PLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSR  127



>gb|KDO45246.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=509

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 80/112 (71%), Gaps = 9/112 (8%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRY--------ARNYRGDPSADII  397
            S  +   S++GL RIGLKKR+LD  +  A  I  KE RY         R+  GD   DI+
Sbjct  17   SCLLLPASSNGLRRIGLKKRRLDLHSLNAARITRKE-RYMGGAGVSGVRHRLGDSDEDIL  75

Query  398  ALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
             LKN+M+AQYFG+IGIGSPPQ F+V+FDTGSSNLWVPS+KCY SI+CYFHS+
Sbjct  76   PLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSR  127



>ref|XP_010430270.1| PREDICTED: aspartic proteinase A2-like [Camelina sativa]
Length=514

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 77/106 (73%), Gaps = 9/106 (8%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGR--------YARNYRGDP-SADIIALKNYM  415
            ++DG  R+GLKK KLD  N LA   GS +          Y  N  GD   ADI+ALKNY+
Sbjct  27   NDDGTFRVGLKKLKLDPNNRLATRFGSNQEEALRSSFRSYNNNLGGDSGDADIVALKNYL  86

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +AQY+G+I IG+PPQKFTV+FDTGSSNLWVPS KC+LS++C+FH+K
Sbjct  87   DAQYYGEISIGTPPQKFTVIFDTGSSNLWVPSGKCFLSLSCFFHAK  132



>emb|CDY21302.1| BnaC03g29860D [Brassica napus]
Length=601

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 4/99 (4%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSK-EGRYARN---YRGDPSADIIALKNYMNAQYFGD  436
            DG +RIGLKKRKL+R N LA  +  K  G ++     +  D ++D + LKNY++AQY+GD
Sbjct  30   DGTLRIGLKKRKLNRANRLASQLFLKNRGSWSSKGFFHLNDGNSDTVPLKNYLDAQYYGD  89

Query  437  IGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            I IG+PPQKFT +FDTGSSNLW+PS+KCYLS+ACYFHSK
Sbjct  90   ITIGTPPQKFTAIFDTGSSNLWMPSSKCYLSVACYFHSK  128



>ref|XP_009416572.1| PREDICTED: aspartic proteinase-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=505

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 5/107 (5%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-----GDPSADIIALKNY  412
            ++   S+DGL+R+ LKKR LDR    A  I  KE  +++N        D   DI++LKNY
Sbjct  18   SLLHASSDGLLRVKLKKRPLDRNTLDAARIVRKENMHSQNNAFHHNLEDSDIDIVSLKNY  77

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            M+AQYFG+IGIGSPPQ F+V+FDTGSSNLWVPS+KC+ S+ CYFH K
Sbjct  78   MDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCFFSVPCYFHHK  124



>dbj|BAB20973.1| aspartic proteinase 5 [Nepenthes alata]
Length=358

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 75/103 (73%), Gaps = 5/103 (5%)
 Frame = +2

Query  254  FSVSNDGLIRIGLKKRKLD----RINHLAESIGSKEGRYARNYR-GDPSADIIALKNYMN  418
            FS S DGL+RIGLK++  D    R   +A   G  +G     Y  GD   DI+ LKNY++
Sbjct  20   FSTSADGLVRIGLKRQFSDSNSIRAVRIARKAGMNQGLKRFQYSFGDSDTDIVYLKNYLD  79

Query  419  AQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            AQY+G+IGIGSPPQKF+V+FDTGSSNLWVPS+KCY S+ACYFH
Sbjct  80   AQYYGEIGIGSPPQKFSVIFDTGSSNLWVPSSKCYFSVACYFH  122



>ref|XP_009416564.1| PREDICTED: aspartic proteinase-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 5/107 (5%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-----GDPSADIIALKNY  412
            ++   S+DGL+R+ LKKR LDR    A  I  KE  +++N        D   DI++LKNY
Sbjct  40   SLLHASSDGLLRVKLKKRPLDRNTLDAARIVRKENMHSQNNAFHHNLEDSDIDIVSLKNY  99

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            M+AQYFG+IGIGSPPQ F+V+FDTGSSNLWVPS+KC+ S+ CYFH K
Sbjct  100  MDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCFFSVPCYFHHK  146



>gb|ADM73842.1| aspartyl protease-like protein, partial [Picea sitchensis]
Length=141

 Score =   120 bits (300),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 74/108 (69%), Gaps = 11/108 (10%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLD----RINHLAESIGSKEGRYARNY--RGDP-----SADIIAL  403
            S ++DGL+R+GLK + LD    R    +   G  E R  R +  RG P       D + L
Sbjct  24   SCADDGLVRVGLKNKPLDLKTLRAARASMRNGCHEERLVRKFGLRGGPGFNSNEGDYVPL  83

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            KNY++AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY S+ACYFH
Sbjct  84   KNYLDAQYFGEIGIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACYFH  131



>gb|AAB03843.2| aspartic proteinase [Vigna unguiculata]
 gb|AAQ14346.1| aspartic proteinase [Vigna unguiculata]
Length=513

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 75/105 (71%), Gaps = 9/105 (9%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRY---------ARNYRGDPSADIIALKNYMN  418
            NDGL RIGLKK KLD  N LA  IGS +  +           N+ G    DI+ALKNY++
Sbjct  27   NDGLRRIGLKKIKLDPNNRLAARIGSNDDSFRASIRKFHLQNNFAGTGETDIVALKNYLD  86

Query  419  AQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            AQY+G+I IG+ PQKFTV+FDTGSSNLWVPS++C  S+ACYFH+K
Sbjct  87   AQYYGEISIGTSPQKFTVIFDTGSSNLWVPSSRCTFSLACYFHAK  131



>ref|XP_002319454.2| aspartic proteinase 2 [Populus trichocarpa]
 gb|EEE95377.2| aspartic proteinase 2 [Populus trichocarpa]
Length=507

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 73/107 (68%), Gaps = 6/107 (6%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR------GDPSADIIALKNY  412
            +   S++GL+RIGLKKR LD        I  +EG+            G    DII LKNY
Sbjct  19   LLPASSNGLVRIGLKKRHLDLQTIKDARIARQEGKAGVGASSRVHDLGSSDGDIIPLKNY  78

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++AQY G+IGIGSPPQ FTVVFDTGSSNLWVPS+KCY SIACYFHSK
Sbjct  79   LDAQYLGEIGIGSPPQNFTVVFDTGSSNLWVPSSKCYFSIACYFHSK  125



>ref|XP_010052871.1| PREDICTED: aspartic proteinase [Eucalyptus grandis]
Length=522

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 10/106 (9%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN---------YRGDPS-ADIIALKNYM  415
             DGL+R+GLKK K D    +A  + S+ G   R+         +RGD    DI+ LKNY+
Sbjct  35   EDGLLRVGLKKFKPDPNKRVAARLESQGGGLLRSSIRPYHLNGWRGDAQLPDIVGLKNYL  94

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +AQY+G+IGIG+PPQKFTV+FDTGSSNLWVPS+KCYLS+AC+FHSK
Sbjct  95   DAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYLSVACFFHSK  140



>gb|KCW77002.1| hypothetical protein EUGRSUZ_D01351 [Eucalyptus grandis]
Length=514

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 10/106 (9%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN---------YRGDPS-ADIIALKNYM  415
             DGL+R+GLKK K D    +A  + S+ G   R+         +RGD    DI+ LKNY+
Sbjct  27   EDGLLRVGLKKFKPDPNKRVAARLESQGGGLLRSSIRPYHLNGWRGDAQLPDIVGLKNYL  86

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +AQY+G+IGIG+PPQKFTV+FDTGSSNLWVPS+KCYLS+AC+FHSK
Sbjct  87   DAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYLSVACFFHSK  132



>ref|XP_010539208.1| PREDICTED: aspartic proteinase A3-like isoform X1 [Tarenaya hassleriana]
Length=518

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 80/99 (81%), Gaps = 2/99 (2%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLA-ESIGSKEGRYARNYR-GDPSADIIALKNYMNAQYFGD  436
            ++DG++RIGLKK KLDR N +  ++     G   R+YR  + +ADI+ALKNY++AQY+G+
Sbjct  38   NDDGMLRIGLKKIKLDRNNWVGLKNWLLAPGARHRDYRMSNGAADIVALKNYLDAQYYGE  97

Query  437  IGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            I +G+PPQKF V+FDTGSSNLWVPS+KCY SIAC+FHSK
Sbjct  98   ISVGTPPQKFEVIFDTGSSNLWVPSSKCYFSIACFFHSK  136



>ref|XP_008800325.1| PREDICTED: aspartic proteinase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008800326.1| PREDICTED: aspartic proteinase-like isoform X1 [Phoenix dactylifera]
Length=507

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 75/106 (71%), Gaps = 5/106 (5%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR-----NYRGDPSADIIALKNYM  415
            +   S+DGL+RIGLKK+ LD     A  I  K   + +     +   D   DII+LKNYM
Sbjct  20   LLHASSDGLLRIGLKKKPLDTETLNAAKIARKMMIHMQKNGLHHSLADSDVDIISLKNYM  79

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY SIACYFH +
Sbjct  80   DAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHHR  125



>ref|XP_009358756.1| PREDICTED: aspartic proteinase-like [Pyrus x bretschneideri]
Length=507

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 10/109 (9%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-----GDPSA---DIIALK  406
            V S  NDGL RI LKK KLD  + +A  + SK G   R YR     G+P +   DI++LK
Sbjct  19   VSSAPNDGLSRIALKKVKLDSNDRVAAQLESKNG--LRKYRLPSNLGEPESGDVDIVSLK  76

Query  407  NYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            NY++AQY+G+I IG+PPQ FTV+FDTGSSNLWVPS+KCY S+AC+FH+K
Sbjct  77   NYLDAQYYGEIAIGTPPQPFTVIFDTGSSNLWVPSSKCYFSLACFFHAK  125



>ref|XP_008800328.1| PREDICTED: aspartic proteinase-like isoform X2 [Phoenix dactylifera]
Length=507

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 75/106 (71%), Gaps = 5/106 (5%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR-----NYRGDPSADIIALKNYM  415
            +   S+DGL+RIGLKK+ LD     A  I  K   + +     +   D   DII+LKNYM
Sbjct  20   LLHASSDGLLRIGLKKKPLDTETLNAAKIARKMMIHMQKNGLHHSLADSDVDIISLKNYM  79

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY SIACYFH +
Sbjct  80   DAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHHR  125



>ref|XP_010539213.1| PREDICTED: aspartic proteinase A3-like isoform X2 [Tarenaya hassleriana]
 ref|XP_010539218.1| PREDICTED: aspartic proteinase A3-like isoform X2 [Tarenaya hassleriana]
 ref|XP_010539226.1| PREDICTED: aspartic proteinase A3-like isoform X2 [Tarenaya hassleriana]
Length=507

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 80/99 (81%), Gaps = 2/99 (2%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLA-ESIGSKEGRYARNYR-GDPSADIIALKNYMNAQYFGD  436
            ++DG++RIGLKK KLDR N +  ++     G   R+YR  + +ADI+ALKNY++AQY+G+
Sbjct  27   NDDGMLRIGLKKIKLDRNNWVGLKNWLLAPGARHRDYRMSNGAADIVALKNYLDAQYYGE  86

Query  437  IGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            I +G+PPQKF V+FDTGSSNLWVPS+KCY SIAC+FHSK
Sbjct  87   ISVGTPPQKFEVIFDTGSSNLWVPSSKCYFSIACFFHSK  125



>ref|XP_010659762.1| PREDICTED: aspartic proteinase A1 isoform X2 [Vitis vinifera]
 emb|CBI39670.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 6/107 (6%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLD----RINHLAESIGSKEGRYARNYRG--DPSADIIALKNY  412
            +  V + G +RIGLKKR LD    R   +A+  G   G     Y G  DP  + ++LKNY
Sbjct  19   LLPVYSHGSVRIGLKKRPLDFNNMRTARIAQMQGKIGGGVMSKYHGFDDPDGEFVSLKNY  78

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++AQYFG+IGIG+PPQ FTVVFDTGSSNLWVPS+KCY SIAC+FH+K
Sbjct  79   LDAQYFGEIGIGTPPQNFTVVFDTGSSNLWVPSSKCYFSIACFFHNK  125



>gb|ADM73810.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73811.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73815.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73820.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73826.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73827.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73835.1| aspartyl protease-like protein, partial [Picea sitchensis]
Length=141

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 74/108 (69%), Gaps = 11/108 (10%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLD----RINHLAESIGSKEGRYARNY--RGDP-----SADIIAL  403
            S ++DGL+R+GLKK+ LD    R    +   G    R  R +  RG P       D + L
Sbjct  24   SCADDGLVRVGLKKKPLDLKTLRAARASMRNGCHTERLVRKFGLRGGPGFNSNEGDYVPL  83

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            KNY++AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY S+ACYFH
Sbjct  84   KNYLDAQYFGEIGIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACYFH  131



>gb|ADM73798.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73799.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73800.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73806.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73812.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73828.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73829.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73830.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73831.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73832.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73836.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73837.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73838.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73839.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73841.1| aspartyl protease-like protein, partial [Picea sitchensis]
Length=141

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 74/108 (69%), Gaps = 11/108 (10%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLD----RINHLAESIGSKEGRYARNY--RGDP-----SADIIAL  403
            S ++DGL+R+GLKK+ LD    R    +   G    R  R +  RG P       D + L
Sbjct  24   SCADDGLVRVGLKKKPLDLKTLRAARASMRNGCHAERLVRKFGLRGGPGLNSNEGDYVPL  83

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            KNY++AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY S+ACYFH
Sbjct  84   KNYLDAQYFGEIGIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACYFH  131



>gb|ADM73795.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73796.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73797.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73801.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73802.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73803.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73804.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73805.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73807.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73808.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73809.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73813.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73814.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73816.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73817.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73818.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73819.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73821.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73822.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73823.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73824.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73825.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73833.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73834.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73840.1| aspartyl protease-like protein, partial [Picea sitchensis]
Length=141

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 74/108 (69%), Gaps = 11/108 (10%)
 Frame = +2

Query  257  SVSNDGLIRIGLKKRKLD----RINHLAESIGSKEGRYARNY--RGDP-----SADIIAL  403
            S ++DGL+R+GLKK+ LD    R    +   G    R  R +  RG P       D + L
Sbjct  24   SCADDGLVRVGLKKKPLDLKTLRAARASMRNGCHAERLVRKFGLRGGPGFNSNEGDYVPL  83

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            KNY++AQYFG+IGIG+PPQ FTV+FDTGSSNLWVPS+KCY S+ACYFH
Sbjct  84   KNYLDAQYFGEIGIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACYFH  131



>ref|XP_009421489.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=520

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 80/117 (68%), Gaps = 20/117 (17%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLA------ESIG----SKEGRYARNYRG---------DPS  385
            S +GL+RIGLKKR LDR   LA      E +G     K G   R+  G         +P 
Sbjct  24   SANGLVRIGLKKRPLDRNGRLAARLSHPEELGVLAARKYGPLLRDSLGLEHGPDGPAEPD  83

Query  386  -ADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
              +I+ALKNYMNAQYFG+IGIGSPPQ FTVVFDTGSSNLWVPS+KCY S+AC+FH+K
Sbjct  84   DGNIVALKNYMNAQYFGEIGIGSPPQNFTVVFDTGSSNLWVPSSKCYFSVACFFHAK  140



>ref|XP_002276363.3| PREDICTED: aspartic proteinase A1 isoform X1 [Vitis vinifera]
Length=529

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 6/107 (6%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLD----RINHLAESIGSKEGRYARNYRG--DPSADIIALKNY  412
            +  V + G +RIGLKKR LD    R   +A+  G   G     Y G  DP  + ++LKNY
Sbjct  46   LLPVYSHGSVRIGLKKRPLDFNNMRTARIAQMQGKIGGGVMSKYHGFDDPDGEFVSLKNY  105

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++AQYFG+IGIG+PPQ FTVVFDTGSSNLWVPS+KCY SIAC+FH+K
Sbjct  106  LDAQYFGEIGIGTPPQNFTVVFDTGSSNLWVPSSKCYFSIACFFHNK  152



>ref|XP_006428328.1| hypothetical protein CICLE_v10011525mg [Citrus clementina]
 gb|ESR41568.1| hypothetical protein CICLE_v10011525mg [Citrus clementina]
Length=419

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 79/112 (71%), Gaps = 9/112 (8%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRY--------ARNYRGDPSADII  397
            S  +   S++GL RIGLKKR+LD  +  A  I  KE RY          +  GD   DI+
Sbjct  17   SCLLLPASSNGLRRIGLKKRRLDLHSLNAARITRKE-RYMGGAGVSGVHHRLGDSDEDIL  75

Query  398  ALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
             LKN+M+AQYFG+IGIGSPPQ F+V+FDTGSSNLWVPS+KCY SI+CYFHS+
Sbjct  76   PLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSR  127



>ref|XP_011023864.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=526

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 73/107 (68%), Gaps = 6/107 (6%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR------GDPSADIIALKNY  412
            +   S++GL+RIGLKKR LD        I  +EG+            G    DII LKNY
Sbjct  38   LLPASSNGLVRIGLKKRHLDLQTIKDARIARQEGKAGVGASSRVHDLGSSDGDIIPLKNY  97

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++AQY G+IGIGSPPQ FTV+FDTGSSNLWVPS+KCY SIACYFHSK
Sbjct  98   LDAQYLGEIGIGSPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSK  144



>ref|XP_004134774.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
 ref|XP_004170034.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
 gb|KGN49091.1| hypothetical protein Csa_6G513550 [Cucumis sativus]
Length=516

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 80/115 (70%), Gaps = 11/115 (10%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLD---RINHLAES-----IGS---KEGRYARNYRGDPSA  388
            S    S SN+G +RIGLKK K D   R   L ES     +GS   K  ++  N     +A
Sbjct  21   SSEATSASNEGFLRIGLKKIKYDQNSRFKALLESKKGEFLGSSVGKHNQWGNNLEESKNA  80

Query  389  DIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            DI+ LKNY++AQY+G+IGIG+PPQKFTV+FDTGSSNLWVPSAKC  S+AC+FH+K
Sbjct  81   DIVPLKNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSAKCIFSLACFFHAK  135



>ref|XP_008649363.1| PREDICTED: aspartic proteinase oryzasin-1-like [Zea mays]
Length=225

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 7/104 (7%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKE-------GRYARNYRGDPSADIIALKNYMNA  421
            S++GL+R+ LKK+ +D+   +A  +  +E       G  A    G+  +D+IALKNYMNA
Sbjct  73   SSEGLVRVALKKQPVDQNGRVATCLSVEERQRLLLRGANALGSGGEDDSDVIALKNYMNA  132

Query  422  QYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            QY G+IG+GSP  KFTV+FDTGSSNLWVPS+KCY  IACYFHS+
Sbjct  133  QYVGEIGVGSPQHKFTVIFDTGSSNLWVPSSKCYFLIACYFHSR  176



>dbj|BAB20972.1| aspartic proteinase 4 [Nepenthes alata]
Length=505

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 75/103 (73%), Gaps = 5/103 (5%)
 Frame = +2

Query  254  FSVSNDGLIRIGLKKRKLD----RINHLAESIGSKEGRYARNYR-GDPSADIIALKNYMN  418
            FS S DGL+RIGLK++  D    R   +A   G  +G     Y  GD   DI+ LKNY++
Sbjct  20   FSTSADGLVRIGLKRQFSDSNSIRAVRIARKAGMNQGLKRFQYSFGDSDTDIVYLKNYLD  79

Query  419  AQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            AQY+G+IGIGSPPQKF+V+FDTGSSNLWVPS+KCY S+ACYFH
Sbjct  80   AQYYGEIGIGSPPQKFSVIFDTGSSNLWVPSSKCYFSVACYFH  122



>ref|XP_006396693.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
 gb|ESQ38146.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
Length=512

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 5/100 (5%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-----GDPSADIIALKNYMNAQYFG  433
            DG +RI LKK KLDR N LA  +  K    + +++      D ++DI+ LKNY++AQY+G
Sbjct  34   DGTLRIALKKSKLDRANRLASELFLKNRGASWSFKDYLRLSDGNSDIVPLKNYLDAQYYG  93

Query  434  DIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            DI IG+PPQKFT +FDTGSSNLW+PS++CYLS+ACYFH+K
Sbjct  94   DITIGTPPQKFTAIFDTGSSNLWIPSSQCYLSVACYFHTK  133



>gb|AAC34854.1| senescence-associated protein 4 [Hemerocallis hybrid cultivar]
Length=517

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 75/108 (69%), Gaps = 8/108 (7%)
 Frame = +2

Query  254  FSVSNDGLIRIGLKKRKLDRINHLAESIGSKE-----GRYARN---YRGDPSADIIALKN  409
             S S +GL+RI LKK+  D  + ++  + + E      RY        G  S DII+LKN
Sbjct  23   LSASAEGLVRINLKKKPFDEKSRVSSRLSADEDEPLKARYGLRGGLNDGADSTDIISLKN  82

Query  410  YMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            YMNAQYFG+IG+G+PPQKFTV+FDTGSSNLWVPSAKCY SIAC  H+K
Sbjct  83   YMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACLLHTK  130



>ref|XP_006396692.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
 gb|ESQ38145.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
Length=507

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 5/100 (5%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-----GDPSADIIALKNYMNAQYFG  433
            DG +RI LKK KLDR N LA  +  K    + +++      D ++DI+ LKNY++AQY+G
Sbjct  29   DGTLRIALKKSKLDRANRLASELFLKNRGASWSFKDYLRLSDGNSDIVPLKNYLDAQYYG  88

Query  434  DIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            DI IG+PPQKFT +FDTGSSNLW+PS++CYLS+ACYFH+K
Sbjct  89   DITIGTPPQKFTAIFDTGSSNLWIPSSQCYLSVACYFHTK  128



>ref|XP_008784384.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
Length=518

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 75/112 (67%), Gaps = 12/112 (11%)
 Frame = +2

Query  254  FSVSNDGLIRIGLKKRKLDRINHLAE-----------SIGSKEGRYARNYRG-DPSADII  397
            F VS DG+ RIGLKKR LD+ + LA                K G +     G     +++
Sbjct  25   FPVSADGVFRIGLKKRALDQNSRLAARLAVREEEAAALAARKYGYFEPGPVGPGEEGNVV  84

Query  398  ALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ALKNYMNAQYF +IG+GSPPQ FTV+FDTGSSNLWVPS+KCY S+ACYFHSK
Sbjct  85   ALKNYMNAQYFAEIGLGSPPQNFTVIFDTGSSNLWVPSSKCYFSVACYFHSK  136



>ref|XP_006428329.1| hypothetical protein CICLE_v10011525mg [Citrus clementina]
 ref|XP_006480355.1| PREDICTED: aspartic proteinase-like [Citrus sinensis]
 gb|ESR41569.1| hypothetical protein CICLE_v10011525mg [Citrus clementina]
Length=506

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 79/112 (71%), Gaps = 9/112 (8%)
 Frame = +2

Query  242  SPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRY--------ARNYRGDPSADII  397
            S  +   S++GL RIGLKKR+LD  +  A  I  KE RY          +  GD   DI+
Sbjct  17   SCLLLPASSNGLRRIGLKKRRLDLHSLNAARITRKE-RYMGGAGVSGVHHRLGDSDEDIL  75

Query  398  ALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
             LKN+M+AQYFG+IGIGSPPQ F+V+FDTGSSNLWVPS+KCY SI+CYFHS+
Sbjct  76   PLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSR  127



>ref|XP_010042427.1| PREDICTED: aspartic proteinase-like isoform X2 [Eucalyptus grandis]
Length=502

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 76/105 (72%), Gaps = 4/105 (4%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRG----DPSADIIALKNYMN  418
            +   S+ GL+RIGLKKR+LD  +  A     +EG      +G        D++ LKNY++
Sbjct  19   LLPTSSHGLVRIGLKKRRLDVWSINAARTARQEGFLKYGTKGLNMHSGGEDMVPLKNYLD  78

Query  419  AQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            AQY+G++GIGSPPQ+FTV+FDTGSSNLWVPSAKC+ SIACYFHSK
Sbjct  79   AQYYGEVGIGSPPQQFTVIFDTGSSNLWVPSAKCFFSIACYFHSK  123



>ref|XP_009419881.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 77/104 (74%), Gaps = 9/104 (9%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSKEGR--YARNY--RG-----DPSADIIALKNYMNA  421
            D LIRIGL+K+ L     +A  +  KEG+   AR +  RG     +   DI++LKNY+NA
Sbjct  30   DALIRIGLRKKPLGENGRIAARLLDKEGKDLMARRHGLRGGVGSNEEDEDIVSLKNYLNA  89

Query  422  QYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            QYFG+IGIGSP QKFTV+FDTGSSNLW+PS+KC LS+ACYFHSK
Sbjct  90   QYFGEIGIGSPAQKFTVIFDTGSSNLWIPSSKCILSVACYFHSK  133



>ref|XP_006838131.1| hypothetical protein AMTR_s00106p00075970 [Amborella trichopoda]
 gb|ERN00700.1| hypothetical protein AMTR_s00106p00075970 [Amborella trichopoda]
Length=513

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 77/103 (75%), Gaps = 10/103 (10%)
 Frame = +2

Query  269  DGLIRIGLKKRKLDRINHLAESIGSKEGRYARN-------YRGDP---SADIIALKNYMN  418
            +GL+RIGLKK+ LD  + LA  I + +G+ ++         RG+      DII+LKNYM+
Sbjct  27   NGLVRIGLKKKSLDPNSLLASRIAAGDGKASKTQPRKFCGLRGNTLNSDEDIISLKNYMD  86

Query  419  AQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            AQY+G+IG+GSPPQ FTV+FDTGSSNLWVPS+KCY S+ACYFH
Sbjct  87   AQYYGEIGVGSPPQTFTVIFDTGSSNLWVPSSKCYFSVACYFH  129



>ref|XP_010529449.1| PREDICTED: aspartic proteinase A3 [Tarenaya hassleriana]
Length=507

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 10/103 (10%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSK------EGRYARNYRGDPSADIIALKNYMNAQ  424
            S+DG++RIGL+K + D  N LA  +GSK      EG    N  GD  + IIALKNY++AQ
Sbjct  27   SDDGILRIGLRKIRQDWNNGLAARLGSKNRAPPLEGYRPSN--GD--SGIIALKNYLDAQ  82

Query  425  YFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            Y+G+I IG+PPQKFTV+FDTGSSNLWVPS+KCY SIAC+FHSK
Sbjct  83   YYGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACFFHSK  125



>ref|XP_009771336.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Nicotiana 
sylvestris]
Length=511

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 11/112 (10%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-----------GDPSADII  397
            VF  S+D L+RI LKKR+LD  +    ++   E RY ++              D ++DI+
Sbjct  19   VFPASSDSLLRISLKKRQLDISSLNVANVARLEDRYGKHVMKDIEKKKKKKKSDTNSDIV  78

Query  398  ALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +LKNY++AQY+GDI IGSPPQ FTV+FDTGSSNLWVPS++CY SIAC+ HSK
Sbjct  79   SLKNYLDAQYYGDISIGSPPQNFTVIFDTGSSNLWVPSSRCYFSIACWIHSK  130



>ref|XP_011086197.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Sesamum indicum]
Length=510

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 76/103 (74%), Gaps = 7/103 (7%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRY-ARNYR------GDPSADIIALKNYMNAQ  424
            +D LIRI +KK KLD  + LA  + SKEGR   R Y        +  +DI+ L+NYM+AQ
Sbjct  27   DDALIRIRVKKLKLDGNSRLAARLESKEGRVPVRKYSPLGKVVNNADSDIVELENYMDAQ  86

Query  425  YFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            Y+G+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY S+ CY HSK
Sbjct  87   YYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSLPCYVHSK  129



>ref|XP_009771335.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Nicotiana 
sylvestris]
Length=526

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 11/112 (10%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYR-----------GDPSADII  397
            VF  S+D L+RI LKKR+LD  +    ++   E RY ++              D ++DI+
Sbjct  34   VFPASSDSLLRISLKKRQLDISSLNVANVARLEDRYGKHVMKDIEKKKKKKKSDTNSDIV  93

Query  398  ALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +LKNY++AQY+GDI IGSPPQ FTV+FDTGSSNLWVPS++CY SIAC+ HSK
Sbjct  94   SLKNYLDAQYYGDISIGSPPQNFTVIFDTGSSNLWVPSSRCYFSIACWIHSK  145



>emb|CDY21021.1| BnaA08g25040D [Brassica napus]
Length=526

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHL-AESIGSKEGRYARNYR-GDP-SADIIALKNYMNAQYFGD  436
            NDG +R+GLKK K D   HL A + GS E    R Y  GD   ADI+ LKNY++AQY+G+
Sbjct  46   NDGTVRVGLKKLKSDPQIHLSARAFGSHEENPPRAYNLGDSGDADIVTLKNYLDAQYYGE  105

Query  437  IGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            I IG+PPQKFTVVFDTGSSNLWVPS+KCY SIAC  H K
Sbjct  106  IAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPK  144



>ref|XP_009110686.1| PREDICTED: aspartic proteinase A1-like [Brassica rapa]
Length=507

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHL-AESIGSKEGRYARNYR-GDP-SADIIALKNYMNAQYFGD  436
            NDG +R+GLKK K D   HL A + GS E    R Y  GD   ADI+ LKNY++AQY+G+
Sbjct  27   NDGTVRVGLKKLKSDPQIHLSARAFGSHEENPPRAYNLGDSGDADIVTLKNYLDAQYYGE  86

Query  437  IGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            I IG+PPQKFTVVFDTGSSNLWVPS+KCY SIAC  H K
Sbjct  87   IAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPK  125



>ref|XP_010042419.1| PREDICTED: aspartic proteinase-like isoform X1 [Eucalyptus grandis]
 gb|KCW84997.1| hypothetical protein EUGRSUZ_B01820 [Eucalyptus grandis]
Length=568

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 76/105 (72%), Gaps = 4/105 (4%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRG----DPSADIIALKNYMN  418
            +   S+ GL+RIGLKKR+LD  +  A     +EG      +G        D++ LKNY++
Sbjct  85   LLPTSSHGLVRIGLKKRRLDVWSINAARTARQEGFLKYGTKGLNMHSGGEDMVPLKNYLD  144

Query  419  AQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            AQY+G++GIGSPPQ+FTV+FDTGSSNLWVPSAKC+ SIACYFHSK
Sbjct  145  AQYYGEVGIGSPPQQFTVIFDTGSSNLWVPSAKCFFSIACYFHSK  189



>ref|XP_006840365.1| hypothetical protein AMTR_s00045p00122510 [Amborella trichopoda]
 gb|ERN02040.1| hypothetical protein AMTR_s00045p00122510 [Amborella trichopoda]
Length=510

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 73/103 (71%), Gaps = 7/103 (7%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEG--RYARNYR-----GDPSADIIALKNYMNAQ  424
            ND L+RIGLKK+  D     A  I +K    R  RNY      GD   DI++LKNY++AQ
Sbjct  26   NDRLVRIGLKKKGFDLQTLTARKIVAKGNPPRNVRNYEILRKLGDSDVDIVSLKNYLDAQ  85

Query  425  YFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            Y+G+IGIGSP Q FTVVFDTGSSNLWVPS+KCY S+ CYFHSK
Sbjct  86   YYGEIGIGSPSQTFTVVFDTGSSNLWVPSSKCYFSLPCYFHSK  128



>ref|XP_011086196.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Sesamum indicum]
Length=561

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 76/103 (74%), Gaps = 7/103 (7%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRY-ARNYR------GDPSADIIALKNYMNAQ  424
            +D LIRI +KK KLD  + LA  + SKEGR   R Y        +  +DI+ L+NYM+AQ
Sbjct  78   DDALIRIRVKKLKLDGNSRLAARLESKEGRVPVRKYSPLGKVVNNADSDIVELENYMDAQ  137

Query  425  YFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            Y+G+IGIG+PPQKFTV+FDTGSSNLWVPS+KCY S+ CY HSK
Sbjct  138  YYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSLPCYVHSK  180



>ref|XP_004507671.1| PREDICTED: aspartic proteinase-like isoform X1 [Cicer arietinum]
 ref|XP_004507672.1| PREDICTED: aspartic proteinase-like isoform X2 [Cicer arietinum]
 ref|XP_004507673.1| PREDICTED: aspartic proteinase-like isoform X3 [Cicer arietinum]
Length=498

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 72/97 (74%), Gaps = 6/97 (6%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRGDPSADIIALKNYMNAQYFGDIG  442
            SNDGL RIGLKK KLDR N LA  I S +             DI+ALKNY++AQY+G+I 
Sbjct  26   SNDGLRRIGLKKIKLDRNNKLAAGIRSNK------LVETEETDIVALKNYLDAQYYGEIA  79

Query  443  IGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            IG+ PQKFTV+FDTGSSNLWVPS+KC  S+ACYFH+K
Sbjct  80   IGNSPQKFTVIFDTGSSNLWVPSSKCTFSVACYFHAK  116



>gb|KDP28021.1| hypothetical protein JCGZ_19101 [Jatropha curcas]
Length=501

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 8/107 (7%)
 Frame = +2

Query  254  FSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARNYRGD-------PSADIIALKNY  412
            F+VS+ GL++IGLKKR LD  +  A  I   +  Y R   GD       P AD++ LKNY
Sbjct  22   FTVSSKGLVKIGLKKRHLDLYSVQAAKITRADTPYDRG-SGDSDATLARPKADLVYLKNY  80

Query  413  MNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            ++ QY+G+IGIG+PPQ F VVFDTGSSNLW+PS+KC  SIACYFHSK
Sbjct  81   LDTQYYGEIGIGTPPQSFAVVFDTGSSNLWIPSSKCVFSIACYFHSK  127



>sp|Q9XFX3.1|CARDA_CYNCA RecName: Full=Procardosin-A; Contains: RecName: Full=Cardosin-A 
intermediate form 35 kDa subunit; Contains: RecName: Full=Cardosin-A 
heavy chain; AltName: Full=Cardosin-A 31 kDa subunit; 
Contains: RecName: Full=Cardosin-A intermediate form 30 
kDa subunit; Contains: RecName: Full=Cardosin-A light chain; 
AltName: Full=Cardosin-A 15 kDa subunit; Flags: Precursor 
[Cynara cardunculus]
 emb|CAB40134.1| preprocardosin A [Cynara cardunculus]
Length=504

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 92/126 (73%), Gaps = 5/126 (4%)
 Frame = +2

Query  188  MGTQlrtslmalllflllSPTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYARN  367
            MGT ++ +++AL LF LLSPTVFSVS+DGLIRIGLKKRK+DRI+ L       EG   ++
Sbjct  1    MGTSIKANVLALFLFYLLSPTVFSVSDDGLIRIGLKKRKVDRIDQLRGRRALMEGNARKD  60

Query  368  Y--RG---DPSADIIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSI  532
            +  RG   D  + ++AL N  +  YFG+IGIG+PPQKFTV+FDTGSS LWVPS+KC  S 
Sbjct  61   FGFRGTVRDSGSAVVALTNDRDTSYFGEIGIGTPPQKFTVIFDTGSSVLWVPSSKCINSK  120

Query  533  ACYFHS  550
            AC  HS
Sbjct  121  ACRAHS  126



>ref|XP_010649704.1| PREDICTED: aspartic proteinase [Vitis vinifera]
 ref|XP_010649705.1| PREDICTED: aspartic proteinase [Vitis vinifera]
 emb|CBI26025.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 76/104 (73%), Gaps = 10/104 (10%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR-------NYRGDPSADIIALKNYMNA  421
            S+DGL+RIGLKK+ LD     A  I    G +A+       NY   P A+ + LKNYM+A
Sbjct  25   SSDGLVRIGLKKKPLDLARLHAARITRGNGFHAQGLGKVDDNY---PKANTVYLKNYMDA  81

Query  422  QYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            QY+G+IGIGSPPQ F+VVFDTGSSNLWVPS+KCY SIACYFH++
Sbjct  82   QYYGEIGIGSPPQTFSVVFDTGSSNLWVPSSKCYFSIACYFHAR  125



>ref|XP_010926196.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
Length=518

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 75/113 (66%), Gaps = 14/113 (12%)
 Frame = +2

Query  254  FSVSNDGLIRIGLKKRKLDRINHLAESIGSKE---GRYARNY-----------RGDPSAD  391
            F VS DG++RI LKKR LD  + LA  +  +E      AR Y                 D
Sbjct  23   FPVSADGVVRIRLKKRALDPNSRLAARLADREEGTALAARKYGYFEPGPVGPVGPGKEGD  82

Query  392  IIALKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHS  550
            +IA KNYMNA+YFG+IG+GSPPQ FTV+FDTGSSN WVPS+KCY+S+ACYFHS
Sbjct  83   VIARKNYMNARYFGEIGLGSPPQNFTVIFDTGSSNFWVPSSKCYISVACYFHS  135



>ref|XP_006301275.1| hypothetical protein CARUB_v10021675mg [Capsella rubella]
 gb|EOA34173.1| hypothetical protein CARUB_v10021675mg [Capsella rubella]
Length=514

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 76/106 (72%), Gaps = 9/106 (8%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLDRINHLAESIGSKEGR--------YARNYRGDP-SADIIALKNYM  415
            ++DG  R+ LKK KLD  N LA   GS + +        Y+ N  GD    DI+ALKNY+
Sbjct  27   NDDGTFRVSLKKLKLDPHNRLAARFGSNQEKALKSSLRSYSNNLGGDSGDTDIVALKNYL  86

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            +AQY+G+I IG+PPQKFTV+FDTGSSNLWVPS KC+ S++C+FH+K
Sbjct  87   DAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFFSLSCFFHAK  132



>gb|KHN03495.1| Aspartic proteinase [Glycine soja]
Length=510

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 75/110 (68%), Gaps = 10/110 (9%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIA  400
            V+   N GL RIGLKK KLD  N LA  +GSK+    R          N+ G    DI+A
Sbjct  22   VYCAPNAGLRRIGLKKIKLDPKNRLAARVGSKDVDSFRASIRKFHLQNNFGGTEETDIVA  81

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHS  550
            LKNY++AQY+G+I IG+ PQKF V+FDTGSSNLWVPS+KC  S+ACYFH+
Sbjct  82   LKNYLDAQYYGEIAIGTSPQKFAVIFDTGSSNLWVPSSKCTFSVACYFHA  131



>ref|NP_001237064.1| aspartic proteinase 1 precursor [Glycine max]
 dbj|BAB62890.1| aspartic proteinase 1 [Glycine max]
Length=514

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 75/110 (68%), Gaps = 10/110 (9%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIA  400
            V+   N GL RIGLKK KLD  N LA  +GSK+    R          N+ G    DI+A
Sbjct  22   VYCAPNAGLRRIGLKKIKLDPKNRLAARVGSKDVDSFRASIRQFHLQNNFGGTEETDIVA  81

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHS  550
            LKNY++AQY+G+I IG+ PQKF V+FDTGSSNLWVPS+KC  S+ACYFH+
Sbjct  82   LKNYLDAQYYGEIAIGTSPQKFAVIFDTGSSNLWVPSSKCTFSVACYFHA  131



>gb|ABI78942.1| aspartic protease [Ipomoea batatas]
Length=508

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 5/104 (5%)
 Frame = +2

Query  248  TVFSVSNDGLIRIGLKKRKLDRINHL----AESIGSKEGRYARNYRGDPSADIIALKNYM  415
            +V   S++ L+R+GLKK  LD  N +    A  +  K G+ A N  GD    I++LKNY+
Sbjct  18   SVLPASSEKLLRVGLKKNPLD-FNSIKAAKAARVQGKCGKGANNKLGDSDTGIVSLKNYL  76

Query  416  NAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFH  547
            +AQY+G+I IGSPPQKFTV+FDTGSSNLWVPS+KCY SIACYFH
Sbjct  77   DAQYYGEISIGSPPQKFTVIFDTGSSNLWVPSSKCYFSIACYFH  120



>gb|KHN33009.1| Aspartic proteinase [Glycine soja]
Length=504

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 78/110 (71%), Gaps = 11/110 (10%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYA-RNYR------GDPSADIIAL  403
            P VF   NDGL RIGLKK KLD      + +G KE R + R +       G    D++AL
Sbjct  17   PLVFCAPNDGLRRIGLKKVKLDT----DDVVGFKEFRSSIRKHHLQNILGGAEDTDVVAL  72

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            KNY++AQY+G+I IG+PPQKFTV+FDTGSSNLWVPS+KCY S+AC+ H++
Sbjct  73   KNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACFMHAR  122



>ref|XP_006600236.1| PREDICTED: aspartic proteinase 1 isoform X1 [Glycine max]
Length=514

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 75/110 (68%), Gaps = 10/110 (9%)
 Frame = +2

Query  251  VFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYAR----------NYRGDPSADIIA  400
            V+   N GL RIGLKK KLD  N LA  +GSK+    R          N+ G    DI+A
Sbjct  22   VYCAPNAGLRRIGLKKIKLDPKNRLAARVGSKDVDSFRASIRKFHLQNNFGGTEETDIVA  81

Query  401  LKNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHS  550
            LKNY++AQY+G+I IG+ PQKF V+FDTGSSNLWVPS+KC  S+ACYFH+
Sbjct  82   LKNYLDAQYYGEIAIGTSPQKFAVIFDTGSSNLWVPSSKCTFSVACYFHA  131



>ref|XP_003546159.1| PREDICTED: aspartic proteinase-like [Glycine max]
Length=507

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 78/110 (71%), Gaps = 11/110 (10%)
 Frame = +2

Query  245  PTVFSVSNDGLIRIGLKKRKLDRINHLAESIGSKEGRYA-RNYR------GDPSADIIAL  403
            P VF   NDGL RIGLKK KLD      + +G KE R + R +       G    D++AL
Sbjct  20   PLVFCAPNDGLRRIGLKKVKLDT----DDVVGFKEFRSSIRKHHLQNILGGAEDTDVVAL  75

Query  404  KNYMNAQYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            KNY++AQY+G+I IG+PPQKFTV+FDTGSSNLWVPS+KCY S+AC+ H++
Sbjct  76   KNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACFMHAR  125



>gb|KDP23334.1| hypothetical protein JCGZ_23167 [Jatropha curcas]
Length=504

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 74/99 (75%), Gaps = 3/99 (3%)
 Frame = +2

Query  266  NDGLIRIGLKKRKLDRINHLAESIGSKEGRY---ARNYRGDPSADIIALKNYMNAQYFGD  436
            +DGL+RI LKKR+LD  +  A  I  +EG+    A N        I+ LKNY++AQY+G+
Sbjct  24   SDGLMRISLKKRRLDVDSIKAARIAREEGKSRIGANNMLRSSDIHIVPLKNYLDAQYYGE  83

Query  437  IGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            IGIGSPPQ FTV+FDTGSSNLW+PS+KCY S+ACYFHS+
Sbjct  84   IGIGSPPQNFTVIFDTGSSNLWIPSSKCYFSLACYFHSR  122



>ref|XP_010038033.1| PREDICTED: cyprosin-like [Eucalyptus grandis]
 gb|KCW49831.1| hypothetical protein EUGRSUZ_K03308 [Eucalyptus grandis]
Length=510

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 7/104 (7%)
 Frame = +2

Query  263  SNDGLIRIGLKKRKLD-------RINHLAESIGSKEGRYARNYRGDPSADIIALKNYMNA  421
            S++GL+RIGLKKR LD       RI+   +    ++  Y R  + D  A+II LKNY++ 
Sbjct  27   SSEGLLRIGLKKRTLDFDSVNAARISRAGDHYYLRKKGYTRRNQMDSKAEIIYLKNYLDT  86

Query  422  QYFGDIGIGSPPQKFTVVFDTGSSNLWVPSAKCYLSIACYFHSK  553
            QY+G+IGIG+PPQKF VVFDTGSSNLWVPS+KC LSI CYFHS+
Sbjct  87   QYYGEIGIGTPPQKFMVVFDTGSSNLWVPSSKCLLSINCYFHSR  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 585029837385