BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8477_g1_i1 len=1807 path=[5:0-406 412:407-1806]

Length=1807
                                                                      Score     E

ref|XP_009780884.1|  PREDICTED: serine/threonine-protein kinase W...    712   0.0      
ref|XP_009626865.1|  PREDICTED: serine/threonine-protein kinase W...    711   0.0      
ref|XP_004243199.1|  PREDICTED: serine/threonine-protein kinase W...    698   0.0      
ref|XP_006366774.1|  PREDICTED: protein kinase PVPK-1-like              690   0.0      
ref|XP_011098137.1|  PREDICTED: serine/threonine-protein kinase W...    674   0.0      
ref|XP_011082827.1|  PREDICTED: serine/threonine-protein kinase WAG1    656   0.0      
emb|CDP06119.1|  unnamed protein product                                631   0.0      
gb|EYU24316.1|  hypothetical protein MIMGU_mgv1a026318mg                587   0.0      
gb|EPS69615.1|  hypothetical protein M569_05148                         567   0.0      
ref|XP_004488713.1|  PREDICTED: protein kinase PINOID 2-like            568   0.0      
gb|EYU38216.1|  hypothetical protein MIMGU_mgv1a022694mg                561   0.0      
ref|XP_010062722.1|  PREDICTED: serine/threonine-protein kinase WAG1    549   0.0      
gb|KEH38373.1|  Serine/Threonine kinase family protein                  546   0.0      
gb|KCW69855.1|  hypothetical protein EUGRSUZ_F03194                     546   0.0      
emb|CAN80973.1|  hypothetical protein VITISV_043376                     544   0.0      Vitis vinifera
ref|XP_002263341.1|  PREDICTED: serine/threonine-protein kinase WAG1    543   0.0      Vitis vinifera
ref|XP_010694834.1|  PREDICTED: serine/threonine-protein kinase WAG1    542   0.0      
gb|AAB71418.1|  putative protein kinase                                 541   0.0      Pisum sativum [garden pea]
ref|XP_007149250.1|  hypothetical protein PHAVU_005G054400g             537   0.0      
ref|XP_010277519.1|  PREDICTED: serine/threonine-protein kinase W...    533   0.0      
ref|XP_006585434.1|  PREDICTED: protein kinase PINOID-like isofor...    531   0.0      
ref|XP_010254561.1|  PREDICTED: serine/threonine-protein kinase W...    526   8e-179   
ref|XP_006478013.1|  PREDICTED: protein kinase PVPK-1-like              524   3e-177   
ref|XP_003546779.1|  PREDICTED: protein kinase PINOID 2-like            523   3e-177   
ref|XP_011009070.1|  PREDICTED: serine/threonine-protein kinase W...    523   4e-177   
ref|XP_002317601.1|  cucumber protein kinase CsPK3                      523   5e-177   Populus trichocarpa [western balsam poplar]
emb|CDY30659.1|  BnaC06g10230D                                          523   6e-177   
ref|XP_009123447.1|  PREDICTED: serine/threonine-protein kinase WAG1    522   1e-176   
ref|XP_006442218.1|  hypothetical protein CICLE_v10019874mg             521   2e-176   
ref|XP_002300477.2|  cucumber protein kinase CsPK3                      520   3e-176   Populus trichocarpa [western balsam poplar]
ref|XP_010542344.1|  PREDICTED: serine/threonine-protein kinase W...    518   2e-175   
ref|XP_011030776.1|  PREDICTED: serine/threonine-protein kinase W...    517   1e-174   
ref|XP_006392761.1|  hypothetical protein EUTSA_v10011428mg             516   2e-174   
emb|CBI21826.3|  unnamed protein product                                513   9e-174   
ref|XP_008451816.1|  PREDICTED: serine/threonine-protein kinase WAG1    510   4e-172   
ref|XP_007022318.1|  Kinase superfamily protein                         508   3e-171   
ref|XP_010487236.1|  PREDICTED: serine/threonine-protein kinase WAG2    507   7e-171   
ref|XP_008390698.1|  PREDICTED: serine/threonine-protein kinase WAG1    507   9e-171   
ref|XP_006297552.1|  hypothetical protein CARUB_v10013575mg             506   2e-170   
gb|KFK38803.1|  hypothetical protein AALP_AA3G162000                    506   2e-170   
ref|NP_188054.1|  protein kinase WAG2                                   505   3e-170   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501866.1|  PREDICTED: serine/threonine-protein kinase W...    505   3e-170   
ref|NP_001267622.1|  protein kinase PINOID 2-like                       505   3e-170   
ref|XP_006407088.1|  hypothetical protein EUTSA_v10020629mg             504   1e-169   
ref|XP_002885040.1|  hypothetical protein ARALYDRAFT_897709             503   2e-169   
emb|CDX98447.1|  BnaC05g39280D                                          503   2e-169   
ref|XP_010501870.1|  PREDICTED: serine/threonine-protein kinase W...    503   3e-169   
ref|XP_002891767.1|  hypothetical protein ARALYDRAFT_892419             503   3e-169   
ref|XP_010479947.1|  PREDICTED: serine/threonine-protein kinase W...    502   8e-169   
gb|AAC78477.1|  protein kinase homolog                                  501   8e-169   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175774.1|  protein WAG1                                          501   9e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465329.1|  PREDICTED: serine/threonine-protein kinase W...    501   1e-168   
emb|CDX97569.1|  BnaA05g25100D                                          501   1e-168   
ref|XP_009146375.1|  PREDICTED: serine/threonine-protein kinase WAG2    499   5e-168   
ref|XP_010087152.1|  Protein kinase G11A                                498   3e-167   
ref|XP_009354815.1|  PREDICTED: serine/threonine-protein kinase W...    498   5e-167   
ref|XP_010462277.1|  PREDICTED: serine/threonine-protein kinase WAG1    496   1e-166   
ref|XP_008226274.1|  PREDICTED: serine/threonine-protein kinase W...    496   1e-166   
ref|XP_006303984.1|  hypothetical protein CARUB_v10008965mg             491   1e-164   
ref|XP_010552414.1|  PREDICTED: serine/threonine-protein kinase WAG1    490   4e-164   
ref|XP_004295704.1|  PREDICTED: protein kinase G11A-like                485   3e-162   
ref|XP_007211844.1|  hypothetical protein PRUPE_ppa004688mg             484   6e-162   
ref|XP_010501029.1|  PREDICTED: serine/threonine-protein kinase W...    478   1e-159   
gb|KFK35703.1|  hypothetical protein AALP_AA4G026000                    455   4e-151   
ref|XP_004161568.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    400   5e-131   
ref|XP_010919072.1|  PREDICTED: serine/threonine-protein kinase W...    390   4e-125   
ref|XP_009398976.1|  PREDICTED: serine/threonine-protein kinase W...    379   9e-121   
ref|XP_009399480.1|  PREDICTED: serine/threonine-protein kinase W...    369   5e-117   
ref|XP_009396991.1|  PREDICTED: serine/threonine-protein kinase W...    367   2e-116   
ref|XP_006852916.1|  hypothetical protein AMTR_s00033p00229200          356   2e-112   
ref|XP_003558331.2|  PREDICTED: serine/threonine-protein kinase W...    357   9e-112   
ref|XP_010275916.1|  PREDICTED: protein kinase PINOID-like              352   4e-111   
gb|EAY89286.1|  hypothetical protein OsI_10787                          352   2e-110   Oryza sativa Indica Group [Indian rice]
ref|NP_001049578.2|  Os03g0253200                                       352   3e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010254342.1|  PREDICTED: protein kinase PINOID 2-like            350   8e-110   
ref|XP_004984986.1|  PREDICTED: protein kinase PINOID 2-like            350   2e-109   
ref|XP_010250008.1|  PREDICTED: protein kinase PINOID 2-like            348   3e-109   
ref|XP_008653608.1|  PREDICTED: serine/threonine-protein kinase W...    350   3e-109   
ref|XP_002468168.1|  hypothetical protein SORBIDRAFT_01g040890          349   5e-109   Sorghum bicolor [broomcorn]
dbj|BAJ96762.1|  predicted protein                                      349   5e-109   
ref|XP_009381125.1|  PREDICTED: protein kinase PINOID 2-like            347   7e-109   
ref|XP_010914915.1|  PREDICTED: protein kinase PINOID 2                 346   9e-109   
ref|XP_007013364.1|  AGC                                                345   6e-108   
ref|XP_007138317.1|  hypothetical protein PHAVU_009G198500g             344   8e-108   
ref|XP_009772702.1|  PREDICTED: protein kinase PINOID 2                 344   2e-107   
ref|XP_006364909.1|  PREDICTED: protein kinase PINOID 2-like            343   2e-107   
ref|XP_009588319.1|  PREDICTED: protein kinase PINOID 2                 344   2e-107   
gb|KHG12432.1|  Protein kinase PINOID 2 -like protein                   341   2e-106   
ref|XP_007154974.1|  hypothetical protein PHAVU_003G162100g             341   2e-106   
ref|XP_002285044.1|  PREDICTED: protein kinase PINOID 2                 341   2e-106   Vitis vinifera
ref|XP_004251575.1|  PREDICTED: protein kinase PINOID 2                 340   3e-106   
ref|XP_003524535.2|  PREDICTED: protein kinase PINOID 2-like            340   4e-106   
emb|CDM81915.1|  unnamed protein product                                340   8e-106   
ref|XP_002274153.1|  PREDICTED: protein kinase PINOID                   338   1e-105   Vitis vinifera
ref|XP_010244530.1|  PREDICTED: protein kinase PINOID-like              338   1e-105   
ref|XP_008792077.1|  PREDICTED: protein kinase PINOID 2-like            337   3e-105   
ref|XP_009408965.1|  PREDICTED: protein kinase PINOID 2-like            338   5e-105   
ref|XP_008785082.1|  PREDICTED: protein kinase PINOID 2-like            336   8e-105   
emb|CDP10371.1|  unnamed protein product                                336   2e-104   
ref|XP_002322241.2|  hypothetical protein POPTR_0015s10550g             335   3e-104   Populus trichocarpa [western balsam poplar]
ref|XP_010687020.1|  PREDICTED: protein kinase PINOID                   335   3e-104   
gb|KHN27411.1|  Protein kinase PINOID 2                                 334   4e-104   
ref|XP_007041112.1|  Kinase superfamily protein isoform 1               332   2e-103   
ref|XP_006842816.1|  hypothetical protein AMTR_s00081p00063880          332   2e-103   
ref|XP_011024047.1|  PREDICTED: protein kinase PINOID 2                 333   4e-103   
gb|ABU68435.1|  putative serine/threonine protein kinase                332   6e-103   Populus tomentosa [Chinese white poplar]
ref|XP_001764163.1|  predicted protein                                  330   7e-103   
ref|XP_003549773.1|  PREDICTED: protein kinase PINOID 2-like            332   7e-103   
ref|XP_006450984.1|  hypothetical protein CICLE_v10008122mg             332   7e-103   
ref|XP_004485993.1|  PREDICTED: protein kinase PINOID-like              331   8e-103   
gb|EMS53056.1|  Protein kinase G11A                                     335   9e-103   
ref|XP_008242730.1|  PREDICTED: protein kinase PINOID 2                 331   2e-102   
ref|XP_004287358.1|  PREDICTED: protein kinase PINOID 2-like            332   2e-102   
gb|EYU43241.1|  hypothetical protein MIMGU_mgv1a006813mg                328   3e-102   
gb|KDP32368.1|  hypothetical protein JCGZ_13293                         330   3e-102   
ref|XP_006836303.1|  hypothetical protein AMTR_s00092p00027310          328   4e-102   
ref|XP_011096652.1|  PREDICTED: protein kinase PINOID                   328   4e-102   
gb|EPS60744.1|  hypothetical protein M569_14057                         329   5e-102   
ref|XP_007201967.1|  hypothetical protein PRUPE_ppa004745mg             330   5e-102   
ref|XP_009621538.1|  PREDICTED: protein kinase PINOID                   328   9e-102   
ref|XP_006346118.1|  PREDICTED: protein kinase G11A-like isoform X1     333   9e-102   
ref|XP_009407829.1|  PREDICTED: serine/threonine-protein kinase D...    335   1e-101   
ref|XP_010241157.1|  PREDICTED: serine/threonine-protein kinase D...    333   1e-101   
ref|XP_004244035.1|  PREDICTED: serine/threonine-protein kinase D...    332   1e-101   
gb|AAS57526.1|  serine/threonine protein kinase                         327   2e-101   Pisum sativum [garden pea]
ref|XP_009606402.1|  PREDICTED: serine/threonine-protein kinase D...    332   2e-101   
ref|XP_009368813.1|  PREDICTED: protein kinase PINOID 2                 328   3e-101   
ref|XP_010919725.1|  PREDICTED: serine/threonine-protein kinase D...    334   3e-101   
ref|XP_011085221.1|  PREDICTED: protein kinase PINOID-like              326   3e-101   
ref|NP_001053471.1|  Os04g0546300                                       334   3e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006431047.1|  hypothetical protein CICLE_v10011523mg             328   3e-101   
ref|XP_009774023.1|  PREDICTED: serine/threonine-protein kinase D...    331   3e-101   
emb|CAH67259.1|  OSIGBa0101C23.11                                       333   4e-101   Oryza sativa [red rice]
ref|XP_003593887.1|  Protein kinase G11A                                326   5e-101   
ref|XP_004248326.1|  PREDICTED: serine/threonine-protein kinase D...    331   5e-101   
emb|CDY30488.1|  BnaA04g25890D                                          331   5e-101   
ref|XP_006352558.1|  PREDICTED: protein kinase G11A-like isoform X1     331   5e-101   
ref|XP_008337325.1|  PREDICTED: protein kinase PINOID 2-like            327   6e-101   
gb|KFK36364.1|  hypothetical protein AALP_AA4G113900                    325   7e-101   
ref|XP_002881348.1|  hypothetical protein ARALYDRAFT_321182             325   1e-100   
ref|XP_010933596.1|  PREDICTED: serine/threonine-protein kinase D...    333   1e-100   
dbj|BAJ98113.1|  predicted protein                                      326   1e-100   
gb|KCW55957.1|  hypothetical protein EUGRSUZ_I01739                     327   2e-100   
ref|XP_006652602.1|  PREDICTED: protein kinase G11A-like                332   2e-100   
ref|XP_008656317.1|  PREDICTED: protein kinase G11A-like                327   2e-100   
ref|XP_009401494.1|  PREDICTED: serine/threonine-protein kinase D...    330   2e-100   
ref|XP_002266700.1|  PREDICTED: serine/threonine-protein kinase D...    330   2e-100   Vitis vinifera
ref|XP_004134809.1|  PREDICTED: protein kinase G11A-like                330   2e-100   
ref|NP_181012.1|  protein serine/threonine kinase PINOID                324   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010057774.1|  PREDICTED: serine/threonine-protein kinase D...    330   2e-100   
ref|XP_010504934.1|  PREDICTED: protein kinase PINOID                   324   3e-100   
emb|CDY23458.1|  BnaC04g49860D                                          330   3e-100   
ref|XP_009790589.1|  PREDICTED: serine/threonine-protein kinase D...    328   3e-100   
gb|KDO72425.1|  hypothetical protein CISIN_1g010603mg                   326   3e-100   
ref|XP_007211600.1|  hypothetical protein PRUPE_ppa005458mg             324   4e-100   
gb|EPS68752.1|  hypothetical protein M569_06017                         322   4e-100   
gb|KDP34968.1|  hypothetical protein JCGZ_09256                         324   4e-100   
ref|XP_010923729.1|  PREDICTED: protein kinase PINOID-like              323   4e-100   
ref|XP_010049971.1|  PREDICTED: protein kinase PINOID 2                 326   4e-100   
ref|XP_009759284.1|  PREDICTED: protein kinase PINOID                   323   4e-100   
ref|XP_006294230.1|  hypothetical protein CARUB_v10023227mg             323   7e-100   
ref|XP_006283574.1|  hypothetical protein CARUB_v10004626mg             325   7e-100   
gb|AAA33905.1|  G11A protein                                            325   9e-100   
ref|XP_008385824.1|  PREDICTED: protein kinase PINOID 2-like            324   9e-100   
gb|KHG17055.1|  Protein kinase PINOID -like protein                     322   1e-99    
emb|CDY43662.1|  BnaA04g20290D                                          322   1e-99    
ref|XP_010516616.1|  PREDICTED: protein kinase PINOID-like              322   1e-99    
gb|KHG10317.1|  hypothetical protein F383_15240                         326   1e-99    
ref|XP_008225548.1|  PREDICTED: protein kinase PINOID                   323   1e-99    
ref|XP_002983674.1|  hypothetical protein SELMODRAFT_234346             324   1e-99    
ref|XP_002990535.1|  hypothetical protein SELMODRAFT_185313             324   1e-99    
emb|CDX84294.1|  BnaC04g10560D                                          322   2e-99    
ref|XP_008224641.1|  PREDICTED: protein kinase G11A                     327   2e-99    
ref|XP_010029109.1|  PREDICTED: serine/threonine-protein kinase D...    327   2e-99    
gb|KHF99558.1|  Protein kinase PINOID -like protein                     322   2e-99    
ref|XP_007214796.1|  hypothetical protein PRUPE_ppa002965mg             327   2e-99    
ref|XP_004508525.1|  PREDICTED: protein kinase PINOID 2-like            323   2e-99    
ref|XP_006482514.1|  PREDICTED: protein kinase PVPK-1-like              324   2e-99    
ref|XP_008794475.1|  PREDICTED: protein kinase PINOID-like              322   2e-99    
ref|XP_010448241.1|  PREDICTED: serine/threonine-protein kinase D...    323   2e-99    
ref|XP_009374840.1|  PREDICTED: serine/threonine-protein kinase D...    327   2e-99    
ref|XP_008384194.1|  PREDICTED: protein kinase G11A                     327   2e-99    
ref|XP_010433468.1|  PREDICTED: serine/threonine-protein kinase D...    323   2e-99    
ref|XP_001777627.1|  predicted protein                                  321   2e-99    
ref|XP_009388967.1|  PREDICTED: protein kinase PINOID-like              321   2e-99    
ref|XP_003563941.1|  PREDICTED: protein kinase G11A-like                325   3e-99    
ref|XP_010438725.1|  PREDICTED: serine/threonine-protein kinase D...    323   3e-99    
ref|XP_004304710.1|  PREDICTED: protein kinase PINOID-like              322   3e-99    
ref|XP_007147579.1|  hypothetical protein PHAVU_006G136500g             327   3e-99    
ref|XP_009141394.1|  PREDICTED: protein kinase PINOID                   321   3e-99    
emb|CDP20597.1|  unnamed protein product                                323   3e-99    
gb|KHN27762.1|  Protein kinase G11A                                     315   3e-99    
ref|XP_010509727.1|  PREDICTED: protein kinase PINOID-like              321   3e-99    
ref|XP_003609262.1|  Protein kinase G11A                                323   3e-99    
emb|CBI34999.3|  unnamed protein product                                323   4e-99    
ref|XP_002869601.1|  hypothetical protein ARALYDRAFT_492147             323   4e-99    
ref|XP_010252801.1|  PREDICTED: serine/threonine-protein kinase D...    326   4e-99    
gb|EMT31913.1|  Protein kinase G11A                                     325   4e-99    
gb|EMS45607.1|  Protein kinase G11A                                     324   5e-99    
ref|XP_009796083.1|  PREDICTED: serine/threonine-protein kinase D...    328   5e-99    
ref|XP_010092339.1|  Protein kinase G11A                                325   5e-99    
ref|XP_008383433.1|  PREDICTED: protein kinase PINOID                   321   5e-99    
ref|XP_004236648.1|  PREDICTED: serine/threonine-protein kinase D...    326   5e-99    
ref|XP_002307848.1|  CsPK1.1 family protein                             322   5e-99    Populus trichocarpa [western balsam poplar]
dbj|BAK06792.1|  predicted protein                                      325   5e-99    
ref|XP_007159618.1|  hypothetical protein PHAVU_002G252500g             322   5e-99    
ref|XP_004293409.1|  PREDICTED: protein kinase G11A-like                326   5e-99    
ref|XP_006413161.1|  hypothetical protein EUTSA_v10024951mg             323   5e-99    
emb|CDP05644.1|  unnamed protein product                                321   6e-99    
ref|XP_007026392.1|  D6 protein kinase like 2                           326   6e-99    
emb|CBI16666.3|  unnamed protein product                                326   6e-99    
ref|XP_003577034.1|  PREDICTED: serine/threonine-protein kinase D...    324   7e-99    
ref|XP_010088105.1|  Protein kinase PINOID                              322   8e-99    
ref|XP_006350249.1|  PREDICTED: protein kinase G11A-like                325   8e-99    
emb|CBI34860.3|  unnamed protein product                                323   9e-99    
ref|XP_009143752.1|  PREDICTED: protein kinase PINOID                   320   1e-98    
ref|XP_009399199.1|  PREDICTED: serine/threonine-protein kinase D...    325   1e-98    
emb|CDX74691.1|  BnaA05g04370D                                          323   1e-98    
ref|XP_009377468.1|  PREDICTED: protein kinase PINOID-like              320   1e-98    
ref|XP_004504155.1|  PREDICTED: protein kinase PINOID-like              320   2e-98    
ref|XP_006380864.1|  hypothetical protein POPTR_0006s00570g             325   2e-98    
ref|NP_001151806.1|  LOC100285441                                       327   2e-98    Zea mays [maize]
ref|XP_009625904.1|  PREDICTED: serine/threonine-protein kinase D...    324   2e-98    
ref|XP_009399531.1|  PREDICTED: serine/threonine-protein kinase D...    324   2e-98    
ref|XP_002530422.1|  serine/threonine protein kinase, putative          324   2e-98    Ricinus communis
ref|XP_008358790.1|  PREDICTED: protein kinase G11A-like                324   2e-98    
emb|CDP13698.1|  unnamed protein product                                324   2e-98    
ref|XP_007133463.1|  hypothetical protein PHAVU_011G1806000g            320   2e-98    
ref|XP_003594321.1|  Protein kinase                                     324   2e-98    
ref|XP_001781978.1|  predicted protein                                  318   3e-98    
ref|NP_194391.1|  D6 protein kinase like 1                              321   3e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004248529.1|  PREDICTED: serine/threonine-protein kinase D...    326   3e-98    
ref|NP_001148103.1|  LOC100281711                                       323   3e-98    Zea mays [maize]
ref|NP_001288816.1|  protein kinase PINOID                              318   3e-98    
ref|XP_008677207.1|  PREDICTED: LOC100281711 isoform X1                 323   3e-98    
ref|XP_008784831.1|  PREDICTED: protein kinase PINOID                   318   3e-98    
ref|XP_010091920.1|  Protein kinase G11A                                319   3e-98    
gb|EYU27452.1|  hypothetical protein MIMGU_mgv1a003783mg                322   4e-98    
dbj|BAF02156.1|  putative protein kinase                                320   4e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003634855.1|  PREDICTED: serine/threonine-protein kinase D...    324   4e-98    
ref|XP_004486363.1|  PREDICTED: protein kinase G11A-like isoform X1     323   4e-98    
ref|XP_002526605.1|  serine/threonine protein kinase, putative          319   4e-98    Ricinus communis
emb|CDY17273.1|  BnaA05g09150D                                          318   5e-98    
ref|XP_008778034.1|  PREDICTED: protein kinase G11A-like                323   5e-98    
dbj|BAK01764.1|  predicted protein                                      322   5e-98    
ref|XP_009386043.1|  PREDICTED: serine/threonine-protein kinase D...    325   8e-98    
ref|XP_008346147.1|  PREDICTED: protein kinase PINOID-like              318   8e-98    
ref|XP_007020448.1|  D6 protein kinase like 2 isoform 1                 322   8e-98    
ref|XP_009362264.1|  PREDICTED: protein kinase PINOID-like              318   1e-97    
ref|XP_007147932.1|  hypothetical protein PHAVU_006G166800g             317   1e-97    
ref|XP_004139320.1|  PREDICTED: protein kinase PINOID 2-like            319   1e-97    
ref|XP_009625903.1|  PREDICTED: serine/threonine-protein kinase D...    323   1e-97    
ref|XP_009396070.1|  PREDICTED: serine/threonine-protein kinase D...    322   2e-97    
emb|CDY56474.1|  BnaC04g53280D                                          320   2e-97    
ref|NP_001067268.1|  Os12g0614600                                       318   2e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002272711.2|  PREDICTED: protein kinase PVPK-1                   323   2e-97    Vitis vinifera
gb|KHN14413.1|  Protein kinase G11A                                     321   2e-97    
ref|XP_009143076.1|  PREDICTED: protein kinase G11A                     324   3e-97    
ref|XP_006410613.1|  hypothetical protein EUTSA_v10016667mg             316   3e-97    
ref|XP_003542945.2|  PREDICTED: protein kinase PINOID-like              316   3e-97    
ref|XP_006842736.1|  hypothetical protein AMTR_s00133p00046270          318   3e-97    
gb|EYU27604.1|  hypothetical protein MIMGU_mgv1a006055mg                316   3e-97    
ref|XP_006378619.1|  hypothetical protein POPTR_0010s18350g             317   3e-97    
ref|XP_010549538.1|  PREDICTED: protein kinase PINOID                   316   4e-97    
ref|XP_008797752.1|  PREDICTED: protein kinase G11A-like                321   4e-97    
ref|XP_003534979.1|  PREDICTED: protein kinase G11A-like isoform X1     320   5e-97    
ref|XP_009387224.1|  PREDICTED: serine/threonine-protein kinase D...    319   5e-97    
gb|KHN40778.1|  Protein kinase G11A                                     320   6e-97    
ref|XP_009398322.1|  PREDICTED: protein kinase PINOID-like              315   7e-97    
gb|KDO75345.1|  hypothetical protein CISIN_1g013016mg                   315   7e-97    
ref|XP_009389885.1|  PREDICTED: serine/threonine-protein kinase D...    323   8e-97    
ref|XP_006468268.1|  PREDICTED: protein kinase PINOID-like              315   9e-97    
ref|XP_010692051.1|  PREDICTED: serine/threonine-protein kinase D...    322   1e-96    
emb|CBI17061.3|  unnamed protein product                                322   1e-96    
ref|XP_010910155.1|  PREDICTED: protein kinase PINOID-like              314   1e-96    
gb|AIN44212.1|  PID                                                     315   1e-96    
ref|XP_004963480.1|  PREDICTED: protein kinase G11A-like                318   2e-96    
ref|XP_011095569.1|  PREDICTED: serine/threonine-protein kinase D...    318   2e-96    
gb|EYU27648.1|  hypothetical protein MIMGU_mgv1a003809mg                317   2e-96    
ref|XP_004953750.1|  PREDICTED: protein kinase G11A-like                317   3e-96    
ref|XP_008440970.1|  PREDICTED: protein kinase G11A                     318   4e-96    
gb|KDP39299.1|  hypothetical protein JCGZ_01056                         318   4e-96    
ref|XP_003630022.1|  Protein kinase G11A                                313   4e-96    
ref|XP_002455093.1|  hypothetical protein SORBIDRAFT_03g004240          315   4e-96    
ref|XP_010909306.1|  PREDICTED: serine/threonine-protein kinase D...    318   4e-96    
ref|XP_002884920.1|  hypothetical protein ARALYDRAFT_478629             317   6e-96    
ref|XP_010915930.1|  PREDICTED: serine/threonine-protein kinase R...    317   6e-96    
gb|EYU33716.1|  hypothetical protein MIMGU_mgv1a004341mg                315   7e-96    
gb|AAA33509.1|  protein kinase                                          311   1e-95    
gb|ACG25344.1|  protein kinase G11A                                     316   1e-95    
ref|XP_008669972.1|  PREDICTED: protein kinase G11A                     316   1e-95    
ref|XP_008444803.1|  PREDICTED: protein kinase PINOID                   313   1e-95    
ref|NP_001169635.1|  uncharacterized LOC100383516                       322   1e-95    
ref|NP_001141794.1|  LOC100273930                                       313   1e-95    
ref|XP_002457063.1|  hypothetical protein SORBIDRAFT_03g000680          314   2e-95    
ref|NP_187875.1|  putative serine/threonine kinase                      315   2e-95    
ref|XP_003578294.1|  PREDICTED: serine/threonine-protein kinase D...    316   2e-95    
ref|XP_008673478.1|  PREDICTED: protein kinase G11A-like isoform X2     313   2e-95    
emb|CBI23515.3|  unnamed protein product                                306   2e-95    
ref|XP_002276011.1|  PREDICTED: serine/threonine-protein kinase D6PK    314   3e-95    
ref|XP_006660743.1|  PREDICTED: protein kinase G11A-like isoform X1     315   3e-95    
ref|XP_004135537.1|  PREDICTED: protein kinase PINOID-like              311   3e-95    
ref|XP_006407305.1|  hypothetical protein EUTSA_v10020378mg             315   4e-95    
ref|XP_006299067.1|  hypothetical protein CARUB_v10015207mg             315   4e-95    
ref|XP_006448958.1|  hypothetical protein CICLE_v10015211mg             310   5e-95    
ref|XP_010499345.1|  PREDICTED: serine/threonine-protein kinase D...    314   5e-95    
ref|XP_009410301.1|  PREDICTED: serine/threonine-protein kinase D...    315   5e-95    
ref|XP_010486995.1|  PREDICTED: serine/threonine-protein kinase D...    314   5e-95    
ref|XP_010092445.1|  Protein kinase G11A                                312   6e-95    
ref|XP_004968386.1|  PREDICTED: protein kinase PINOID 2-like            313   6e-95    
ref|XP_010465047.1|  PREDICTED: serine/threonine-protein kinase D...    314   8e-95    
ref|XP_008673477.1|  PREDICTED: protein kinase G11A-like isoform X1     312   8e-95    
ref|XP_008464303.1|  PREDICTED: protein kinase G11A-like                314   1e-94    
ref|NP_001062700.1|  Os09g0258500                                       313   1e-94    
gb|EAZ08333.1|  hypothetical protein OsI_30587                          313   1e-94    
ref|XP_002968124.1|  hypothetical protein SELMODRAFT_89681              308   1e-94    
ref|XP_004956362.1|  PREDICTED: protein kinase G11A-like                313   1e-94    
ref|XP_004173166.1|  PREDICTED: protein kinase G11A-like                314   2e-94    
gb|EYU34122.1|  hypothetical protein MIMGU_mgv1a024729mg                311   2e-94    
ref|XP_004139518.1|  PREDICTED: protein kinase G11A-like                314   2e-94    
ref|XP_006578441.1|  PREDICTED: protein kinase PINOID 2-like            310   2e-94    
ref|XP_006416818.1|  hypothetical protein EUTSA_v10007415mg             310   2e-94    
ref|XP_006660470.1|  PREDICTED: protein kinase G11A-like                312   3e-94    
ref|XP_002970360.1|  hypothetical protein SELMODRAFT_93137              308   3e-94    
ref|NP_001066769.2|  Os12g0480200                                       306   4e-94    
ref|XP_008341516.1|  PREDICTED: protein kinase PVPK-1                   310   4e-94    
ref|XP_004251960.1|  PREDICTED: serine/threonine-protein kinase D...    308   6e-94    
gb|EPS64845.1|  hypothetical protein M569_09933                         307   7e-94    
emb|CBI28164.3|  unnamed protein product                                305   1e-93    
ref|XP_001770948.1|  predicted protein                                  306   2e-93    
ref|XP_002974209.1|  hypothetical protein SELMODRAFT_11420              305   2e-93    
ref|XP_009120387.1|  PREDICTED: serine/threonine-protein kinase D...    310   2e-93    
ref|XP_008783022.1|  PREDICTED: protein kinase G11A                     311   2e-93    
emb|CDY50542.1|  BnaA01g30380D                                          309   5e-93    
gb|ABA98253.1|  protein kinase, putative, expressed                     314   8e-93    
ref|XP_009395513.1|  PREDICTED: serine/threonine-protein kinase D...    309   1e-92    
emb|CBI24125.3|  unnamed protein product                                302   1e-92    
ref|XP_006664018.1|  PREDICTED: serine/threonine-protein kinase K...    313   1e-92    
gb|EAY83106.1|  hypothetical protein OsI_38323                          313   1e-92    
ref|XP_010532023.1|  PREDICTED: serine/threonine-protein kinase D6PK    307   1e-92    
ref|XP_010669642.1|  PREDICTED: serine/threonine-protein kinase A...    306   3e-92    
gb|EYU38626.1|  hypothetical protein MIMGU_mgv1a001339mg                312   1e-91    
ref|XP_010669641.1|  PREDICTED: serine/threonine-protein kinase R...    305   1e-91    
ref|XP_004963218.1|  PREDICTED: protein kinase PINOID-like              301   4e-91    
ref|XP_009408545.1|  PREDICTED: protein kinase PINOID-like              299   1e-90    
dbj|BAJ87219.1|  predicted protein                                      299   2e-90    
ref|NP_001050749.1|  Os03g0642200                                       298   6e-90    
dbj|BAJ92991.1|  predicted protein                                      298   1e-89    
ref|XP_002442538.1|  hypothetical protein SORBIDRAFT_08g021520          297   4e-89    
ref|XP_009334142.1|  PREDICTED: protein kinase PVPK-1-like              301   4e-89    
ref|XP_009399283.1|  PREDICTED: protein kinase PINOID                   294   7e-89    
gb|EEE53612.1|  hypothetical protein OsJ_36869                          303   7e-89    
ref|XP_010049690.1|  PREDICTED: protein kinase G11A-like                306   1e-88    
emb|CBI30273.3|  unnamed protein product                                300   3e-88    
gb|EYU19146.1|  hypothetical protein MIMGU_mgv1a007439mg                290   7e-88    
ref|XP_002466761.1|  hypothetical protein SORBIDRAFT_01g013640          292   1e-87    
gb|EPS64317.1|  hypothetical protein M569_10467                         291   1e-87    
ref|XP_006645554.1|  PREDICTED: protein kinase PINOID 2-like            290   3e-87    
gb|AHZ63905.1|  phototropin                                             301   4e-87    
gb|KDO44091.1|  hypothetical protein CISIN_1g042913mg                   285   7e-87    
ref|NP_001063472.1|  Os09g0478500                                       293   8e-87    
gb|EAZ45122.1|  hypothetical protein OsJ_29759                          292   1e-86    
gb|EAZ09496.1|  hypothetical protein OsI_31769                          292   1e-86    
gb|AHZ63906.1|  phototropin                                             299   2e-86    
ref|XP_003572082.1|  PREDICTED: serine/threonine-protein kinase D...    294   2e-86    
ref|XP_009387487.1|  PREDICTED: serine/threonine-protein kinase D...    292   3e-86    
ref|NP_001141985.1|  uncharacterized LOC100274135                       291   3e-86    
gb|AHZ63879.1|  phototropin                                             300   4e-86    
ref|XP_002439491.1|  hypothetical protein SORBIDRAFT_09g008030          290   5e-86    
tpg|DAA47511.1|  TPA: barren inflorescence2                             287   5e-86    
gb|EMT19817.1|  Protein kinase G11A                                     290   6e-86    
dbj|BAK01767.1|  predicted protein                                      290   9e-86    
ref|NP_001062116.1|  Os08g0491200                                       290   9e-86    
emb|CDX76251.1|  BnaA04g05150D                                          295   1e-85    
ref|NP_001106051.1|  barren inflorescence2                              287   2e-85    
emb|CBX25520.1|  hypothetical_protein                                   285   2e-85    
ref|XP_002445963.1|  hypothetical protein SORBIDRAFT_07g028750          290   2e-85    
ref|XP_004973774.1|  PREDICTED: protein kinase G11A-like isoform X1     289   3e-85    
emb|CBX25322.1|  hypothetical_protein                                   279   8e-85    
gb|AHZ63875.1|  phototropin                                             296   2e-84    
emb|CBX24471.1|  hypothetical_protein                                   280   2e-84    
gb|AHZ63918.1|  phototropin                                             292   5e-84    
ref|XP_006852313.1|  hypothetical protein AMTR_s00049p00198350          287   5e-83    
emb|CBI40246.3|  unnamed protein product                                274   6e-83    
gb|AHZ63898.1|  phototropin                                             291   1e-82    
gb|AHZ63920.1|  phototropin                                             287   2e-82    
gb|AHZ63857.1|  phototropin                                             289   2e-82    
ref|XP_010443529.1|  PREDICTED: phototropin-2-like                      288   3e-82    
emb|CDX88659.1|  BnaA03g09900D                                          288   3e-82    
ref|XP_010453258.1|  PREDICTED: phototropin-2-like                      287   6e-82    
ref|XP_010483373.1|  PREDICTED: phototropin-2 isoform X1                287   6e-82    
ref|XP_002514387.1|  serine/threonine protein kinase, putative          288   7e-82    
gb|AAA50304.1|  protein kinase                                          274   1e-81    
gb|AAB39188.1|  putative serine/threonine protein kinase                271   2e-81    
gb|AHZ63904.1|  phototropin                                             288   2e-81    
gb|KGN60664.1|  hypothetical protein Csa_2G006100                       274   3e-81    
emb|CDY58574.1|  BnaC03g12530D                                          285   3e-81    
ref|NP_851210.1|  phototropin 2                                         285   4e-81    
emb|CDY62690.1|  BnaA10g29230D                                          285   6e-81    
gb|KDP47050.1|  hypothetical protein JCGZ_10777                         284   7e-81    
ref|XP_004167957.1|  PREDICTED: LOW QUALITY PROTEIN: phototropin-...    281   7e-81    
ref|XP_009132076.1|  PREDICTED: phototropin-2-like isoform X1           284   7e-81    
dbj|BAE20159.1|  neochrome                                              288   8e-81    
ref|XP_004140063.1|  PREDICTED: phototropin-2-like                      284   8e-81    
ref|XP_006849852.1|  hypothetical protein AMTR_s00022p00051940          285   1e-80    
ref|XP_007043127.1|  Phototropin 2 isoform 2                            285   1e-80    
ref|XP_007043126.1|  Phototropin 2 isoform 1                            285   1e-80    
gb|AHZ63855.1|  phototropin                                             285   2e-80    
ref|XP_009132080.1|  PREDICTED: phototropin-2-like isoform X2           283   2e-80    
gb|AHZ63921.1|  phototropin                                             281   2e-80    
gb|AHZ63909.1|  phototropin                                             280   2e-80    
gb|AHZ63886.1|  phototropin                                             285   2e-80    
emb|CDY43878.1|  BnaC09g33650D                                          283   2e-80    
ref|XP_008448153.1|  PREDICTED: phototropin-2                           283   2e-80    
ref|XP_009120327.1|  PREDICTED: phototropin-2                           283   3e-80    
gb|KCW55711.1|  hypothetical protein EUGRSUZ_I01551                     278   3e-80    
ref|XP_003539746.1|  PREDICTED: phototropin-1-like isoform X1           283   3e-80    
ref|XP_002982959.1|  hypothetical protein SELMODRAFT_10296              281   3e-80    
ref|XP_010270626.1|  PREDICTED: phototropin-2                           283   4e-80    
gb|AHZ63894.1|  phototropin                                             280   4e-80    
gb|AHZ63922.1|  phototropin                                             281   4e-80    
ref|NP_851212.2|  phototropin 2                                         281   9e-80    
ref|XP_008463863.1|  PREDICTED: phototropin-1                           283   1e-79    
gb|AAX81328.1|  neochrome                                               285   1e-79    
gb|AHZ63911.1|  phototropin                                             280   1e-79    
emb|CBI17059.3|  unnamed protein product                                264   1e-79    
gb|KGN47332.1|  hypothetical protein Csa_6G301020                       282   1e-79    
gb|ABG21841.1|  Nonphototropic hypocotyl protein 1, putative, exp...    275   1e-79    
dbj|BAD89967.1|  phototropin                                            282   1e-79    
gb|AHZ63881.1|  phototropin                                             283   1e-79    
gb|AHZ63919.1|  phototropin                                             280   1e-79    
emb|CDP08961.1|  unnamed protein product                                282   1e-79    
ref|XP_010535562.1|  PREDICTED: phototropin-1                           282   2e-79    
gb|AHZ63897.1|  phototropin                                             283   2e-79    
dbj|BAM36550.1|  phototropin 2                                          281   2e-79    
ref|XP_004290098.1|  PREDICTED: phototropin-2-like                      281   2e-79    
gb|KFK33944.1|  hypothetical protein AALP_AA5G081900                    281   2e-79    
gb|AHZ63880.1|  phototropin                                             282   2e-79    
gb|AHZ63851.1|  phototropin                                             282   2e-79    
gb|KHG01262.1|  Phototropin-2 -like protein                             281   2e-79    
gb|AHZ63924.1|  phototropin                                             277   2e-79    
gb|AHZ63887.1|  phototropin                                             282   2e-79    
ref|XP_004148228.1|  PREDICTED: phototropin-1-like                      281   2e-79    
ref|XP_010238859.1|  PREDICTED: protein kinase PINOID-like              270   3e-79    
ref|XP_010112314.1|  hypothetical protein L484_011180                   281   3e-79    
gb|AHZ63935.1|  phototropin                                             283   3e-79    
gb|AHZ63903.1|  phototropin                                             281   3e-79    
gb|AHZ63916.1|  phototropin                                             278   4e-79    
ref|XP_007132147.1|  hypothetical protein PHAVU_011G070300g             280   4e-79    
ref|XP_002991589.1|  hypothetical protein SELMODRAFT_186203             280   4e-79    
ref|XP_009126786.1|  PREDICTED: phototropin-2-like isoform X1           280   4e-79    
gb|AHZ63856.1|  phototropin                                             281   4e-79    
ref|XP_001766409.1|  PHOTB1 phototropin B1 blue light photoreceptor     282   4e-79    
gb|KHN30224.1|  Phototropin-1                                           278   4e-79    
gb|AHZ63917.1|  phototropin                                             278   5e-79    
gb|AHZ63885.1|  phototropin                                             281   5e-79    
dbj|BAP28445.1|  phototropin                                            281   6e-79    
ref|XP_002965484.1|  hypothetical protein SELMODRAFT_230655             280   6e-79    
ref|XP_009358918.1|  PREDICTED: phototropin-2 isoform X2                279   7e-79    
ref|XP_009358915.1|  PREDICTED: phototropin-2 isoform X1                279   7e-79    
ref|XP_006401122.1|  hypothetical protein EUTSA_v10012609mg             279   7e-79    
ref|XP_006422369.1|  hypothetical protein CICLE_v10027745mg             280   7e-79    
gb|AHZ63901.1|  phototropin                                             272   7e-79    
gb|AHZ63858.1|  phototropin                                             280   8e-79    
gb|KHN33432.1|  Phototropin-1                                           277   8e-79    
ref|XP_002298559.1|  kinase family protein                              279   9e-79    
gb|AHZ63860.1|  phototropin                                             280   9e-79    
ref|XP_006422370.1|  hypothetical protein CICLE_v10027745mg             280   9e-79    
gb|AHZ63862.1|  phototropin                                             271   1e-78    
gb|KEH39402.1|  phototropin-2 protein                                   275   1e-78    
ref|XP_006292321.1|  hypothetical protein CARUB_v10018535mg             279   1e-78    
ref|XP_002971709.1|  hypothetical protein SELMODRAFT_172224             278   1e-78    
ref|XP_006653257.1|  PREDICTED: phototropin-2-like                      276   1e-78    
ref|XP_010028883.1|  PREDICTED: phototropin-2                           278   1e-78    
ref|XP_009415438.1|  PREDICTED: phototropin-2                           278   2e-78    
gb|EEC83791.1|  hypothetical protein OsI_29700                          271   2e-78    
emb|CDY32722.1|  BnaA02g07840D                                          278   2e-78    
ref|XP_010426006.1|  PREDICTED: phototropin-1                           279   2e-78    
ref|XP_008349724.1|  PREDICTED: phototropin-1-like                      274   2e-78    
ref|XP_001765408.1|  PHOTA3 phototropin photoreceptor                   280   2e-78    
gb|AHZ63884.1|  phototropin                                             280   2e-78    
gb|ACQ42250.1|  blue light photoreceptor                                272   2e-78    
gb|AHZ63861.1|  phototropin                                             278   2e-78    
ref|XP_006419006.1|  hypothetical protein EUTSA_v10002386mg             278   2e-78    
ref|XP_006347791.1|  PREDICTED: phototropin-2-like isoform X1           278   2e-78    
ref|XP_002864550.1|  hypothetical protein ARALYDRAFT_495918             277   2e-78    
gb|AHZ63849.1|  phototropin                                             279   2e-78    
gb|AHZ63899.1|  phototropin                                             276   3e-78    
gb|AHZ63843.1|  neochrome 2                                             281   3e-78    
ref|XP_008222543.1|  PREDICTED: LOW QUALITY PROTEIN: phototropin-1      278   3e-78    
ref|XP_010922472.1|  PREDICTED: phototropin-1A isoform X2               278   3e-78    
ref|XP_006424699.1|  hypothetical protein CICLE_v10027740mg             278   3e-78    
gb|KDO73046.1|  hypothetical protein CISIN_1g001847mg                   278   3e-78    
gb|AHZ63907.1|  phototropin                                             276   3e-78    
gb|KDO73048.1|  hypothetical protein CISIN_1g001847mg                   278   3e-78    
ref|XP_006488214.1|  PREDICTED: phototropin-1-like                      278   3e-78    
gb|KDO73044.1|  hypothetical protein CISIN_1g001847mg                   278   3e-78    
ref|XP_011005564.1|  PREDICTED: phototropin-1                           278   3e-78    
ref|XP_010514900.1|  PREDICTED: phototropin-1-like                      278   4e-78    
gb|KDO73043.1|  hypothetical protein CISIN_1g001847mg                   278   4e-78    



>ref|XP_009780884.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Nicotiana 
sylvestris]
Length=487

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/486 (81%), Positives = 429/486 (88%), Gaps = 11/486 (2%)
 Frame = -3

Query  1607  EDDILYPPDSDLDLSFTSCASITTT--DrtlsarsslarssltlSFNERLSATSTAGNPS  1434
             E D LYPPDSDLDLSFTSCASITTT  DRTLSARSSLARSSLTLSFN+RLS+TST  NPS
Sbjct  3     ELDTLYPPDSDLDLSFTSCASITTTTTDRTLSARSSLARSSLTLSFNDRLSSTSTTNNPS  62

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             + IPNLH RPHRKH  NWSAIKAA TLSSDGALHLRHLKLHRLVGSGNLGRVFLCRLRDY
Sbjct  63    TEIPNLHRRPHRKHDPNWSAIKAATTLSSDGALHLRHLKLHRLVGSGNLGRVFLCRLRDY  122

Query  1253  EHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
             +H++FALKVIDRDSLTAKKLSHVQTEAEILS LDHPFLPTLYAHLEVSHYTCLL+DFC N
Sbjct  123   DHANFALKVIDRDSLTAKKLSHVQTEAEILSSLDHPFLPTLYAHLEVSHYTCLLIDFCPN  182

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ GNRL V+SVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS
Sbjct  183   GDLHSLLRKQPGNRLPVESVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  242

Query  893   DFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTH  714
             DFDLCF++D+ P+L+  TR  L    R+     +R REETVTEFVAEPT AFSRSCVGTH
Sbjct  243   DFDLCFKSDVSPKLDFTTRT-LERSKRRYSCFSDRLREETVTEFVAEPTGAFSRSCVGTH  301

Query  713   EYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADD  534
             EYLAPELISG GHGNGVDWWAFGVL+YELL+GTTPFKGSSKESTLRNIAS++GV+F  ++
Sbjct  302   EYLAPELISGTGHGNGVDWWAFGVLLYELLYGTTPFKGSSKESTLRNIASSKGVKFNVEE  361

Query  533   GERETPA-MAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPR  357
              +   P+ M  AKDLIERLLVKDPR+RLGCA+GATDIKRHPFF GIKWPLIRTYRPPE R
Sbjct  362   SQGNEPSGMGEAKDLIERLLVKDPRRRLGCARGATDIKRHPFFAGIKWPLIRTYRPPEVR  421

Query  356   GLVLKRSKSK---AHVTGV---SSPRRRRCWWKRLGHLVRIKGSKHNLNFNHNYYCYAT-  198
             GL +KR+KSK   +HVTGV   SSPRR+ CWWKRLG+L+RIKGSK+NLN NHNYYCY   
Sbjct  422   GLSIKRTKSKLRVSHVTGVTSSSSPRRKCCWWKRLGYLMRIKGSKYNLNSNHNYYCYTNQ  481

Query  197   KISKIA  180
             K+ K A
Sbjct  482   KVRKCA  487



>ref|XP_009626865.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Nicotiana 
tomentosiformis]
Length=487

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/486 (81%), Positives = 428/486 (88%), Gaps = 11/486 (2%)
 Frame = -3

Query  1607  EDDILYPPDSDLDLSFTSCASITTT--DrtlsarsslarssltlSFNERLSATSTAGNPS  1434
             E D LYPPDSDLDLSFTSCASITTT  DRTLSARSSLARSSLTLSFN+RLS+TST  NPS
Sbjct  3     ELDTLYPPDSDLDLSFTSCASITTTTTDRTLSARSSLARSSLTLSFNDRLSSTSTTNNPS  62

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             + IPNLH RPHRKH  NWSAIKAA TLSSDGALHLRHLKLHRLVGSGNLGRVFLCRLRDY
Sbjct  63    TEIPNLHRRPHRKHDPNWSAIKAATTLSSDGALHLRHLKLHRLVGSGNLGRVFLCRLRDY  122

Query  1253  EHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
             +H++FALKVIDRDSLTAKK+SHVQTEAEILS LDHPFLPTLYAHLEVSHYTCLL+DFC N
Sbjct  123   DHANFALKVIDRDSLTAKKISHVQTEAEILSSLDHPFLPTLYAHLEVSHYTCLLIDFCPN  182

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ GNRL V+SVRFYAAEVL+ALEYLHSLGIVYRDLKPENILIREDGHIMLS
Sbjct  183   GDLHSLLRKQPGNRLPVESVRFYAAEVLIALEYLHSLGIVYRDLKPENILIREDGHIMLS  242

Query  893   DFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTH  714
             DFDLCF++D+ P+L+  TR  L    R+     +R REETVTEFVAEPT AFSRSCVGTH
Sbjct  243   DFDLCFKSDVSPKLDFTTRT-LDRSKRRYSCFSDRLREETVTEFVAEPTGAFSRSCVGTH  301

Query  713   EYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADD  534
             EYLAPELISG GHGNGVDWWAFGVL+YELL GTTPFKGSSKESTLRNIAS++GV+F  ++
Sbjct  302   EYLAPELISGAGHGNGVDWWAFGVLLYELLHGTTPFKGSSKESTLRNIASSKGVKFNVEE  361

Query  533   GE-RETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPR  357
              +  E   M  AKDLIERLLVKDPR+RLGCA+GATDIKRHPFF GIKWPLIRTYRPPE R
Sbjct  362   TQGNEHSGMGEAKDLIERLLVKDPRRRLGCARGATDIKRHPFFAGIKWPLIRTYRPPEVR  421

Query  356   GLVLKRSKSK---AHVTGV---SSPRRRRCWWKRLGHLVRIKGSKHNLNFNHNYYCYAT-  198
             GL +KR+KSK   +HVTGV   SSPRR+RCWWKRLG+L+RIKGSK+NLN NHNYYCY   
Sbjct  422   GLSIKRTKSKLHVSHVTGVTTSSSPRRKRCWWKRLGYLMRIKGSKYNLNSNHNYYCYTNQ  481

Query  197   KISKIA  180
             K+ K A
Sbjct  482   KVRKCA  487



>ref|XP_004243199.1| PREDICTED: serine/threonine-protein kinase WAG2-like [Solanum 
lycopersicum]
Length=483

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/484 (79%), Positives = 427/484 (88%), Gaps = 11/484 (2%)
 Frame = -3

Query  1607  EDDILYPPDSDLDLSFTSCASITTT--DrtlsarsslarssltlSFNERLSATSTAGNPS  1434
             E D LYPPDSDLDLSFTSCASITTT  DRTLSARSSLARSSLTLSFN+RLS TS+  NPS
Sbjct  3     ELDALYPPDSDLDLSFTSCASITTTTTDRTLSARSSLARSSLTLSFNDRLSCTSSTNNPS  62

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             + IPN H R HR+H  NWSAIKA  TLSSDG+LHLRHLKLHRLVGSGNLGRVFLCRLRDY
Sbjct  63    AEIPNFHRRAHRQHDPNWSAIKAVTTLSSDGSLHLRHLKLHRLVGSGNLGRVFLCRLRDY  122

Query  1253  EHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
             +H++FALKVIDRDSLTAKK+SHVQTEAEILS LDHPFLPTLYAHLEVSHYTCLL+DFC N
Sbjct  123   DHANFALKVIDRDSLTAKKISHVQTEAEILSSLDHPFLPTLYAHLEVSHYTCLLIDFCPN  182

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ GNRL VDSVRFYAAEVL+ALEYLHSLGIVYRDLKPENILIREDGHIMLS
Sbjct  183   GDLHSLLRKQPGNRLPVDSVRFYAAEVLIALEYLHSLGIVYRDLKPENILIREDGHIMLS  242

Query  893   DFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTH  714
             DFDLCF++++ P+L+  TRV  GS  R+    G+R+REETVTEFV+EPT+AFSRSCVGTH
Sbjct  243   DFDLCFKSEVSPKLDFTTRVLEGSRRRRNSCYGDRQREETVTEFVSEPTSAFSRSCVGTH  302

Query  713   EYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADD  534
             EYLAPEL+SG GHGNGVDWWAFGVL+YELL+GTTPFKGSSKESTLRNIAS++GV+FY D+
Sbjct  303   EYLAPELVSGAGHGNGVDWWAFGVLLYELLYGTTPFKGSSKESTLRNIASSKGVKFYVDE  362

Query  533   GERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRG  354
              + E    A  +DLIE+LLVKDPRKRLGC +GATDIKRHPFF GIKWPLIRTYRPPE RG
Sbjct  363   TQGEE---AELRDLIEKLLVKDPRKRLGCTRGATDIKRHPFFAGIKWPLIRTYRPPEVRG  419

Query  353   LVLKRSKSKAHVTGV----SSPR-RRRCWWKRLGHLVRIKGSKHNLNFNHNYYCYAT-KI  192
             + +KR+KSKAHV+ V    SSPR RRRC WK+LG+L+RIKGSK+NLN NHNYYC+   K+
Sbjct  420   ITIKRTKSKAHVSHVTGFSSSPRIRRRCLWKKLGYLMRIKGSKYNLNSNHNYYCHTNHKV  479

Query  191   SKIA  180
              K A
Sbjct  480   RKCA  483



>ref|XP_006366774.1| PREDICTED: protein kinase PVPK-1-like [Solanum tuberosum]
Length=481

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/483 (79%), Positives = 426/483 (88%), Gaps = 11/483 (2%)
 Frame = -3

Query  1607  EDDILYPPDSDLDLSFTSCASITTT--DrtlsarsslarssltlSFNERLSATSTAGNPS  1434
             E D LYPPDSDLDLSFTSCASITTT  DRTLSARSSLARSSLTLSFN+RLS TS+  NPS
Sbjct  3     ELDALYPPDSDLDLSFTSCASITTTTTDRTLSARSSLARSSLTLSFNDRLSCTSSTNNPS  62

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             + IPN H R HR+H  NWSAIKA  TLSSDGALHLRHLKLHRLVGSGNLGRVFLCRLRDY
Sbjct  63    AEIPNFHRRAHRQHDPNWSAIKAVTTLSSDGALHLRHLKLHRLVGSGNLGRVFLCRLRDY  122

Query  1253  EHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
             +H++FALKVIDRDSLTAKKLSHVQTEAEILS LDHPFLPTLYAHLEVSHYTCLL+DFC N
Sbjct  123   DHANFALKVIDRDSLTAKKLSHVQTEAEILSSLDHPFLPTLYAHLEVSHYTCLLIDFCPN  182

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ  NRL V+SVRFYAAEVL+ALEYLHSLGIVYRDLKPENILIREDGHIMLS
Sbjct  183   GDLHSLLRKQPRNRLPVESVRFYAAEVLIALEYLHSLGIVYRDLKPENILIREDGHIMLS  242

Query  893   DFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTH  714
             DFDLCF++++ P+L+  TR+  GS  R   + G+R+REETVTEFV+EPT+AFSRSCVGTH
Sbjct  243   DFDLCFKSEVSPKLDFTTRIREGSRRRNSCY-GDRQREETVTEFVSEPTSAFSRSCVGTH  301

Query  713   EYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADD  534
             EYLAPELISG GHGNGVDWWAFGVL+YELL+GTTPFKG+SKESTLRNIAS++GV+FY D+
Sbjct  302   EYLAPELISGAGHGNGVDWWAFGVLLYELLYGTTPFKGNSKESTLRNIASSKGVKFYVDE  361

Query  533   GERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRG  354
              +      A  +DLIE+LL+KDPR+RLGC +GATDIKRHPFF GIKWPLIRTYRPPE RG
Sbjct  362   TQGHE---AELRDLIEKLLIKDPRRRLGCTRGATDIKRHPFFAGIKWPLIRTYRPPEVRG  418

Query  353   LVLKRSKSKA---HVTGVSSPR-RRRCWWKRLGHLVRIKGSKHNLNFNHNYYCYAT-KIS  189
             L +K++KSKA   HVTG+SSPR RRRC WK+LG+L+RIKGSK+NLN NHNYYC+   K+ 
Sbjct  419   LTIKKTKSKAHVSHVTGLSSPRIRRRCLWKKLGYLMRIKGSKYNLNSNHNYYCHTNHKVR  478

Query  188   KIA  180
             K A
Sbjct  479   KCA  481



>ref|XP_011098137.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Sesamum 
indicum]
Length=510

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/501 (73%), Positives = 421/501 (84%), Gaps = 19/501 (4%)
 Frame = -3

Query  1667  LSLITASCIVV--------QRFLRWIKMEDDILYPPDSDLDLSFTSCASITTTDrtlsar  1512
             L L++  C+ +        Q   R +  E+ I    DSDLDLSFTS     TTDRT SAR
Sbjct  9     LRLLSLLCVYIYASLRAQGQHLCRNMDHEESIYSFADSDLDLSFTS----VTTDRTHSAR  64

Query  1511  sslarssltlSFNERLSATSTAGNPSSNIPNLHSRPHRKHGS-NWSAIKAAATLSSDGAl  1335
             SSLARSSLTLSFNE   +T++A  PS+ +PN+H+RPH +H + NW+A+ A  TLSSDGAL
Sbjct  65    SSLARSSLTLSFNESRLSTASA-TPSTAVPNIHTRPHCRHDNPNWAAVNAVTTLSSDGAL  123

Query  1334  hlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALKVIDRDSLTAKKLSHVQTEAEILSML  1155
             HLRHL+L RLVGSGNLGRVFLCRLRDYEH++FALKV+DRDSL++KKLSHVQTEA+ILS L
Sbjct  124   HLRHLQLLRLVGSGNLGRVFLCRLRDYEHANFALKVVDRDSLSSKKLSHVQTEAQILSSL  183

Query  1154  DHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEY  975
             DHPFLPTLYAHLEVSHYTCLLMD+CSNGDLHSLLRKQ   RLSV +VRF+AAEVL+ALEY
Sbjct  184   DHPFLPTLYAHLEVSHYTCLLMDYCSNGDLHSLLRKQPHYRLSVQAVRFFAAEVLLALEY  243

Query  974   LHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLG  795
             LH+ GIVYRDLKPENILIREDGHIMLSDFDLCF +D+ P+LE  TR+ +GS   + G  G
Sbjct  244   LHAKGIVYRDLKPENILIREDGHIMLSDFDLCFHSDVSPKLENGTRIKVGSA--RYGCFG  301

Query  794   errreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGT  615
             + + EE VTEFVAEPTTAFSRSCVGTHEYL+PEL+SGNGHGNGVDWWAFG+L+YELL+GT
Sbjct  302   DPQVEERVTEFVAEPTTAFSRSCVGTHEYLSPELVSGNGHGNGVDWWAFGILIYELLYGT  361

Query  614   TPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGA  435
             TPFKG SK+STLRNIAST+GVRF+A +G+RE P MA A+DLIE+LLVKDPRKRLGC +GA
Sbjct  362   TPFKGGSKDSTLRNIASTKGVRFHAAEGDREEPGMAEARDLIEKLLVKDPRKRLGCTRGA  421

Query  434   TDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKA---HVTGVSSPRRRRCWWKRLGH  264
             TDIKRHPFFNGIKWPLIRTYRPPE RGL +KRSKS+A   HV GVSSPRRRRC WKRL  
Sbjct  422   TDIKRHPFFNGIKWPLIRTYRPPEVRGLTVKRSKSRANVSHVIGVSSPRRRRCLWKRLSR  481

Query  263   LVRIKGSKHNLNFNHNYYCYA  201
             L+RIKGSK++LN N NYY YA
Sbjct  482   LMRIKGSKYSLNSNSNYYSYA  502



>ref|XP_011082827.1| PREDICTED: serine/threonine-protein kinase WAG1 [Sesamum indicum]
Length=460

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/473 (74%), Positives = 397/473 (84%), Gaps = 18/473 (4%)
 Frame = -3

Query  1616  IKMEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNP  1437
             ++ ED + Y  DSDLDLSFTS A   TTDR+LSARSS            R S T +   P
Sbjct  1     MEQEDSVYYLADSDLDLSFTSVA---TTDRSLSARSS----------LARSSLTLSLVPP  47

Query  1436  SSNIPNLHSRPHRKHGS-NWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLR  1260
             S+ +PN H RPHR+H + NW+AI AA TLSSDG+LHLRHLKL RLVGSGNLGRVFLCRLR
Sbjct  48    STAVPNCHPRPHRRHDNPNWAAIHAATTLSSDGSLHLRHLKLLRLVGSGNLGRVFLCRLR  107

Query  1259  DYEHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFC  1080
             DY+H++FALKV+DRDSLT+KKLSHVQTEAEILS LDHPFLPTLYAHLEVSHYTCLLMD+C
Sbjct  108   DYDHANFALKVVDRDSLTSKKLSHVQTEAEILSSLDHPFLPTLYAHLEVSHYTCLLMDYC  167

Query  1079  SNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIM  900
              NGDLH+LLRKQ  NRL + +VRF+ AEVL+ALEYLH+ GIVYRDLKPENILIREDGHIM
Sbjct  168   PNGDLHALLRKQPSNRLPIQAVRFFVAEVLLALEYLHAQGIVYRDLKPENILIREDGHIM  227

Query  899   LSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVG  720
             LSDFDLCF +D+ P+L++ T++ + S    C   G+RRREE VTEFVAEPT+AFSRSCVG
Sbjct  228   LSDFDLCFHSDVSPKLDSRTQIKVFSNS--C--FGDRRREERVTEFVAEPTSAFSRSCVG  283

Query  719   THEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYA  540
             THEYLAPEL+SGNGHGNGVDWWAFGVL+YELL+GTTPFKG SKESTLRNIASTR VRF A
Sbjct  284   THEYLAPELVSGNGHGNGVDWWAFGVLIYELLYGTTPFKGGSKESTLRNIASTREVRFPA  343

Query  539   DDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEP  360
              +GERE   MA A+DLIE+LLVKDPR+RLGC  GATDIKRHPFFNGIKWPLIRTYRPPE 
Sbjct  344   VEGEREEAGMAEARDLIEKLLVKDPRRRLGCTTGATDIKRHPFFNGIKWPLIRTYRPPEV  403

Query  359   RGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLVRIKGSKHNLNFNHNYYCYA  201
             RGL +KRSKSKA + GV+SPRRRRC+WKRL HL RIK SK++LN NHNYY Y 
Sbjct  404   RGLAVKRSKSKAQLVGVASPRRRRCFWKRLSHLTRIKSSKYSLNSNHNYYSYV  456



>emb|CDP06119.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/465 (74%), Positives = 381/465 (82%), Gaps = 10/465 (2%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME++  YP D DLDLSFTSC + TT     +  S    S        RLS+TS   + S+
Sbjct  1     MEEETHYPADPDLDLSFTSCTTTTTDRTFSARSSLARSSLTLSFNESRLSSTSNPTSSST  60

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             +IPNLH R HR+H  NW+AIKAA TLSSDGAL L HLKL RLVGSGNLGRVFLCRLRDY+
Sbjct  61    SIPNLHRRAHRRHDPNWAAIKAATTLSSDGALRLGHLKLLRLVGSGNLGRVFLCRLRDYD  120

Query  1250  HSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNG  1071
             H++FALKV+DRDSLT+KKLSHVQTEAEILS LDHPFLPTLYAHLEVSHYTCLL+D+C NG
Sbjct  121   HANFALKVVDRDSLTSKKLSHVQTEAEILSSLDHPFLPTLYAHLEVSHYTCLLIDYCPNG  180

Query  1070  DLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSD  891
             DLHSLLRKQ  NRL VD+VRFYAAEVLVALEYLH+LGIVYRDLKPENILIRE+GHIMLSD
Sbjct  181   DLHSLLRKQPNNRLPVDAVRFYAAEVLVALEYLHALGIVYRDLKPENILIRENGHIMLSD  240

Query  890   FDLCFRADIFPQLETLTRVPLG-----SGGRKCG-FLGerrreETVTEFVAEPTTAFSRS  729
             FDLCF++DI P+LE+ T V  G        R C  F G  +R+ETV EFVAEPTTAFSRS
Sbjct  241   FDLCFKSDISPKLESRTHVNPGTTRKRHRRRTCNCFDGRHQRQETVMEFVAEPTTAFSRS  300

Query  728   CVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVR  549
             CVGTHEYLAPEL+SGNGHGNGVDWWAFGVL+YELL GTTPFKG SKESTLRNIAST+GVR
Sbjct  301   CVGTHEYLAPELVSGNGHGNGVDWWAFGVLIYELLSGTTPFKGGSKESTLRNIASTKGVR  360

Query  548   FYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRP  369
             FY D+ ERE   MA A+DLIERLLVKDPRKRLGCA+GATDIKRHPFF+G+KWPLIR  RP
Sbjct  361   FYVDEREREEAGMAEARDLIERLLVKDPRKRLGCARGATDIKRHPFFHGVKWPLIRACRP  420

Query  368   PEPRGLVLKRSKSKAHVTGV----SSPRRRRCWWKRLGHLVRIKG  246
             PE RGL + RSKSK H + V    SSPRRRRCWWKRL + +RIKG
Sbjct  421   PELRGLAVTRSKSKPHASHVSGPSSSPRRRRCWWKRLCNYMRIKG  465



>gb|EYU24316.1| hypothetical protein MIMGU_mgv1a026318mg [Erythranthe guttata]
Length=471

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/466 (75%), Positives = 390/466 (84%), Gaps = 23/466 (5%)
 Frame = -3

Query  1613  KMEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNE-RLSATSTAGNP  1437
             + E  I Y  DSDLDLSFTS     TTDR+LS R+SL+RSSLTLSFNE RLS  S    P
Sbjct  3     QEESSIYYLADSDLDLSFTSA----TTDRSLSGRTSLSRSSLTLSFNESRLSTAS----P  54

Query  1436  SSNIPNLHSRPHRKHGS-NWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLR  1260
             S+ + N+H RPHR+H + NW+A+ AA TLSSDGALHLRHLKL RLVGSGN GRVFLCRLR
Sbjct  55    SAAVYNVHHRPHRRHDNPNWAAVDAATTLSSDGALHLRHLKLLRLVGSGNHGRVFLCRLR  114

Query  1259  DYEHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFC  1080
             DY+H+DFALKV+DRDSLT KKLSHVQTEAEILS LDHPFLPTLYAH+EVSHYTCLLMD+C
Sbjct  115   DYDHADFALKVVDRDSLTTKKLSHVQTEAEILSALDHPFLPTLYAHIEVSHYTCLLMDYC  174

Query  1079  SNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIM  900
              NGDLHSLLRKQ  +RL V +VRF+AAEVL+ALEYLH+ G+VYRDLKPENILIREDGHIM
Sbjct  175   PNGDLHSLLRKQPHHRLPVQAVRFFAAEVLLALEYLHARGVVYRDLKPENILIREDGHIM  234

Query  899   LSDFDLCFRADIFPQLE-TLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCV  723
             LSDFDLCF +D+ P+LE   T++  GSGGR+        +E   TEFVAEPT AFSRSCV
Sbjct  235   LSDFDLCFSSDVSPRLENNRTQIKAGSGGRRT-------KERVTTEFVAEPTAAFSRSCV  287

Query  722   GTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFY  543
             GTHEYLAPEL+ GNGHGNGVDWWAFGVL+YELL GTTPFKG SKESTLRNIASTRGV+F+
Sbjct  288   GTHEYLAPELVGGNGHGNGVDWWAFGVLIYELLSGTTPFKGRSKESTLRNIASTRGVKFH  347

Query  542   -ADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP  366
              A     E   MA A+DLIE+LLVKDPR+RLGCA+GATDIKRHPFFNGIKWPLIRTYRPP
Sbjct  348   AAAAAAAEEQGMAEARDLIEKLLVKDPRRRLGCARGATDIKRHPFFNGIKWPLIRTYRPP  407

Query  365   EPRGLVLKR-SKSK-AHVTGVSSPRRRRCWWKRLGH--LVRIKGSK  240
             E RGL +KR SKSK AHVTGVSSPRRRRC WK+L H  ++R+KGSK
Sbjct  408   EVRGLAVKRSSKSKTAHVTGVSSPRRRRCLWKKLRHHLIMRLKGSK  453



>gb|EPS69615.1| hypothetical protein M569_05148, partial [Genlisea aurea]
Length=471

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/472 (69%), Positives = 384/472 (81%), Gaps = 17/472 (4%)
 Frame = -3

Query  1586  PDSDLDLSFTSCASITTTDrtlsarsslarssltlSF---NERLSATSTAGNPSSNIPNL  1416
             PDSDLDLSFTS      TDR+LS RSSLARSSLTLS      RLS +S   + SS + + 
Sbjct  9     PDSDLDLSFTS----DNTDRSLSPRSSLARSSLTLSLGSGESRLSGSSATAH-SSAVHSA  63

Query  1415  HSRPHRKHG-SNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDF  1239
             H RPHR+HG +NW+A+ AA TLSSDG LHLRHLKL RLVGSGNLGRVFLCRLRDY+ +DF
Sbjct  64    HRRPHRRHGNANWTAMDAATTLSSDGDLHLRHLKLVRLVGSGNLGRVFLCRLRDYDGADF  123

Query  1238  ALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             ALKV+DRD+L+AKKLSHVQTEA+ILS LDHPFLPTLYAHLEVSHYTCLLMD+CSNGDLHS
Sbjct  124   ALKVVDRDNLSAKKLSHVQTEAKILSHLDHPFLPTLYAHLEVSHYTCLLMDYCSNGDLHS  183

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             LLRKQ  +R SV +VRF+AAEVL+ALEYLHS GIVYRDLKPENILIREDGH+MLSDFDLC
Sbjct  184   LLRKQPAHRFSVAAVRFFAAEVLLALEYLHSQGIVYRDLKPENILIREDGHVMLSDFDLC  243

Query  878   FRADIFPQLETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAP  699
             FR+D+ P+LE  +++       +     +RRREE  T FVAEPT A S+SCVGTHEYLAP
Sbjct  244   FRSDVSPKLEVNSKMITA----RSTCFNQRRREERSTVFVAEPTAALSKSCVGTHEYLAP  299

Query  698   ELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGER  525
             E++SGNGHGNGVDWWAFG+L+YELL+GTTPFKG+SK+STLRNIAS RG+RF   A + ER
Sbjct  300   EILSGNGHGNGVDWWAFGILIYELLYGTTPFKGASKDSTLRNIASARGIRFPAPATEAER  359

Query  524   ETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVL  345
               P MA A+DLIE+LL KDPR+RLGCA GATDIKRHPFFNG+KWPLIRTYRPPE RGL +
Sbjct  360   IDPGMADARDLIEKLLAKDPRQRLGCAIGATDIKRHPFFNGLKWPLIRTYRPPEIRGLAV  419

Query  344   KRSKSKAHVTGVSSPRRRRCWWKRLGH--LVRIKGSKHNLNFNHNYYCYATK  195
             KRSKSK    G S+PRRRR  W+R+    + +++  +  +N N NY+  ++K
Sbjct  420   KRSKSKTQSAGSSTPRRRRHVWRRVSRNLMNKLRNYRSTVNPNCNYFSDSSK  471



>ref|XP_004488713.1| PREDICTED: protein kinase PINOID 2-like [Cicer arietinum]
Length=484

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/479 (65%), Positives = 367/479 (77%), Gaps = 16/479 (3%)
 Frame = -3

Query  1607  EDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSSN  1428
             E  +L+PPD+DLDLSFTS  +  T   + +  S    SSL LSFN+RLS  S A +  S+
Sbjct  3     EPTLLFPPDTDLDLSFTSTTTDRTFTSSSARTSLARTSSLALSFNDRLSTASAAVDIVSS  62

Query  1427  IPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEH  1248
                +  RPHR    NW+AIKAA  LSSDG LHLRHLKL R +GSG+LGRVFLCRLRDY+ 
Sbjct  63    --TVIRRPHRSSDPNWTAIKAATNLSSDGRLHLRHLKLLRHLGSGDLGRVFLCRLRDYDG  120

Query  1247  SDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGD  1068
             ++FALKV+D+D L  KKLSH +TEAEIL  LDHPFLPTLYA ++VSHYTCLL+D+C  GD
Sbjct  121   ANFALKVVDKDLLNPKKLSHAETEAEILHTLDHPFLPTLYARIDVSHYTCLLIDYCPGGD  180

Query  1067  LHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDF  888
             LHSLLRKQ GNRL++ + RF+AAE+LVALEYLH+LG+VYRDLKPEN+L+REDGH+MLSDF
Sbjct  181   LHSLLRKQPGNRLTLSAARFFAAEILVALEYLHALGVVYRDLKPENVLLREDGHVMLSDF  240

Query  887   DLCFRADIFPQLETLTRVPLGSGGRKCGFLGer------rreETVTEFVAEPTTAFSRSC  726
             DLCF+AD+ P  E  T V     G  CG            RE  V EFVAEP TAFSRSC
Sbjct  241   DLCFKADVAPTFEPCT-VHKPKVGSTCGCFSYNGSRSRDSRERVVAEFVAEPITAFSRSC  299

Query  725   VGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF  546
             VGTHEYLAPEL+SGNGHGNGVDWWAFGV +YELL+GTTPFKG SKE+TLRNIAS   VRF
Sbjct  300   VGTHEYLAPELVSGNGHGNGVDWWAFGVFIYELLYGTTPFKGCSKENTLRNIASPNNVRF  359

Query  545   YADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP  366
             +    E E   M  A+DLIE+LLVKDPR+RLGCA+GATD+KRHPFF+GIKWPLIR YR P
Sbjct  360   HV--AENEEVGMVEARDLIEKLLVKDPRRRLGCARGATDVKRHPFFDGIKWPLIRNYRAP  417

Query  365   EPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLVRIKGSKHNL--NF-NHNYYCYAT  198
             E +GLVL+R KS +H++ V+S RRR  WWKRLG  +R KG++ +L  NF N+NYYCY  
Sbjct  418   EVKGLVLRRKKSDSHLSHVNSKRRR--WWKRLGCALRNKGTRFDLLSNFSNNNYYCYVN  474



>gb|EYU38216.1| hypothetical protein MIMGU_mgv1a022694mg [Erythranthe guttata]
Length=498

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/489 (72%), Positives = 396/489 (81%), Gaps = 18/489 (4%)
 Frame = -3

Query  1616  IKMEDD--ILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNE-RLSATSTA  1446
             IKME D  + Y PDSDL   F+  ++ TTTDRTLSARSSLARSS+TLSFNE RLS  ST 
Sbjct  14    IKMEQDDSVYYLPDSDL--DFSFTSTTTTTDRTLSARSSLARSSITLSFNESRLSTASTT  71

Query  1445  GNPSSNIPNLHSRPHRKHGS-NWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLC  1269
               PS+ +PN H RPHR+H + NW+AI AA TLSSDGALHLRHLKL RLVG+GNLGRVFLC
Sbjct  72    TTPSTAVPNAHPRPHRRHDNPNWAAINAATTLSSDGALHLRHLKLVRLVGAGNLGRVFLC  131

Query  1268  RLRDYEHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLM  1089
             RLRDY+ +DFALKV+DRDSLT+KK+SHVQTEA+I+S LDHPFLPTLYAHLEVSHYTCLLM
Sbjct  132   RLRDYDGADFALKVVDRDSLTSKKVSHVQTEAQIISALDHPFLPTLYAHLEVSHYTCLLM  191

Query  1088  DFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDG  909
             D+C NGDLHSLL KQ  NRL V +VRF+ AEVL+ALEYLH+LGIVYRDLKPENILIREDG
Sbjct  192   DYCPNGDLHSLLHKQPSNRLPVRAVRFFVAEVLLALEYLHALGIVYRDLKPENILIREDG  251

Query  908   HIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRS  729
             HIMLSDFDLCFR+D+ P+L   T   +     K G  G R REE   EF+AEPT AFS+S
Sbjct  252   HIMLSDFDLCFRSDVSPKLNRTTTTQIV----KVGPTGRRWREERAAEFIAEPTAAFSKS  307

Query  728   CVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVR  549
             CVGTHEYLAPEL+ G GHGNGVDWWAFGVL++E+L+GTTPFKG SKESTLRNIAS RGVR
Sbjct  308   CVGTHEYLAPELVGGYGHGNGVDWWAFGVLVFEMLYGTTPFKGGSKESTLRNIASARGVR  367

Query  548   F-YADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYR  372
             F  A +GERE   MA AKDLIE+LLV DPR+RLGC +GATDIKRHPFF GIKWPLIRTYR
Sbjct  368   FPAAAEGEREEAGMAEAKDLIEKLLVMDPRRRLGCERGATDIKRHPFFAGIKWPLIRTYR  427

Query  371   PPEPRGLVLKRSK----SKAHVTGVSSPRRRRCWWKRLGHLVRIKGSKHN-LNFNHNYYC  207
             PPE RGL +KRSK           VSSPRRRR +WKR+  L+ IKGSK++ LN NHNYY 
Sbjct  428   PPEVRGLAVKRSKLSKGVVGGGVSVSSPRRRRSFWKRVSRLMGIKGSKYSGLNPNHNYYS  487

Query  206   Y--ATKISK  186
             Y    KI+K
Sbjct  488   YEKQKKINK  496



>ref|XP_010062722.1| PREDICTED: serine/threonine-protein kinase WAG1 [Eucalyptus grandis]
Length=511

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/507 (64%), Positives = 373/507 (74%), Gaps = 34/507 (7%)
 Frame = -3

Query  1610  MEDDILYP-PDSDLDLSFTSCASITTTDrtls---arsslarssltlSFNERLSATSTAG  1443
             M+DD L+P  ++DLDLSFTS AS   TDRT +   ARSSLARSSLTLSFN+RLS +S + 
Sbjct  1     MDDDTLFPSAETDLDLSFTSLASTAATDRTFACSSARSSLARSSLTLSFNDRLSTSSASA  60

Query  1442  NPSSNIPN-------LHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLG  1284
             +  S+  +       LH RPHR+   NWSAIKAA TLSSDG LHLRHLKL R +G+GNLG
Sbjct  61    SAPSSSSSSAVTASLLHRRPHRRSDPNWSAIKAATTLSSDGRLHLRHLKLLRHLGTGNLG  120

Query  1283  RVFLCRLRDYEHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHY  1104
             RV+LCRLRD   + FALKV+DRD LT KKLSHVQ EAEILS LDHPFLPTLYAH+ VSHY
Sbjct  121   RVYLCRLRDCHSASFALKVVDRDFLTGKKLSHVQMEAEILSALDHPFLPTLYAHINVSHY  180

Query  1103  TCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENIL  924
             TCLL+D+C  GDLHSLLR+Q GNRLSV +VRF+AAEVLVALEYLH+LG+VYRDLKPENIL
Sbjct  181   TCLLIDYCPGGDLHSLLRRQPGNRLSVQAVRFFAAEVLVALEYLHALGVVYRDLKPENIL  240

Query  923   IREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCG---------FLGerrr----  783
             +REDGHIMLSDFDLCF+AD+ P   T          R+ G           G  +R    
Sbjct  241   LREDGHIMLSDFDLCFKADVVPTFNTRAGPTSPRTTRRKGRKLSSSSSCIYGSVKRGEAW  300

Query  782   eETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFK  603
              E V EF AEPT A+SR CVGTHEYLAPEL+SGNGHGNGVDWWAFG+L+YELL GTTPFK
Sbjct  301   REVVAEFAAEPTAAYSRCCVGTHEYLAPELVSGNGHGNGVDWWAFGILLYELLHGTTPFK  360

Query  602   GSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIK  423
             G SKESTLRNIAS++ VRF A   ERE   MA A+DLIE+LLVKDPR+RLGCA+GATD+K
Sbjct  361   GGSKESTLRNIASSKQVRFPA-AAEREEAGMAEARDLIEKLLVKDPRRRLGCARGATDVK  419

Query  422   RHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSS-PRRRRCWWKRLGHLVRIKG  246
             RHPFF+GI WPLIR+YRPPE  GLV K      HV  ++   +RRR WWK L + +R   
Sbjct  420   RHPFFDGINWPLIRSYRPPEVPGLVRKPKPHAGHVASIAPHHKRRRWWWKGLEYFMRSSK  479

Query  245   --------SKHNLNFNHNYYCYATKIS  189
                     S++    N NYY Y  K S
Sbjct  480   RSTSKYYYSRNPSRSNSNYYQYYVKNS  506



>gb|KEH38373.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=484

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/473 (64%), Positives = 362/473 (77%), Gaps = 19/473 (4%)
 Frame = -3

Query  1589  PPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSSNIPNLHS  1410
             PPDSDLDLSFTS  +   T  + +  S    SSL LSFN+RLS  STAG+  S+   +  
Sbjct  10    PPDSDLDLSFTS-TTTERTFTSSARTSLARTSSLALSFNDRLSTASTAGDTVSSA--VIR  66

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             RPHR   SNW+AIKAA  LSSDG LHLRHLKL R +GSG+LGRVFLCRLRDY+ ++FALK
Sbjct  67    RPHRSSDSNWTAIKAATNLSSDGRLHLRHLKLIRHLGSGDLGRVFLCRLRDYDGANFALK  126

Query  1229  VIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLLR  1050
             V+D+D LT KK SH +TEAEIL  LDHPFLPTLYA ++VSHYTCLL+D+C  GDLH+LLR
Sbjct  127   VVDKDLLTPKKFSHAETEAEILHALDHPFLPTLYARIDVSHYTCLLIDYCPGGDLHALLR  186

Query  1049  KQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRA  870
             KQ GNRL++ + RF+AAE+LVALEYLH+LG+VYRDLKPEN+L+REDGH+MLSDFDLCF+A
Sbjct  187   KQPGNRLTISAARFFAAEILVALEYLHALGVVYRDLKPENVLLREDGHVMLSDFDLCFKA  246

Query  869   DIFPQLETLTRVPLGSGGRKCGFLGer------rreETVTEFVAEPTTAFSRSCVGTHEY  708
             D+ P  E   +V     G   G  G         RE+ V +FVAEPTTAFSRSCVGTHEY
Sbjct  247   DVTPTFEC-CKVNKHYAGPTYGCFGCNGSRSRDSREKVVADFVAEPTTAFSRSCVGTHEY  305

Query  707   LAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGE  528
             LAPEL+SGNGHGNGVDWWAFGV +YELL+G TPFKG SKE TLRNIAS   V+F+    E
Sbjct  306   LAPELVSGNGHGNGVDWWAFGVFIYELLYGMTPFKGCSKEGTLRNIASNNDVKFHV--AE  363

Query  527   RETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLV  348
              E   M  A+DLIE+LLVKDP+KRLGC +GATD+KRHPFF+GIKWPLIRTY+PPE +GL 
Sbjct  364   NEEVGMVEARDLIEKLLVKDPKKRLGCVRGATDVKRHPFFDGIKWPLIRTYKPPEVKGL-  422

Query  347   LKRSKSKAHVTGVSSPRRRRCWWKRLGHLVRIKGSKHNL--NF-NHNYYCYAT  198
             L+R KS   VT   S + R+ WWKRLG  +R KG++ +L  N+ N+N+YCY  
Sbjct  423   LRRKKSDLIVT---SKKIRKGWWKRLGCALRNKGARFDLLSNYSNNNHYCYVN  472



>gb|KCW69855.1| hypothetical protein EUGRSUZ_F03194, partial [Eucalyptus grandis]
Length=502

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/502 (64%), Positives = 371/502 (74%), Gaps = 34/502 (7%)
 Frame = -3

Query  1610  MEDDILYP-PDSDLDLSFTSCASITTTDrtls---arsslarssltlSFNERLSATSTAG  1443
             M+DD L+P  ++DLDLSFTS AS   TDRT +   ARSSLARSSLTLSFN+RLS +S + 
Sbjct  1     MDDDTLFPSAETDLDLSFTSLASTAATDRTFACSSARSSLARSSLTLSFNDRLSTSSASA  60

Query  1442  NPSSNIPN-------LHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLG  1284
             +  S+  +       LH RPHR+   NWSAIKAA TLSSDG LHLRHLKL R +G+GNLG
Sbjct  61    SAPSSSSSSAVTASLLHRRPHRRSDPNWSAIKAATTLSSDGRLHLRHLKLLRHLGTGNLG  120

Query  1283  RVFLCRLRDYEHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHY  1104
             RV+LCRLRD   + FALKV+DRD LT KKLSHVQ EAEILS LDHPFLPTLYAH+ VSHY
Sbjct  121   RVYLCRLRDCHSASFALKVVDRDFLTGKKLSHVQMEAEILSALDHPFLPTLYAHINVSHY  180

Query  1103  TCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENIL  924
             TCLL+D+C  GDLHSLLR+Q GNRLSV +VRF+AAEVLVALEYLH+LG+VYRDLKPENIL
Sbjct  181   TCLLIDYCPGGDLHSLLRRQPGNRLSVQAVRFFAAEVLVALEYLHALGVVYRDLKPENIL  240

Query  923   IREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCG---------FLGerrr----  783
             +REDGHIMLSDFDLCF+AD+ P   T          R+ G           G  +R    
Sbjct  241   LREDGHIMLSDFDLCFKADVVPTFNTRAGPTSPRTTRRKGRKLSSSSSCIYGSVKRGEAW  300

Query  782   eETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFK  603
              E V EF AEPT A+SR CVGTHEYLAPEL+SGNGHGNGVDWWAFG+L+YELL GTTPFK
Sbjct  301   REVVAEFAAEPTAAYSRCCVGTHEYLAPELVSGNGHGNGVDWWAFGILLYELLHGTTPFK  360

Query  602   GSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIK  423
             G SKESTLRNIAS++ VRF A   ERE   MA A+DLIE+LLVKDPR+RLGCA+GATD+K
Sbjct  361   GGSKESTLRNIASSKQVRFPA-AAEREEAGMAEARDLIEKLLVKDPRRRLGCARGATDVK  419

Query  422   RHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSS-PRRRRCWWKRLGHLVRIKG  246
             RHPFF+GI WPLIR+YRPPE  GLV K      HV  ++   +RRR WWK L + +R   
Sbjct  420   RHPFFDGINWPLIRSYRPPEVPGLVRKPKPHAGHVASIAPHHKRRRWWWKGLEYFMRSSK  479

Query  245   --------SKHNLNFNHNYYCY  204
                     S++    N NYY Y
Sbjct  480   RSTSKYYYSRNPSRSNSNYYQY  501



>emb|CAN80973.1| hypothetical protein VITISV_043376 [Vitis vinifera]
Length=474

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/463 (68%), Positives = 360/463 (78%), Gaps = 16/463 (3%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITT-----TDrtlsarsslarssltlSFNERLSATSTA  1446
             M+++  +P D+D+D SFTS  S  T     T  + SAR+SLARSSLTLSFNE  S  ST+
Sbjct  1     MDEETFFPSDTDIDFSFTSTTSSVTTATDRTFASSSARTSLARSSLTLSFNE--SRLSTS  58

Query  1445  GNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCR  1266
                ++   NLH RPHRK   +WSAI AA TLSSDGALHLRHLKL R +G+GNLGRVFLCR
Sbjct  59    TAGATAAANLHHRPHRKSDPHWSAINAATTLSSDGALHLRHLKLLRHLGTGNLGRVFLCR  118

Query  1265  LRDYEHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMD  1086
             LRD + ++FALKV+DRD+LT KKLSHVQ EA+ILS LDHPFLPTLYAHLEVSHYTCLL+D
Sbjct  119   LRDCDAANFALKVVDRDALTNKKLSHVQMEADILSALDHPFLPTLYAHLEVSHYTCLLID  178

Query  1085  FCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGH  906
             +C  GDLHSLLRKQ GNRL VD+ RFYAAEVLVALEYLH+ G+VYRDLKPEN+L+REDGH
Sbjct  179   YCPGGDLHSLLRKQPGNRLPVDAARFYAAEVLVALEYLHATGVVYRDLKPENVLLREDGH  238

Query  905   IMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSC  726
             IMLSDFDLCF+AD+ P LE+  R     G   C F      EE V EFVAEPT AFSRSC
Sbjct  239   IMLSDFDLCFKADVVPILESRARTRPVHG---C-FGSREAAEEVVAEFVAEPTDAFSRSC  294

Query  725   VGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF  546
             VGTHEYLAPEL++G GHGNGVDWWAFGV ++E+L GTTPFKG SKE+TLRNIASTR V+F
Sbjct  295   VGTHEYLAPELVAGTGHGNGVDWWAFGVFIFEMLHGTTPFKGGSKEATLRNIASTRQVKF  354

Query  545   YADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP  366
              A D E +   +  A+DLIERLLVKDPRKRLG ++GATDIKRHPFFNGIKWPLIRTY PP
Sbjct  355   QARDEEEKGVGITEARDLIERLLVKDPRKRLGFSRGATDIKRHPFFNGIKWPLIRTYTPP  414

Query  365   EPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLVRIKGSKH  237
             E RG+  K     +HVTG+  PR R  WW    +  + KGSKH
Sbjct  415   EVRGVARKTKAHVSHVTGI--PRERGHWW---WNSKKNKGSKH  452



>ref|XP_002263341.1| PREDICTED: serine/threonine-protein kinase WAG1 [Vitis vinifera]
Length=474

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/463 (68%), Positives = 360/463 (78%), Gaps = 16/463 (3%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITT-----TDrtlsarsslarssltlSFNERLSATSTA  1446
             M+++  +P D+D+D SFTS  S  T     T  + SAR+SLARSSLTLSFNE  S  ST+
Sbjct  1     MDEETFFPSDTDIDFSFTSTTSSVTTATDRTFASSSARTSLARSSLTLSFNE--SRLSTS  58

Query  1445  GNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCR  1266
                ++   NLH RPHRK   +WSAI AA TLSSDGALHLRHLKL R +G+GNLGRVFLCR
Sbjct  59    TAGATAAANLHHRPHRKSDPHWSAINAATTLSSDGALHLRHLKLLRHLGTGNLGRVFLCR  118

Query  1265  LRDYEHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMD  1086
             LRD + ++FALKV+DRD+LT KKLSHVQ EA+ILS LDHPFLPTLYAHLEVSHYTCLL+D
Sbjct  119   LRDCDAANFALKVVDRDALTNKKLSHVQMEADILSALDHPFLPTLYAHLEVSHYTCLLID  178

Query  1085  FCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGH  906
             +C  GDLHSLLRKQ GNRL VD+VRFYAAEVLVALEYLH+ G+VYRDLKPEN+L+REDGH
Sbjct  179   YCPGGDLHSLLRKQPGNRLPVDAVRFYAAEVLVALEYLHATGVVYRDLKPENVLLREDGH  238

Query  905   IMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSC  726
             IMLSDFDLCF+AD+ P LE+  R     G   C F      EE V EFVAEPT AFSRSC
Sbjct  239   IMLSDFDLCFKADVVPILESRARTRPVHG---C-FGSREAAEEVVAEFVAEPTDAFSRSC  294

Query  725   VGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF  546
             VGTHEYLAPEL++G GHGNGVDWWAFGV ++E+L GTTPFKG SKE+TLRNIASTR V+F
Sbjct  295   VGTHEYLAPELVAGTGHGNGVDWWAFGVFIFEMLHGTTPFKGGSKEATLRNIASTRQVKF  354

Query  545   YADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP  366
              A D E +   +  A+DLIERLLVKDPRKRLG ++GATDIKRHPFFNGIKWPLIRTY PP
Sbjct  355   QARDEEEKGVGITEARDLIERLLVKDPRKRLGFSRGATDIKRHPFFNGIKWPLIRTYTPP  414

Query  365   EPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLVRIKGSKH  237
             E RG+  K     +HVTGV  P  R  WW    +  + KGSKH
Sbjct  415   EVRGVARKTKAHVSHVTGV--PSERGHWW---WNSKKNKGSKH  452



>ref|XP_010694834.1| PREDICTED: serine/threonine-protein kinase WAG1 [Beta vulgaris 
subsp. vulgaris]
Length=479

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/474 (65%), Positives = 366/474 (77%), Gaps = 37/474 (8%)
 Frame = -3

Query  1610  MEDDILYPP-DSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPS  1434
             M+DD  Y   D+DLD SFTS  +   T  + SARSSLARSSLTLSFNER+S TS      
Sbjct  1     MDDDTFYYSLDTDLDSSFTSTIT-DRTFGSSSARSSLARSSLTLSFNERISTTSGPTYKH  59

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
              N  N   RPHR+   +WSAI+AA  LS D  +HLRHLKL   +G+GNLG+VFLCR+RDY
Sbjct  60    HN--NTIIRPHRREDPHWSAIRAATNLSQDNRIHLRHLKLMSHLGAGNLGKVFLCRIRDY  117

Query  1253  EHSD----FALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMD  1086
              HS     FALKV+D+DSL+ KKLSHVQTEAEILS+LDHPFLPTLYAH+EVSHYTCLL+D
Sbjct  118   HHSSPNSHFALKVVDKDSLSPKKLSHVQTEAEILSLLDHPFLPTLYAHIEVSHYTCLLID  177

Query  1085  FCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGH  906
             +CS GDLHSLLRKQ  NRL + +V+FYAAEVLVALEYLHSLGIVYRDLKPENIL+REDGH
Sbjct  178   YCSGGDLHSLLRKQPSNRLPLQAVKFYAAEVLVALEYLHSLGIVYRDLKPENILLREDGH  237

Query  905   IMLSDFDLCFRADIFPQLETL----TRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAF  738
             IMLSDFDLCF++D+ P++E       R+     GR+        R+  V EFVAEPTTAF
Sbjct  238   IMLSDFDLCFKSDVTPKIEIFDDEYNRMSKIKSGRR--------RDRMVGEFVAEPTTAF  289

Query  737   SRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTR  558
             S+SCVGTHEYLAPEL+SGNGHGNGVDWW FGVL+YELLFGTTPFKG +KE+TLRNIAS+R
Sbjct  290   SKSCVGTHEYLAPELVSGNGHGNGVDWWGFGVLIYELLFGTTPFKGVNKEATLRNIASSR  349

Query  557   GVRF-------YADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGI  399
              +RF       + DD E     MA AKDLIE+LL+KDPRKR+G  +GAT+IK+HPFFNG+
Sbjct  350   DMRFCHVEEREFEDDKE-----MALAKDLIEKLLIKDPRKRMGSIRGATEIKKHPFFNGV  404

Query  398   KWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLVRI-KGSK  240
             KW LIR+YRPPE RG +++  KSK+HV+G+ +  RR+ WW+ L H +R  KGSK
Sbjct  405   KWALIRSYRPPEVRGGLVR--KSKSHVSGIHN--RRKWWWRGLNHFLRKNKGSK  454



>gb|AAB71418.1| putative protein kinase [Pisum sativum]
Length=479

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/471 (63%), Positives = 361/471 (77%), Gaps = 13/471 (3%)
 Frame = -3

Query  1589  PPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLS-ATSTAGNPSSNIPNLH  1413
             PPDSDLDLSFTS  +  T   + +  S    SSL LSFN+RLS A++ AG+  S+   + 
Sbjct  10    PPDSDLDLSFTSTTTDRTFTSSSARTSLARTSSLALSFNDRLSTASAAAGDTVSSA--II  67

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
              RPHR    NW+AIKAA  LSSDG LHLRHLKL R +GSG+LGRVFLCRLRDY+ ++FAL
Sbjct  68    RRPHRSSDPNWTAIKAATNLSSDGRLHLRHLKLLRHLGSGDLGRVFLCRLRDYDGANFAL  127

Query  1232  KVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             KV+D+D LT KK +H +TEAEIL  LDHPFLPTLYA ++VSHYTCLL+D+C  GDLHSLL
Sbjct  128   KVVDKDLLTLKKSTHAETEAEILHALDHPFLPTLYARIDVSHYTCLLIDYCPGGDLHSLL  187

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             RKQ GNR ++ + RF+AAE+LVALEYLH+LG+VYRDLKPEN+LIREDGH+MLSDFDLC++
Sbjct  188   RKQPGNRFTLSAARFFAAEILVALEYLHALGVVYRDLKPENVLIREDGHVMLSDFDLCYK  247

Query  872   ADIFPQLETLTRVPLG-SGGRKCGFLGerrreETVT-EFVAEPTTAFSRSCVGTHEYLAP  699
             AD+ P  E  T   L       C      +  E+VT EFVAEPTTAFSRSCVGTHEYLAP
Sbjct  248   ADVSPTFEFSTNHKLHVDPTHGCFSYNRSKSRESVTAEFVAEPTTAFSRSCVGTHEYLAP  307

Query  698   ELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERET  519
             EL+SGNGHGNGVDWWAFGV +YELL+GTTPFKG +KESTLRNIAS + V+F+    E E 
Sbjct  308   ELVSGNGHGNGVDWWAFGVFIYELLYGTTPFKGCNKESTLRNIASNKDVKFHV--AENEE  365

Query  518   PAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKR  339
               M  A+DLIE+LLVKDPR+RLGCA+GATDIKRHPFF+GIKWPLIRTY+ PE +GL+  R
Sbjct  366   VGMVGARDLIEKLLVKDPRRRLGCARGATDIKRHPFFDGIKWPLIRTYKAPEVKGLL--R  423

Query  338   SKSKAHVTGVSSPRRRRCWWKRLGHLVRIKGSKHNL--NFNHN--YYCYAT  198
              K         S +R+R WWKRLG ++R KG++ +L  N+++N  YYCY  
Sbjct  424   RKKSESSLSQLSSKRKRGWWKRLGCVLRNKGARFDLLSNYSNNNHYYCYVN  474



>ref|XP_007149250.1| hypothetical protein PHAVU_005G054400g [Phaseolus vulgaris]
 gb|ESW21244.1| hypothetical protein PHAVU_005G054400g [Phaseolus vulgaris]
Length=473

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/466 (64%), Positives = 352/466 (76%), Gaps = 24/466 (5%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME+  L  PD+DLDLSFTS    TTTDRT +  S    SSLTLSFN+R+S       PS 
Sbjct  1     MEEPTLLFPDTDLDLSFTS----TTTDRTSARTSLARTSSLTLSFNDRISTI----EPSI  52

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             ++ N   RPHR    +W+AIKAA  LSSDG LHLRHLKL R +GSGNLGRVFLCRLRDY+
Sbjct  53    SVVN--RRPHRSSDPHWTAIKAATMLSSDGRLHLRHLKLLRHLGSGNLGRVFLCRLRDYD  110

Query  1250  HSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNG  1071
              ++FALKV+D+D LT KKLSH +TEAEIL  LDHPFLPTLYA ++VSHYTCLLMD+C  G
Sbjct  111   GANFALKVVDKDLLTPKKLSHAETEAEILQALDHPFLPTLYARIDVSHYTCLLMDYCPAG  170

Query  1070  DLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSD  891
             DLHSLLRKQ  +RL +   RF+AAEVLVALEYLH+LGIVYRDLKPEN+L+REDGH+MLSD
Sbjct  171   DLHSLLRKQPHHRLPLSVARFFAAEVLVALEYLHALGIVYRDLKPENVLLREDGHVMLSD  230

Query  890   FDLCFRADIFPQLETLTRVPLGSGGRKCGFLG------errreETVTEFVAEPTTAFSRS  729
             FDLCF++D+ P +   T       G   G         ++ ++  + EF+AEP TAFSRS
Sbjct  231   FDLCFKSDVAPSVTLRTHSKPPRAGPTNGRFSYNRRPYKQHQQTFLAEFIAEPVTAFSRS  290

Query  728   CVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVR  549
             CVGTHEYLAPEL+SGNGHGNGVDWWAFGV +YELL+GTTPFKG +KE TLRNIAS + VR
Sbjct  291   CVGTHEYLAPELVSGNGHGNGVDWWAFGVFVYELLYGTTPFKGCNKEGTLRNIASCKDVR  350

Query  548   FYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRP  369
             F     E E   M  A+DLIE+LLVKDPR+RLGC KGATD+KRHPFF+GIKWPLIRTYRP
Sbjct  351   F-VHVAEGEEAGMGEARDLIEKLLVKDPRRRLGCTKGATDVKRHPFFDGIKWPLIRTYRP  409

Query  368   PEPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLVRIKGSKHNL  231
             PE +GLV    ++K+HV+G  S +R R  WK L H++R    K+NL
Sbjct  410   PEVKGLV---RRNKSHVSGHVSCKRTRWSWKTLAHVLR----KYNL  448



>ref|XP_010277519.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Nelumbo 
nucifera]
Length=460

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/443 (65%), Positives = 344/443 (78%), Gaps = 21/443 (5%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNE-RLSATSTAGNPS  1434
             M++DIL   D+DLD SFTSCAS T+TDRT ++ S+ +  S++  FNE RLS+++  G   
Sbjct  1     MDEDILLSSDTDLDFSFTSCASNTSTDRTFTSSSARSSLSVS--FNESRLSSSTGVG---  55

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
                     RPHRK   +W+AIKAA  LSSDG+LHL  LKL R +GSGNLGRVFLCRL DY
Sbjct  56    --------RPHRKSDPHWAAIKAATNLSSDGSLHLSQLKLVRHIGSGNLGRVFLCRLEDY  107

Query  1253  EHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
             + ++FALKV+D+D LTAKKLSHVQ EA++LSM+DHPFLPTLYAHLE SHY+CLL+D+C  
Sbjct  108   DGANFALKVVDKDVLTAKKLSHVQMEAQVLSMVDHPFLPTLYAHLEESHYSCLLIDYCPG  167

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ  +R  VDSVRF+AAEVLVALEYLH+LG+VYRDLKPEN+LIR+DGHIMLS
Sbjct  168   GDLHSLLRKQPTHRFRVDSVRFFAAEVLVALEYLHALGVVYRDLKPENVLIRDDGHIMLS  227

Query  893   DFDLCFRADIFPQLETLTRVPLGSGGRK----C-GFLGerrreETVTEFVAEPTTAFSRS  729
             DFDLCFRAD+ P L+     P G    K    C G +  RR+   V EFVAEPTTAFS+S
Sbjct  228   DFDLCFRADVLPTLDKRHFHPAGVESTKKQPTCFGTVSRRRKMTEVAEFVAEPTTAFSKS  287

Query  728   CVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVR  549
             CVGTHEYLAPEL+SGNGHGNGVDWWAFGV +YELL+G TPFKG SKE+TLRNIAST+  R
Sbjct  288   CVGTHEYLAPELLSGNGHGNGVDWWAFGVFIYELLYGQTPFKGGSKEATLRNIASTKSFR  347

Query  548   FY-ADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYR  372
             F      + E   ++ A+DLI+RLLVKDPR+RLG AKGAT+IK+HPFF  IKWPLIR+YR
Sbjct  348   FRDCGRADEEEEGISEARDLIQRLLVKDPRRRLGYAKGATEIKQHPFFKRIKWPLIRSYR  407

Query  371   PPEP-RGLVLKRSKSKAHVTGVS  306
             PPE  RGLV K+     +V  VS
Sbjct  408   PPEEVRGLVKKKVTHVRNVNIVS  430



>ref|XP_006585434.1| PREDICTED: protein kinase PINOID-like isoform X1 [Glycine max]
 ref|XP_006585435.1| PREDICTED: protein kinase PINOID-like isoform X2 [Glycine max]
Length=462

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/462 (66%), Positives = 352/462 (76%), Gaps = 18/462 (4%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarss--larssltlSFNERLSATSTAGNP  1437
             ME+  L  PD+DLDLSFTS  +  TT  T ++  +     SSLTLSFN+RLS  S +   
Sbjct  1     MEEPTLLFPDTDLDLSFTSTTTDRTTTTTTTSARTSLARTSSLTLSFNDRLSTFSASETT  60

Query  1436  SSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD  1257
             ++++  +  RPHR    NWSAI+AA  LSSDG LHLRHLKL R +GSGNLGRVFLCRLRD
Sbjct  61    TASL--ISRRPHRSGDPNWSAIQAAVNLSSDGRLHLRHLKLLRHLGSGNLGRVFLCRLRD  118

Query  1256  YEHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
             Y+ + FALKV+D+D LT KKLSH QTEAEIL  LDHPFLPTLYA ++VSHYTCLLMDFC 
Sbjct  119   YDGAHFALKVVDKDLLTPKKLSHAQTEAEILHALDHPFLPTLYARIDVSHYTCLLMDFCP  178

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
              GDLHSLLRKQ   RL + + RF+AAEVLVALEYLH+LGIVYRDLKPEN+L+R+DGH+ML
Sbjct  179   GGDLHSLLRKQPQFRLPLAAARFFAAEVLVALEYLHALGIVYRDLKPENVLLRDDGHVML  238

Query  896   SDFDLCFRADIFPQLE-----TLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSR  732
             SDFDLCF++D+ P +      +  RV   SG   C     R RE+ V EFVAEP TAFSR
Sbjct  239   SDFDLCFKSDVAPNVNFRSHTSPPRVGPTSGCFSCNN-NNRHREKLVAEFVAEPVTAFSR  297

Query  731   SCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGV  552
             SCVGTHEYLAPEL+S NGHGNGVDWWAFGV +YELL+GTTPFKG SKE TLRNIAS++ V
Sbjct  298   SCVGTHEYLAPELVSVNGHGNGVDWWAFGVFVYELLYGTTPFKGCSKEGTLRNIASSKDV  357

Query  551   RFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYR  372
             RF     ERE   MA A+DLIE+LLVKDPRKRLGCAKGAT+IK HPFF GIKWPLIRTYR
Sbjct  358   RF-VHVAEREEAGMAEARDLIEKLLVKDPRKRLGCAKGATEIKLHPFFYGIKWPLIRTYR  416

Query  371   PPEPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLVRIKG  246
             PPE +G + +R+KS        + +R  CWWKRLG LVR KG
Sbjct  417   PPEVKGFI-RRNKSNV------TCKRNTCWWKRLGLLVRNKG  451



>ref|XP_010254561.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Nelumbo 
nucifera]
Length=457

 Score =   526 bits (1355),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 277/439 (63%), Positives = 341/439 (78%), Gaps = 20/439 (5%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             M+++ L+P D+DLDLSF SCAS T+TDRT ++ S+ +  +L+     RLS+++  G    
Sbjct  1     MDEETLFPSDTDLDLSFNSCASNTSTDRTFTSSSARSSLTLSFK-GSRLSSSAGTG----  55

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
                    RPHRK   +W+AIKAA  LSSDG+LHLRHLKL R +GSGNLGRVFLCRL+DY+
Sbjct  56    -------RPHRKSDPHWTAIKAATNLSSDGSLHLRHLKLIRHIGSGNLGRVFLCRLKDYD  108

Query  1250  HSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNG  1071
              ++FALKV+D+D LTAKKLS VQ EA++LSM+DHPFLPTLYAHLEVSHY+CLL+D+C  G
Sbjct  109   GANFALKVVDKDVLTAKKLSQVQMEAQVLSMVDHPFLPTLYAHLEVSHYSCLLIDYCPGG  168

Query  1070  DLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSD  891
             DLHSLLRKQ  NR  V++VRF+AAEVLVALEYLH++G+VYRDLKPEN+LIR+DGHIMLSD
Sbjct  169   DLHSLLRKQPENRFRVEAVRFFAAEVLVALEYLHAIGVVYRDLKPENVLIRDDGHIMLSD  228

Query  890   FDLCFRADIFPQLETL---TRVPLGSGGRKC-GFLGerrreETVTEFVAEPTTAFSRSCV  723
             FDLCF+AD+ P LE     T V        C G +  R       EFVAEPT AFS+SCV
Sbjct  229   FDLCFKADVVPTLEKRFEPTVVQSTKNQPSCLGTVSRRYEMTETAEFVAEPTAAFSKSCV  288

Query  722   GTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFY  543
             GTHEYLAPEL+SGNGHGNGVDWWAFGV ++ELL+G TPF+G +KE+TLRNI S++ ++F 
Sbjct  289   GTHEYLAPELVSGNGHGNGVDWWAFGVFLFELLYGHTPFRGGTKETTLRNIVSSKPLKFP  348

Query  542   ADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
               D   E   MA  +DLI+RLLVKDPR+RLGC KGAT+IK+HPFF GIKWPLIRTYRPPE
Sbjct  349   EWDVAEEE-GMAEVRDLIQRLLVKDPRRRLGCTKGATEIKQHPFFQGIKWPLIRTYRPPE  407

Query  362   P-RGLVLKRSKSKAHVTGV  309
               RGL+++  K+  HV  +
Sbjct  408   EVRGLLVR--KATTHVNRI  424



>ref|XP_006478013.1| PREDICTED: protein kinase PVPK-1-like [Citrus sinensis]
Length=492

 Score =   524 bits (1349),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 276/424 (65%), Positives = 323/424 (76%), Gaps = 21/424 (5%)
 Frame = -3

Query  1403  HRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALKVI  1224
             HRK   +WSAIKAA  LSSDG LHLRHLKL R +G+GNLGRVFLC LRD   + FALKV+
Sbjct  74    HRKSDLHWSAIKAATNLSSDGKLHLRHLKLVRHLGTGNLGRVFLCHLRDCTSASFALKVV  133

Query  1223  DRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQ  1044
             D+D L+AKKLSHVQ EAEILSMLDHPFLPTLYAHLEVSHY C L+D+C NGDLHSLL KQ
Sbjct  134   DKDLLSAKKLSHVQMEAEILSMLDHPFLPTLYAHLEVSHYICFLIDYCPNGDLHSLLPKQ  193

Query  1043  AGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRADI  864
               NR S+ +VRF+AAEVLVALEYLH+LGI+YRDLKPENIL+REDGHIMLSDFDLCF++D+
Sbjct  194   PNNRFSLQAVRFFAAEVLVALEYLHALGIIYRDLKPENILLREDGHIMLSDFDLCFQSDV  253

Query  863   FPQLETLTRVPLGSGGRK-----C-GFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLA  702
              P   TL    +GS  R+     C GF   +RR+E V EFVAEP  AFSRSCVGTHEYLA
Sbjct  254   VP---TLVETNVGSATRRRRRKSCNGFGSAKRRQENVMEFVAEPLAAFSRSCVGTHEYLA  310

Query  701   PELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERE  522
             PEL+SGNGHGNGVDWWAFG+L+YEL++G+TPF+G SKESTLRNIAS+  V  +   G +E
Sbjct  311   PELVSGNGHGNGVDWWAFGILIYELMYGSTPFRGGSKESTLRNIASSSRVACHV--GNKE  368

Query  521   TPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLK  342
                 A A+DLI++LLVKDPR+RLGCA+GATDIKRHPFF GIKWPLIR Y+ PE RGLV +
Sbjct  369   EEGTADARDLIDKLLVKDPRERLGCARGATDIKRHPFFYGIKWPLIRNYKTPEVRGLVRR  428

Query  341   RSKSKAHVTGVSSPRRRRCWWKRLGHLVRIKGSK----HNLNFNHN------YYCYATKI  192
                   HVTG+ S + RRCWWK+L    +         HNL+ N +      +Y    K 
Sbjct  429   TRSHVRHVTGIGSHKNRRCWWKKLVLFAKRNNQASRNYHNLSLNRSNSNYSQFYYVNNKA  488

Query  191   SKIA  180
             +K A
Sbjct  489   TKCA  492



>ref|XP_003546779.1| PREDICTED: protein kinase PINOID 2-like [Glycine max]
Length=478

 Score =   523 bits (1347),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 299/463 (65%), Positives = 348/463 (75%), Gaps = 16/463 (3%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             M++  L  PD+DLDLSFTS  +  TT    +  S    SSLTLSFN+RLS  S A N ++
Sbjct  1     MDEPTLLFPDTDLDLSFTSTTTDRTT--ISARASLARTSSLTLSFNDRLSTFSAAENTTA  58

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
              + N    PHR    NWSAI+AA  LSSDG LHLRHLKL R +GSGNLGRVFLCRLRDY+
Sbjct  59    AVTN--RLPHRSADPNWSAIQAAVNLSSDGRLHLRHLKLLRHLGSGNLGRVFLCRLRDYD  116

Query  1250  HSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNG  1071
              + FALKV+D+D LTAKKLSH QTEAEIL  LDHPFLPTLYA ++VSHYTCLL+DFC  G
Sbjct  117   GAHFALKVVDKDLLTAKKLSHAQTEAEILQTLDHPFLPTLYARIDVSHYTCLLIDFCPGG  176

Query  1070  DLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSD  891
             DLHSLLR+Q   RL + + RF+AAEVLVALEYLH+LGIVYRDLKPEN+L+REDGH+MLSD
Sbjct  177   DLHSLLRRQPQFRLPLAAARFFAAEVLVALEYLHALGIVYRDLKPENVLMREDGHVMLSD  236

Query  890   FDLCFRADIFPQLETLTRVPL------GSGGRKCGFLGerrreETVTEFVAEPTTAFSRS  729
             FDLCF++D+ P ++     P       G     C    +RR+E+ V EFVAEP TAFSRS
Sbjct  237   FDLCFKSDVAPCVDFRAHSPRRVGPTNGCFSYNCHRSQDRRKEKLVAEFVAEPVTAFSRS  296

Query  728   CVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVR  549
              VGTHEYLAPEL+SGNGHGNGVDWWAFGV +YELL+GTTPFKG SKE TLR IAS++ VR
Sbjct  297   SVGTHEYLAPELVSGNGHGNGVDWWAFGVFVYELLYGTTPFKGCSKEGTLRKIASSKDVR  356

Query  548   FYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRP  369
             F     ERE P M  A+DLIE+LLVKDP+KRLGCAKGAT+IKRH FF+GIKWPLIRTYRP
Sbjct  357   F-VHVAEREEPGMTEARDLIEKLLVKDPKKRLGCAKGATEIKRHRFFDGIKWPLIRTYRP  415

Query  368   PEPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLVRIKGSK  240
             PE +GL ++R+KSK                KRLGH+VR KG K
Sbjct  416   PELKGL-MRRNKSKVSCKSKRWWWWW----KRLGHVVRTKGGK  453



>ref|XP_011009070.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Populus 
euphratica]
Length=488

 Score =   523 bits (1347),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 315/495 (64%), Positives = 365/495 (74%), Gaps = 43/495 (9%)
 Frame = -3

Query  1589  PPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSSNIPNLHS  1410
             P D+DLD SFTS A+  T        SS ARSSLTLSFN+RLS T+T         +LH 
Sbjct  12    PSDTDLDFSFTSTATDRT------FTSSSARSSLTLSFNDRLSTTTTT-----TTSSLH-  59

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
               HR    +WSAIK A +LS+DG LHLRHLKL R +G+GNLGRVFLC+LRD+ +++FALK
Sbjct  60    --HRICDQHWSAIKTATSLSTDGRLHLRHLKLLRHLGTGNLGRVFLCQLRDFNNANFALK  117

Query  1229  VIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLLR  1050
             V+D+DSLT KKLS VQ E EILSMLDHPFLPTLYAHLEVSHY+CLL+D+C NGDLHSLLR
Sbjct  118   VMDKDSLTKKKLSQVQMEGEILSMLDHPFLPTLYAHLEVSHYSCLLIDYCPNGDLHSLLR  177

Query  1049  KQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRA  870
             KQ GNRL V +V+F+AAEVLVALEYLHSLG+VYRDLKPENIL+REDGHIMLSDFDLCF+A
Sbjct  178   KQPGNRLPVQAVKFFAAEVLVALEYLHSLGVVYRDLKPENILLREDGHIMLSDFDLCFKA  237

Query  869   DIFPQLE-TLTRVPLGSGGRKCGFL-------GerrreETVTEFVAEPTTAFSRSCVGTH  714
             D+ P  +  + R  +    RK G         G    E    EFVAEPT A SRSCVGTH
Sbjct  238   DVVPTFDRRVHRKRMAGSMRKGGDCFGTFSRRGVVEEEVVEEEFVAEPTAALSRSCVGTH  297

Query  713   EYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADD  534
             EYL+PEL+SGNGHGNGVDWWAFGVL+YELL GTTPFKG SKE TLRNIAS++ V F+   
Sbjct  298   EYLSPELLSGNGHGNGVDWWAFGVLVYELLHGTTPFKGGSKECTLRNIASSKRVNFHVLA  357

Query  533   GERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRG  354
             GE +   M  AKDLIE+LLVKDPR+RLGC KGATDIKRHPFF+GIKWPLIR YRPPE RG
Sbjct  358   GEGK--GMEEAKDLIEKLLVKDPRQRLGCTKGATDIKRHPFFDGIKWPLIRNYRPPEVRG  415

Query  353   LVLKR--SKSKAHVTGVSSPRRRRCWWK--------RLGHLVRIKGS-------KHNLNF  225
             LV+K+  S S  HV G  S  RRRCWW+         LG+ +R KGS        +N ++
Sbjct  416   LVVKKGMSHSSGHVLGGVSSPRRRCWWRLWKKGGGGGLGNSLRNKGSSPRYHLFNNNQHY  475

Query  224   NHNYYCYATKISKIA  180
             N NY+ Y  K+ K A
Sbjct  476   NGNYHHY--KVRKCA  488



>ref|XP_002317601.1| cucumber protein kinase CsPK3 [Populus trichocarpa]
 gb|EEE98213.1| cucumber protein kinase CsPK3 [Populus trichocarpa]
Length=497

 Score =   523 bits (1347),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 315/493 (64%), Positives = 370/493 (75%), Gaps = 36/493 (7%)
 Frame = -3

Query  1592  YPPDSDLDLSFTSCASITTTDrt---lsarsslarssltlSFNERLSATSTAGNPSSNIP  1422
             YP D+DLD SF S    TTTDRT    SARSSLARSSLTLSFN+RLS TST    ++   
Sbjct  11    YPSDTDLDFSFNS----TTTDRTFASSSARSSLARSSLTLSFNDRLSTTSTTTTTTTIKN  66

Query  1421  NLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD  1242
             +LH   HRK   +WSAIK A  LS+D  LHLRHLKL R +G+GNLGRVFLC+LRD  +++
Sbjct  67    SLH---HRKCDPHWSAIKTATNLSTDSKLHLRHLKLLRHLGTGNLGRVFLCQLRDCNNAN  123

Query  1241  FALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLH  1062
             FALKVID+DSLT KKLSHVQ E EILSMLDHPFLPTLYAHLEVSHYTCLL+D+C NGDLH
Sbjct  124   FALKVIDKDSLTNKKLSHVQMEGEILSMLDHPFLPTLYAHLEVSHYTCLLIDYCPNGDLH  183

Query  1061  SLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDL  882
             SLLRKQ GNRL V +V+F+AAEVLVALEYLH++G+VYRDLKPENIL+REDGHIMLSDFDL
Sbjct  184   SLLRKQPGNRLPVQAVKFFAAEVLVALEYLHAVGVVYRDLKPENILLREDGHIMLSDFDL  243

Query  881   CFRADIFPQLETLTRVPLGSGGRKCGF--------LGerrreETVTEFVAEPTTAFSRSC  726
             CF+AD+ P  +        +G  + G          G    E    EFVAEPT A SRSC
Sbjct  244   CFKADVVPTFDRRVHKKRMAGSTRRGGSCFGTVNRRGVEEEEVVEEEFVAEPTAASSRSC  303

Query  725   VGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF  546
             VGTHEYLAPEL+SGNGHGNGVDWWAFGVL+YELL+GTTPFKG SKESTLRNIAS++ V F
Sbjct  304   VGTHEYLAPELLSGNGHGNGVDWWAFGVLVYELLYGTTPFKGGSKESTLRNIASSKHVTF  363

Query  545   YADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP  366
                +GE +   M  A+DL+E+LLVK+PR+RLGC KGAT+IKRHPFF+GIKWPLIR Y+PP
Sbjct  364   RVMEGEGK--GMEEARDLVEKLLVKNPRQRLGCIKGATEIKRHPFFDGIKWPLIRNYKPP  421

Query  365   EPRGLVLKRSKS--KAHVTGVSSPRRRRCWWK-------RLGHLVRIKGS-------KHN  234
             E RGLV K+ KS    H+ G  S  RR+CWW+        LG+L+R KGS        ++
Sbjct  422   EVRGLVAKKGKSHPSGHLLGSVSSPRRKCWWRLWKNGGSGLGNLLRSKGSSPRYYPLSNS  481

Query  233   LNFNHNYYCYATK  195
              ++N NY+ Y  +
Sbjct  482   QHYNGNYHHYKVR  494



>emb|CDY30659.1| BnaC06g10230D [Brassica napus]
Length=491

 Score =   523 bits (1346),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 316/490 (64%), Positives = 367/490 (75%), Gaps = 26/490 (5%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             MED+  Y  ++DLD SFTS A+   T  + SARSSLARSSLTLSFN+RLS  +T    +S
Sbjct  1     MEDEGYYL-ETDLDFSFTSTAT-DRTFTSSSARSSLARSSLTLSFNDRLSTATTPSTTTS  58

Query  1430  NIPN-LHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
                  LH   HR+   +W+AI+AA TLSSDG LHLRHLKL RL+G+GNLGRVFLC LRD 
Sbjct  59    AAATTLH---HRRQDPHWTAIRAATTLSSDGRLHLRHLKLVRLLGTGNLGRVFLCHLRDC  115

Query  1253  EH-SDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
                + FALKVIDRD+LTAKKLSHVQTEAEILSMLDHPFLPTLYA ++ SHYTCLL+D+C 
Sbjct  116   PTPTAFALKVIDRDALTAKKLSHVQTEAEILSMLDHPFLPTLYARIDASHYTCLLIDYCP  175

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
             NGDLHSLLRKQ GNRL V SVRF+A+EVLVALEYLH+LGIVYRDLKPENILIREDGHI+L
Sbjct  176   NGDLHSLLRKQPGNRLPVSSVRFFASEVLVALEYLHALGIVYRDLKPENILIREDGHIVL  235

Query  896   SDFDLCFRADI--------FPQLETLTRVPLGSGGRKCGFLGerrr----eETVTEFVAE  753
             SDFDLCF+AD+        FP++ T    P      + G           EE V EF AE
Sbjct  236   SDFDLCFKADVVPTFRSRRFPRVSTPPSSPRRLRRSRRGGCFSTEVEYEREEIVAEFAAE  295

Query  752   PTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRN  573
             P TAFS+SCVGTHEYLAPEL++GNGHG+GVDWWAFG+ +YE+L GTTPFKG +KE TLR 
Sbjct  296   PVTAFSKSCVGTHEYLAPELVAGNGHGSGVDWWAFGIFLYEMLHGTTPFKGVTKEQTLRK  355

Query  572   IASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKW  393
             IAS+  V F     E E   +  AKDLI++LLVKDP KRLGCA+GA DIKRHPFF GIKW
Sbjct  356   IASSDDVAFPL---ELEEEGIREAKDLIQKLLVKDPMKRLGCARGAQDIKRHPFFEGIKW  412

Query  392   PLIRTYRPPEPRGLVLKRSKSKA-HVTGVSSPRRRRCWWKRLGHLVR---IKGSKHNLNF  225
             PLIR Y+PPE RGLV K +K+ A HVTGVSSPRRR+  W  L +L+R   +KGS   +  
Sbjct  413   PLIRNYKPPEIRGLVKKSTKAHACHVTGVSSPRRRKWLWWALSNLLRSKSLKGSNSKIQS  472

Query  224   NHNYYCYATK  195
             N+NYY Y  K
Sbjct  473   NNNYYHYVGK  482



>ref|XP_009123447.1| PREDICTED: serine/threonine-protein kinase WAG1 [Brassica rapa]
 emb|CDY67737.1| BnaA05g35630D [Brassica napus]
Length=492

 Score =   522 bits (1345),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 318/493 (65%), Positives = 365/493 (74%), Gaps = 31/493 (6%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             MEDD  Y  ++DLD SFTS A+   T  + SARSSLARSSLTLSFN+RLS  +T    +S
Sbjct  1     MEDDGYYL-ETDLDFSFTSTAT-DRTFTSSSARSSLARSSLTLSFNDRLSTATTPSTTTS  58

Query  1430  NIPN-LHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
                  LH   HR+   +W+AI+AA TLSSDG LHLRHLKL RL+G+GNLGRVFLC LRD 
Sbjct  59    AAATTLH---HRRQDPHWTAIRAATTLSSDGRLHLRHLKLVRLLGTGNLGRVFLCHLRDC  115

Query  1253  EH-SDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
                + FALKVIDRD+LTAKKLSHVQTEAEILSMLDHPFLPTLYA ++ SHYTCLL+D+C 
Sbjct  116   PTPTAFALKVIDRDTLTAKKLSHVQTEAEILSMLDHPFLPTLYARIDASHYTCLLIDYCP  175

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
             NGDLHSLLRKQ GNRL V SVRF+AAEVLVALEYLH+LGIVYRDLKPENILIREDGHIML
Sbjct  176   NGDLHSLLRKQPGNRLPVSSVRFFAAEVLVALEYLHALGIVYRDLKPENILIREDGHIML  235

Query  896   SDFDLCFRADIFP-------------QLETLTRVPLGSGGRKCGFLGerrr--eETVTEF  762
             SDFDLCF+AD+ P                         GG  C F  E     EE V EF
Sbjct  236   SDFDLCFKADVVPTFRSRRFRRVSTPPSSPRRLRRSRRGG--CCFSTEVEYEREEIVAEF  293

Query  761   VAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKEST  582
              AEP TAFS+SCVGTHEYLAPEL++GNGHG+GVDWWAFG+ ++E+L GTTPFKG++KE T
Sbjct  294   AAEPVTAFSKSCVGTHEYLAPELVAGNGHGSGVDWWAFGIFLHEMLHGTTPFKGATKEQT  353

Query  581   LRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNG  402
             LR IAS+  V F     E E   +  AKDLI++LLVKDP KRLGCA+GA DIKRHPFF G
Sbjct  354   LRKIASSDDVAFPL---ELEEEGIREAKDLIQKLLVKDPMKRLGCARGAQDIKRHPFFEG  410

Query  401   IKWPLIRTYRPPEPRGLVLKRSKSKA-HVTGVSSPRRRRCWWKRLGHLVR---IKGSKHN  234
             IKWPLIR Y+PPE RGLV K +K+ A HVT VSSPRRR+  W  L +L+R   +KGS   
Sbjct  411   IKWPLIRNYKPPEIRGLVKKSTKAHACHVTAVSSPRRRKWLWWALSNLLRSKSLKGSNSK  470

Query  233   LNFNHNYYCYATK  195
             +  N+NYY Y  K
Sbjct  471   IQSNNNYYHYVGK  483



>ref|XP_006442218.1| hypothetical protein CICLE_v10019874mg [Citrus clementina]
 gb|ESR55458.1| hypothetical protein CICLE_v10019874mg [Citrus clementina]
Length=492

 Score =   521 bits (1343),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 276/424 (65%), Positives = 325/424 (77%), Gaps = 21/424 (5%)
 Frame = -3

Query  1403  HRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALKVI  1224
             HRK   +WSAIKAA  LSSDG LHLRHLKL R +G+GNLGRVFLC LRD   ++FALKVI
Sbjct  74    HRKSDLHWSAIKAATNLSSDGKLHLRHLKLVRHLGTGNLGRVFLCHLRDCTSANFALKVI  133

Query  1223  DRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQ  1044
             D+D L+AKKLSHVQ EAEILSMLDHPFLPTLYAHLEVSHY C L+D+C NGDLH LL KQ
Sbjct  134   DKDLLSAKKLSHVQMEAEILSMLDHPFLPTLYAHLEVSHYICFLIDYCPNGDLHCLLPKQ  193

Query  1043  AGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRADI  864
               NR S+ +VRF+AAEVLV LEYLH+LGI+YRDLKPENIL+REDGHIMLSDFDLCF++D+
Sbjct  194   PNNRFSLQAVRFFAAEVLVGLEYLHALGIIYRDLKPENILLREDGHIMLSDFDLCFQSDV  253

Query  863   FPQLETLTRVPLGSGGRK-----C-GFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLA  702
              P   TL    +GS  R+     C GF   +RR+E V EFVAEP  AFSRSCVGTHEYLA
Sbjct  254   VP---TLVETNVGSATRRRRRKSCNGFGSAKRRQENVMEFVAEPVAAFSRSCVGTHEYLA  310

Query  701   PELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERE  522
             PEL+SGNGHGNGVDWWAFG+L+YEL++G+TPF+G SKESTLRNIAS+  V  +   G +E
Sbjct  311   PELVSGNGHGNGVDWWAFGILIYELMYGSTPFRGGSKESTLRNIASSSRVACHV--GNKE  368

Query  521   TPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLK  342
                 A A+DLI++LLVKD R+RLGCA+GATDIKRHPFF+GIKWPLIR Y+ PE RGLV +
Sbjct  369   EEGTADARDLIDKLLVKDLRERLGCARGATDIKRHPFFDGIKWPLIRNYKTPEVRGLVRR  428

Query  341   RSKSKAHVTGVSSPRRRRCWWKRLGHLVR--IKGSK--HNLNFNH------NYYCYATKI  192
                  +HVTG+ S + RRCWWK+L    +   K S+  HNL+ N        +Y    K 
Sbjct  429   TRSHVSHVTGIGSHKNRRCWWKKLVRFAKRNNKASRNYHNLSLNRSNSNYSQFYYINNKA  488

Query  191   SKIA  180
             +K A
Sbjct  489   TKCA  492



>ref|XP_002300477.2| cucumber protein kinase CsPK3 [Populus trichocarpa]
 gb|EEE85282.2| cucumber protein kinase CsPK3 [Populus trichocarpa]
Length=471

 Score =   520 bits (1340),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 298/448 (67%), Positives = 344/448 (77%), Gaps = 26/448 (6%)
 Frame = -3

Query  1589  PPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSSNIPNLHS  1410
             P D+DLD SFTS A+  T        SS ARSSLTLSFN+ LS T+          +LH 
Sbjct  12    PSDTDLDFSFTSTATDRT------FASSSARSSLTLSFNDGLSTTTMT-----TTSSLH-  59

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
               HRK   +WSAIK A +LS+DG LHLRHLKL R +G+GNLGRVFLC+LRD+ +++FALK
Sbjct  60    --HRKCDQHWSAIKTATSLSTDGRLHLRHLKLLRHLGTGNLGRVFLCQLRDFNNANFALK  117

Query  1229  VIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLLR  1050
             V+D+DSLT KKLS VQ E EILSMLDHPFLPTLYAHLEVSHY+CLL+D+C NGDLHSLLR
Sbjct  118   VMDKDSLTKKKLSQVQMEGEILSMLDHPFLPTLYAHLEVSHYSCLLIDYCPNGDLHSLLR  177

Query  1049  KQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRA  870
             KQ  NRL V +V+F+AAEVLVALEYLHSLG+VYRDLKPENIL+REDGHIMLSDFDLCF+A
Sbjct  178   KQPANRLPVQAVKFFAAEVLVALEYLHSLGVVYRDLKPENILLREDGHIMLSDFDLCFKA  237

Query  869   DIFPQLE-TLTRVPLGSGGRKCGFL-------GerrreETVTEFVAEPTTAFSRSCVGTH  714
             D+ P  +  + R  +    R+ G         G    E    EFVAEPT A SRSCVGTH
Sbjct  238   DVVPTFDRRVHRKRMAGSMRRGGDCFGTFSRRGVVEEEVVEEEFVAEPTEALSRSCVGTH  297

Query  713   EYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADD  534
             EYLAPEL+SGNGHGNGVDWWAFGVL+YELL+GTTPFKG SKESTLRNIAS++ V F+  +
Sbjct  298   EYLAPELLSGNGHGNGVDWWAFGVLVYELLYGTTPFKGGSKESTLRNIASSKHVNFHVME  357

Query  533   GERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRG  354
             GE +   M  AKDLIE+LLVKDPR+RLGC KGATDIKRHPFF GIKWPLIR Y+PPE RG
Sbjct  358   GEGK--GMEEAKDLIEKLLVKDPRQRLGCTKGATDIKRHPFFYGIKWPLIRNYKPPEVRG  415

Query  353   LVLKRSKSKA--HVTGVSSPRRRRCWWK  276
             LV K+ KS +  HV G  S  RR+CWW+
Sbjct  416   LVAKKGKSHSSGHVLGGVSSPRRKCWWR  443



>ref|XP_010542344.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Tarenaya 
hassleriana]
Length=480

 Score =   518 bits (1335),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 305/492 (62%), Positives = 356/492 (72%), Gaps = 35/492 (7%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME+D  Y PD+DLDLSFTS    TTTDRT ++ S+ +  +L+  FNERLS   TA  P++
Sbjct  1     MEEDA-YFPDTDLDLSFTS----TTTDRTFASLSARSSLTLS--FNERLS---TASAPTT  50

Query  1430  NI-PNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
              +  +     HRK   +W+A++AA  LSSDG LHLRHLKL   +G+GNLGRVFLC LRD 
Sbjct  51    TVTASAVGLNHRKCDPHWTAVRAATVLSSDGRLHLRHLKLVSQLGAGNLGRVFLCHLRDC  110

Query  1253  EHS-DFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
              +S  FALKVIDRDSLTAKKL HVQTEAEILS LDHPFLPTLYA ++ SHYTCLL+D+C 
Sbjct  111   PNSTSFALKVIDRDSLTAKKLGHVQTEAEILSGLDHPFLPTLYARIDASHYTCLLIDYCP  170

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
             NGDLHSLLRKQ GNRL V  VRF+AAEVLVALEYLH+LGIVYRDLKPEN+L+REDGHIML
Sbjct  171   NGDLHSLLRKQPGNRLPVHPVRFFAAEVLVALEYLHALGIVYRDLKPENVLLREDGHIML  230

Query  896   SDFDLCFRADIFP------QLETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFS  735
             SDFDLCF+AD+ P         T +     SG    G      REE V++F AEP TAFS
Sbjct  231   SDFDLCFKADVVPTFRTRRIRRTTSCRRRRSGCLCSGRYVTEEREEFVSDFTAEPVTAFS  290

Query  734   RSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAS-TR  558
             RSCVGTHEYLAPEL+SGNGHG+GVDWWAFG+ +YELL+GTTPFKG  KE TLRNIAS  +
Sbjct  291   RSCVGTHEYLAPELVSGNGHGSGVDWWAFGIFLYELLYGTTPFKGGCKEYTLRNIASPAK  350

Query  557   GVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRT  378
              V F A     E   M  A DLI++LLVKDPR+RLGCA+GA DIKRHPFF GIKWPLIR 
Sbjct  351   NVVFPAT----EEAGMEEAMDLIQKLLVKDPRERLGCARGAQDIKRHPFFEGIKWPLIRN  406

Query  377   YRPPEPRGLVLKRS--KSKAHVTGVSSPRRRRCW-WKRLGHLVRIKGSKHN--LNFNHNY  213
             Y+ PE RGL+ K +      HVT V SPRRR+ W W  + HL+R K S  +   +   NY
Sbjct  407   YKAPEVRGLMKKTTAMSHAGHVTAV-SPRRRKIWLWSVMSHLLRSKNSSRSGKSHSTSNY  465

Query  212   Y------CYATK  195
             Y      CYA +
Sbjct  466   YHHSVSKCYANE  477



>ref|XP_011030776.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Populus 
euphratica]
Length=497

 Score =   517 bits (1332),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 316/489 (65%), Positives = 369/489 (75%), Gaps = 30/489 (6%)
 Frame = -3

Query  1583  DSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSSNIPNLHSRP  1404
             D+DLD SF S A+   T  + SARSSLARSSLTLSFN+RLS TST    ++   +LH   
Sbjct  14    DTDLDFSFNSTAT-DRTFASSSARSSLARSSLTLSFNDRLSTTSTTTTTTTIKNSLH---  69

Query  1403  HRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALKVI  1224
             HRK   +WSAIK A  LS+DG LHLRHLKL R +G+GNLGRVFLC+LRD  +++FALKVI
Sbjct  70    HRKWDPHWSAIKTATNLSTDGKLHLRHLKLLRHLGTGNLGRVFLCQLRDCNNANFALKVI  129

Query  1223  DRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQ  1044
             D+DSLT KKLSHVQ E EILSMLDHPFLPTLYAHLEVSHYTCLL+D+C NGDLHSLLRKQ
Sbjct  130   DKDSLTNKKLSHVQMEGEILSMLDHPFLPTLYAHLEVSHYTCLLIDYCPNGDLHSLLRKQ  189

Query  1043  AGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRADI  864
              GNRL V +V+F+AAEVLVALEYLH++G+VYRDLKPENIL+REDGHIMLSDFDLCF+AD+
Sbjct  190   PGNRLPVQAVKFFAAEVLVALEYLHAVGVVYRDLKPENILLREDGHIMLSDFDLCFKADV  249

Query  863   FPQLE--TLTRVPLGSGGRKCGFLGerr------reETVTEFVAEPTTAFSRSCVGTHEY  708
              P  +     +   GS  R  G  G          E    EFVAEPT A SRSCVGTHEY
Sbjct  250   VPTFDRRVHKKRMTGSTRRGGGCFGTVNRRGVEEEEVVEEEFVAEPTAASSRSCVGTHEY  309

Query  707   LAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGE  528
             LAPEL+SGNGHGNGVDWWAFGVL+YELL+G TPFKG SKESTLRNIAS++ V F   +GE
Sbjct  310   LAPELLSGNGHGNGVDWWAFGVLVYELLYGMTPFKGGSKESTLRNIASSKHVTFRVMEGE  369

Query  527   RETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLV  348
              +   M  AKDL+E+LLVK+P +RLGC KGATDIKRHPFF+GIKWPLIR Y+PPE RGL 
Sbjct  370   GK--GMEEAKDLVEKLLVKNPMQRLGCIKGATDIKRHPFFDGIKWPLIRNYKPPEVRGLP  427

Query  347   LKRSKS--KAHVTG-VSSPRRRRCW--WKR----LGHLVRIKGS-------KHNLNFNHN  216
              K+ KS    H+ G VSSPRRR  W  WK+    LG+L+R KGS        ++ ++N N
Sbjct  428   AKKGKSHPSGHLLGSVSSPRRRGWWRLWKKGGSGLGNLLRSKGSSARYYPLSNSQHYNGN  487

Query  215   YYCYATKIS  189
             Y+ Y  + S
Sbjct  488   YHHYKVRKS  496



>ref|XP_006392761.1| hypothetical protein EUTSA_v10011428mg [Eutrema salsugineum]
 gb|ESQ30047.1| hypothetical protein EUTSA_v10011428mg [Eutrema salsugineum]
Length=492

 Score =   516 bits (1329),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 313/490 (64%), Positives = 362/490 (74%), Gaps = 26/490 (5%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             MEDD  Y  D+DLDLSFTS A+   T  + SARSSLARSSLTLSFN+RLS  +T    +S
Sbjct  1     MEDDGYYL-DTDLDLSFTSTAT-DRTFASSSARSSLARSSLTLSFNDRLSTATTPSTTTS  58

Query  1430  NIPN-LHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             +    LH   HR++  +W+AI+AA TLSSDG LHLRH KL R +G+GNLGRVFLC LRD 
Sbjct  59    SAATTLH---HRRYDPHWTAIRAATTLSSDGRLHLRHFKLVRHLGTGNLGRVFLCHLRDC  115

Query  1253  EH-SDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
              + + FALKVIDRD+LTAKKLSHVQTEAEILS+LDHPFLPTLYA ++ SHYTCLL+D+C 
Sbjct  116   PNPTGFALKVIDRDALTAKKLSHVQTEAEILSLLDHPFLPTLYARIDASHYTCLLIDYCP  175

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
             NGDLHSLLRKQ GNRL +  VRF+AAEVLVALEYLH+LGIVYRDLKPENILIREDGHI+L
Sbjct  176   NGDLHSLLRKQPGNRLPISPVRFFAAEVLVALEYLHALGIVYRDLKPENILIREDGHIIL  235

Query  896   SDFDLCFRADIFPQL------------ETLTRVPLGSGGRKCGFLGerrreETVTEFVAE  753
             SDFDLCF++D+ P                  R+    GG       E  REE V EF AE
Sbjct  236   SDFDLCFKSDVVPTFRSRRFRRVSSPSSNRRRLSRRRGGCFFSTEVEYEREEIVAEFAAE  295

Query  752   PTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRN  573
             P TAFSRSCVGTHEYLAPE+++GNGHG+GVDWWAFG+ +YELL GTTPFKG +KE TLRN
Sbjct  296   PVTAFSRSCVGTHEYLAPEIVAGNGHGSGVDWWAFGIFLYELLHGTTPFKGGTKEQTLRN  355

Query  572   IASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKW  393
             I S   V F  +  E     +  AKDLIE+LLVKDP KRLGCA+GA DIKRHPFF GIKW
Sbjct  356   ILSNDDVAFPLELTEE---GITEAKDLIEKLLVKDPMKRLGCARGAQDIKRHPFFEGIKW  412

Query  392   PLIRTYRPPEPRGLVLK-RSKSKAHVTGVSSPRRRRCWWKRLGHLVR---IKGSKHNLNF  225
             PLIR Y+PPE RGLV K ++ +  HVT VSSPRRR+  W  L HL+R   +K S      
Sbjct  413   PLIRNYKPPEIRGLVKKTKAHAGGHVTTVSSPRRRKWLWWALSHLLRGKSLKRSNSQTQS  472

Query  224   NHNYYCYATK  195
             N+NYY Y  K
Sbjct  473   NNNYYRYVGK  482



>emb|CBI21826.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   513 bits (1320),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 299/463 (65%), Positives = 342/463 (74%), Gaps = 50/463 (11%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITT-----TDrtlsarsslarssltlSFNERLSATSTA  1446
             M+++  +P D+D+D SFTS  S  T     T  + SAR+SLARSSLTLSFNE  S  ST+
Sbjct  1     MDEETFFPSDTDIDFSFTSTTSSVTTATDRTFASSSARTSLARSSLTLSFNE--SRLSTS  58

Query  1445  GNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCR  1266
                ++   NLH RPHRK   +WSAI AA TLSSDGALHLRHLKL R +G+GNLGRVFLCR
Sbjct  59    TAGATAAANLHHRPHRKSDPHWSAINAATTLSSDGALHLRHLKLLRHLGTGNLGRVFLCR  118

Query  1265  LRDYEHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMD  1086
             LRD + ++FALKV+DRD+LT KKLSHVQ EA+ILS LDHPFLPTLYAHLEVSHYTCLL+D
Sbjct  119   LRDCDAANFALKVVDRDALTNKKLSHVQMEADILSALDHPFLPTLYAHLEVSHYTCLLID  178

Query  1085  FCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGH  906
             +C  GDLHSLLRKQ GNRL VD+VRFYAAEVLVALEYLH+ G+VYRDLKPEN+L+REDGH
Sbjct  179   YCPGGDLHSLLRKQPGNRLPVDAVRFYAAEVLVALEYLHATGVVYRDLKPENVLLREDGH  238

Query  905   IMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSC  726
             IMLSDFDLCF+AD                                      PT AFSRSC
Sbjct  239   IMLSDFDLCFKAD--------------------------------------PTDAFSRSC  260

Query  725   VGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF  546
             VGTHEYLAPEL++G GHGNGVDWWAFGV ++E+L GTTPFKG SKE+TLRNIASTR V+F
Sbjct  261   VGTHEYLAPELVAGTGHGNGVDWWAFGVFIFEMLHGTTPFKGGSKEATLRNIASTRQVKF  320

Query  545   YADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP  366
              A D E +   +  A+DLIERLLVKDPRKRLG ++GATDIKRHPFFNGIKWPLIRTY PP
Sbjct  321   QARDEEEKGVGITEARDLIERLLVKDPRKRLGFSRGATDIKRHPFFNGIKWPLIRTYTPP  380

Query  365   EPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLVRIKGSKH  237
             E RG+  K     +HVTGV S  R   WW       + KGSKH
Sbjct  381   EVRGVARKTKAHVSHVTGVPS-ERGHWWWNS----KKNKGSKH  418



>ref|XP_008451816.1| PREDICTED: serine/threonine-protein kinase WAG1 [Cucumis melo]
Length=471

 Score =   510 bits (1313),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 306/478 (64%), Positives = 359/478 (75%), Gaps = 17/478 (4%)
 Frame = -3

Query  1610  MEDDI-LYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNE-RLSATSTAGNP  1437
             MEDD  ++PPDSDLD SFTS  +  T   + SAR+SLARSSLTLSFNE RLSA + A   
Sbjct  1     MEDDYSIFPPDSDLDFSFTSTTTDRTFTTSSSARTSLARSSLTLSFNESRLSAAAAA---  57

Query  1436  SSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD  1257
                   L+ RPH +  S+WSAI+AA TLSSDG LHLRHLKL R +G+GNLGRVFLC LRD
Sbjct  58    ------LNLRPHHRSDSHWSAIRAATTLSSDGHLHLRHLKLIRHLGTGNLGRVFLCHLRD  111

Query  1256  YEHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
              +H+ FALKV+D+++L+ KKLS VQTEAEIL+ LDHPFLPTLYA L+VSHYTCLL+D+C 
Sbjct  112   NDHASFALKVVDKEALSNKKLSQVQTEAEILASLDHPFLPTLYARLDVSHYTCLLIDYCP  171

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
              GDLHSLLRKQ G+R SV + RF+AAEVLVALEYLH+LGIVYRDLKPEN+L+REDGH+ML
Sbjct  172   AGDLHSLLRKQPGSRFSVAAARFFAAEVLVALEYLHALGIVYRDLKPENVLLREDGHVML  231

Query  896   SDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGe-rrreETVTEFVAEPTTAFSRSCVG  720
             SDFDLCF++D+ P   T TR    + G   G+       EE V EFVAEPT AFS+SCVG
Sbjct  232   SDFDLCFKSDVVPTFHTWTRPGPKATGCCLGWRTTPDDEEEIVGEFVAEPTAAFSKSCVG  291

Query  719   THEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYA  540
             THEYLAPEL+SG GHGNGVDWWAFGV +YELL GTTPFKG +KE TLRNIAS+ GV+F A
Sbjct  292   THEYLAPELVSGGGHGNGVDWWAFGVFVYELLHGTTPFKGVNKEGTLRNIASSEGVKFRA  351

Query  539   DDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEP  360
                  E   M  A+DLIERLLVKDP  RLG  KGAT+IKRHPFF GIKWPLIRTYR PE 
Sbjct  352   A--GEEEEGMGEARDLIERLLVKDPAMRLGSEKGATEIKRHPFFEGIKWPLIRTYRVPEV  409

Query  359   RGLVLKRSKSKAHVTGVSSPRRRRCWW---KRLGHLVRIKGSKHNLNFNHNYYCYATK  195
              G++ K     +HV GVS   RRR WW   K + + +   GS    + N N+Y Y++K
Sbjct  410   YGMMRKGRSQVSHVRGVSQRIRRRGWWNWRKVISNGLIKNGSCSKSHSNTNFYSYSSK  467



>ref|XP_007022318.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY13843.1| Kinase superfamily protein [Theobroma cacao]
Length=474

 Score =   508 bits (1307),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 306/458 (67%), Positives = 343/458 (75%), Gaps = 23/458 (5%)
 Frame = -3

Query  1604  DDILYPPDSDLDLSFTSCASITTTDrtl---sarsslarssltlSFNERLSATSTAGNPS  1434
             D+  Y PD+DLD SFTS    TTTDRT+   SARSSLARSSLTLSFNE   + ST     
Sbjct  2     DEETYFPDTDLDFSFTS----TTTDRTVPSSSARSSLARSSLTLSFNESRLSCSTTTTTP  57

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             SNI  LH   HRK    WSAIKAA  LSSD  LHLRHLKL R +G+GNLGRVFLC+LRD 
Sbjct  58    SNITTLH---HRKWDPRWSAIKAATNLSSDRNLHLRHLKLIRHLGTGNLGRVFLCQLRDC  114

Query  1253  EHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
               + FALKVIDRD+L+ KKLSHVQ EAEILSMLDHPFLPTLYAH++ SHYTCLL+DFC N
Sbjct  115   NSATFALKVIDRDTLSNKKLSHVQMEAEILSMLDHPFLPTLYAHIQASHYTCLLIDFCPN  174

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ GNR  + +VRF+AAEVLVALEYLH+LGIVYRDLKPENIL+REDGHIMLS
Sbjct  175   GDLHSLLRKQPGNRFPLAAVRFFAAEVLVALEYLHALGIVYRDLKPENILLREDGHIMLS  234

Query  893   DFDLCFRADIFPQLETLTRVPLGS------GGRKCGFLGerrreETVTEFVAEPTTAFSR  732
             DFDLCF+AD+ P  +  +R    S      GG           EE   EFVAEP TAFSR
Sbjct  235   DFDLCFKADVVPTFKFQSRKSRKSRQNCFTGGCFGSVADSGEEEEVDPEFVAEPVTAFSR  294

Query  731   SCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGV  552
             SCVGTHEYLAPEL+SGNGHGNGVDWWAFGV +YELL+GTTPFKG SK+STLRNIAS+R V
Sbjct  295   SCVGTHEYLAPELVSGNGHGNGVDWWAFGVFVYELLYGTTPFKGGSKDSTLRNIASSRQV  354

Query  551   RFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYR  372
             RF     E E    A A DLI +LLVKDPR+RLGC +GA DIKRHPFF+GIKWPLIR Y+
Sbjct  355   RFL-HVTEMEEAGTAEANDLIGKLLVKDPRRRLGCTRGAQDIKRHPFFDGIKWPLIRHYK  413

Query  371   PPEPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLV  258
             PPE  G V ++     HV      +RRR  WK L +L+
Sbjct  414   PPEVVGGVARKRGHVGHV------KRRRWLWKGLDYLM  445



>ref|XP_010487236.1| PREDICTED: serine/threonine-protein kinase WAG2 [Camelina sativa]
Length=482

 Score =   507 bits (1305),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 295/490 (60%), Positives = 359/490 (73%), Gaps = 34/490 (7%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME +  Y PD+DLDLSFTS    T TDRT ++ S+ +  +L+  FN+RLS +S     S 
Sbjct  1     MEQEDFYFPDTDLDLSFTS----TVTDRTFASSSARSSLTLS--FNDRLSTSSAVTTSSV  54

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             +   ++   HR+H  +WSAIK+A  LSSDG +HLRHLKL R +GSGNLGRVFLC LRD  
Sbjct  55    SSSTIN---HRRHDPHWSAIKSAKLLSSDGNIHLRHLKLIRHLGSGNLGRVFLCNLRD-S  110

Query  1250  HSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
              + FALKVIDR+ LT  KKLS V+TEAEILS+LDHPFLPTLYA ++ SHYTCLL+D+  N
Sbjct  111   SARFALKVIDRNCLTTEKKLSQVETEAEILSLLDHPFLPTLYARIDESHYTCLLIDYAPN  170

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLH+LLRKQ GNRL +  VRF+AAEVLVALEYLH++GIVYRDLKPEN+L+REDGH+MLS
Sbjct  171   GDLHTLLRKQPGNRLPIQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLS  230

Query  893   DFDLCFRADIFPQLE---------TLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTA  741
             DFDLCF++D+ P  +         + +     SG        +  REE V+EF AEP TA
Sbjct  231   DFDLCFKSDVVPTFKSRRYRRTSSSPSLRRRRSGCFSVQTEEKYEREEIVSEFAAEPVTA  290

Query  740   FSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAST  561
             FSRSCVGTHEYLAPEL+SGNGHG+GVDWWAFG+ +YE+L GTTPFKG SKE TLRNI ST
Sbjct  291   FSRSCVGTHEYLAPELVSGNGHGSGVDWWAFGIFLYEMLHGTTPFKGESKEQTLRNIVST  350

Query  560   RGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIR  381
                  +  DG+     +  AKDLIE+L VKDPRKRLGCA+GA DIKRHPFF+GIKWPLIR
Sbjct  351   TKTASFHVDGD----LVEEAKDLIEKLFVKDPRKRLGCARGAQDIKRHPFFDGIKWPLIR  406

Query  380   TYRPPEP-RGLVLKRSKSKAHVTGVS--SPRRRRCW-WKRLGHLVRIK----GSKHNLNF  225
              Y+PPE  RGLV+K+S ++AHV  V+  SPRRR+ + W+ L  L+R K    GSK+    
Sbjct  407   HYKPPEEVRGLVIKKSSTRAHVGHVTAVSPRRRKSFLWRALSFLLRGKSSSGGSKNQS--  464

Query  224   NHNYYCYATK  195
             N NYY Y  K
Sbjct  465   NSNYYHYVGK  474



>ref|XP_008390698.1| PREDICTED: serine/threonine-protein kinase WAG1 [Malus domestica]
Length=491

 Score =   507 bits (1305),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 281/437 (64%), Positives = 329/437 (75%), Gaps = 18/437 (4%)
 Frame = -3

Query  1478  FNERLSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVG  1299
             FN+RLS TST    ++N   LH   H K    W+AIKAA  +SSD  LHLRHLKL R VG
Sbjct  56    FNDRLSTTSTTTTTTTN--PLH---HXKSDPRWTAIKAATAISSDRTLHLRHLKLLRHVG  110

Query  1298  SGNLGRVFLCRLRD-YEHSD---FALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTL  1131
             +GNLGRVFLCRLRD +++ D   FALKV+D+D LT KKL HV TEAEILSMLDHPFLPTL
Sbjct  111   TGNLGRVFLCRLRDDHDNPDAATFALKVVDKDLLTPKKLGHVSTEAEILSMLDHPFLPTL  170

Query  1130  YAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVY  951
             YA ++VSHYTCLL+D+C NGDLH+LL +Q  NRL V +VRF+AAEVL+ALEYLH+LG+VY
Sbjct  171   YARIDVSHYTCLLIDYCPNGDLHNLLLRQPLNRLPVSAVRFFAAEVLIALEYLHALGVVY  230

Query  950   RDLKPENILIREDGHIMLSDFDLCFRADIFPQLE----TLTRVPLGSGGRKCGFLGerrr  783
             RDLKPENIL+REDGH+MLSDFDLCF+ D+ P L+      TR     G   C      ++
Sbjct  231   RDLKPENILLREDGHVMLSDFDLCFKGDVNPTLQHRRVQKTRPTKRKGTYSCFGSRREQQ  290

Query  782   eETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFK  603
             EE V EFVAEPTTAFS+SCVGTHEYLAPELISGNGHGNGVDWWAFGV +YELL GTTPFK
Sbjct  291   EEMVAEFVAEPTTAFSKSCVGTHEYLAPELISGNGHGNGVDWWAFGVFIYELLHGTTPFK  350

Query  602   GSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIK  423
             G +KE+TLRNIAS+ GVRF     E E   M  A+DLIERLLV+DPR+RLGCAKGAT+IK
Sbjct  351   GVTKENTLRNIASSSGVRFRV--AEEEEEGMKEARDLIERLLVRDPRRRLGCAKGATEIK  408

Query  422   RHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLVRIKGS  243
             +HPFF GI W LIRTYRPPE  GL  K SK   ++    + +RR+ WWK LG  V+ + S
Sbjct  409   QHPFFGGINWALIRTYRPPEVXGLRRKPSKPHGNILXGPTQKRRKSWWKALGQFVKTRSS  468

Query  242   ---KHNLNFNHNYYCYA  201
                K+N + N NYY Y 
Sbjct  469   SNYKNNRHSNSNYYQYV  485



>ref|XP_006297552.1| hypothetical protein CARUB_v10013575mg [Capsella rubella]
 gb|EOA30450.1| hypothetical protein CARUB_v10013575mg [Capsella rubella]
Length=482

 Score =   506 bits (1302),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 294/494 (60%), Positives = 362/494 (73%), Gaps = 34/494 (7%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME +  Y PD+DLDLSFTS    T TDRT ++ S+ +  +L+  FN+RLS +S     S+
Sbjct  1     MEQEDFYFPDTDLDLSFTS----TVTDRTFASSSARSSLTLS--FNDRLSTSSAVTTSSA  54

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             +   ++   HR+H  +WSAIK+A  LSSDG +HLRHLKL R +G+GNLGRVFLC LRD  
Sbjct  55    SSSTVN---HRRHDPHWSAIKSAKLLSSDGNIHLRHLKLIRHLGTGNLGRVFLCNLRD-S  110

Query  1250  HSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
              + FALKVIDR+ LT  KKLS V+TEAEILS+LDHPFLPTLYA ++ SHYTCLL+D+  N
Sbjct  111   SARFALKVIDRNCLTTEKKLSQVETEAEILSLLDHPFLPTLYARIDESHYTCLLIDYAPN  170

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ GN L   +VRF+AAEVLVALEYLH++GIVYRDLKPEN+L+REDGH+MLS
Sbjct  171   GDLHSLLRKQPGNCLPNQAVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLS  230

Query  893   DFDLCFRADIFPQLE---------TLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTA  741
             DFDLCF++D+ P  +         + +     SG        +  REE V EF AEP TA
Sbjct  231   DFDLCFKSDVVPTFKSRRYRRTSSSPSLRRRRSGCFSVATEEKYEREEMVAEFAAEPVTA  290

Query  740   FSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAS-  564
             FSRSCVGTHEYLAPEL+SGNGHG+GVDWWAFG+ +YELL+GTTPFKG SKE TLRNI S 
Sbjct  291   FSRSCVGTHEYLAPELVSGNGHGSGVDWWAFGIFLYELLYGTTPFKGESKEQTLRNIVST  350

Query  563   TRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLI  384
             T+   F+ D  + E      AKDLIE+LLVKDPRKRLGCA+GA DIKRHPFF+GIKWPLI
Sbjct  351   TKTASFHVDGDDSE-----EAKDLIEKLLVKDPRKRLGCARGAQDIKRHPFFDGIKWPLI  405

Query  383   RTYRPPEP-RGLVLKRSKSKA---HVTGVSSPRRRRCWWKRLGHLVRIK----GSKHNLN  228
             R Y+PPE  RGLV+K+S ++A   HVT VS  RR+   W+ L +L+R K    GSK+  N
Sbjct  406   RHYKPPEEVRGLVIKKSTTRAHAGHVTAVSPRRRKSFLWRALSYLLRGKSSSGGSKNQSN  465

Query  227   FNHNYYCYATKISK  186
              N+ +Y   + +S+
Sbjct  466   SNYYHYVGKSYVSR  479



>gb|KFK38803.1| hypothetical protein AALP_AA3G162000 [Arabis alpina]
Length=481

 Score =   506 bits (1302),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 297/493 (60%), Positives = 362/493 (73%), Gaps = 33/493 (7%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME++  Y PD+DLDLSFTS    T TDRT ++ S  +  + +  FN+RLS +S     SS
Sbjct  1     MEEEDFYFPDTDLDLSFTS----TVTDRTFASSSGRSSLTSS--FNDRLSTSSAVTTSSS  54

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
                   +  HR+H  +WSAIK+A  LSSDG +HLRHLKL R +G+GNLGRVFLC LR   
Sbjct  55    TS----TINHRRHDPHWSAIKSAKHLSSDGNIHLRHLKLIRHLGTGNLGRVFLCNLRGDS  110

Query  1250  HSDFALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
              + FALKVIDR++LT AKKLS V+TEAEILS+LDHPFLPTLYA ++ SHYTCLL+D+  N
Sbjct  111   SARFALKVIDRNNLTTAKKLSQVETEAEILSLLDHPFLPTLYARIDESHYTCLLIDYAPN  170

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ GNRL +  VRF+AAEVLVALEYLH++GIVYRDLKPEN+L+REDGH+MLS
Sbjct  171   GDLHSLLRKQPGNRLPIQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLS  230

Query  893   DFDLCFRADIFPQLE------TLTRVPLGSGGRKCGFLGerr--reETVTEFVAEPTTAF  738
             DFDLCF++D+ P  +      T +   L      C F GE++  REE V EF AEP TAF
Sbjct  231   DFDLCFKSDVVPTFKSRRYRRTCSSPSLRRRKSGCLFSGEKKYEREEIVAEFTAEPVTAF  290

Query  737   SRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTR  558
             SRSCVGTHEYLAPELISGNGHG+GVDWWAFG+ +YELL+GTTPFKG SKE TLRNIAST 
Sbjct  291   SRSCVGTHEYLAPELISGNGHGSGVDWWAFGIFLYELLYGTTPFKGGSKEQTLRNIASTS  350

Query  557   G--VRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLI  384
                V F+ +  + E      A+DLIE+LLVKDPRKRLGCA+GA DIKRH FF+GIKWPLI
Sbjct  351   NNTVNFHVEGCDSE-----EARDLIEKLLVKDPRKRLGCARGAQDIKRHAFFDGIKWPLI  405

Query  383   RTYRPPEP-RGLVLKRSKSK--AHVTGVSSPRRRRCWWKRLGHLVRIK----GSKHNLNF  225
             R Y+PPE  RGLV+K+S     +HV  VS  RR+   W+ L +L+R K    GSK+  N 
Sbjct  406   RHYKPPEEVRGLVVKKSPRSHVSHVIAVSPRRRKWVLWRALSYLLRGKSSNGGSKNQSNS  465

Query  224   NHNYYCYATKISK  186
             N+ +Y   + +S+
Sbjct  466   NYYHYIGKSHVSR  478



>ref|NP_188054.1| protein kinase WAG2 [Arabidopsis thaliana]
 sp|Q9LUL2.1|WAG2_ARATH RecName: Full=Serine/threonine-protein kinase WAG2 [Arabidopsis 
thaliana]
 dbj|BAB01042.1| protein kinase [Arabidopsis thaliana]
 gb|AAM67139.1| putative protein kinase [Arabidopsis thaliana]
 gb|ABJ98574.1| At3g14370 [Arabidopsis thaliana]
 gb|AEE75509.1| protein kinase WAG2 [Arabidopsis thaliana]
Length=480

 Score =   505 bits (1301),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 294/489 (60%), Positives = 358/489 (73%), Gaps = 34/489 (7%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME +  Y PD+DLDLSFTS    TTTDRT ++ S+    +L+  FN+RLS +S     S+
Sbjct  1     MEQEDFYFPDTDLDLSFTS----TTTDRTFASSSARTSLTLS--FNDRLSTSSAVTTSST  54

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             +  +++   HR+H  +WSAIK+A  LSSDG +HLRHLKL R +G+GNLGRVFLC LRD  
Sbjct  55    SSSSVN---HRRHDPHWSAIKSAKLLSSDGNIHLRHLKLIRHLGTGNLGRVFLCNLRD-S  110

Query  1250  HSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
              + FALKVIDR+ LT  KKLS V+TEAEILS+LDHPFLPTLYA ++ SHYTCLL+D+  N
Sbjct  111   SARFALKVIDRNCLTTEKKLSQVETEAEILSLLDHPFLPTLYARIDESHYTCLLIDYAPN  170

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ GNRL +  VRF+AAEVLVALEYLH++GIVYRDLKPEN+L+REDGH+MLS
Sbjct  171   GDLHSLLRKQPGNRLPIQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLS  230

Query  893   DFDLCFRADIFPQLE---------TLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTA  741
             DFDLCF++D+ P  +         + +     SG        +  REE V+EF AEP TA
Sbjct  231   DFDLCFKSDVVPTFKSRRYRRSSSSPSLRRRRSGCFSVAAEKKYEREEIVSEFAAEPVTA  290

Query  740   FSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAST  561
             FSRSCVGTHEYLAPEL+SGNGHG+GVDWWAFG+ +YELL+GTTPFKG SKE TLRNI ST
Sbjct  291   FSRSCVGTHEYLAPELVSGNGHGSGVDWWAFGIFLYELLYGTTPFKGESKEQTLRNIVST  350

Query  560   RGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIR  381
                  +  DG+     +  A+DLIE+LLVKDPRKRLGCA+GA DIKRHPFF+GIKWPLIR
Sbjct  351   TKTASFHMDGD-----LDEARDLIEKLLVKDPRKRLGCARGAQDIKRHPFFDGIKWPLIR  405

Query  380   TYRPPEP-RGLVLKRSKS--KAHVTGVSSPRRRRCWWKRLGHLVRIK----GSKHNLNFN  222
              Y+PPE  RGLV+K+S     +HV  VS  RR+   W+ L +L+R K    GSK+    N
Sbjct  406   HYKPPEEVRGLVIKKSTRPHASHVIAVSPRRRKSFLWRALSYLLRGKSSSGGSKN--QSN  463

Query  221   HNYYCYATK  195
              NYY Y  K
Sbjct  464   SNYYHYVGK  472



>ref|XP_010501866.1| PREDICTED: serine/threonine-protein kinase WAG2-like isoform 
X1 [Camelina sativa]
Length=482

 Score =   505 bits (1301),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 296/490 (60%), Positives = 356/490 (73%), Gaps = 34/490 (7%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME    Y PD+DLDLSFTS    T TDRT ++ S+ +  +L+  FN+RLS +S     S 
Sbjct  1     MEQVDFYFPDTDLDLSFTS----TVTDRTFASSSARSSLTLS--FNDRLSTSSAVTTSSV  54

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             +   ++   HR+H  +WSAIK+A  LSSDG +HLRHLKL R +GSGNLGRVFLC LRD  
Sbjct  55    SSSTVN---HRRHDPHWSAIKSAKLLSSDGNIHLRHLKLIRHLGSGNLGRVFLCNLRD-S  110

Query  1250  HSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
              + FALKVIDR+ LT  KKLS V+TEAEILSMLDHPFLPTLYA ++ SHYTCLL+D+  N
Sbjct  111   SARFALKVIDRNCLTTEKKLSQVETEAEILSMLDHPFLPTLYARIDESHYTCLLIDYAPN  170

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLH+LLRKQ GNRL +  VRF+AAEVLVALEYLH++GIVYRDLKPEN+L+REDGH+MLS
Sbjct  171   GDLHTLLRKQPGNRLPIQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLS  230

Query  893   DFDLCFRADIFPQLE---------TLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTA  741
             DFDLCF++D+ P  +         + +     SG        +  REE V+EF AEP TA
Sbjct  231   DFDLCFKSDVVPTFKSRRYRRTSSSPSLRRRRSGCFSVQTEEKYEREEIVSEFAAEPVTA  290

Query  740   FSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAST  561
             FSRSCVGTHEYLAPEL+SGNGHG+GVDWWAFG+ +YE+L GTTPFKG SKE TLRNI ST
Sbjct  291   FSRSCVGTHEYLAPELVSGNGHGSGVDWWAFGIFLYEMLQGTTPFKGESKEQTLRNIVST  350

Query  560   RGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIR  381
                  +  DG+     +  AKDLIE+LLVKDPRKRLGCA+GA DIKRHPFF+GIKWPLIR
Sbjct  351   TKTASFHVDGD----LVEKAKDLIEKLLVKDPRKRLGCARGAQDIKRHPFFDGIKWPLIR  406

Query  380   TYRPPEP-RGLVLKRSKSKA---HVTGVSSPRRRRCWWKRLGHLVRIK----GSKHNLNF  225
              Y+PPE  RGLV+K+S ++A   HVT VS  RR+   W+ L  L+R K    GSK+    
Sbjct  407   HYKPPEEVRGLVIKKSSTRAHAGHVTAVSPRRRKSFLWRALSFLLRGKSSSGGSKNQS--  464

Query  224   NHNYYCYATK  195
             N NYY Y  K
Sbjct  465   NSNYYHYVGK  474



>ref|NP_001267622.1| protein kinase PINOID 2-like [Cucumis sativus]
 dbj|BAA82168.1| CsPK3 [Cucumis sativus]
 dbj|BAA93704.1| cucumber protein kinase CsPK3 [Cucumis sativus]
 gb|KGN53527.1| hypothetical protein Csa_4G064100 [Cucumis sativus]
Length=471

 Score =   505 bits (1300),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 301/478 (63%), Positives = 357/478 (75%), Gaps = 17/478 (4%)
 Frame = -3

Query  1610  MEDDI-LYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNE-RLSATSTAGNP  1437
             MEDD  ++PPDSDLD SFTS  +  T   + SAR+SLARSSLTLSFNE RLSA + A   
Sbjct  1     MEDDYSIFPPDSDLDFSFTSTTTDRTFTTSSSARTSLARSSLTLSFNESRLSAAAAA---  57

Query  1436  SSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD  1257
                   L+ RP+ +  S+WSAI+AA TLSSDG LHLRHLKL R +G+GNLGRVFLC LRD
Sbjct  58    ------LNLRPYHRSDSHWSAIRAATTLSSDGHLHLRHLKLIRHLGTGNLGRVFLCHLRD  111

Query  1256  YEHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
              +H+ FALKV+D+++L+ KKL  VQTEAEIL+ LDHPFLPTLYA L+VSHYTCLL+D+C 
Sbjct  112   NDHASFALKVVDKEALSNKKLLQVQTEAEILASLDHPFLPTLYARLDVSHYTCLLIDYCP  171

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
              GDLHSLLRKQ G+R SV + RF+AAEVLVALEYLH+LGIVYRDLKPEN+L+REDGH+ML
Sbjct  172   AGDLHSLLRKQPGSRFSVAAARFFAAEVLVALEYLHALGIVYRDLKPENVLLREDGHVML  231

Query  896   SDFDLCFRADIFPQLETLTRVPLGSGGRKCGF-LGerrreETVTEFVAEPTTAFSRSCVG  720
             SDFDLCF++D+ P   T TR    + G   G+       EE V EFVAEPT+AFS+SCVG
Sbjct  232   SDFDLCFKSDVVPTFHTWTRPGPQATGSCFGWRTSPEFEEEIVGEFVAEPTSAFSKSCVG  291

Query  719   THEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYA  540
             THEYLAPEL++G GHGNGVDWWAFGV +YELL GTTPFKG +KE TLRNIAS+ GV+F  
Sbjct  292   THEYLAPELVTGGGHGNGVDWWAFGVFVYELLHGTTPFKGVNKEGTLRNIASSEGVKFRG  351

Query  539   DDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEP  360
                  E   M  A+DLIERLLVKDP +RLG  KGAT+IKRHPFF GIKWPLIRTYR PE 
Sbjct  352   G--GEEEGGMGEARDLIERLLVKDPGRRLGWEKGATEIKRHPFFEGIKWPLIRTYRVPEV  409

Query  359   RGLVLKRSKSKAHVTGVSSPRRRRCWW---KRLGHLVRIKGSKHNLNFNHNYYCYATK  195
              G++ K     +HV  V+   RRR WW   K +   +   GS    + N NYY Y++K
Sbjct  410   YGMMRKGRAQVSHVREVTERIRRRGWWNWRKVMRKRLIKNGSCSKSHSNTNYYSYSSK  467



>ref|XP_006407088.1| hypothetical protein EUTSA_v10020629mg [Eutrema salsugineum]
 gb|ESQ48541.1| hypothetical protein EUTSA_v10020629mg [Eutrema salsugineum]
Length=479

 Score =   504 bits (1297),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 298/491 (61%), Positives = 362/491 (74%), Gaps = 39/491 (8%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME++ +Y PD+DLDLSFTS    T TDRT ++ S  +  +L+  FN+RLS +S     ++
Sbjct  1     MEEEDIYFPDTDLDLSFTS----TVTDRTFASSSGRSSLTLS--FNDRLSTSSVV---TN  51

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             +  +  +  HR+H  +WSAIK+A  LSS G +HLRHLKL R +G+GNLGRVFLC LRD  
Sbjct  52    SSTSSSTVNHRRHDPHWSAIKSAKHLSSTGNIHLRHLKLIRHLGTGNLGRVFLCNLRD-S  110

Query  1250  HSDFALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
              + FALKVIDR++LT AKKLS V+TEAEILS+LDHPFLPTLYA ++ SHYTCLL+D+  N
Sbjct  111   SARFALKVIDRNNLTTAKKLSQVETEAEILSLLDHPFLPTLYARIDESHYTCLLIDYAPN  170

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ GNRL +  VRF+AAEVLVALEYLH++GIVYRDLKPEN+L+REDGH+MLS
Sbjct  171   GDLHSLLRKQPGNRLPIQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLS  230

Query  893   DFDLCFRADIFPQLETLTRVPLGSGGRKCG-----FLGerrr-----eETVTEFVAEPTT  744
             DFDLCF++D+ P  ++       S           F G         EE V EF AEP T
Sbjct  231   DFDLCFKSDVVPTFKSRRYRRTSSSPSLRRRRSGCFSGVAAEDKYEREEIVAEFAAEPVT  290

Query  743   AFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAS  564
             AFSRSCVGTHEYLAPEL+SGNGHG+GVDWWAFG+ +YELL GTTPFKG SKE TLRNIAS
Sbjct  291   AFSRSCVGTHEYLAPELVSGNGHGSGVDWWAFGIFLYELLHGTTPFKGCSKEETLRNIAS  350

Query  563   T-RGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPL  387
             T + + F+ D  E        AKDLIE+LLVKDPRKRLGCA+GA DIKRHPFF+GIKWPL
Sbjct  351   TNKNMSFHGDSEE--------AKDLIEKLLVKDPRKRLGCARGAQDIKRHPFFDGIKWPL  402

Query  386   IRTYRPPEP-RGLVLKRS-KSKA-HVTGVSSPRRRRCWWKRLGHLVRIK----GSKHNLN  228
             IR Y+PPE  RGLV+K+S +S A HVT VS  RR+   W+ L +L+R K    GSK+  +
Sbjct  403   IRHYKPPEEVRGLVIKKSPRSHAGHVTAVSPRRRKSFLWRALSYLLRGKSSSGGSKN--H  460

Query  227   FNHNYYCYATK  195
              N NYY Y +K
Sbjct  461   SNSNYYHYVSK  471



>ref|XP_002885040.1| hypothetical protein ARALYDRAFT_897709 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61299.1| hypothetical protein ARALYDRAFT_897709 [Arabidopsis lyrata subsp. 
lyrata]
Length=480

 Score =   503 bits (1296),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 296/490 (60%), Positives = 359/490 (73%), Gaps = 36/490 (7%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME +  Y PD+DLDLSFTS    TTTDRT ++ S+    +L+  FN+RLS +S     S+
Sbjct  1     MEQEDFYFPDTDLDLSFTS----TTTDRTFASSSARTSLTLS--FNDRLSTSSAVTTSST  54

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             +   ++   HR+H  +WSAIK+A  LSSDG +HLRHLKL R +G+GNLGRVFLC LRD  
Sbjct  55    SSSTVN---HRRHDPHWSAIKSAKLLSSDGNIHLRHLKLIRHLGTGNLGRVFLCNLRD-S  110

Query  1250  HSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
              + FALKVIDR+ LT  KKLS V+TEAEILS+LDHPFLPTLYA ++ SHYTCLL+D+  N
Sbjct  111   SARFALKVIDRNCLTTEKKLSQVETEAEILSLLDHPFLPTLYARIDESHYTCLLIDYAPN  170

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ GNRL +  VRF+AAEVLVALEYLH++GIVYRDLKPEN+L+REDGH+MLS
Sbjct  171   GDLHSLLRKQPGNRLPIQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLS  230

Query  893   DFDLCFRADIFPQLE---------TLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTA  741
             DFDLCF++D+ P  +         + +     SG        +  REE V+EF AEP TA
Sbjct  231   DFDLCFKSDVVPTFKSRRYRRTSSSPSLRRRRSGCFSVAAEKKYEREEIVSEFAAEPVTA  290

Query  740   FSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAS-  564
             FSRSCVGTHEYLAPEL++GNGHG+GVDWWAFG+ +YELL+GTTPFKG SKE TLRNI S 
Sbjct  291   FSRSCVGTHEYLAPELVAGNGHGSGVDWWAFGIFLYELLYGTTPFKGESKEQTLRNIVST  350

Query  563   TRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLI  384
             T+   F+ D    E      A+DLIE+LLVKDPRKRLGCA+GA DIKRHPFF+GIKWPLI
Sbjct  351   TKSASFHVDVDSEE------ARDLIEKLLVKDPRKRLGCARGAQDIKRHPFFDGIKWPLI  404

Query  383   RTYRPPEP-RGLVLKRS-KSKA-HVTGVSSPRRRRCWWKRLGHLVRIK----GSKHNLNF  225
             R Y+PPE  RGLV+K+S +S A HV  VS  RR+   W+ L +L+R K    GSK+    
Sbjct  405   RHYKPPEEVRGLVIKKSTRSHAGHVIAVSPRRRKSFLWRALSYLLRGKNSSGGSKN--QS  462

Query  224   NHNYYCYATK  195
             N NYY Y  K
Sbjct  463   NSNYYHYVGK  472



>emb|CDX98447.1| BnaC05g39280D [Brassica napus]
Length=474

 Score =   503 bits (1295),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 292/485 (60%), Positives = 358/485 (74%), Gaps = 32/485 (7%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME++I Y PD+DLDLSFTS    T TDRT ++ S  +  +L+  FN+RLS +S     S+
Sbjct  1     MEEEI-YFPDTDLDLSFTS----TVTDRTFASSSGRSSLTLS--FNDRLSTSSAVTTSST  53

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             +   ++   HR+   +WSAIK+A  LSSDG +HLRHLKL R +G+GNLGRVFLC LRD  
Sbjct  54    SSSTIN---HRRQDPHWSAIKSAKLLSSDGNIHLRHLKLIRHLGTGNLGRVFLCNLRD-P  109

Query  1250  HSDFALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
              + FALKVIDR++LT AKKLS V+TEAEILS+LDHPFLPTL+A ++ SHYTCLL+D+  N
Sbjct  110   SARFALKVIDRNNLTTAKKLSQVETEAEILSLLDHPFLPTLHARIDESHYTCLLIDYAPN  169

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ GNRL +  VRF+AAEVLVALEYLH++GIVYRDLKPEN+L+REDGH+MLS
Sbjct  170   GDLHSLLRKQPGNRLPLQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLS  229

Query  893   DFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerrre----ETVTEFVAEPTTAFSRSC  726
             DFDLCF++D+ P  ++       S    C        +    E V+EF AEP TAFSRSC
Sbjct  230   DFDLCFKSDVVPTFKSRRYRRTSSSRSGCFSAAPAEEKYEREEIVSEFTAEPVTAFSRSC  289

Query  725   VGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAS-TRGVR  549
             VGTHEYLAPEL+SGNGHG+GVDWWAFG+ +YELL+GTTPFKG SKE TLRNI S T+ VR
Sbjct  290   VGTHEYLAPELVSGNGHGSGVDWWAFGIFLYELLYGTTPFKGDSKEQTLRNIVSTTKTVR  349

Query  548   FYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRP  369
             F+ D    E      A+DLIE+LLVKDP+KRLGCA+GA DIKRHPFF+GIKWPLIR Y+P
Sbjct  350   FHVDSDLDE------ARDLIEKLLVKDPKKRLGCARGAQDIKRHPFFDGIKWPLIRHYKP  403

Query  368   PEP-RGLVLKRSKS--KAHVTGVSSPRRRRCWWKRLGHLVRIK----GSKHNLNFNHNYY  210
             PE  RGLV+K+S      HVT V+  RR+   W+ L +++R K    GSK+    N NYY
Sbjct  404   PEEVRGLVIKKSTRAHAGHVTAVTPRRRKSFLWRALSYILRGKSSSGGSKN--QSNSNYY  461

Query  209   CYATK  195
              Y  K
Sbjct  462   HYVGK  466



>ref|XP_010501870.1| PREDICTED: serine/threonine-protein kinase WAG2-like isoform 
X2 [Camelina sativa]
Length=487

 Score =   503 bits (1295),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 304/490 (62%), Positives = 360/490 (73%), Gaps = 29/490 (6%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME    Y PD+DLDLSFTS  +   T  + SARSSLARSSLTLSFN+RLS +S     S 
Sbjct  1     MEQVDFYFPDTDLDLSFTSTVT-DRTFASSSARSSLARSSLTLSFNDRLSTSSAVTTSSV  59

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             +   ++   HR+H  +WSAIK+A  LSSDG +HLRHLKL R +GSGNLGRVFLC LRD  
Sbjct  60    SSSTVN---HRRHDPHWSAIKSAKLLSSDGNIHLRHLKLIRHLGSGNLGRVFLCNLRD-S  115

Query  1250  HSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
              + FALKVIDR+ LT  KKLS V+TEAEILSMLDHPFLPTLYA ++ SHYTCLL+D+  N
Sbjct  116   SARFALKVIDRNCLTTEKKLSQVETEAEILSMLDHPFLPTLYARIDESHYTCLLIDYAPN  175

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLH+LLRKQ GNRL +  VRF+AAEVLVALEYLH++GIVYRDLKPEN+L+REDGH+MLS
Sbjct  176   GDLHTLLRKQPGNRLPIQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLS  235

Query  893   DFDLCFRADIFPQLE---------TLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTA  741
             DFDLCF++D+ P  +         + +     SG        +  REE V+EF AEP TA
Sbjct  236   DFDLCFKSDVVPTFKSRRYRRTSSSPSLRRRRSGCFSVQTEEKYEREEIVSEFAAEPVTA  295

Query  740   FSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAST  561
             FSRSCVGTHEYLAPEL+SGNGHG+GVDWWAFG+ +YE+L GTTPFKG SKE TLRNI ST
Sbjct  296   FSRSCVGTHEYLAPELVSGNGHGSGVDWWAFGIFLYEMLQGTTPFKGESKEQTLRNIVST  355

Query  560   RGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIR  381
                  +  DG+     +  AKDLIE+LLVKDPRKRLGCA+GA DIKRHPFF+GIKWPLIR
Sbjct  356   TKTASFHVDGD----LVEKAKDLIEKLLVKDPRKRLGCARGAQDIKRHPFFDGIKWPLIR  411

Query  380   TYRPPEP-RGLVLKRSKSKA---HVTGVSSPRRRRCWWKRLGHLVRIK----GSKHNLNF  225
              Y+PPE  RGLV+K+S ++A   HVT VS  RR+   W+ L  L+R K    GSK+    
Sbjct  412   HYKPPEEVRGLVIKKSSTRAHAGHVTAVSPRRRKSFLWRALSFLLRGKSSSGGSKNQS--  469

Query  224   NHNYYCYATK  195
             N NYY Y  K
Sbjct  470   NSNYYHYVGK  479



>ref|XP_002891767.1| hypothetical protein ARALYDRAFT_892419 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68026.1| hypothetical protein ARALYDRAFT_892419 [Arabidopsis lyrata subsp. 
lyrata]
Length=483

 Score =   503 bits (1294),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 269/414 (65%), Positives = 310/414 (75%), Gaps = 16/414 (4%)
 Frame = -3

Query  1403  HRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEH-SDFALKV  1227
             HR++  +W++I+AA TLSSDG LHLRH KL   +G+GNLGRVFLC LRD  + + FALKV
Sbjct  66    HRRYDPHWTSIRAATTLSSDGRLHLRHFKLVHHLGTGNLGRVFLCHLRDCPNPTGFALKV  125

Query  1226  IDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLLRK  1047
             IDRD LTAKKLSHV+TEAEILS+LDHPFLPTLYA ++ SHYTCLL+D+C NGDLHSLLRK
Sbjct  126   IDRDVLTAKKLSHVETEAEILSLLDHPFLPTLYARIDASHYTCLLIDYCPNGDLHSLLRK  185

Query  1046  QAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRAD  867
             Q  NRL + SVRF+AAEVLVALEYLH+LGIVYRDLKPENILIREDGHIMLSDFDLCF+AD
Sbjct  186   QPNNRLPISSVRFFAAEVLVALEYLHALGIVYRDLKPENILIREDGHIMLSDFDLCFKAD  245

Query  866   IFPQLETLTRVPLGSGGRKCGFLG-------errreETVTEFVAEPTTAFSRSCVGTHEY  708
             + P   +       S  R+   +G       E  REE V EF AEP TAFS+SCVGTHEY
Sbjct  246   VVPTFRSRRLRRASSSPRRTRRVGGCFSTEVEYEREEIVAEFAAEPVTAFSKSCVGTHEY  305

Query  707   LAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGE  528
             LAPEL++GNGHG+GVDWWAFG+ +YE+L GTTPFKG +KE TLRNI S   V F      
Sbjct  306   LAPELVAGNGHGSGVDWWAFGIFLYEMLHGTTPFKGGTKEQTLRNIVSNDDVAF-----T  360

Query  527   RETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLV  348
              E   M  AKDLIE+LLVKDPRKRLGCA+GA DIKRH FF GIKWPLIR Y+PPE RGLV
Sbjct  361   LEEEGMVEAKDLIEKLLVKDPRKRLGCARGAQDIKRHEFFQGIKWPLIRNYKPPEIRGLV  420

Query  347   LKRSKSKAHVTGVSSPRRRRCWWKRLGHLV---RIKGSKHNLNFNHNYYCYATK  195
              K      HVT V +PRRR+  W  L HL+    +  S   +  N+NYY Y  K
Sbjct  421   KKTKAHDGHVTAVVTPRRRKWLWWALSHLLPSKSLNKSSSKIQSNNNYYHYVGK  474



>ref|XP_010479947.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Camelina 
sativa]
Length=489

 Score =   502 bits (1292),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 309/488 (63%), Positives = 356/488 (73%), Gaps = 24/488 (5%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             MEDD+ Y  D+DLDLSFTS  +   T  + SARSSLARSSLTLSFN+RLS  +T    +S
Sbjct  1     MEDDVYYL-DTDLDLSFTS-TTTDRTFTSSSARSSLARSSLTLSFNDRLSTATTPSTTTS  58

Query  1430  NIPN-LHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             +    LH   HR++  +W+AI+AA TLSSD  LHLRHLKL R +G+GNLGRVFLC LRD 
Sbjct  59    SAATTLH---HRRYDPHWTAIRAATTLSSDRRLHLRHLKLVRHLGTGNLGRVFLCHLRDC  115

Query  1253  EH-SDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
              + + FALKVIDRD LTAKK+SHV+TEAEILSMLDHPFLPTLYA ++ SHYTCLL+D+C 
Sbjct  116   PNPTGFALKVIDRDVLTAKKMSHVETEAEILSMLDHPFLPTLYARIDASHYTCLLIDYCP  175

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
             NGDLHSLLRKQ  NRL +  VRF+AAEVLVALEYLH+LGIVYRDLKPENILIREDGHIML
Sbjct  176   NGDLHSLLRKQPNNRLPISPVRFFAAEVLVALEYLHALGIVYRDLKPENILIREDGHIML  235

Query  896   SDFDLCFRADIFPQLETLTRVPLGSGGRK---------CGFLGerrr--eETVTEFVAEP  750
             SDFDLCF+AD+ P   +       S             C F  E     EE V EF AEP
Sbjct  236   SDFDLCFKADVVPTFRSRRFRRPSSPPSSPRRSRLRRGCFFSTEVEYEREEIVAEFAAEP  295

Query  749   TTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNI  570
              TAFS+SCVGTHEYLAPEL++GNGHG+GVDWWAFG+ +YE+L GTTPFKG +KE TLRNI
Sbjct  296   VTAFSKSCVGTHEYLAPELVAGNGHGSGVDWWAFGIFLYEMLHGTTPFKGGTKEQTLRNI  355

Query  569   ASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWP  390
              S   V F     E E   M  AKDLIE+LL KDPRKRLGCA+GA DIKRH FF GIKWP
Sbjct  356   VSNDDVAFTL---EEEEEGMVEAKDLIEKLLEKDPRKRLGCARGAQDIKRHEFFEGIKWP  412

Query  389   LIRTYRPPEPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLVRIKG---SKHNLNFNH  219
             LIR Y+PPE RGLV K      HVT V +PRR++  W+ L HL+R KG   S   +  N+
Sbjct  413   LIRNYKPPEIRGLVKKTKGHGGHVTAVVTPRRKKWLWRALSHLLRSKGLNKSSSKIQSNN  472

Query  218   NYYCYATK  195
             NYY Y  K
Sbjct  473   NYYHYVGK  480



>gb|AAC78477.1| protein kinase homolog [Arabidopsis thaliana]
Length=476

 Score =   501 bits (1291),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 304/488 (62%), Positives = 352/488 (72%), Gaps = 30/488 (6%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             MEDD  Y  D+DLDLSFTS A+   T  + SARSSLARSSLTLSFN+RLS  +T    +S
Sbjct  1     MEDDGYYL-DTDLDLSFTSTAT-DRTFTSSSARSSLARSSLTLSFNDRLSTATTPSTTTS  58

Query  1430  NIPN-LHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             +    LH   HR++  +W++I+AA TLSSDG LHLRH KL R +G+GNLGRVFLC LRD 
Sbjct  59    SAATTLH---HRRYDPHWTSIRAATTLSSDGRLHLRHFKLVRHLGTGNLGRVFLCHLRDC  115

Query  1253  EH-SDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
              + + FALKVIDRD LTAKK+SHV+TEAEILS+LDHPFLPTLYA ++ SHYTCLL+D+C 
Sbjct  116   PNPTGFALKVIDRDVLTAKKISHVETEAEILSLLDHPFLPTLYARIDASHYTCLLIDYCP  175

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
             NGDLHSLLRKQ  NRL +  VRF+AAEVLVALEYLH+LGIVYRDLKPENILIREDGHIML
Sbjct  176   NGDLHSLLRKQPNNRLPISPVRFFAAEVLVALEYLHALGIVYRDLKPENILIREDGHIML  235

Query  896   SDFDLCFRADIFPQLETL-----------TRVPLGSGGRKCGFLGerrreETVTEFVAEP  750
             SDFDLCF+AD+ P   +            TR   G    +  F     REE V EF AEP
Sbjct  236   SDFDLCFKADVVPTFRSRRFRRTSSSPRKTRRGGGCFSTEVEF----EREEIVAEFAAEP  291

Query  749   TTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNI  570
              TAFS+SCVGTHEYLAPEL++GNGHG+GVDWWAFG+ +YE+L+GTTPFKG +KE TLRNI
Sbjct  292   VTAFSKSCVGTHEYLAPELVAGNGHGSGVDWWAFGIFLYEMLYGTTPFKGGTKEQTLRNI  351

Query  569   ASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWP  390
              S   V F       E   M  AKDLIE+LLVKDPRKRLGCA+GA DIKRH FF GIKWP
Sbjct  352   VSNDDVAFTL-----EEEGMVEAKDLIEKLLVKDPRKRLGCARGAQDIKRHEFFEGIKWP  406

Query  389   LIRTYRPPEPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGH---LVRIKGSKHNLNFNH  219
             LIR Y+PPE RGLV K      HVT   +PRR +  W  L H      +  S   +  N+
Sbjct  407   LIRNYKPPEIRGLVKKTKAHAGHVTAAVTPRRNKWLWWALSHLLRSKSLSKSSSKIQSNN  466

Query  218   NYYCYATK  195
             NYY Y  K
Sbjct  467   NYYHYVGK  474



>ref|NP_175774.1| protein WAG1 [Arabidopsis thaliana]
 sp|Q9C8M5.1|WAG1_ARATH RecName: Full=Serine/threonine-protein kinase WAG1; AltName: 
Full=Protein kinase 3; Short=AtPK3 [Arabidopsis thaliana]
 gb|AAG51984.1|AC024260_22 auxin-induced protein kinase, putative; 23581-22151 [Arabidopsis 
thaliana]
 gb|ABO45689.1| At1g53700 [Arabidopsis thaliana]
 gb|AEE32983.1| protein WAG1 [Arabidopsis thaliana]
Length=476

 Score =   501 bits (1291),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 305/484 (63%), Positives = 352/484 (73%), Gaps = 22/484 (5%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             MEDD  Y  D+DLDLSFTS A+   T  + SARSSLARSSLTLSFN+RLS  +T    +S
Sbjct  1     MEDDGYYL-DTDLDLSFTSTAT-DRTFTSSSARSSLARSSLTLSFNDRLSTATTPSTTTS  58

Query  1430  NIPN-LHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             +    LH   HR++  +W++I+AA TLSSDG LHLRH KL R +G+GNLGRVFLC LRD 
Sbjct  59    SAATTLH---HRRYDPHWTSIRAATTLSSDGRLHLRHFKLVRHLGTGNLGRVFLCHLRDC  115

Query  1253  EH-SDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
              + + FALKVIDRD LTAKK+SHV+TEAEILS+LDHPFLPTLYA ++ SHYTCLL+D+C 
Sbjct  116   PNPTGFALKVIDRDVLTAKKISHVETEAEILSLLDHPFLPTLYARIDASHYTCLLIDYCP  175

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
             NGDLHSLLRKQ  NRL +  VRF+AAEVLVALEYLH+LGIVYRDLKPENILIREDGHIML
Sbjct  176   NGDLHSLLRKQPNNRLPISPVRFFAAEVLVALEYLHALGIVYRDLKPENILIREDGHIML  235

Query  896   SDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLG-------errreETVTEFVAEPTTAF  738
             SDFDLCF+AD+ P   +       S  RK    G       E  REE V EF AEP TAF
Sbjct  236   SDFDLCFKADVVPTFRSRRFRRTSSSPRKTRRGGGCFSTEVEYEREEIVAEFAAEPVTAF  295

Query  737   SRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTR  558
             S+SCVGTHEYLAPEL++GNGHG+GVDWWAFG+ +YE+L+GTTPFKG +KE TLRNI S  
Sbjct  296   SKSCVGTHEYLAPELVAGNGHGSGVDWWAFGIFLYEMLYGTTPFKGGTKEQTLRNIVSND  355

Query  557   GVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRT  378
              V F       E   M  AKDLIE+LLVKDPRKRLGCA+GA DIKRH FF GIKWPLIR 
Sbjct  356   DVAFTL-----EEEGMVEAKDLIEKLLVKDPRKRLGCARGAQDIKRHEFFEGIKWPLIRN  410

Query  377   YRPPEPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGH---LVRIKGSKHNLNFNHNYYC  207
             Y+PPE RGLV K      HVT   +PRR +  W  L H      +  S   +  N+NYY 
Sbjct  411   YKPPEIRGLVKKTKAHAGHVTAAVTPRRNKWLWWALSHLLRSKSLSKSSSKIQSNNNYYH  470

Query  206   YATK  195
             Y  K
Sbjct  471   YVGK  474



>ref|XP_010465329.1| PREDICTED: serine/threonine-protein kinase WAG2-like [Camelina 
sativa]
Length=483

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 293/488 (60%), Positives = 348/488 (71%), Gaps = 29/488 (6%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME +  Y PDSDLDLSFTS    T TDRT ++ S+ +  +    FN+RLS +S     S 
Sbjct  1     MEQEDFYFPDSDLDLSFTS----TVTDRTFASSSARSSLTSLS-FNDRLSTSSAVTTSSV  55

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             +   ++   HR+H  +WSAIK+A  LSSDG +HLRHLKL R +GSGNLGRVFLC LRD  
Sbjct  56    SSSTVN---HRRHDPHWSAIKSAKLLSSDGNIHLRHLKLIRHLGSGNLGRVFLCNLRD-S  111

Query  1250  HSDFALKVIDRDSL-TAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
              + FALKVIDR+ L T KKLS V+TEAEILS+LDHPFLPTLYA ++ SHYTCLL+D+  N
Sbjct  112   SARFALKVIDRNCLATEKKLSQVETEAEILSLLDHPFLPTLYARIDESHYTCLLIDYAPN  171

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ GNRL +  VRF+AAEVLVALEYLH++GIVYRDLKPEN+L+REDGH+MLS
Sbjct  172   GDLHSLLRKQPGNRLPIQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLS  231

Query  893   DFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerrreET---------VTEFVAEPTTA  741
             DFDLCF++D+ P  ++       S              +T         V+EF AEP TA
Sbjct  232   DFDLCFKSDVVPTFKSRRYRRTSSSPSLRRRRSGCFSVQTEERYEREEIVSEFAAEPVTA  291

Query  740   FSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAST  561
             FSRSCVGTHEYLAPEL+SGNGHG+GVDWWAFG+ +YE+L GTTPFKG SKE TLRNI ST
Sbjct  292   FSRSCVGTHEYLAPELVSGNGHGSGVDWWAFGIFLYEMLHGTTPFKGESKEQTLRNIVST  351

Query  560   RGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIR  381
                  +  DG+ E      AKDLIE+LLVKDPRKRLGCAKGA DIKRHPFF+GIKWPLIR
Sbjct  352   TKTASFNVDGDLE----EEAKDLIEKLLVKDPRKRLGCAKGAQDIKRHPFFDGIKWPLIR  407

Query  380   TYRPPEP-RGLVLKRSKSKA---HVTGVSSPRRRRCWWKRLGHLVRIKGSKHNL--NFNH  219
              Y+PPE  RGLV+K+S ++A   HVT VS  RR+   W+ L  L+R K S        N 
Sbjct  408   HYKPPEEVRGLVIKKSSTRAHAGHVTAVSPRRRKSFLWRALSFLLRSKSSSGGSRNQSNS  467

Query  218   NYYCYATK  195
             NYY Y  K
Sbjct  468   NYYHYVGK  475



>emb|CDX97569.1| BnaA05g25100D [Brassica napus]
Length=479

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 293/490 (60%), Positives = 360/490 (73%), Gaps = 37/490 (8%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME++I Y PD+DLDLSFTS    T TDRT ++ S  +  +L+  FN+RLS +S     S+
Sbjct  1     MEEEI-YFPDTDLDLSFTS----TVTDRTFASSSGRSSLTLS--FNDRLSTSSAVTTSST  53

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             +   ++   HR+   +WSAIK+A  LSSDG +HLRHLKL R +G+GNLGRVFLC LRD  
Sbjct  54    SSSTIN---HRRQDPHWSAIKSAKLLSSDGNIHLRHLKLIRHLGTGNLGRVFLCNLRD-S  109

Query  1250  HSDFALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
              + FALKVIDR++LT AKKLS V+TEAEILS+LDHPFLPTL+A ++ SHYTCLL+D+  N
Sbjct  110   SARFALKVIDRNNLTTAKKLSQVETEAEILSLLDHPFLPTLHARIDESHYTCLLIDYAPN  169

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ GNRL +  VRF+AAEVLVALEYLH++GIVYRDLKPEN+L+REDGH+MLS
Sbjct  170   GDLHSLLRKQPGNRLPLQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLS  229

Query  893   DFDLCFRADIFPQLE---------TLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTA  741
             DFDLCF++D+ P  +         + +     SG        +   EE V+EF AEP TA
Sbjct  230   DFDLCFKSDVVPTFKSRRYRRTSSSPSLRRRRSGCFSTPAEEKYEMEEIVSEFTAEPVTA  289

Query  740   FSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAS-  564
             FSRSCVGTHEYLAPEL+SGNGHG+GVDWWAFG+ +YELL+GTTPFKG SKE TLRNI S 
Sbjct  290   FSRSCVGTHEYLAPELVSGNGHGSGVDWWAFGIFLYELLYGTTPFKGDSKEQTLRNIVST  349

Query  563   TRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLI  384
             T+ V+F+ D        M  A+DLIE+LLVKDP+KRLGCA+GA DIKRHPFF+GIKWPLI
Sbjct  350   TKTVKFHVDSD------MDEARDLIEKLLVKDPKKRLGCARGAQDIKRHPFFDGIKWPLI  403

Query  383   RTYRPPEP-RGLVLKRSKS--KAHVTGVSSPRRRRCWWKRLGHLVRIK----GSKHNLNF  225
             R Y+PPE  RGLV+K+S      HVT V+  RR+   W+ L +L+R K    GSK+    
Sbjct  404   RHYKPPEEVRGLVIKKSTRAHAGHVTAVTPRRRKSFLWRALSYLLRGKSSSGGSKN--QS  461

Query  224   NHNYYCYATK  195
             N NYY Y  K
Sbjct  462   NSNYYHYVGK  471



>ref|XP_009146375.1| PREDICTED: serine/threonine-protein kinase WAG2 [Brassica rapa]
Length=479

 Score =   499 bits (1286),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 293/490 (60%), Positives = 360/490 (73%), Gaps = 37/490 (8%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             ME++I Y PD+DLDLSFTS    T TDRT ++ S  +  +L+  FN+RLS +S     S+
Sbjct  1     MEEEI-YFPDTDLDLSFTS----TVTDRTFASSSGRSSLTLS--FNDRLSTSSAVTTSST  53

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             +   ++   HR+   +WSAIK+A  LSSDG +HLRHLKL R +G+GNLGRVFLC LRD  
Sbjct  54    SSSTIN---HRRQDPHWSAIKSAKLLSSDGNIHLRHLKLIRHLGTGNLGRVFLCNLRD-S  109

Query  1250  HSDFALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
              + FALKVIDR++LT AKKLS V+TEAEILS+LDHPFLPTL+A ++ SHYTCLL+D+  N
Sbjct  110   SARFALKVIDRNNLTTAKKLSQVETEAEILSLLDHPFLPTLHARIDESHYTCLLIDYAPN  169

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLRKQ GNRL +  VRF+AAEVLVALEYLH++GIVYRDLKPEN+L+REDGH+MLS
Sbjct  170   GDLHSLLRKQPGNRLPLQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLS  229

Query  893   DFDLCFRADIFPQLE---------TLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTA  741
             DFDLCF++D+ P  +         + +     SG        +   EE V+EF AEP TA
Sbjct  230   DFDLCFKSDVVPTFKSRRYRRTSSSPSLRRRRSGCFSTPAEEKYEMEEIVSEFTAEPVTA  289

Query  740   FSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAS-  564
             FSRSCVGTHEYLAPEL+SGNGHG+GVDWWAFG+ +YELL+GTTPFKG SKE TLRNI S 
Sbjct  290   FSRSCVGTHEYLAPELVSGNGHGSGVDWWAFGIFLYELLYGTTPFKGDSKEQTLRNIVST  349

Query  563   TRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLI  384
             T+ V+F+ D    E      A+DLIE+LLVKDP+KRLGCA+GA DIKRHPFF+GIKWPLI
Sbjct  350   TKTVKFHVDSDLDE------ARDLIEKLLVKDPKKRLGCARGAQDIKRHPFFDGIKWPLI  403

Query  383   RTYRPPEP-RGLVLKRSKS--KAHVTGVSSPRRRRCWWKRLGHLVRIK----GSKHNLNF  225
             R Y+PPE  RGLV+K+S      HVT V+  RR+   W+ L +L+R K    GSK+    
Sbjct  404   RHYKPPEEVRGLVIKKSTRAHAGHVTAVTPRRRKSFLWRALSYLLRGKSSSGGSKN--QS  461

Query  224   NHNYYCYATK  195
             N NYY Y  K
Sbjct  462   NSNYYHYVGK  471



>ref|XP_010087152.1| Protein kinase G11A [Morus notabilis]
 gb|EXB27057.1| Protein kinase G11A [Morus notabilis]
Length=487

 Score =   498 bits (1282),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 289/443 (65%), Positives = 346/443 (78%), Gaps = 12/443 (3%)
 Frame = -3

Query  1610  MEDDILYPP--DSDLDLSFTSCASITTTDrtlsarssl--arssltlSFNERLSATSTAG  1443
             M+++ L+ P  D+DLDLSFTS AS   T  T +  +    ARSSLTLSFN+RLS T+   
Sbjct  8     MDEEALFFPSSDTDLDLSFTSIASTDRTTTTTTTSARTSLARSSLTLSFNDRLSTTAETY  67

Query  1442  NPSSNIPNLHSRPHRKHGSN---WSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFL  1272
             N +++  +       +  S+   WSAIKAA TLSSDGALHLRHLKL R +G+GNLGRVFL
Sbjct  68    NTTTSSSSSSLLRSHRRSSDDPHWSAIKAATTLSSDGALHLRHLKLLRHLGTGNLGRVFL  127

Query  1271  CRLRDYEH---SDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYT  1101
             CRLRDY++   ++FALKV+D++SL+AKKLSHV+TEAEILS LDHPFL TLYAH+EVSHYT
Sbjct  128   CRLRDYDNHANANFALKVVDKESLSAKKLSHVKTEAEILSTLDHPFLLTLYAHIEVSHYT  187

Query  1100  CLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILI  921
             CLL+D+C  GDLH+LL +Q GNRL + +V+F+A+EVLVALEYLHSLGIVYRDLKPENIL+
Sbjct  188   CLLIDYCPGGDLHALLHRQPGNRLPLKAVKFFASEVLVALEYLHSLGIVYRDLKPENILL  247

Query  920   REDGHIMLSDFDLCFRADIFPQL-ETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTT  744
             REDGHIMLSDFDLCF+AD+ P L +  T  P  S        GE   E   T+ VAEPT 
Sbjct  248   REDGHIMLSDFDLCFKADVVPILVQYTTSTPTRSRAGSLSCFGEDEEEVVTTDIVAEPTA  307

Query  743   AFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAS  564
             AFSRSCVGTHEYLAPEL++GNGHGNGVDWWAFGVL+YEL +GTTPFKG SKESTLRNIAS
Sbjct  308   AFSRSCVGTHEYLAPELVAGNGHGNGVDWWAFGVLIYELAYGTTPFKGGSKESTLRNIAS  367

Query  563   TRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLI  384
             TR VRF  ++ E E   M+  +DL+E+LLVKDPR+RLGCA+GATD+KRHPFF GIKW LI
Sbjct  368   TRDVRF-PENDEEEGEEMSLLRDLVEKLLVKDPRRRLGCARGATDVKRHPFFRGIKWALI  426

Query  383   RTYRPPEPRGLVLKRSKSKAHVT  315
             R Y+ PE RGL  K + +K HVT
Sbjct  427   RNYKAPEVRGLPRKTTMTKGHVT  449



>ref|XP_009354815.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Pyrus x 
bretschneideri]
Length=492

 Score =   498 bits (1281),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 277/438 (63%), Positives = 325/438 (74%), Gaps = 17/438 (4%)
 Frame = -3

Query  1478  FNERLSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVG  1299
             FN+RLS TST    ++N   LH   HRK   + +AI       SD  LHLRHLKL R VG
Sbjct  56    FNDRLSTTSTTTTTTTN--PLHH--HRKSDPHCTAIXXXXXXXSDRTLHLRHLKLLRHVG  111

Query  1298  SGNLGRVFLCRLRD----YEHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTL  1131
             +G+LGRVFLCRLRD     + + FALKV+D+D LT KKL HV TEAEILSMLDHPFLPTL
Sbjct  112   TGDLGRVFLCRLRDDRDNPDAATFALKVVDKDLLTPKKLGHVSTEAEILSMLDHPFLPTL  171

Query  1130  YAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVY  951
             YA ++VSHYTCLL+D+C NGDLH+LL +Q  NRL V +VRF+AAEVLVALEYLH+LG+VY
Sbjct  172   YARIDVSHYTCLLIDYCPNGDLHNLLLRQPLNRLPVSAVRFFAAEVLVALEYLHALGVVY  231

Query  950   RDLKPENILIREDGHIMLSDFDLCFRADIFPQLE----TLTRVPLGSGGRKCGFLGerrr  783
             RDLKPENIL+REDGH+MLSDFDLCF+ D+ P L+      TR     G   C      ++
Sbjct  232   RDLKPENILLREDGHVMLSDFDLCFKGDVNPTLQHRRVQKTRPTKRKGTYSCFGSRREQQ  291

Query  782   eETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFK  603
             EE V EFVAEPTTAFS+SCVGTHEYLAPELISGNGHGNGVDWWAFGV +YELL GTTPFK
Sbjct  292   EEMVAEFVAEPTTAFSKSCVGTHEYLAPELISGNGHGNGVDWWAFGVFIYELLHGTTPFK  351

Query  602   GSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIK  423
             G +KE+TLRNIA++ GVRF     E E   M  A+DLIERLLV+DPR+RLGCAKGAT+IK
Sbjct  352   GVTKENTLRNIAASSGVRFRV--AEEEEEGMKEARDLIERLLVRDPRRRLGCAKGATEIK  409

Query  422   RHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLVRIKGS  243
             +HPFF GI W LIRTYRPPE  GL  K SK   ++    + +RR+CWWK LG  VR + S
Sbjct  410   QHPFFVGINWALIRTYRPPEVNGLRRKPSKPHGNILVGPTQKRRKCWWKALGQFVRTRSS  469

Query  242   ---KHNLNFNHNYYCYAT  198
                K+N + N NYY Y +
Sbjct  470   SNYKNNRHSNSNYYQYVS  487



>ref|XP_010462277.1| PREDICTED: serine/threonine-protein kinase WAG1 [Camelina sativa]
Length=490

 Score =   496 bits (1278),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 308/488 (63%), Positives = 355/488 (73%), Gaps = 23/488 (5%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             MEDD+ Y  D+DLDLSFTS  +   T  + SARSSLARSSLTLSFN+RLS  +T    +S
Sbjct  1     MEDDVYYL-DTDLDLSFTS-TTTDRTFTSSSARSSLARSSLTLSFNDRLSTATTPSTTTS  58

Query  1430  NIPN-LHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             +    LH   HR++  +W+AI+AA TLSSD  LHLRHLKL R +G+GNLGRVFLC LRD 
Sbjct  59    SAATTLH---HRRYDPHWTAIRAATTLSSDRRLHLRHLKLVRHLGTGNLGRVFLCHLRDC  115

Query  1253  EH-SDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
              + + FALKVIDRD LTAKK+SHV+TEAEILSMLDHPFLPTLYA ++ SHYTCLL+D+C 
Sbjct  116   PNPTGFALKVIDRDVLTAKKISHVETEAEILSMLDHPFLPTLYARIDASHYTCLLIDYCP  175

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
             NGDLHSLLRKQ  NRL +  VRF+AAEVLVALEYLH+LGIVYRDLKPENILIREDGHIML
Sbjct  176   NGDLHSLLRKQPNNRLPISPVRFFAAEVLVALEYLHALGIVYRDLKPENILIREDGHIML  235

Query  896   SDFDLCFRADIFP-----------QLETLTRVPLGSGGRKCGFLGerrreETVTEFVAEP  750
             SDFDLCF+AD+ P              +  R     GG       E  REE V EF AEP
Sbjct  236   SDFDLCFKADVVPTFRSRRFRRPSSPPSSPRRSRRRGGCFFSTEVEYEREEIVAEFAAEP  295

Query  749   TTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNI  570
              TAFS+SCVGTHEYLAPEL++GNGHG+GVDWWAFG+ +YE+L GTTPFKG +KE TLRNI
Sbjct  296   VTAFSKSCVGTHEYLAPELVAGNGHGSGVDWWAFGIFLYEMLHGTTPFKGGTKEQTLRNI  355

Query  569   ASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWP  390
              S   V F     E E   M  AKDLIE+LL KDPRKRLGCA+GA DIKRH FF GIKWP
Sbjct  356   VSNNDVAFTL--EEEEEEGMVEAKDLIEKLLEKDPRKRLGCARGAQDIKRHEFFEGIKWP  413

Query  389   LIRTYRPPEPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLVRIKG---SKHNLNFNH  219
             LIR Y+PPE RGLV K      HVT V +PR+++  W  L HL+R K    S   +  N+
Sbjct  414   LIRNYKPPEIRGLVKKTKAHAGHVTAVVTPRKKKWLWWGLSHLLRSKSLNKSSIKIQSNN  473

Query  218   NYYCYATK  195
             NYY Y  K
Sbjct  474   NYYHYVGK  481



>ref|XP_008226274.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Prunus 
mume]
Length=496

 Score =   496 bits (1278),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 272/412 (66%), Positives = 318/412 (77%), Gaps = 17/412 (4%)
 Frame = -3

Query  1403  HRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD------  1242
             HRK   NWSAIKAA  LSSD  LHL HLKL R +G+GNLGRVFLCRLRD +H D      
Sbjct  77    HRKWDPNWSAIKAATALSSDRTLHLSHLKLLRHLGTGNLGRVFLCRLRD-DHRDNPDAAT  135

Query  1241  FALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLH  1062
             FALKV+D+DSLT KKL  V TEAEILSMLDHPFLPTLYA ++VSHYTCLL+D+C NGDLH
Sbjct  136   FALKVVDKDSLTPKKLRQVSTEAEILSMLDHPFLPTLYARIDVSHYTCLLIDYCPNGDLH  195

Query  1061  SLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDL  882
             +LL +Q  NRL + +VRF+AAEVLVALEYLH+LG+VYRDLKPENIL+R DGH+MLSDFDL
Sbjct  196   NLLIRQPLNRLPLPAVRFFAAEVLVALEYLHALGVVYRDLKPENILLRGDGHVMLSDFDL  255

Query  881   CFRADIFPQLETLTRVPLGSGGRK----CGFLGerrreETVTEFVAEPTTAFSRSCVGTH  714
             CFRAD+ P ++       G   RK    C        EE V EFVAEPTTA+S+SCVGTH
Sbjct  256   CFRADVSPAVQHRRVEKTGPTRRKNTHSCFGSRRGHEEEMVAEFVAEPTTAYSKSCVGTH  315

Query  713   EYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADD  534
             EYLAPELISGNGHGNGVDWWAFGV +YELL GTTPFKG SKESTLRNIA++ GVRF+  +
Sbjct  316   EYLAPELISGNGHGNGVDWWAFGVFIYELLHGTTPFKGGSKESTLRNIAASSGVRFHVVE  375

Query  533   GERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRG  354
             G+ E   M  A+DLIERLLV+DP +RLGCAKGAT+IK+HPFF GI W LIRTYRPPE  G
Sbjct  376   GKEE--GMKEARDLIERLLVRDPWRRLGCAKGATEIKQHPFFGGINWALIRTYRPPEVNG  433

Query  353   LVLKRSKSKAHVTGVSSP--RRRRCWWKRLGHLVRIKGSKHNLNFNHNYYCY  204
               L+R   K H + V++   +R++CWW+ L H V+ + +KHN + N NYY Y
Sbjct  434   --LRRRPIKPHGSPVAAALHKRKKCWWEGLCHFVKTRCNKHNNHSNSNYYKY  483



>ref|XP_006303984.1| hypothetical protein CARUB_v10008965mg [Capsella rubella]
 gb|EOA36882.1| hypothetical protein CARUB_v10008965mg [Capsella rubella]
Length=491

 Score =   491 bits (1265),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 306/495 (62%), Positives = 358/495 (72%), Gaps = 36/495 (7%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             MEDD  Y  D+DLDLSFTS A+   T  + SARSSLARSSLTLSFN+RLS  +T    +S
Sbjct  1     MEDDGYYL-DNDLDLSFTSTAT-DRTFTSSSARSSLARSSLTLSFNDRLSTATTPSTTTS  58

Query  1430  NIPN-LHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             +    LH   HR++  +W+AI+AA TLSSDG LHLRHLKL R +G+GNLGRVFLC LRD 
Sbjct  59    SAAATLH---HRRYDPHWTAIRAATTLSSDGRLHLRHLKLVRHLGTGNLGRVFLCHLRDC  115

Query  1253  EH-SDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
              + + FALKVIDRD LTAKK+SHV+TEAEILSMLDHPFLPTLYA ++ SHYTCLL+D+C 
Sbjct  116   PNPTGFALKVIDRDVLTAKKISHVETEAEILSMLDHPFLPTLYARIDASHYTCLLIDYCP  175

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
             NGD+HSLLRKQ  NRL +  VRF+AAEVLVALEYLH+LGIVYRDLKPENILIREDGH+ML
Sbjct  176   NGDIHSLLRKQPNNRLPISPVRFFAAEVLVALEYLHALGIVYRDLKPENILIREDGHVML  235

Query  896   SDFDLCFRADIFPQLETL----------------TRVPLGSGGRKCGFLGerrreETVTE  765
             SDFDLCF+AD+ P   +                 +R  +G    +  +     REE V E
Sbjct  236   SDFDLCFKADVVPTFRSRRFRRPSSPPSSPKRWRSRRGVGCFSTEVEY----EREEIVAE  291

Query  764   FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKES  585
             F AEP TAFS+SCVGTHEYLAPEL++GNGHG+GVDWWAFG+ +YE+L GTTPFKG +KE 
Sbjct  292   FAAEPVTAFSKSCVGTHEYLAPELVAGNGHGSGVDWWAFGIFLYEMLHGTTPFKGGTKEQ  351

Query  584   TLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFN  405
             TLRNI S       A   E E   M  AKDLIE+LL KDPRKRLGCA+GA DIKRH FF 
Sbjct  352   TLRNILSND----VAFPLEEEEEGMVEAKDLIEQLLEKDPRKRLGCARGAQDIKRHEFFQ  407

Query  404   GIKWPLIRTYRPPEPRGLVLKRSKSKAHVT-GVSSPRRRRCW-WKRLGHLVR---IKGSK  240
             GIKWPLIR Y+PPE RGLV K      HVT  V +PRR++ W W  L HL+R   +  S 
Sbjct  408   GIKWPLIRNYKPPEIRGLVKKTKAHAGHVTAAVVTPRRKKKWLWWALSHLLRSKSLNKSS  467

Query  239   HNLNFNHNYYCYATK  195
               +  N+NYY Y  K
Sbjct  468   SKIQSNNNYYHYVGK  482



>ref|XP_010552414.1| PREDICTED: serine/threonine-protein kinase WAG1 [Tarenaya hassleriana]
Length=493

 Score =   490 bits (1262),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 295/466 (63%), Positives = 347/466 (74%), Gaps = 26/466 (6%)
 Frame = -3

Query  1583  DSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSSNIPNLHSRP  1404
             ++DLDLSFTS A+   T  + SARSSLARSSLTLSFN+RLS  +T  + S     LH   
Sbjct  9     NTDLDLSFTSTAT-DRTFASSSARSSLARSSLTLSFNDRLSTATTTVSTSVA--GLH---  62

Query  1403  HRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEH-SDFALKV  1227
             HRK   +W A++AA+ LSSDG LHLRHLKL R +G+GNLGRVFLC LRD  + + FALKV
Sbjct  63    HRKTDPHWIAVRAASVLSSDGWLHLRHLKLVRHLGTGNLGRVFLCHLRDCPNKTSFALKV  122

Query  1226  IDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLLRK  1047
             IDRDSLTAKKL HVQTEAEILS+LDHPFLPTLYA ++ SHYTCLL+D+C NGDLHSLLRK
Sbjct  123   IDRDSLTAKKLGHVQTEAEILSLLDHPFLPTLYARIDASHYTCLLIDYCPNGDLHSLLRK  182

Query  1046  QAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRAD  867
             Q GNRL +  VRF+AAEVLVALEYLH+LGIVYRDLKPEN+L+REDGHIMLSDFDLCF+++
Sbjct  183   QPGNRLPIHPVRFFAAEVLVALEYLHALGIVYRDLKPENVLLREDGHIMLSDFDLCFKSE  242

Query  866   IFPQLETLTRVPLGSGGRK----CGFLG----errreETVTEFVAEPTTAFSRSCVGTHE  711
             + P   T  R+   +  R+    C           RE  V+EF AEP TAFSRSCVGTHE
Sbjct  243   VVPTFRT-RRIQRATSSRRRQRSCCLCSRRYETEEREALVSEFAAEPVTAFSRSCVGTHE  301

Query  710   YLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAS-TRGVRFYA-D  537
             YLAPEL+SGNGHG+GVDWWAFG+ +YELL+GTTPFKG SKE TLRNIAS  +   F A  
Sbjct  302   YLAPELVSGNGHGSGVDWWAFGIFLYELLYGTTPFKGRSKEHTLRNIASPAKNAVFPAVP  361

Query  536   DGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPR  357
                 E   M  A+DLIE+LL KDP KRLG  +GA DIK HPFF+GIKWPLIR Y+ P+ R
Sbjct  362   SAATEDAGMEEARDLIEKLLAKDPMKRLGSERGAQDIKSHPFFDGIKWPLIRNYKAPDVR  421

Query  356   GLVLKRSKSKA------HVTGVSSPRRRRCW-WKRLGHLVRIKGSK  240
             GLV K S + A      HVT V SPRRR+ W W+ + +L+R K  +
Sbjct  422   GLVKKTSLTAAARSHAGHVTAV-SPRRRKIWLWRAMSYLLRSKSCR  466



>ref|XP_004295704.1| PREDICTED: protein kinase G11A-like [Fragaria vesca subsp. vesca]
Length=491

 Score =   485 bits (1249),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 299/488 (61%), Positives = 363/488 (74%), Gaps = 20/488 (4%)
 Frame = -3

Query  1610  MEDDILYP-PDS---DLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAG  1443
             M+ D+ YP P++   DLD SFTSC +  T   + SAR+SLARSSLTLSFN+R S  S+A 
Sbjct  1     MDVDLDYPLPNAEYGDLDFSFTSCTTDRTFVSSSSARTSLARSSLTLSFNDRDSRLSSAT  60

Query  1442  NPSSN--IPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLC  1269
               ++   +P + S+ HRK   +W+AIKAA  +SSD  LHLRHLKL R +G+G+LGRVFLC
Sbjct  61    ATTTTATVP-IFSQHHRKSDPHWTAIKAATNMSSDKRLHLRHLKLLRHLGTGDLGRVFLC  119

Query  1268  RLRDYEHSD--FALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCL  1095
             RLRDY+HSD  FALKV+D  ++  KK +HV+TEAEILS+LDHPFLPTLYA ++VSHYTCL
Sbjct  120   RLRDYDHSDSTFALKVVDHAAIPPKKQAHVETEAEILSLLDHPFLPTLYARIDVSHYTCL  179

Query  1094  LMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIRE  915
             L+D+C NGDL +LL KQ   RL V   RF+AAEVL +LEYLH+LGIVYRDLKPEN+L+RE
Sbjct  180   LIDYCPNGDLQTLLMKQPHRRLPVKPARFFAAEVLASLEYLHALGIVYRDLKPENVLLRE  239

Query  914   DGHIMLSDFDLCFRADIFPQLETLTR-VPLGSGGRKCGFL------GerrreETVTEFVA  756
             DGHIMLSDFDLCF++D+ P      R V      R+ G        G+   EE   EFVA
Sbjct  240   DGHIMLSDFDLCFKSDVVPTFHRRRRPVIKPRKTRRAGNCFGSRERGQNEEEEMEAEFVA  299

Query  755   EPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLR  576
             EPT AFS+SCVGTHEYLAPEL+ G+GHGNGVDWWAFG+ ++ELL+GTTPFKG SKESTLR
Sbjct  300   EPTAAFSKSCVGTHEYLAPELVGGHGHGNGVDWWAFGIFIFELLYGTTPFKGGSKESTLR  359

Query  575   NIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIK  396
             NIA   GVRF+  +GE E   M  A+DLIE LLV+DP++RLGCAKGAT+IKRHPFFNGI 
Sbjct  360   NIALANGVRFHVAEGEEE--GMKEARDLIEGLLVRDPQRRLGCAKGATEIKRHPFFNGIN  417

Query  395   WPLIRTYRPPEPRGLVLKRSKSKAHVTGV--SSPRRRRCWWKRLGHLVRIKGSKHNLNFN  222
             W L+RTYRPP+  GL  K SK+ A   GV  S+ +RRR WWK LG LVR + +K N   N
Sbjct  418   WALLRTYRPPDVYGLRKKPSKTIAVPVGVALSAHKRRRWWWKGLGQLVRTRSNKKNSQSN  477

Query  221   HNYYCYAT  198
              NYY Y +
Sbjct  478   SNYYHYVS  485



>ref|XP_007211844.1| hypothetical protein PRUPE_ppa004688mg [Prunus persica]
 gb|EMJ13043.1| hypothetical protein PRUPE_ppa004688mg [Prunus persica]
Length=496

 Score =   484 bits (1247),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 274/412 (67%), Positives = 320/412 (78%), Gaps = 17/412 (4%)
 Frame = -3

Query  1403  HRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD------  1242
             HRK   +WSAIKAA  LSSD  LHL HLKL R +G+GNLGRVFLCRLRD +H D      
Sbjct  78    HRKWDPHWSAIKAATALSSDRTLHLSHLKLLRHLGTGNLGRVFLCRLRD-DHRDNPDAAT  136

Query  1241  FALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLH  1062
             FALKV+D+DSLT KKL HV TEAEILSMLDHPFLPTLYA ++VSHYTCLL+D+C NGDLH
Sbjct  137   FALKVVDKDSLTPKKLGHVSTEAEILSMLDHPFLPTLYARIDVSHYTCLLIDYCPNGDLH  196

Query  1061  SLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDL  882
             +LL  Q  NRL + +VRF+AAEVLVALEYLH+LG+VYRDLKPENIL+R D H+MLSDFDL
Sbjct  197   NLLLLQPLNRLPLPAVRFFAAEVLVALEYLHALGVVYRDLKPENILLRGDRHVMLSDFDL  256

Query  881   CFRADIFPQLETLTRVPLGSGGRK----CGFLGerrreETVTEFVAEPTTAFSRSCVGTH  714
             CF+AD+ P ++       G   RK    C        EE V EFVAEPTTA+S+SCVGTH
Sbjct  257   CFKADVSPAVQHRRVEKTGPTRRKNTHSCFGSRREHEEEMVAEFVAEPTTAYSKSCVGTH  316

Query  713   EYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADD  534
             EYLAPELISGNGHGNGVDWWAFGV +YELL GTTPFKG SKESTLRNIA++ GVRF+  +
Sbjct  317   EYLAPELISGNGHGNGVDWWAFGVFIYELLHGTTPFKGGSKESTLRNIAASSGVRFHVAE  376

Query  533   GERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRG  354
             GE E   M  A+DLIERLLV+DPR+RLGC+KGAT+IK+HPFF GI W LIRTYRPPE  G
Sbjct  377   GEEE--GMKEARDLIERLLVRDPRRRLGCSKGATEIKQHPFFGGINWALIRTYRPPEVNG  434

Query  353   LVLKRSKSKAHVTGVSSP--RRRRCWWKRLGHLVRIKGSKHNLNFNHNYYCY  204
               L+R  SK HV+ V++   +R++CWWK L H V+ + +KHN + N NYY Y
Sbjct  435   --LRRRPSKPHVSPVAAALHKRKKCWWKGLCHFVKTRCNKHNNHSNSNYYKY  484



>ref|XP_010501029.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Camelina 
sativa]
 ref|XP_010462276.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Camelina 
sativa]
Length=489

 Score =   478 bits (1231),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 302/488 (62%), Positives = 352/488 (72%), Gaps = 24/488 (5%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             MEDD+ Y  D+DLDLSFTS  +   T  + SARSSLARSSLTLSFN+RLS  +T    +S
Sbjct  1     MEDDVYYL-DTDLDLSFTS-TTTDRTFTSSSARSSLARSSLTLSFNDRLSTATTPSTTTS  58

Query  1430  NIPN-LHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             +    LH   HR++  +W+AI+AA TLSSD  LHLRHLKL R +G+GNLGRVFLC LRD 
Sbjct  59    SAATTLH---HRRYDPHWTAIRAATTLSSDRRLHLRHLKLVRHLGTGNLGRVFLCHLRDC  115

Query  1253  EH-SDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
              + + FALKVIDRD LT KK+SHV+TEAEILSMLDHPFLPTLYA ++ SHYTCLL+D+C 
Sbjct  116   PNPTGFALKVIDRDVLTEKKISHVETEAEILSMLDHPFLPTLYARIDASHYTCLLIDYCP  175

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
             NGDLHSLLRKQ  NRL +  VRF+AAEVLVALEYLH+LGIVYRDLKPENILI EDGHIML
Sbjct  176   NGDLHSLLRKQPNNRLQISPVRFFAAEVLVALEYLHALGIVYRDLKPENILICEDGHIML  235

Query  896   SDFDLCFRADIFP-----------QLETLTRVPLGSGGRKCGFLGerrreETVTEFVAEP  750
             SDFDLCF+AD+ P              +  R     GG       E  REE V EF AEP
Sbjct  236   SDFDLCFKADVVPTFRSRRFRRPSSPPSSPRRSRRRGGCFFSTEVEYEREEIVAEFAAEP  295

Query  749   TTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNI  570
              TAFS+SCVGTHEYLAPEL++GNGHG+GVDWWAFG+ +YE+L GTTPFKG +KE TLRNI
Sbjct  296   VTAFSKSCVGTHEYLAPELVAGNGHGSGVDWWAFGIFLYEMLHGTTPFKGGTKEQTLRNI  355

Query  569   ASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWP  390
              S   V F  ++ E  T     AKDLIE+LL KDPRKRLG A+GA DIKRH FF GIKWP
Sbjct  356   VSNDDVAFTLEEEEEGT---VEAKDLIEKLLEKDPRKRLGSARGAQDIKRHEFFEGIKWP  412

Query  389   LIRTYRPPEPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHLVR---IKGSKHNLNFNH  219
             LIR  +PPE RGLV K      HVT V +PR+++  W  L HL+R   +  S   +  N+
Sbjct  413   LIRNCKPPEIRGLVKKTQAHAGHVTAVVTPRKKKWLWWGLSHLLRSKSLNKSSSKIQSNN  472

Query  218   NYYCYATK  195
             NYY Y  K
Sbjct  473   NYYHYVGK  480



>gb|KFK35703.1| hypothetical protein AALP_AA4G026000 [Arabis alpina]
Length=457

 Score =   455 bits (1171),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 244/403 (61%), Positives = 301/403 (75%), Gaps = 13/403 (3%)
 Frame = -3

Query  1403  HRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHS-DFALKV  1227
             HR++  +W++I AA TLSSD  +HLRHLKL RL+G+GNLGRVFLC LRD  +S +FALKV
Sbjct  62    HRRYDPHWTSINAAKTLSSDARIHLRHLKLIRLLGTGNLGRVFLCHLRDCPNSGEFALKV  121

Query  1226  IDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLLRK  1047
             IDRDSLT KK+S+V+ E+EILS+LDHPFLP LYA ++ SHYTC+L+D+CS GDLH+LLRK
Sbjct  122   IDRDSLTTKKISNVEIESEILSLLDHPFLPNLYARIDASHYTCVLIDYCSKGDLHTLLRK  181

Query  1046  QAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRAD  867
             Q  +R S+ S RF+A+E+LVALEYLH++GIVYRDLKPEN+LIREDGHIMLSDFDLCF++D
Sbjct  182   QPNHRFSISSARFFASEILVALEYLHAIGIVYRDLKPENVLIREDGHIMLSDFDLCFKSD  241

Query  866   IFPQLETLTRVPLG-SGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELI  690
             + P  ++     L  S  R+      R REE V EF AEP  A+SRSCVGTHEYLAPE++
Sbjct  242   VTPSFKSTPASSLSPSSNRRRLRNHRRGREEMVAEFAAEPVKAYSRSCVGTHEYLAPEIV  301

Query  689   SGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAM  510
             +GNGHGNGVDWWAFGV +YE+L+GTTPFKG +KE TL  I S   V F+ ++G  E    
Sbjct  302   AGNGHGNGVDWWAFGVFLYEMLYGTTPFKGLNKEQTLHKIVSNDDVAFFEEEGLEE----  357

Query  509   AAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKS  330
               A DLI+ LLVKD  KRLGC KGA DIKRH FF+GI WPLIR Y+PPE      K+SKS
Sbjct  358   --ANDLIKMLLVKDSSKRLGCVKGAQDIKRHRFFDGINWPLIRNYKPPE----FGKKSKS  411

Query  329   K-AHVTGVSSPRRRRCWWKRLGHLVRIKGSKHNLNFNHNYYCY  204
             +  +V+G+SS  RRR W       +  + S   +  N NYY Y
Sbjct  412   RDGYVSGLSSSLRRRKWLWLALAKLLRRRSNSKIQSNSNYYRY  454



>ref|XP_004161568.1| PREDICTED: LOW QUALITY PROTEIN: protein kinase PINOID 2-like 
[Cucumis sativus]
Length=353

 Score =   400 bits (1028),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 238/353 (67%), Positives = 281/353 (80%), Gaps = 12/353 (3%)
 Frame = -3

Query  1610  MEDDI-LYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNE-RLSATSTAGNP  1437
             MEDD  ++PPDSDLD SFTS  +  T   + SAR+SLARSSLTLSFNE RLSA + A   
Sbjct  1     MEDDYSIFPPDSDLDFSFTSTTTDRTFTTSSSARTSLARSSLTLSFNESRLSAAAAA---  57

Query  1436  SSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD  1257
                   L+ RP+ +  S+WSAI+AA TLSSDG LHLRHLKL R +G+GNLGRVFLC LRD
Sbjct  58    ------LNLRPYHRSDSHWSAIRAATTLSSDGHLHLRHLKLIRHLGTGNLGRVFLCHLRD  111

Query  1256  YEHSDFALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
              +H+ FALKV+D+++L+ KKL  VQTEAEIL+ LDHPFLPTLYA L+VSHYTCLL+D+C 
Sbjct  112   NDHASFALKVVDKEALSNKKLXQVQTEAEILASLDHPFLPTLYARLDVSHYTCLLIDYCP  171

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
              GDLHSLLRKQ G+R SV + RF+AAEVLVALEYLH+LGIVYRDLKPEN+L+REDGH+ML
Sbjct  172   AGDLHSLLRKQPGSRFSVAAARFFAAEVLVALEYLHALGIVYRDLKPENVLLREDGHVML  231

Query  896   SDFDLCFRADIFPQLETLTRVPLGSGGRKCGF-LGerrreETVTEFVAEPTTAFSRSCVG  720
             SDFDLCF++D+ P   T TR    + G   G+       EE V EFVAEPT+AFS+SCVG
Sbjct  232   SDFDLCFKSDVVPTFHTWTRPGPQATGSCFGWRTSPEFEEEIVGEFVAEPTSAFSKSCVG  291

Query  719   THEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAST  561
             THEYLAPEL++G GHGNGVDWWAFGV +YELL GTTPFKG +KE TLRNIAS+
Sbjct  292   THEYLAPELVTGGGHGNGVDWWAFGVFVYELLHGTTPFKGVNKEGTLRNIASS  344



>ref|XP_010919072.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Elaeis 
guineensis]
Length=498

 Score =   390 bits (1002),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 217/382 (57%), Positives = 269/382 (70%), Gaps = 39/382 (10%)
 Frame = -3

Query  1406  PHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEH-------  1248
             PHR+   +WSA++AA+ LS DG+LHLRHL+L R +GSGNL RVF CRLR ++        
Sbjct  57    PHRRSDPHWSAVRAASNLSPDGSLHLRHLRLLRHLGSGNLARVFHCRLRGFDASDPSSSS  116

Query  1247  --SDFALKVIDRDSLT------------AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVS  1110
               +DFALKV+D D++               +LSHV+TEA +L+ LDHPFLPTLYA L+ S
Sbjct  117   SATDFALKVVDLDAVARAGGEPTKEADDGGRLSHVRTEARVLAELDHPFLPTLYARLDAS  176

Query  1109  HYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPEN  930
             HY C L+D+C  GDLHSLLR+  G+RL  ++VRFYAAEVL+ALEYLH+LG VYRDLKPEN
Sbjct  177   HYACFLIDYCPGGDLHSLLRRSPGHRLPPNAVRFYAAEVLLALEYLHALGFVYRDLKPEN  236

Query  929   ILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLG--------------SGGRKCGFLGe  792
             +L+R DGH+MLSDFDLCF++D+ P L    R+                  G +  G  GE
Sbjct  237   VLLRADGHVMLSDFDLCFQSDVTPVLLRRRRLRRRQRRPSPLPRLNFCFGGAQTLGDNGE  296

Query  791   rrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTT  612
                E       AEP  A+SR+CVGTHEYLAPE+++GNGHGNGVDWWAFGV +YELL+G T
Sbjct  297   EEDEVVEFV--AEPEAAYSRACVGTHEYLAPEVVNGNGHGNGVDWWAFGVFIYELLYGRT  354

Query  611   PFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGAT  432
             PFKG SKE+TLRNI  TR +RF  D        +AAAKDLI RLLV+DP++R+GC +GA 
Sbjct  355   PFKGGSKEATLRNIL-TRELRF-PDGVPAAGDDVAAAKDLISRLLVRDPKRRVGCTRGAA  412

Query  431   DIKRHPFFNGIKWPLIRTYRPP  366
             +IKRHPFF GI+WPLIR  RPP
Sbjct  413   EIKRHPFFEGIQWPLIRCARPP  434



>ref|XP_009398976.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Musa acuminata 
subsp. malaccensis]
Length=488

 Score =   379 bits (972),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 214/394 (54%), Positives = 263/394 (67%), Gaps = 28/394 (7%)
 Frame = -3

Query  1406  PHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLR----DYEHSDF  1239
             PH     +WSA++AAA LS DG LHL HL+L R +GSG+L RVF CRL     D+  S+F
Sbjct  59    PHNCSDPHWSALRAAANLSPDGLLHLHHLRLLRPLGSGHLARVFHCRLHGFDDDHSSSEF  118

Query  1238  ALKVIDRDSLTAK------------KLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCL  1095
             ALKVID D+L+              K+ HV+ EA  L+ +DHPFLPTLYA L+ SHY C 
Sbjct  119   ALKVIDLDALSRSSGNYSKPDDDEGKMWHVRAEARALAEMDHPFLPTLYARLDASHYACF  178

Query  1094  LMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIRE  915
             L+D+C  GDLH LLR+  G+RL   + RFYAAEVL+ALEYLH+LG VYRDLKPENIL+R 
Sbjct  179   LIDYCPGGDLHLLLRRCRGHRLPPVAARFYAAEVLLALEYLHALGFVYRDLKPENILLRT  238

Query  914   DGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRK-CGFLG-errreETVTEFVAEPTTA  741
             DGHIMLSDFDL FR+ + P L            R  C  LG     E+   EFVAEP++A
Sbjct  239   DGHIMLSDFDLSFRSHVTPVLRRRRHRRPRRRNRLFCCLLGCSVSSEDEEPEFVAEPSSA  298

Query  740   FSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAST  561
             FSR+CVGTHEYLAPE+++G GHGNGVDWWAFGV +YEL +G TPFKG++KE+TLRNI  T
Sbjct  299   FSRACVGTHEYLAPEVVNGRGHGNGVDWWAFGVFLYELFYGRTPFKGATKEATLRNIL-T  357

Query  560   RGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIR  381
             R V+F   +G   +     A+DLI RLLVKDP +R+G A+GA +IKRHPFF  ++W LIR
Sbjct  358   REVKFPETNGGNGS--ETKARDLISRLLVKDPARRMGSARGAAEIKRHPFFESVQWQLIR  415

Query  380   TYRPPEPRGLVLKRSKSKAHVTGVSSPRRRRCWW  279
               RPP   G      +  A V       +R  WW
Sbjct  416   CTRPPVVTGPAGSARERAAKV-------KRAQWW  442



>ref|XP_009399480.1| PREDICTED: serine/threonine-protein kinase WAG2-like [Musa acuminata 
subsp. malaccensis]
Length=496

 Score =   369 bits (947),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 209/382 (55%), Positives = 260/382 (68%), Gaps = 32/382 (8%)
 Frame = -3

Query  1406  PHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE--HS--DF  1239
             PH     +WSA++AAA LS DG LHL HL+L R +GSG+L RVF CRL  ++  HS  +F
Sbjct  52    PHNCSDPHWSALRAAANLSPDGLLHLHHLRLLRPLGSGHLARVFHCRLHGFDDGHSPAEF  111

Query  1238  ALKVIDRDSLT-----------------------AKKLSHVQTEAEILSMLDHPFLPTLY  1128
             ALKVID D+L+                         K+ HV+ EA +L+ +DHPFLPTLY
Sbjct  112   ALKVIDLDALSRTSSDYKKPDDSECDEETGEGGGRGKMWHVRAEARVLAEMDHPFLPTLY  171

Query  1127  AHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYR  948
             A L+  HY C L+D+C  GDLHSLLR + G+RL   + RFYAAEVLVALEYLH+LG VYR
Sbjct  172   ARLDAGHYACFLIDYCPGGDLHSLLRHRRGHRLPPAAARFYAAEVLVALEYLHALGFVYR  231

Query  947   DLKPENILIREDGHIMLSDFDLCFRADIFP-QLETLTRVPLGSGGRKCGFLGerrreETV  771
             DLKPEN+L+R DGH+MLSDFDL FR+ + P  L    R+P    G  C  +G     E  
Sbjct  232   DLKPENVLLRSDGHVMLSDFDLSFRSHVSPTLLHRRRRLPRRKSGLLCCLVGCSASGEDE  291

Query  770   T-EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSS  594
               E VAEP++AFSR+ VGTHEYLAPE+++G+GHGN VDWWAFGV +YELL+G TPFKG++
Sbjct  292   ELECVAEPSSAFSRASVGTHEYLAPEVVNGSGHGNAVDWWAFGVFLYELLYGRTPFKGAT  351

Query  593   KESTLRNIASTRGVRFYADDGER--ETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKR  420
             KE+TLRNI  TR V+    +G    E   MA A+DLI +LLV+DP KR+G   GA +IKR
Sbjct  352   KEATLRNIL-TREVKLPDTNGGDVVEGGDMAKARDLIAQLLVRDPAKRMGSVLGAAEIKR  410

Query  419   HPFFNGIKWPLIRTYRPPEPRG  354
             HPFF  ++WPLIR  RPP P G
Sbjct  411   HPFFASVRWPLIRCARPPIPCG  432



>ref|XP_009396991.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Musa acuminata 
subsp. malaccensis]
Length=498

 Score =   367 bits (943),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 209/381 (55%), Positives = 253/381 (66%), Gaps = 34/381 (9%)
 Frame = -3

Query  1427  IPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEH  1248
             +P   S PH      WSA++A   LS DG LHL H +L R +GSG+L RVF CRL  ++ 
Sbjct  59    LPRNSSDPH------WSALRAVGNLSPDGLLHLHHFRLIRPLGSGHLARVFQCRLNGFDD  112

Query  1247  S----DFALKVIDRDSLTAKKLS---------------------HVQTEAEILSMLDHPF  1143
                  +FALKVID D+L+  K                       HV  EA  L+ +DHPF
Sbjct  113   DRSPVEFALKVIDLDALSRSKADYSKPDNDNDDEDCGDEGGKTWHVSAEARALAEMDHPF  172

Query  1142  LPTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSL  963
             LPTLYA L+ SHY C L+D+C  GDL SLL ++ GNRL   + RFYAAEVL+ALEYLH+L
Sbjct  173   LPTLYARLDASHYACFLIDYCPGGDLQSLLSRRRGNRLPPAAARFYAAEVLLALEYLHAL  232

Query  962   GIVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFL--Ger  789
             G VYRDLKPENIL+R DGH+MLSDFDL FR+ + P L   +R+P       C     G  
Sbjct  233   GFVYRDLKPENILLRADGHVMLSDFDLSFRSHVSPALLRRSRLPRRRSRFLCCRFGAGGA  292

Query  788   rreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTP  609
               E    EFVAEP++AFSR+CVGTHEYLAPE++SG+GHG+ VDWWAFGV +YELL+G TP
Sbjct  293   SGEGEELEFVAEPSSAFSRACVGTHEYLAPEVVSGSGHGSAVDWWAFGVFLYELLYGRTP  352

Query  608   FKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATD  429
             FKG++KE+TLRNI  TR VRF       +   MA AKDLI RLLV+DP  R+G A GAT+
Sbjct  353   FKGATKEATLRNIL-TREVRFPETINGGDEAEMAKAKDLITRLLVRDPAARMGSAAGATE  411

Query  428   IKRHPFFNGIKWPLIRTYRPP  366
             IKRHPFF G+ WPLIR  RPP
Sbjct  412   IKRHPFFEGLWWPLIRCVRPP  432



>ref|XP_006852916.1| hypothetical protein AMTR_s00033p00229200 [Amborella trichopoda]
 gb|ERN14383.1| hypothetical protein AMTR_s00033p00229200 [Amborella trichopoda]
Length=463

 Score =   356 bits (914),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 205/430 (48%), Positives = 275/430 (64%), Gaps = 38/430 (9%)
 Frame = -3

Query  1610  MEDDILYPPDSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSS  1431
             M+    +PPDSDLD SFTS ++  TT  + +  S            + LS++S+   P  
Sbjct  1     MDTSSSFPPDSDLDFSFTSVSTDATTSTSSARTSLSLSDF------QPLSSSSSHTRP--  52

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
              +P     PHR     W+ I+  + LS    L   +L + R +GSG+ GRV+ CRL  + 
Sbjct  53    -LP----LPHRSSDPAWAPIQTLSPLSP--PLSFSNLHIVRHLGSGDSGRVYQCRLEGF-  104

Query  1250  HSDFALKVIDRDSLTAKKLSHVQT--------EAEILSMLDHPFLPTLYAHLEVSHYTCL  1095
               D+ALKV+DRD+ + K+ +  +         EAE+L  LDHPFLPTLY  +E   ++C+
Sbjct  105   --DYALKVVDRDAPSVKEKARAKGGGGGGGWEEAEVLGELDHPFLPTLYGRIEAGRHSCV  162

Query  1094  LMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIRE  915
             L+D+C  GDLH L  +Q G R  +++VRFYAAEVLVALEYLH+LGIVYRDLKPEN+L+RE
Sbjct  163   LIDYCPGGDLHRLRARQPGGRFGINAVRFYAAEVLVALEYLHALGIVYRDLKPENVLLRE  222

Query  914   DGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRK-------CGFLGerrreETVTEFVA  756
             +GHIMLSDFDL F++++ P+L   T     SGG         C F   +   + + +F+A
Sbjct  223   NGHIMLSDFDLSFKSNVTPKLHFRT----NSGGTNLEDFTPACCFSHPQSSIDWLPQFMA  278

Query  755   EPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLR  576
             EP  A SRS VGTHEYLAPE+ISG GHG GVDWWA GV +YELL+G TPFKG +K++TL+
Sbjct  279   EPEGAHSRSYVGTHEYLAPEIISGEGHGAGVDWWALGVFIYELLYGRTPFKGPTKKATLK  338

Query  575   NIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIK  396
             NI S + +R+     +  +  + A  DLI+RLL KDPR+RLG  KGA +IK HPFF  I+
Sbjct  339   NILS-KPLRWPESGEDHVSGEILAVMDLIKRLLTKDPRRRLGFEKGACEIKEHPFFRSIR  397

Query  395   WPLIRTYRPP  366
             WPLIR+  PP
Sbjct  398   WPLIRSIPPP  407



>ref|XP_003558331.2| PREDICTED: serine/threonine-protein kinase WAG1-like [Brachypodium 
distachyon]
Length=528

 Score =   357 bits (915),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 199/374 (53%), Positives = 247/374 (66%), Gaps = 22/374 (6%)
 Frame = -3

Query  1421  NLHSRPHRKHGS-NWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHS  1245
              L  RPH    S +W+ + AA   + DG L L HL L R +G G+L RVFLCRL+    S
Sbjct  82    TLSPRPHSSSASPDWAHLAAARAATPDGVLRLAHLHLVRELGHGHLARVFLCRLKGSPPS  141

Query  1244  D--FALKVID-RDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
                FALKV+D RD +   ++ HV  E+ +LS LDHPFLPTLYA L+   Y C L+D+CS 
Sbjct  142   SPLFALKVVDLRDDVDPSRVCHVLAESRVLSSLDHPFLPTLYARLDAGRYACFLIDYCSG  201

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSLLR++ G RL V + RFYAAEVL+ALEYLH LG VYRDLKPEN+L+R DGH++LS
Sbjct  202   GDLHSLLRRRPGGRLPVAAARFYAAEVLLALEYLHVLGFVYRDLKPENVLLRGDGHVVLS  261

Query  893   DFDLCFRADIFPQLET------------LTRVPL----GSGGRKCGFLGerrreETVTEF  762
             DFDL   A + P +               TR+ L     SG        +    +   EF
Sbjct  262   DFDLALPASVEPAVRQRHVRSQQSRRRRKTRMLLLPSCFSGANNGRGEDDEIDAKERLEF  321

Query  761   VAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKEST  582
             VAEPT A S+ CVGTHEYLAPEL+SG+GHGNGVDWWAFGV +YEL++G TPFKG +K+ T
Sbjct  322   VAEPTGASSKDCVGTHEYLAPELVSGSGHGNGVDWWAFGVFLYELVYGRTPFKGPAKDVT  381

Query  581   LRNIASTRGVRFYADDGERETPAMAAA--KDLIERLLVKDPRKRLGCAKGATDIKRHPFF  408
             L+NI S +      DDG+ E  A +AA  KDL+ RLL +DPR+R+G A+GA +IKRHPFF
Sbjct  382   LKNILSKQVAYPKLDDGDGEAAAESAAQLKDLVGRLLERDPRRRMGSARGAAEIKRHPFF  441

Query  407   NGIKWPLIRTYRPP  366
              G+ W LIR   PP
Sbjct  442   AGVDWALIRCVTPP  455



>ref|XP_010275916.1| PREDICTED: protein kinase PINOID-like [Nelumbo nucifera]
Length=459

 Score =   352 bits (904),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 196/384 (51%), Positives = 245/384 (64%), Gaps = 35/384 (9%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD----  1242
             +PHR     W AI++A +    G L  R  KL R +GSG++G V+LCRLR     D    
Sbjct  59    KPHRSSDFAWEAIRSAISRRKSG-LTFRDFKLVRRIGSGDIGSVYLCRLRTPVAGDDSCY  117

Query  1241  FALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             +A+KV+D+++LT  KK+   +TE  IL MLDHPFLPTLYA LE SHY C++M+FCS GDL
Sbjct  118   YAMKVVDKEALTLKKKVERAETEKRILKMLDHPFLPTLYAELEASHYACVVMEFCSGGDL  177

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             H+L  KQ   R S+ S RFYAAEVLVALEYLH LGI+YRDLKPENIL+R DGHIMLSDFD
Sbjct  178   HTLRHKQPSKRFSLSSARFYAAEVLVALEYLHMLGIIYRDLKPENILVRSDGHIMLSDFD  237

Query  884   LCFRADIFPQLE---------TLTRVPLGSGGRK------------CGF--LGerrreET  774
             L   +D  P +E         T T VP  +G  K            C +  L   R+ +T
Sbjct  238   LSLCSDAIPAVESPDSSPGATTATSVPSSTGRTKTKRSTYSTSTFSCLYNRLFRSRKVQT  297

Query  773   VT---EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFK  603
              T    FVAEP +A S S VGTHEY+APE+ +G  HGN VDWWA G+ +YEL++G TPF 
Sbjct  298   ATLNRRFVAEPVSARSCSFVGTHEYVAPEVAAGKSHGNAVDWWALGIFIYELIYGRTPFS  357

Query  602   GSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIK  423
             G + E+TLRNI   + + F  +    ET     A+DLI  LLVKDP  RLG  +GA D+K
Sbjct  358   GENNEATLRNIVQ-KPLVFPTESPASETEVH--ARDLISGLLVKDPSTRLGSKRGAADVK  414

Query  422   RHPFFNGIKWPLIRTYRPPEPRGL  351
              HPFF G+ + L+R+YRPPE  G 
Sbjct  415   THPFFKGLNFALVRSYRPPEIPGF  438



>gb|EAY89286.1| hypothetical protein OsI_10787 [Oryza sativa Indica Group]
Length=498

 Score =   352 bits (903),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 188/353 (53%), Positives = 242/353 (69%), Gaps = 17/353 (5%)
 Frame = -3

Query  1385  NWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD--FALKVIDRDS  1212
             +W+ + A    + DG L L HL L R +G G+L RVFLCRL+    +   FALKV+D   
Sbjct  82    HWALLAAERAATPDGVLRLAHLHLIRELGHGHLARVFLCRLKSSPPASPLFALKVVDLRD  141

Query  1211  LTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNR  1032
                 +++HV  E+ +LS LDHPF+PTLYA L+   Y C LMD+CS GDLH++LR++ G  
Sbjct  142   DDPSRVTHVLAESRVLSSLDHPFVPTLYARLDAGRYACFLMDYCSGGDLHAVLRRRPGGL  201

Query  1031  LSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRADIFP--  858
             L V + RFYAAEVL+ALEYLH+LG VYRDLKPEN+L+R DGH++LSDFDL   A + P  
Sbjct  202   LPVAAARFYAAEVLLALEYLHALGFVYRDLKPENVLLRGDGHVVLSDFDLALPASVEPAV  261

Query  857   ---QLETLTR-----VP-LGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYL  705
                Q+  L+R     VP   S     G  G+    +   EFVAEPTTA S+ CVGTHEYL
Sbjct  262   RRRQVRKLSRRKNRIVPSCFSANGGSGDDGDEVNAKEQFEFVAEPTTANSKDCVGTHEYL  321

Query  704   APELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGER  525
             APEL+SG+GHGNGVDWWAFGV +YEL++G TPFKG +K++TL+NI + + V +   DGE 
Sbjct  322   APELVSGSGHGNGVDWWAFGVFLYELVYGRTPFKGHAKDATLKNILAKQ-VTYPQLDGEA  380

Query  524   ETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP  366
             +    A  +DLI RLL +DPR+R+G A+GA +IKRHPFF G+ W LIR   PP
Sbjct  381   DA---AQLRDLIGRLLERDPRRRMGSARGAAEIKRHPFFAGVDWALIRCVAPP  430



>ref|NP_001049578.2| Os03g0253200 [Oryza sativa Japonica Group]
 gb|ABF95009.1| CsPK3, putative, expressed [Oryza sativa Japonica Group]
 gb|EAZ20986.1| hypothetical protein OsJ_36637 [Oryza sativa Japonica Group]
 dbj|BAF11492.2| Os03g0253200 [Oryza sativa Japonica Group]
Length=498

 Score =   352 bits (902),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 190/353 (54%), Positives = 244/353 (69%), Gaps = 17/353 (5%)
 Frame = -3

Query  1385  NWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD--FALKVIDRDS  1212
             +W+ + AA   + DG L L HL L R +G G+L RVFLCRL+    +   FALKV+D   
Sbjct  82    HWALLAAARAATPDGVLRLAHLHLIRELGHGHLARVFLCRLKSSPPASPLFALKVVDLRD  141

Query  1211  LTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNR  1032
                 +++HV  E+ +LS LDHPF+PTLYA L+   Y C LMD+CS GDLH++LR++ G R
Sbjct  142   DDPSRVTHVLAESRVLSSLDHPFVPTLYARLDAGRYACFLMDYCSGGDLHAVLRRRPGGR  201

Query  1031  LSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRADIFP--  858
             L V + RFYAAEVL+ALEYLH+LG VYRDLKPEN+L+R DGH++LSDFDL   A + P  
Sbjct  202   LPVAAARFYAAEVLLALEYLHALGFVYRDLKPENVLLRGDGHVVLSDFDLALPASVEPAV  261

Query  857   ---QLETLTR-----VP-LGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYL  705
                Q+  L+R     VP   S     G  G+    +   EFVAEPTTA S+ CVGTHEYL
Sbjct  262   RRRQVRKLSRRKNRIVPSCFSANGGSGDDGDEVNAKEQFEFVAEPTTANSKDCVGTHEYL  321

Query  704   APELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGER  525
             APEL+SG+GHGNGVDWWAFGV +YEL++G TPFKG +K++TL+NI + + V +   DGE 
Sbjct  322   APELVSGSGHGNGVDWWAFGVFLYELVYGRTPFKGHAKDATLKNILAKQ-VTYPQLDGEA  380

Query  524   ETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP  366
             +    A  +DLI RLL +DPR+R+G A+GA +IKRHPFF G+ W LIR   PP
Sbjct  381   DA---AQLRDLIGRLLERDPRRRMGSARGAAEIKRHPFFAGVDWALIRCVAPP  430



>ref|XP_010254342.1| PREDICTED: protein kinase PINOID 2-like [Nelumbo nucifera]
Length=476

 Score =   350 bits (897),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 195/424 (46%), Positives = 261/424 (62%), Gaps = 46/424 (11%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEHS  1245
              +PH+ + + W A+K       +G + L H  L R +GSG++G V+LCRLR+        
Sbjct  53    QKPHKANQAAWEAMKRLR--GENGQVGLHHFHLLRRLGSGDIGNVYLCRLRNPVVGLPEC  110

Query  1244  DFALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGD  1068
              +A+KV+DR++L   KKL   + E EIL MLDHPFLPTLYA  + SHY+CL+M+FC  GD
Sbjct  111   LYAMKVVDREALAFRKKLQRAEMEKEILRMLDHPFLPTLYAEFDTSHYSCLVMEFCPGGD  170

Query  1067  LHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDF  888
             L+++ ++Q G R S+ S +FYAAE+L+ALEYLH LGIVYRDLKPEN+L+REDGHIMLSDF
Sbjct  171   LYAVRQRQPGKRFSISSAKFYAAEILLALEYLHMLGIVYRDLKPENVLVREDGHIMLSDF  230

Query  887   DLCFRADIFPQLETLTRVP------LGSGGRKCG---------FLGerrreETVT-----  768
             DL F+ D+ P+L      P      + S    C          FL   +  +        
Sbjct  231   DLSFKCDVVPKLLRTKPNPAATYRNVKSSTPSCAAPMQPVFSCFLASTKSSKKKKEAAMG  290

Query  767   -------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYEL  627
                          E VAEP  A S+S VGTHEYLAPE+ISG GHG+ VDWW  GV +YEL
Sbjct  291   AVAPEVDLQNVDPELVAEPINARSKSFVGTHEYLAPEVISGLGHGSAVDWWTLGVFLYEL  350

Query  626   LFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIERLLVKDPRKRL  453
             L+G TPFKG S E TL NI   + + F        +E   +A  +DLI +LLVK+P+KR+
Sbjct  351   LYGKTPFKGESNEKTLINIIK-QPLTFPRIGVSTSKELEEIAKVQDLISKLLVKNPKKRI  409

Query  452   GCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRRRRCWWK  276
             G  KG+ +IKRH FF G+ W LIR+ +PPE P+   L+R KSKA ++  SS + R+  ++
Sbjct  410   GSLKGSVEIKRHEFFKGVNWALIRSAKPPEVPKD--LRRIKSKASLSKFSSRKERKPAYQ  467

Query  275   RLGH  264
                H
Sbjct  468   LPDH  471



>ref|XP_004984986.1| PREDICTED: protein kinase PINOID 2-like [Setaria italica]
Length=525

 Score =   350 bits (899),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 195/367 (53%), Positives = 245/367 (67%), Gaps = 24/367 (7%)
 Frame = -3

Query  1409  RPHRKHGS-NWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD--F  1239
             RPH    S +W+ + AA   + DG L L HL L R +G G+L RVFLCRL+    +   F
Sbjct  84    RPHSSAASPHWAHLAAARAATPDGVLRLAHLHLVRELGHGHLARVFLCRLKSSPPASPLF  143

Query  1238  ALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             ALKV+D       ++SHV  E+ +LS LDHPF+PTLYA L+   Y C LMD+CS GDLH+
Sbjct  144   ALKVVDLRDDDPSRVSHVLAESRVLSSLDHPFVPTLYARLDAGRYACFLMDYCSGGDLHA  203

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             +LR++ G RL V + RFYAAEVL+ALEYLH+LG VYRDLKPENIL+R DGH++LSDFDL 
Sbjct  204   VLRRRPGGRLPVAAARFYAAEVLLALEYLHALGFVYRDLKPENILLRGDGHVVLSDFDLA  263

Query  878   FRADIFPQLETLTRVPLGSGGRKCGFL---------GerrreETVT-------EFVAEPT  747
               A + P +    +V   S  RK   L         G     + V        EFVAEPT
Sbjct  264   LPASVEPAVRR-RQVRKQSRRRKSILLPSCFSGANGGSGDDGDEVEIDAKERFEFVAEPT  322

Query  746   TAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIA  567
             +A S+ CVGTHEYLAPEL+SG+GHGNGVDWWAFGV +YEL++G TPFKG +KE TL+NI 
Sbjct  323   SASSKDCVGTHEYLAPELVSGSGHGNGVDWWAFGVFLYELVYGRTPFKGHTKEVTLKNIL  382

Query  566   STRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPL  387
             S + V +   DGE +    A  +DL+ RLL +DPR+R+G A+GA +IKRHPFF G+ W L
Sbjct  383   SKQ-VTYPQLDGEADA---AQLRDLVGRLLERDPRRRMGAARGAAEIKRHPFFAGVDWAL  438

Query  386   IRTYRPP  366
             IR   PP
Sbjct  439   IRCVAPP  445



>ref|XP_010250008.1| PREDICTED: protein kinase PINOID 2-like [Nelumbo nucifera]
Length=479

 Score =   348 bits (894),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 196/427 (46%), Positives = 258/427 (60%), Gaps = 47/427 (11%)
 Frame = -3

Query  1436  SSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD  1257
             S N  +   +PH+ + + W A+K       +G + L H +L R +GSG++G V+LCRLR+
Sbjct  49    SDNSLSCAQKPHKANQAAWEAMKRLR--GENGQVGLDHFQLLRRLGSGDIGNVYLCRLRN  106

Query  1256  ----YEHSDFALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLL  1092
                      +A+KV+DR++L   KKL   + E EIL MLDHPFLPTLYA  E SHY+CL+
Sbjct  107   PVVGLPECLYAMKVVDREALAFRKKLQRAEMEKEILGMLDHPFLPTLYADFEASHYSCLV  166

Query  1091  MDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIRED  912
             M+FC  GDL++L ++Q G R S+ S RFYAAE+L+ALEYLH LGIVYRDLKPEN+L+RED
Sbjct  167   MEFCPGGDLYALRQRQPGKRFSISSARFYAAEILLALEYLHMLGIVYRDLKPENVLVRED  226

Query  911   GHIMLSDFDLCFRADIFPQLETLTRVPLGSGGR------KCG---------FLGerrreE  777
             GHIMLSDFDL F+ D+ P+L      P  +          C          FL   +  +
Sbjct  227   GHIMLSDFDLSFKCDVVPKLLRTKPNPEATHKNVKSLIPSCATPIQPVLSCFLASTKNSK  286

Query  776   TVT-------------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWW  654
                                   E VAEP  A S+S VGTHEYLAPE+ISG+GHG+ VDWW
Sbjct  287   KKKEVSSGAVAPAEVDLQEVDPELVAEPINARSKSFVGTHEYLAPEVISGSGHGSAVDWW  346

Query  653   AFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIERL  480
               GV +YELL+G TPFKG + E TL NI   + + F        RE   +   +DLI +L
Sbjct  347   TLGVFLYELLYGRTPFKGENNEKTLVNIIK-QPLTFPRIGVSSSRELEEIMKVQDLISKL  405

Query  479   LVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSS  303
             LVK+P+KR+G  KG+ +IKRH FF G+ W LIR+ +PPE PR   L + KSKA +  +S 
Sbjct  406   LVKNPKKRIGSLKGSVEIKRHEFFKGVNWALIRSVKPPEVPRD--LHKIKSKASLPKLSR  463

Query  302   PRRRRCW  282
               R   +
Sbjct  464   KEREATY  470



>ref|XP_008653608.1| PREDICTED: serine/threonine-protein kinase WAG1-like [Zea mays]
 tpg|DAA44421.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=529

 Score =   350 bits (898),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 191/365 (52%), Positives = 246/365 (67%), Gaps = 22/365 (6%)
 Frame = -3

Query  1409  RPHRKHGS-NWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD--F  1239
             RPH    S +W+ + AA   + DG L L HL L R +G G+L RVFLCRL+    +   F
Sbjct  90    RPHSSSASPHWAHLAAARAATPDGVLRLAHLHLVRELGHGHLARVFLCRLKSSPPASPLF  149

Query  1238  ALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             ALKV+D       ++SHV  E+ +LS LDHPF+PTLYA L+   Y C LMD+CS GDLH+
Sbjct  150   ALKVVDLRDDDPSRVSHVLAESRVLSCLDHPFVPTLYARLDAGRYACFLMDYCSGGDLHA  209

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             +LR++ G RL V + RFYAAEVL+A+EYLH+LG VYRDLKPEN+L+R DGH++LSDFDL 
Sbjct  210   VLRRRPGGRLPVAAARFYAAEVLLAIEYLHALGFVYRDLKPENVLLRGDGHVVLSDFDLA  269

Query  878   FRADIFPQLETLTRVPLGSGGRKCGFL---------GerrreETVT-----EFVAEPTTA  741
               A + P +  L +V   S  R+   L         G    EE +      EFVAEPT A
Sbjct  270   LPASVEPAVR-LRQVRKQSRRRRIALLLSCFSGPSNGGGEDEEEIDGKERFEFVAEPTAA  328

Query  740   FSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAST  561
              S+ CVGTHEYLAPEL+SG+GHGNGVDWWAFGV +YEL++G TPFKG +KE+TL+NI S 
Sbjct  329   SSKDCVGTHEYLAPELVSGSGHGNGVDWWAFGVFLYELVYGRTPFKGHTKEATLKNILSK  388

Query  560   RGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIR  381
             +   +   DGE +   +   +DL+ RLL +DPR+R+G  +GA +IKRHPFF+G+ W LIR
Sbjct  389   QAT-YPQLDGEADASQL---RDLVGRLLERDPRRRMGATRGAAEIKRHPFFSGVDWALIR  444

Query  380   TYRPP  366
                PP
Sbjct  445   CVAPP  449



>ref|XP_002468168.1| hypothetical protein SORBIDRAFT_01g040890 [Sorghum bicolor]
 gb|EER95166.1| hypothetical protein SORBIDRAFT_01g040890 [Sorghum bicolor]
Length=525

 Score =   349 bits (896),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 193/367 (53%), Positives = 244/367 (66%), Gaps = 25/367 (7%)
 Frame = -3

Query  1409  RPHRKHGS-NWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD--F  1239
             RPH    S +W+ + AA   + DG L L HL L R +G G+L RVFLCRL+    S   F
Sbjct  88    RPHSSSASPHWAHLAAARAATPDGVLRLAHLHLVRELGHGHLARVFLCRLKSSPPSSPLF  147

Query  1238  ALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             ALKV+D       ++SHV  E+ +LS LDHPF+PTLYA L+   Y C LMD+CS GDLH+
Sbjct  148   ALKVVDLRDDDPSRVSHVLAESRVLSSLDHPFVPTLYARLDAGRYACFLMDYCSGGDLHA  207

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             +LR++ G RL V + RFYAAEVL+A+EYLH+LG VYRDLKPEN+L+R DGH++LSDFDL 
Sbjct  208   VLRRRPGARLPVAAARFYAAEVLLAIEYLHALGFVYRDLKPENVLLRGDGHVVLSDFDLA  267

Query  878   FRADIFPQLE-------------TLTRVPLGSGGRKCGFLGerrreETVT---EFVAEPT  747
               A + P +              TL      SG R  G  G+   E       EFVAEPT
Sbjct  268   LPASVEPAVRRRQVRKQNRRRKITLLLPSCFSGPRNGG--GDDEEEIDAKERFEFVAEPT  325

Query  746   TAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIA  567
              A S+ CVGTHEYLAPEL+SG+GHGNGVDWWAFGV +YEL++G TPFKG +KE+TL+NI 
Sbjct  326   AASSKDCVGTHEYLAPELVSGSGHGNGVDWWAFGVFLYELVYGRTPFKGHTKEATLKNIL  385

Query  566   STRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPL  387
             S + V +   DGE +   +   +DL+ RLL +DPR+R+G  +GA +IKRHPFF G+ W L
Sbjct  386   SKQ-VTYPQLDGEADASQL---RDLVGRLLERDPRRRMGATRGAAEIKRHPFFAGVDWAL  441

Query  386   IRTYRPP  366
             IR   PP
Sbjct  442   IRCVAPP  448



>dbj|BAJ96762.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   349 bits (896),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 194/361 (54%), Positives = 241/361 (67%), Gaps = 16/361 (4%)
 Frame = -3

Query  1409  RPHRKHGS-NWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD--F  1239
             RPH    S +W+ + AA   ++DG L L HL L R +G G+L RVFLCRL+    +   F
Sbjct  98    RPHSSSTSPHWTHLAAARAATADGVLRLAHLHLVRELGHGHLARVFLCRLKSSPPASPLF  157

Query  1238  ALKVIDRDSLTAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             ALKV+D       ++ HV  E+ +LS LDHPF+PTLYA L+   Y C LMD+CS GDLHS
Sbjct  158   ALKVVDLRDDDPSRVCHVLAESRVLSSLDHPFVPTLYARLDAGRYACFLMDYCSGGDLHS  217

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             +LR++ G RL V + RFYAAEVL+ALEYLH LG VYRDLKPEN+L+R DGH++LSDFDL 
Sbjct  218   VLRRRPGGRLPVAAARFYAAEVLLALEYLHVLGFVYRDLKPENVLLRGDGHVVLSDFDLA  277

Query  878   FRADIFPQLETLTRVPLGSGGR-----KCGFLGerrreETVT-----EFVAEPTTAFSRS  729
               A + P +        G   +      C        E+ V      EFVAEPT A S+ 
Sbjct  278   LPASVEPAVRRRQVRQQGRRRKRSLLPSCFSSNGDSDEDDVDAKERFEFVAEPTAANSKD  337

Query  728   CVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVR  549
             CVGTHEYLAPEL+SGNGHGNGVDWWAFGV +YEL++G TPFKG +K+ TL+NI S + V 
Sbjct  338   CVGTHEYLAPELVSGNGHGNGVDWWAFGVFLYELVYGRTPFKGPAKDVTLKNILSKQ-VT  396

Query  548   FYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRP  369
             +   DGE E  A A  KDL+ RLL +DPR+R+G A+GA +IKRHPFF G+ W LIR   P
Sbjct  397   YPKLDGEAE--AAAQLKDLVGRLLERDPRRRMGAARGAAEIKRHPFFAGVDWALIRCVTP  454

Query  368   P  366
             P
Sbjct  455   P  455



>ref|XP_009381125.1| PREDICTED: protein kinase PINOID 2-like [Musa acuminata subsp. 
malaccensis]
Length=476

 Score =   347 bits (891),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 190/402 (47%), Positives = 251/402 (62%), Gaps = 38/402 (9%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD--YEHSDFA  1236
             +PH+ + + W AI+     S  G++ L H +L R +GSG+LG V+LCRLRD  +    +A
Sbjct  56    KPHKANQAEWEAIQRLRAAS--GSVRLEHFRLVRRLGSGDLGNVYLCRLRDPRFPGCLYA  113

Query  1235  LKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             +KV+DR++L   KKL   +TE EIL  LDHPFLPTLYA  + +HY+CLLM+FC  GDLH 
Sbjct  114   MKVVDREALAFRKKLQRAETEKEILRTLDHPFLPTLYADFDAAHYSCLLMEFCPGGDLHV  173

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             + ++Q G R ++ S +FYAAE+L+ALEYLH +G+VYRDLKPEN+L+R+DGHIM+SDFDL 
Sbjct  174   VRQRQPGRRFTISSAKFYAAEILLALEYLHMMGVVYRDLKPENVLVRDDGHIMISDFDLS  233

Query  878   FRADIFPQLET--LTRVPLGSGGRKCG-------------FLGerrre------------  780
              + D+ P+L T  L+  P+    +  G             F G    +            
Sbjct  234   LKCDVVPKLMTPRLSGKPVARNAKGSGSSCVPPMQPVLACFYGRGANKHDRKPKTPEEDD  293

Query  779   -----ETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGT  615
                  E   E VAEP TA S+S VGTHEYLAPE+ISG GHG+ VDWWA GV +YE++ G 
Sbjct  294   LDDQEELDPELVAEPITARSKSFVGTHEYLAPEVISGAGHGSAVDWWALGVFLYEMIHGR  353

Query  614   TPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGA  435
             TPFKG   E TL NI         A    +E   +  A+DLI +LLVK+P+KR+G  KG+
Sbjct  354   TPFKGEDNERTLVNIIKAPLSFPVAAATGKELDELLRAQDLISKLLVKNPKKRIGSVKGS  413

Query  434   TDIKRHPFFNGIKWPLIRTYRPPEPRGLVLK-RSKSKAHVTG  312
               IKRH FF G+ W LIR+ RPPE  G   + RS+SK  V  
Sbjct  414   AQIKRHVFFKGVNWALIRSVRPPEVPGDSRRARSRSKGPVAA  455



>ref|XP_010914915.1| PREDICTED: protein kinase PINOID 2 [Elaeis guineensis]
Length=459

 Score =   346 bits (888),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 193/405 (48%), Positives = 257/405 (63%), Gaps = 35/405 (9%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD--FA  1236
             +PH+ + + W AI+     ++ G + L H +L R +GSG+LG V+LC+LRD   S   +A
Sbjct  49    KPHKANQTEWEAIRRVQ--AAAGRVGLDHFRLVRRLGSGDLGNVYLCQLRDPMFSGCLYA  106

Query  1235  LKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             +KV+D+++L   KKL   +TE EIL  LDHPFLPTLYA  + +HY+CLLM+FC  GDLH 
Sbjct  107   IKVVDKEALAFRKKLQRAETEREILRTLDHPFLPTLYAEFDAAHYSCLLMEFCPGGDLHV  166

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             + ++Q G R ++ S RFYAAE L+ALEYLH +G+VYRDLKPEN+L+R+DGHIMLSDFDL 
Sbjct  167   VRQRQPGRRFTISSARFYAAETLLALEYLHMMGVVYRDLKPENVLVRDDGHIMLSDFDLS  226

Query  878   FRADIFPQL----------------ETLTRVPLGSGGRKCGFLGerrre----ETVT---  768
              +  + P+L                 + + VP       C + G R++     ETVT   
Sbjct  227   LKCHVVPRLLRQRLDPKLVDKNAKGSSSSCVPPMQPVLSCFYGGTRQKARPAPETVTKED  286

Query  767   ----EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKG  600
                 E VAEP  A SRS VGTHEYLAPE+ISG GHG+ VDWW  GV +YE+++G TPFKG
Sbjct  287   GFDPELVAEPVAARSRSFVGTHEYLAPEVISGAGHGSAVDWWTLGVFLYEMMYGRTPFKG  346

Query  599   SSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKR  420
                E TL NI              +E   +  A+DLI +LLVK+P++R+G  KGA +IKR
Sbjct  347   DDNEKTLVNIIKQPLTFPKVATCGKELDEILRAQDLISKLLVKNPKRRIGSLKGAAEIKR  406

Query  419   HPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRRRR  288
             H FF G+ W LIR+ RPPE PR   L+R++SKA V  +   R  R
Sbjct  407   HEFFKGVNWALIRSVRPPEVPRD--LRRTRSKAPVQKLGKKRDER  449



>ref|XP_007013364.1| AGC [Theobroma cacao]
 gb|EOY30983.1| AGC [Theobroma cacao]
Length=474

 Score =   345 bits (884),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 189/410 (46%), Positives = 248/410 (60%), Gaps = 41/410 (10%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEHSD  1242
             +PH+ + + W A+K      + G + L H +L R +GSG++G V+LC++R+         
Sbjct  55    KPHKANQAAWEAMKRLR--RAKGRVGLDHFRLLRRLGSGDIGNVYLCQIRNPVVGLPQCF  112

Query  1241  FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             +A+KV+DR++L   KKL     E EIL MLDHPFLPTLYA  E SHY+CL+M+FC  GDL
Sbjct  113   YAMKVVDREALAIRKKLQRADMEKEILGMLDHPFLPTLYAEFEASHYSCLVMEFCPGGDL  172

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             ++  ++Q G R S+ S +FYAAE L+ALEYLH +GIVYRDLKPEN+L+REDGHIMLSDFD
Sbjct  173   YAARQRQPGKRFSISSAKFYAAETLLALEYLHMMGIVYRDLKPENVLVREDGHIMLSDFD  232

Query  884   LCFRADIFPQLE---------------------TLTRVPLGSGGRKCGFLGerrreETV-  771
             L F+ D+ P+L                      T    P+ S         +     T+ 
Sbjct  233   LSFKCDVVPKLLRPKPNLEDTEKYDKYCLTPSCTTPMQPVLSCFSSSNKKKKTATVTTIR  292

Query  770   ---------TEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFG  618
                       E VAEP  A SRS VGTHEYLAPE+ISG GHG+ VDWW  GV +YE+L+G
Sbjct  293   EQADCQEVDPELVAEPINAKSRSFVGTHEYLAPEVISGQGHGSAVDWWTLGVFLYEMLYG  352

Query  617   TTPFKGSSKESTLRNIASTRGV--RFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCA  444
              TPFKG + E TL NI        RF  + G +E   M   +DLI +LLVK+P+KR G  
Sbjct  353   RTPFKGENNEKTLINILKQPLTFPRFSVNSG-KEFEEMVKVQDLISKLLVKNPKKRFGSL  411

Query  443   KGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSSPRR  294
             KG+ +IKRH FF G+ W LIR+ RPPE    + K   S+AH+  +S   R
Sbjct  412   KGSVEIKRHEFFKGVNWALIRSVRPPEVPSDLYKIRSSRAHLAKLSKEER  461



>ref|XP_007138317.1| hypothetical protein PHAVU_009G198500g [Phaseolus vulgaris]
 gb|ESW10311.1| hypothetical protein PHAVU_009G198500g [Phaseolus vulgaris]
Length=458

 Score =   344 bits (882),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 172/343 (50%), Positives = 226/343 (66%), Gaps = 30/343 (9%)
 Frame = -3

Query  1304  VGSGNLGRVFLCRLRD----YEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFL  1140
             +GSG++G V+LC++R+         +A+KV+DR++L+  KKL   + E EIL+M+DHPFL
Sbjct  82    LGSGDIGNVYLCQIRNPAVGLAQCLYAMKVVDREALSIRKKLHRAEMEKEILAMMDHPFL  141

Query  1139  PTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLG  960
             PTLYA  + SHY+C +MDFC  GDL S  ++  G R ++ S +FYAAE LVALEYLH  G
Sbjct  142   PTLYAAFDASHYSCFVMDFCPGGDLFSARQRLPGKRFTISSTKFYAAETLVALEYLHMKG  201

Query  959   IVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQL---ETLTRVPLGSGGRKCG-----  804
             IVYRDLKPEN+L+REDGHIMLSDFDLC R D+ P+L   +T +   + +    C      
Sbjct  202   IVYRDLKPENVLVREDGHIMLSDFDLCLRCDVVPKLLRSKTRSERSIKTRASSCAAPMQS  261

Query  803   -FLGerrreETV-------------TEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNG  666
              F    +R++               TE VAEP  A S+S VGTHEYLAPE+ISG GHG+ 
Sbjct  262   CFSASSKRKKVTTVIRENVEVCELDTEVVAEPINARSKSFVGTHEYLAPEVISGQGHGSA  321

Query  665   VDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDL  492
             VDWW FGV +YE+L+G TPFKG + E TL NI   + + F   A    +E   M   +DL
Sbjct  322   VDWWTFGVFLYEMLYGRTPFKGENNEKTLTNILK-QPLCFPRIAVSSSKEYEEMVKVQDL  380

Query  491   IERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             I +LLVK+P+KR+GC  G+ +IKRH FF G+ W LIR+ RPPE
Sbjct  381   ISKLLVKNPKKRIGCCMGSVEIKRHEFFKGVNWALIRSVRPPE  423



>ref|XP_009772702.1| PREDICTED: protein kinase PINOID 2 [Nicotiana sylvestris]
Length=489

 Score =   344 bits (882),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 192/426 (45%), Positives = 255/426 (60%), Gaps = 48/426 (11%)
 Frame = -3

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             N  N H +PH+ +   W  IK        G + L H +L R VGSG++G V++C +R+  
Sbjct  55    NFSNSH-KPHKSNQIPWELIKKLRV--KTGQIKLEHFRLLRRVGSGDIGNVYVCEIRNPI  111

Query  1250  HSD-----------------FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYA  1125
              S+                 +A+KV+D+++L   KKL   + E EIL ++DHPFLPTLYA
Sbjct  112   LSNGWPENYTMSRGLLPQCFYAMKVVDKEALLIRKKLQRAEMEKEILGIIDHPFLPTLYA  171

Query  1124  HLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRD  945
               E SHY+CL+M++C  GDLH+  ++Q G R S+ S +FYAAE+L+ALEYLH +GIVYRD
Sbjct  172   QFEASHYSCLVMEYCPGGDLHAARQRQPGKRFSISSAKFYAAEILLALEYLHMMGIVYRD  231

Query  944   LKPENILIREDGHIMLSDFDLCFRADIFPQL--------ETLTRVPLGSGGRKCG-----  804
             LKPEN+L+R DGHIMLSDFDL F+ ++ P L           T     S    C      
Sbjct  232   LKPENVLVRADGHIMLSDFDLSFKCEVIPTLIKSKPKPNNQKTTTSCISKHSYCTLPIQP  291

Query  803   ----FLGerrreETV------TEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWW  654
                 FL  ++ ++ V      +E V EP  A SRS VGTHEYLAPE+ISG GHG+ VDWW
Sbjct  292   VLSCFLSPKKEQKIVEIQDHNSEIVVEPINARSRSFVGTHEYLAPEVISGQGHGSAVDWW  351

Query  653   AFGVLMYELLFGTTPFKGSSKESTLRNIASTRGV--RFYADDGERETPAMAAAKDLIERL  480
               GV +YEL+FGTTPFKG + E TL NI        R       +E   M   +DLI RL
Sbjct  352   TLGVFLYELIFGTTPFKGENNEKTLVNILKKPLTFPRIGISSTSKEYEEMVKVQDLISRL  411

Query  479   LVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLV-LKRSKSKAHVTGVS  306
             LVK+P+KR+G  KG+ +IKRH FF G+ W LIR+ +PPE P  LV LK +++ A V    
Sbjct  412   LVKNPKKRIGNLKGSVEIKRHEFFKGVNWALIRSIKPPEIPNDLVKLKSARNAAAVIPKL  471

Query  305   SPRRRR  288
             S ++R 
Sbjct  472   SKKQRE  477



>ref|XP_006364909.1| PREDICTED: protein kinase PINOID 2-like [Solanum tuberosum]
Length=464

 Score =   343 bits (879),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 247/386 (64%), Gaps = 35/386 (9%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEHSD  1242
             +PH+ +   W  I+     S  G + L H +L R VG G++G V+LC +R+         
Sbjct  59    KPHKSNQIPWELIRRIRVES--GQIKLEHFRLLRRVGGGDIGSVYLCEIRNPVVGLPQCF  116

Query  1241  FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             +A+KV+DR+++   KKL   + E EIL ++DHPFLPTLYA  E SHY+CL+M++C  GDL
Sbjct  117   YAMKVVDREAVEIRKKLQRAEMEKEILGIIDHPFLPTLYAQFEASHYSCLVMEYCPGGDL  176

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             H++ ++Q G R S+ S +FYAAE+LVALEYLH +GIVYRDLKPEN+L+R DGHIMLSDFD
Sbjct  177   HAVRQRQPGKRFSISSAKFYAAEILVALEYLHMMGIVYRDLKPENVLVRSDGHIMLSDFD  236

Query  884   LCFRAD-IFPQL------ETLTRVPLGSGGRKCG---------FLGerrr-----eETVT  768
             L F+ D + P L      +++T+ P  S    C          FL  +       +E   
Sbjct  237   LSFKCDEVVPTLVKSKTTKSITKTPRNS---YCAMPIQPVLSCFLSRKTEQNHENQEQNQ  293

Query  767   EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKE  588
             E VAEP  A S+S VGTHEYLAPE+ISG GHG+ VDWW  GV +YEL+FGTTPFKG + E
Sbjct  294   EIVAEPINARSKSFVGTHEYLAPEVISGQGHGSAVDWWTLGVFLYELIFGTTPFKGENNE  353

Query  587   STLRNIASTRGVRF--YADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHP  414
              TL NI   + + F   A    RE   M   +DLI RLLVK+P+KR+G  +G+ +IK+H 
Sbjct  354   KTLVNILK-KPLTFPRIAISSSREYEEMVKVQDLICRLLVKNPKKRIGSLQGSVEIKKHE  412

Query  413   FFNGIKWPLIRTYRPPE-PRGLVLKR  339
             FF G+ W LIR+ +PPE P  LV  R
Sbjct  413   FFKGVNWALIRSIKPPEVPNDLVKMR  438



>ref|XP_009588319.1| PREDICTED: protein kinase PINOID 2 [Nicotiana tomentosiformis]
Length=489

 Score =   344 bits (882),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 184/398 (46%), Positives = 240/398 (60%), Gaps = 45/398 (11%)
 Frame = -3

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD--  1257
             N  N H +PH+ +   W  IK        G + L H +L R VG G++G V++C +R+  
Sbjct  55    NFSNSH-KPHKSNQIPWELIKKLRV--KTGQIKLEHFRLLRRVGGGDIGNVYVCEIRNPI  111

Query  1256  --------YEHSD-------FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYA  1125
                     Y  S        +A+KV+D+++L   KKL   + E EIL ++DHPFLPTLYA
Sbjct  112   VISNWPENYTMSRGLLPQCFYAMKVVDKEALIIRKKLQRAEMEKEILGIIDHPFLPTLYA  171

Query  1124  HLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRD  945
               E SHY+CL+M++C  GDLH+  ++Q G R S+ S +FYAAE+L+ALEYLH +GIVYRD
Sbjct  172   QFEASHYSCLVMEYCPGGDLHAARQRQPGKRFSISSAKFYAAEILLALEYLHMMGIVYRD  231

Query  944   LKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKC--------------  807
             LKPEN+L+R DGHIMLSDFDL F+ ++ P L      P       C              
Sbjct  232   LKPENVLVRADGHIMLSDFDLSFKCEVIPTLIKSKPKPNDQKNTSCISKHSYCSLPIQPV  291

Query  806   --GFLGerrreETV------TEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWA  651
                FL  +  ++ V      +E VAEP  A SRS VGTHEYLAPE+ISG GHG+ VDWW 
Sbjct  292   LSCFLSPKIEQKKVEIQDHNSEIVAEPINARSRSFVGTHEYLAPEVISGQGHGSAVDWWT  351

Query  650   FGVLMYELLFGTTPFKGSSKESTLRNI--ASTRGVRFYADDGERETPAMAAAKDLIERLL  477
              GV +YEL+FGTTPFKG + E TL NI   S    R       +E   M   +DLI RLL
Sbjct  352   LGVFLYELIFGTTPFKGENNEKTLVNILKKSLTFPRIGISSTSKEYEEMVKVQDLISRLL  411

Query  476   VKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             VK+P+KR+G  KG+ +IKRH FF G+ W LIR+ +PPE
Sbjct  412   VKNPKKRIGSLKGSVEIKRHDFFKGVNWALIRSIKPPE  449



>gb|KHG12432.1| Protein kinase PINOID 2 -like protein [Gossypium arboreum]
Length=480

 Score =   341 bits (875),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 185/415 (45%), Positives = 252/415 (61%), Gaps = 46/415 (11%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEHSD  1242
             +PH+ + + W A+K      + G + L H +L R +GSG++G V+LC++R+         
Sbjct  56    KPHKANQAAWEAMKRLK--RAKGKVGLDHFRLLRRLGSGDIGNVYLCQIRNPVVGLPQCF  113

Query  1241  FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             +A+KV+DR++L   KKL     E EIL MLDHPF+PTLYA  E SHY+CL+M++C  GDL
Sbjct  114   YAMKVVDREALAIRKKLQRADMEKEILGMLDHPFVPTLYAEFEASHYSCLVMEYCPGGDL  173

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             +   ++Q G R S+ S +FYAAE+L+ALEYLH +GIVYRDLKPEN+L+REDGHIMLSDFD
Sbjct  174   YVARQRQPGKRFSISSAKFYAAEILLALEYLHMMGIVYRDLKPENVLVREDGHIMLSDFD  233

Query  884   LCFRADIFPQLETLTR----------------------VPLGSGGRKCGFLGerrreETV  771
             L F+ D+ P+L   ++                       P+ S         +  R  T+
Sbjct  234   LSFKCDVVPKLLRRSKPNLEDNEDDDDFCLAPSCASPMQPVLSCFSSSNRKKKGSRVTTI  293

Query  770   T--------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
             T              E VAEP  A S+S VGTHEYLAPE+ISG GHG+ VDWW  GV +Y
Sbjct  294   TEQADNSAAAQEVGPELVAEPLNAKSKSFVGTHEYLAPEVISGQGHGSAVDWWTLGVFLY  353

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIERLLVKDPRK  459
             E+L+G TPFKG + E TL NI   + + F   +  G +E   M   +DLI +LLVK+P+K
Sbjct  354   EMLYGRTPFKGENNEKTLINILK-QPLTFPRISVKGGKEFEDMVKIQDLISKLLVKNPKK  412

Query  458   RLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSSPRR  294
             R+G  KG+ +IKRH FF G+ W LIR+ RPPE    + K   S+ H+  +S   R
Sbjct  413   RIGSMKGSVEIKRHEFFKGVNWALIRSVRPPEVPSDLYKVKSSRVHIPKLSKQER  467



>ref|XP_007154974.1| hypothetical protein PHAVU_003G162100g [Phaseolus vulgaris]
 gb|ESW26968.1| hypothetical protein PHAVU_003G162100g [Phaseolus vulgaris]
Length=484

 Score =   341 bits (875),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 182/389 (47%), Positives = 245/389 (63%), Gaps = 42/389 (11%)
 Frame = -3

Query  1415  HSRPHRKHGSNWSAIKAAATLSSD-GAlhlrhlklhrLVGSGNLGRVFLCRLRD----YE  1251
             H+RPH+ + + W  ++    L  D G + L H +L R +GSG++G V+LC++R+      
Sbjct  64    HARPHKANQAAWEVMR---RLRRDKGQVGLEHFRLLRRLGSGDIGNVYLCQIRNPVVGLP  120

Query  1250  HSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
                +A+KV+DR++L   KKL   + E EIL+MLDHPFLPTLY   + SHY+CL+M+FC  
Sbjct  121   QCFYAMKVVDREALAIRKKLQRAEMEKEILAMLDHPFLPTLYTEFDASHYSCLVMEFCPG  180

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDL++  ++Q G R S+ S +FYAAE L+ALEYLH +GIVYRDLKPEN+L+REDGHIMLS
Sbjct  181   GDLYAARQRQPGKRFSITSTKFYAAETLLALEYLHMMGIVYRDLKPENVLVREDGHIMLS  240

Query  893   DFDLCFRADIFPQ-LETLTRVPLGSGGRK---------------CGFLGerrreETVT--  768
             DFDL  + D+ P+ L + TRV       K               C     ++++ TVT  
Sbjct  241   DFDLSLKCDVVPKLLRSKTRVERSIKSTKRSVPACTAPMQPVLSCFLASSKKKKATVTTV  300

Query  767   ------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELL  624
                         E VAEP  A S+S VGTHEYLAPE+I G GHG+ VDWW FGV +YE+L
Sbjct  301   IRENVEVEELDPELVAEPIDAKSKSFVGTHEYLAPEVILGQGHGSAVDWWTFGVFLYEML  360

Query  623   FGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIERLLVKDPRKRLG  450
             +G TPFKG + E TL NI   + + F   A    ++   M   +DLI +LLVK+P KR+G
Sbjct  361   YGRTPFKGENNEKTLVNILK-QPLAFPRIAASSSKDYEEMVKVQDLISKLLVKNPNKRIG  419

Query  449   CAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
                G+ +IKRH FF G+ W LIR+ RPPE
Sbjct  420   SCMGSVEIKRHEFFKGVNWALIRSVRPPE  448



>ref|XP_002285044.1| PREDICTED: protein kinase PINOID 2 [Vitis vinifera]
Length=470

 Score =   341 bits (874),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 186/411 (45%), Positives = 254/411 (62%), Gaps = 42/411 (10%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEHSD  1242
             +PH+ + + W A+K        G + L H ++ R +GSG++G V+LC++R+       S 
Sbjct  50    KPHKANQAAWEAMKRLR--GEKGRVGLDHFRMLRRLGSGDIGNVYLCQIRNPVVGLPQSF  107

Query  1241  FALKVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             +A+KV+DR++L  + KL   + E EIL +LDHPFLPTLYA  + SHY+CL+M+FC  GDL
Sbjct  108   YAMKVVDREALAIRNKLQRAEMEKEILGILDHPFLPTLYAEFDASHYSCLVMEFCPGGDL  167

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             H+  ++Q G R S+ S +FYAAE LVALEYLH +G+VYRDLKPEN+L+REDGHIMLSDFD
Sbjct  168   HAARQRQPGKRFSISSAKFYAAETLVALEYLHMMGVVYRDLKPENVLVREDGHIMLSDFD  227

Query  884   LCFRADIFPQL--------ETLTRV---------PL--------GSGGRKCGFLGerrre  780
             L  + D+ P+L         T  +V         P+         S  +K G +      
Sbjct  228   LSLKCDVVPKLLRPKPDQEATGKKVKSSTPSCATPMQPVLSCFSASNKKKKGSVRTIVAS  287

Query  779   ET------VTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFG  618
             +         E VAEP  A S+S VGTHEYLAPE+ISG GHG+ VDWW  GV +YELL+G
Sbjct  288   QADDVQEIDPELVAEPINARSKSFVGTHEYLAPEVISGQGHGSAVDWWTLGVFLYELLYG  347

Query  617   TTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIERLLVKDPRKRLGCA  444
              TPFKG + E TL NI   + + F        +E   M   +DLI +LLVK+P+KR+G  
Sbjct  348   RTPFKGENNEKTLINILK-QPLTFPRIGVSSSKEFEEMVKVQDLISKLLVKNPKKRIGSL  406

Query  443   KGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRR  294
             KG+ +IKRH FF G+ W LIR+ +PPE PR  + K  +S+A +  +S   R
Sbjct  407   KGSVEIKRHEFFKGVNWALIRSVKPPEVPRDHLQKIIRSRASLPKLSKKER  457



>ref|XP_004251575.1| PREDICTED: protein kinase PINOID 2 [Solanum lycopersicum]
Length=462

 Score =   340 bits (871),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 184/396 (46%), Positives = 252/396 (64%), Gaps = 41/396 (10%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEHSD  1242
             +PH+ +  +W  I+     S  G + L H +L R VG G++G V+LC +R+         
Sbjct  59    KPHKSNQISWELIRRIRVES--GQIKLEHFRLLRRVGGGDIGSVYLCEIRNPVVGLPQCF  116

Query  1241  FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             +A+KV+DR+++   KKL   + E EIL ++DHPFLPTLYA  E SHY+CL+M++C  GDL
Sbjct  117   YAMKVVDREAVEIRKKLQRGEMEKEILGIIDHPFLPTLYAQFEASHYSCLVMEYCPGGDL  176

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             H++ ++Q G R S+ S +FYAAE+L+ALEYLH +GIVYRDLKPEN+L+R DGHIMLSDFD
Sbjct  177   HAVRQRQPGKRFSISSAKFYAAEILLALEYLHMMGIVYRDLKPENVLVRSDGHIMLSDFD  236

Query  884   LCFRAD-IFPQL------ETLTRVPLGSGGRKCG---------FLGerrr-----eETVT  768
             L F+ D + P L      +++ + P  S    C          FL ++       +E   
Sbjct  237   LSFKCDEVVPTLVKSKTTKSIAKTPRNS---YCAMPIQPVLSCFLSQKTEQNHENQEEDQ  293

Query  767   EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKE  588
             E VAEP  A S+S VGTHEYLAPE+ISG GHG+ VDWW  GV +YEL+FGTTPFKG + E
Sbjct  294   EIVAEPINARSKSFVGTHEYLAPEVISGQGHGSAVDWWTLGVFLYELIFGTTPFKGENNE  353

Query  587   STLRNIASTRGVRF--YADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHP  414
              TL NI   + + F   A    +E   M   +DLI RLLVK+P+KR+G  +G+ +IK+H 
Sbjct  354   KTLVNILK-KPLTFPRIAISSSKEYEEMVKVQDLISRLLVKNPKKRIGSLQGSVEIKKHE  412

Query  413   FFNGIKWPLIRTYRPPEP-------RGLVLKRSKSK  327
             FF G+ W LIR+ +PP+        RG+V K SK +
Sbjct  413   FFKGVNWALIRSIKPPQVPNDLVKMRGVVPKLSKKQ  448



>ref|XP_003524535.2| PREDICTED: protein kinase PINOID 2-like [Glycine max]
Length=488

 Score =   340 bits (873),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 180/388 (46%), Positives = 244/388 (63%), Gaps = 40/388 (10%)
 Frame = -3

Query  1415  HSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEH  1248
             H++PH+ + + W A++        G + L H +L R +GSG+LG V+LC++R+       
Sbjct  68    HAKPHKANQAAWEAMRR--LWRDKGQVGLDHFRLLRRLGSGDLGNVYLCQIRNPVVGLPQ  125

Query  1247  SDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNG  1071
               +A+KV+DR++L   KKL   + E EIL+MLDHPFLPTLY   + SHY+CL+M+FC  G
Sbjct  126   CFYAMKVVDREALAIRKKLQRAEMEKEILAMLDHPFLPTLYTEFDASHYSCLVMEFCPGG  185

Query  1070  DLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSD  891
             DL++  ++Q G R S+ S +FYAAE L+ALEYLH +GIVYRDLKPEN+L+REDGHIML+D
Sbjct  186   DLYAARQRQPGKRFSIASAKFYAAETLLALEYLHMMGIVYRDLKPENVLVREDGHIMLTD  245

Query  890   FDLCFRADIFPQL------------ETLTRVPLGSGGRK----CGFLGerrreETVT---  768
             FDL  + D+ P+L             T   VP  +   +    C     ++++ TVT   
Sbjct  246   FDLSLKCDVIPKLLRSKTRLERSIKSTKRSVPACTAPMQPVLSCFLSSSKKKKATVTTVI  305

Query  767   -----------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLF  621
                        E VAEP  A S+S VGTHEYLAPE+I G GHG+ VDWW FGV +YE+L+
Sbjct  306   RENVEVEENDPELVAEPIDAKSKSFVGTHEYLAPEVILGQGHGSAVDWWTFGVFLYEMLY  365

Query  620   GTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIERLLVKDPRKRLGC  447
             G TPFKG + E TL NI   + + F   A    +E   M   +DLI +LLVK+P KR+G 
Sbjct  366   GRTPFKGENNEKTLVNILK-QPLSFPRIAVSSSKEFEEMVKVQDLISKLLVKNPSKRIGS  424

Query  446   AKGATDIKRHPFFNGIKWPLIRTYRPPE  363
               G+ +IKRH FF G+ W LIR+ RPPE
Sbjct  425   CMGSVEIKRHEFFKGVNWALIRSVRPPE  452



>emb|CDM81915.1| unnamed protein product [Triticum aestivum]
Length=485

 Score =   340 bits (871),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 194/428 (45%), Positives = 246/428 (57%), Gaps = 66/428 (15%)
 Frame = -3

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
               P  HS+PH+ + + W AI      ++ G++ L H +L R +GSG+LG V+LC LR+  
Sbjct  42    ETPCRHSKPHKANHAEWEAIAHVRAAATGGSVGLDHFRLVRRLGSGDLGNVYLCELREPP  101

Query  1250  HSD-------FALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCL  1095
             H         +A+KV+D+D+L   KKL   + E EIL  LDHPFLPTLYA  E SHY CL
Sbjct  102   HRPSSSGRLYYAMKVVDKDALAFRKKLRRAEVEREILRSLDHPFLPTLYADFEASHYACL  161

Query  1094  LMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIRE  915
             +M+FC  GDLH   ++Q G R SV S RFYAAE ++ALEYLH +G+VYRDLKPEN+L+R 
Sbjct  162   VMEFCPGGDLHVARQRQPGRRFSVASARFYAAETVLALEYLHMMGVVYRDLKPENVLVRA  221

Query  914   DGHIMLSDFDLCFRA-DIFPQLETLTRVPLGSGG--------------------------  816
             DGHIMLSDFDL  +  D+ P+   L R P G G                           
Sbjct  222   DGHIMLSDFDLSLKCDDVIPK---LLRQPRGDGAGANPSSTYGHSSSCVPPIQPVLSCLL  278

Query  815   ------RKCGFLGerrreETVTE--------------FVAEPTTAFSRSCVGTHEYLAPE  696
                   R+    G    +    E               V EP  A SRS VGTHEYLAPE
Sbjct  279   NGVTRKRQVPMPGAAAVDADAAEHSEPEQTSESDPAEVVVEPVAARSRSFVGTHEYLAPE  338

Query  695   LISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF-----YADDG  531
             +ISG GHG+ VDWW  GV MYE+++G TPFKG++ E TL NI S R V F      A  G
Sbjct  339   VISGQGHGSAVDWWTLGVFMYEMVYGQTPFKGATNEETLANIVSKRPVAFPRIPASASCG  398

Query  530   ERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGL  351
             ERE   +  A+DL+ RLL K P KRLG   G+ ++KRH FF G+ W L+R+ RPPE   +
Sbjct  399   EREE--LLRAQDLMARLLAKCPGKRLGSCTGSGEVKRHGFFQGVNWALVRSVRPPE-VPV  455

Query  350   VLKRSKSK  327
                RSK+K
Sbjct  456   PAARSKAK  463



>ref|XP_002274153.1| PREDICTED: protein kinase PINOID [Vitis vinifera]
 emb|CAN62073.1| hypothetical protein VITISV_032865 [Vitis vinifera]
Length=451

 Score =   338 bits (866),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 185/379 (49%), Positives = 242/379 (64%), Gaps = 32/379 (8%)
 Frame = -3

Query  1421  NLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD  1242
             NL  +PHR   S + AI++AA  S    L  R  KL R +GSG++G V+LCRLR     D
Sbjct  43    NLTLKPHRSSDSAYEAIRSAA-FSRKSGLSFRDFKLVRRIGSGDIGTVYLCRLRSSSDDD  101

Query  1241  ---FALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
                +A+KV+D+++L   KK+   + E  IL MLDHPFLPTLYA  E SH++ ++M++CS 
Sbjct  102   GCFYAMKVVDKETLAMKKKIQRAEMEKRILKMLDHPFLPTLYAEFEASHFSGIVMEYCSG  161

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLHSL  KQ   R S+ S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R DGHIMLS
Sbjct  162   GDLHSLKHKQPQKRFSLSSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIMLS  221

Query  893   DFDLCFRADIFPQLETL--------------TRVPLGSGGRKCGFLGerrreETVTE-FV  759
             DFDL   ++  P +E+                R P       C F   + +  ++   FV
Sbjct  222   DFDLSLCSNAIPAVESPDFSPDSPSPASPPNCRTP---SPFSCLFRSRKVQTLSINRLFV  278

Query  758   AEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTL  579
             AEP +A S S VGTHEY++PE+ SG  HGNGVDWWA G+ +YE+++G TPF G++ E+TL
Sbjct  279   AEPVSAKSCSFVGTHEYVSPEVASGRSHGNGVDWWALGIFIYEMVYGATPFAGATNEATL  338

Query  578   RNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDPRKRLGCAKGATDIKRHPFF  408
             RNI   + + F       ETPA  +   A+DL+  LLVKDP  RLG  +GA D+K HPFF
Sbjct  339   RNIV-KKPLSF-----PTETPASVSEMHARDLMSGLLVKDPASRLGSKRGAADVKTHPFF  392

Query  407   NGIKWPLIRTYRPPEPRGL  351
              G+ + L+R+  PPE  GL
Sbjct  393   KGLNFALVRSLTPPEIPGL  411



>ref|XP_010244530.1| PREDICTED: protein kinase PINOID-like [Nelumbo nucifera]
Length=451

 Score =   338 bits (866),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 187/377 (50%), Positives = 241/377 (64%), Gaps = 36/377 (10%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD----  1242
             +PHR     W AI++A T      L  R  KL R +GSG++G V+L RLR +   +    
Sbjct  56    KPHRSSDYAWEAIRSA-TFHRKNGLSFRDFKLIRRIGSGDIGSVYLSRLRTHGAGEDGCY  114

Query  1241  FALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             +A+KV+D+++L   KK+   +TE  IL MLDHPFLPTLYA  E SHYTC++M+FCS GDL
Sbjct  115   YAMKVVDKEALALKKKVERAETEKRILKMLDHPFLPTLYAEFEASHYTCVVMEFCSGGDL  174

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             H+L  KQ G R S+ S RFYAAEVLVALEYLH +GI+YRDLKPEN+L+R DGHIMLSDFD
Sbjct  175   HTLRHKQPGKRFSLSSARFYAAEVLVALEYLHMMGIIYRDLKPENVLVRSDGHIMLSDFD  234

Query  884   LCFRADIFPQLETLTRVP----------------LGSGGRKCGF--LGerrreETVT---  768
             L   ++  P +E+    P                  S    C +  L   R+  TV+   
Sbjct  235   LSLCSNAIPAVESPDSSPDPTTTSSLSSTSRARTRSSSSLSCLYNRLFRSRKVRTVSMNR  294

Query  767   EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKE  588
              FVAEP +A S S VGTHEY+APE+ +G  HGN VDWWA G+ +YEL++G TPF G + E
Sbjct  295   RFVAEPVSARSCSFVGTHEYVAPEVAAGKSHGNAVDWWALGIFIYELIYGRTPFSGETNE  354

Query  587   STLRNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDPRKRLGCAKGATDIKRH  417
             +TLRNI   +   F+      E+PA A+   A+DLI  LLVKDP  RLG  +GA D+K H
Sbjct  355   ATLRNI--VKKPLFFPT----ESPASASEVHARDLISGLLVKDPATRLGSKRGAADVKTH  408

Query  416   PFFNGIKWPLIRTYRPP  366
             PFF G+ + LIR+Y+PP
Sbjct  409   PFFKGLNFALIRSYKPP  425



>ref|XP_008792077.1| PREDICTED: protein kinase PINOID 2-like [Phoenix dactylifera]
Length=461

 Score =   337 bits (865),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 187/408 (46%), Positives = 250/408 (61%), Gaps = 40/408 (10%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD--FA  1236
             +PH+ + + W AI+     ++ G + L H +L R +GSG+LG V+LC+LRD + S   +A
Sbjct  45    KPHKANQAEWEAIRRVQ--AAAGRVGLDHFRLVRRLGSGDLGNVYLCQLRDPKFSGCLYA  102

Query  1235  LKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             +KV D+++L   KKL   +TE +IL  LDHPFLPTLYA  E +HY+CL+M+FC  GDLH 
Sbjct  103   IKVADKEALAFRKKLQRAETERDILRTLDHPFLPTLYAEFEAAHYSCLVMEFCPGGDLHV  162

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             + ++Q G R ++ S RFYAAE L+ALEYLH +G+VYRDLKPEN+L+R+DGHIMLSDFDL 
Sbjct  163   VRQRQPGRRFTISSARFYAAETLLALEYLHMMGVVYRDLKPENVLVRDDGHIMLSDFDLS  222

Query  878   FRADIFPQL--ETLTRVPLGSGGR--------------KCGFLGerrreETVT-------  768
              +  + P+L  + L   P     R               C + G    E+          
Sbjct  223   LQCHVVPRLLRQRLDPKPAEKKARGSSSSCVPPMQPVLSCFYGGAVESEKQKARPAAPET  282

Query  767   ---------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGT  615
                      E VAEP  A S S VGTHEYLAPE+ISG GHG  VDWW  GV +YE+++G 
Sbjct  283   IAKEDGFDPELVAEPIAARSASFVGTHEYLAPEVISGAGHGGAVDWWTLGVFLYEMMYGR  342

Query  614   TPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGA  435
             TPFKG   E TL NI              +E   +  A+DLI +LLVK+P++RLG  KGA
Sbjct  343   TPFKGEDNEKTLVNIIKQPLTFPKVATCGKELDEILRAQDLISKLLVKNPKRRLGSLKGA  402

Query  434   TDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRR  294
              +IKRH FF G+ W LIR+ +PPE PR   L+R++S+A V  +S   R
Sbjct  403   AEIKRHEFFKGVNWALIRSVKPPEVPRD--LRRTRSRAPVQKLSKKER  448



>ref|XP_009408965.1| PREDICTED: protein kinase PINOID 2-like [Musa acuminata subsp. 
malaccensis]
Length=498

 Score =   338 bits (867),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 188/414 (45%), Positives = 253/414 (61%), Gaps = 44/414 (11%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD--FA  1236
             +PH+ + + W AI+     S  G + L H ++ R +GSG+LG V+LC+LRD       +A
Sbjct  74    KPHKANQAEWEAIRRLRAAS--GHVRLDHFRIVRRLGSGDLGNVYLCQLRDPRSPGCLYA  131

Query  1235  LKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             +KV+DR++L   KKL   +TE EIL  LDHPFLPTLYA  + +HY+CL+M+FC  GDLH 
Sbjct  132   MKVVDREALAFRKKLQRAETEKEILRSLDHPFLPTLYADFDAAHYSCLVMEFCPGGDLHV  191

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
               ++Q G R S+ S +FYAAE L+ALEYLH +G+VYRDLKPEN+L+R+DGHIMLSDFDL 
Sbjct  192   ARQRQPGRRFSISSAKFYAAETLLALEYLHMMGVVYRDLKPENVLVRDDGHIMLSDFDLS  251

Query  878   FRADIFPQL----------------ETLTRVPL------------GSGGRKCGFLGerrr  783
              + D+ P+L                 + + VP             GS   KC    +   
Sbjct  252   LKCDVVPKLMMQRLSSKLAAKNAKGSSSSCVPPMQPVLSCFYGGGGSNANKCDKRAKTED  311

Query  782   eETVT---------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYE  630
             +++           E VAEP  A S+S VGTHEYLAPE+ISG GHG+ VDWWA GV +YE
Sbjct  312   DDSDDDSDDQELDPELVAEPIAARSKSFVGTHEYLAPEVISGAGHGSAVDWWALGVFIYE  371

Query  629   LLFGTTPFKGSSKESTLRNIASTR-GVRFYADDGERETPAMAAAKDLIERLLVKDPRKRL  453
             +++G TPFKG   E TL NI     G    A    +E   ++ A+DLI +LLVK+P+KR+
Sbjct  372   MIYGRTPFKGEDNEKTLINIIKQPLGFPKAAAAAGKELEELSRAQDLICKLLVKNPKKRI  431

Query  452   GCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRR  294
             G  KG+ +IK+H FF G+ W LIR+ RPPE PR     RS++ A    +S   R
Sbjct  432   GSMKGSAEIKKHEFFKGVNWALIRSVRPPEVPRDPRRGRSRTPAVAQKLSKKAR  485



>ref|XP_008785082.1| PREDICTED: protein kinase PINOID 2-like [Phoenix dactylifera]
Length=462

 Score =   336 bits (862),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 188/410 (46%), Positives = 256/410 (62%), Gaps = 43/410 (10%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD--FA  1236
             +PH+ +   W AI+     ++ G + L H +L R +GSG+LG V+LC+LRD   +   +A
Sbjct  45    KPHKANQVEWEAIRRVQ--AAAGHVGLDHFRLVRRLGSGDLGNVYLCQLRDPMSAGCLYA  102

Query  1235  LKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             +KV+D+++L   +KL   +TE EIL  LDHPFLPTLYA  E +H++CL M+FC  GDLH 
Sbjct  103   MKVVDKEALAFRRKLQRAETEREILRTLDHPFLPTLYAEFEAAHHSCLAMEFCPGGDLHV  162

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             + ++Q G R ++ S RFYAAE L+ALEYLH +G+VYRDLKPEN+L+R+DGHIMLSDFDL 
Sbjct  163   VRQRQPGRRFTISSARFYAAETLLALEYLHMMGVVYRDLKPENVLVRDDGHIMLSDFDLS  222

Query  878   FRADIFPQL-------ETLTRVPLGSGGRKC---------GFLGerrre--------ETV  771
              + D+ P+L       +++ +   GS    C          F G   R         +TV
Sbjct  223   LKCDVVPRLLRGRQDCKSVEKNVKGSSS-SCVPPMQPVLSWFYGAAIRSSKRARRAPQTV  281

Query  770   T----------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLF  621
             T          E VAEP  A S+S VGTHEYLAPE+ISG GHG+ VDWW FGV +YE+++
Sbjct  282   TKEDGFEELDPELVAEPIAARSKSFVGTHEYLAPEVISGAGHGSAVDWWTFGVFLYEMMY  341

Query  620   GTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAK  441
             G TPFKG   E TL NI              ++   +  A+DLI +LLVK+P++R+G  K
Sbjct  342   GRTPFKGEDNEKTLANIIKQPLTFPKVATCGKDLDEILRAQDLISKLLVKNPKRRIGSLK  401

Query  440   GATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRR  294
             G+ +IKRH FF G+ W LIR+ RPPE PR   L+R+++KA V   S   R
Sbjct  402   GSVEIKRHDFFKGVNWALIRSVRPPEVPRD--LRRTRTKATVQKFSRKER  449



>emb|CDP10371.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   336 bits (862),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 183/403 (45%), Positives = 244/403 (61%), Gaps = 56/403 (14%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEHSD  1242
             +PH+ + + W A+K        G + L H +L R +GSG++G V+LC++R+     +   
Sbjct  55    KPHKANQAAWEAMKRLRC--EKGHVGLDHFRLLRRLGSGDIGNVYLCQIRNPIVGLQQCF  112

Query  1241  FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             +A+KV+DR++L   KKL   + E EIL MLDHPFLPTLYA  + SHY+CL+M+FC  GDL
Sbjct  113   YAMKVVDREALAIRKKLQRAEMEKEILGMLDHPFLPTLYADFDASHYSCLVMEFCPGGDL  172

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             H+  ++Q G R S+ S +FYAAE L+ALEYLH +GI+YRDLKPEN+L+REDGHIMLSDFD
Sbjct  173   HASRQRQPGKRFSISSAKFYAAETLLALEYLHMMGIIYRDLKPENVLVREDGHIMLSDFD  232

Query  884   LCFRADIFPQLETLTRV------PLGS--GGRKCG--------------FLGerrreETV  771
             L  ++D+ P++    +V      P  S     KC               F    ++  T+
Sbjct  233   LSLKSDVVPKVIRSAKVCPADHQPTHSHKNTTKCSTPTCALPIQPVLSCFSTSNKKCTTI  292

Query  770   T--------------------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGN  669
             T                          E VAEP  A S+S VGTHEYLAPE+ISG GHG+
Sbjct  293   TVTATPLQQQPQPQATNFIYNIQEYNPELVAEPIDARSKSFVGTHEYLAPEVISGQGHGS  352

Query  668   GVDWWAFGVLMYELLFGTTPFKGSSKESTLRNI-ASTRGVRFYADDGERETPAMAAAKDL  492
              VDWW FGV +YELLFG TPFKG + E TL NI               +E   +   +DL
Sbjct  353   AVDWWTFGVFLYELLFGKTPFKGENNEKTLINILKQPLAFPRIGVSTTKEYEELLKVQDL  412

Query  491   IERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             I +LLVK+P+KR+G +KG+ +IKRH FFNG+ W LIR+ RPPE
Sbjct  413   ISKLLVKNPKKRIGSSKGSVEIKRHEFFNGVNWALIRSVRPPE  455



>ref|XP_002322241.2| hypothetical protein POPTR_0015s10550g [Populus trichocarpa]
 gb|EEF06368.2| hypothetical protein POPTR_0015s10550g [Populus trichocarpa]
Length=488

 Score =   335 bits (860),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 187/420 (45%), Positives = 258/420 (61%), Gaps = 52/420 (12%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEHSD  1242
             +PH+ + + W AIK      + G + L H +L R +GSG++G V+LC++R+         
Sbjct  62    KPHKANQAAWQAIKRLQ--RATGRVGLDHFRLLRRLGSGDIGNVYLCQIRNPVVGLPQCF  119

Query  1241  FALKVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             +A+KV+D+++L  + KL   + E EIL MLDHPFLPTLYA  E SHY+CL+ ++C  GDL
Sbjct  120   YAMKVVDKEALAIRNKLQRAEMEKEILGMLDHPFLPTLYAEFEASHYSCLVTEYCPGGDL  179

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             ++  ++Q   R S+ S +FYAAE L+ALEYLH +GIVYRDLKPEN+L+REDGHIMLSDFD
Sbjct  180   YAARQRQPWKRFSISSAKFYAAETLLALEYLHMMGIVYRDLKPENVLVREDGHIMLSDFD  239

Query  884   LCFRADIFPQL---------------ETLTRVPL--------------GSGGRK------  810
             L F+ D+ P+L               ET +  PL               S  +K      
Sbjct  240   LSFKCDVVPKLLRSKPSLEAIVRHKNETTSFAPLTFCATPIHPVLSCFSSSNKKRKPRIT  299

Query  809   ----CGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGV  642
                     G+   EE  TE VAEP +A S+S VGTHEYLAPE+ISG GHG+ VDWW  GV
Sbjct  300   TTITEQIDGQGYDEEVETELVAEPISARSKSFVGTHEYLAPEVISGQGHGSAVDWWTLGV  359

Query  641   LMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIERLLVKD  468
              +YE+L+G TPFKG + E TL NI   + + F     +  +E   M   +DL+ +LLVK+
Sbjct  360   FLYEMLYGRTPFKGENNEKTLINILK-QPLTFPRIGVNSSKEFEEMVKLQDLVGKLLVKN  418

Query  467   PRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRRR  291
             P++R+G  KG+ +IKRH FF G+ W LIR+ +PPE P  L   R +S+AH+  +S   R+
Sbjct  419   PKRRIGSLKGSVEIKRHEFFKGVNWALIRSIKPPESPSDLC--RFRSRAHIPMLSKKERQ  476



>ref|XP_010687020.1| PREDICTED: protein kinase PINOID [Beta vulgaris subsp. vulgaris]
Length=460

 Score =   335 bits (858),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 188/395 (48%), Positives = 241/395 (61%), Gaps = 41/395 (10%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             S+PHR   S + AI AA T +++ AL     KL R +G+G++  V+LCRLR  E  D+A+
Sbjct  49    SKPHRSSDSAFEAIVAATTTANNRALTFNDFKLVRRIGAGDISTVYLCRLRVDETCDYAM  108

Query  1232  KVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+++L  K K    + E +IL +LDHPFLPTLYAH   SH++C++M++CS GDLHSL
Sbjct  109   KVVDQEALALKNKTQRAEVEKKILKLLDHPFLPTLYAHFNASHFSCIVMEYCSAGDLHSL  168

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
               K    R S+ S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R DGHIMLSDFDL  
Sbjct  169   RHKFLSKRFSLSSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIMLSDFDLSL  228

Query  875   RADIFPQLE-----------TLTRVPLGSG--------------GRKCGF-------LGe  792
              +D  P +E           T    PL S                    F       L  
Sbjct  229   CSDSIPAVEWPNYTSPTHDPTAQTPPLPSSPTNQTTKTACTSNTNNSPSFSCLPYNRLFR  288

Query  791   rrreETVTE---FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLF  621
              ++ +T+T    FVAEP TA S S VGTHEY+APE+ SGN HGN VDWWAFG+ +YE+++
Sbjct  289   SKKIQTLTGNRLFVAEPVTARSCSFVGTHEYIAPEVASGNSHGNAVDWWAFGIFIYEMIY  348

Query  620   GTTPFKGSSKESTLRNI-ASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCA  444
             G TPF G S  +TLRNI   T     +A     E    A A+DLI  LL KDP  RLG +
Sbjct  349   GHTPFAGPSNAATLRNILKKTLTFPTHAPSSTSE----AHARDLISGLLRKDPATRLGSS  404

Query  443   KGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKR  339
             +GA D+K HPFF  + + L+R+  PP   GL  +R
Sbjct  405   RGAADVKTHPFFKSLNFALVRSLTPPTVPGLRQQR  439



>gb|KHN27411.1| Protein kinase PINOID 2 [Glycine soja]
Length=448

 Score =   334 bits (857),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 170/351 (48%), Positives = 225/351 (64%), Gaps = 38/351 (11%)
 Frame = -3

Query  1304  VGSGNLGRVFLCRLRD----YEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFL  1140
             +GSG+LG V+LC++R+         +A+KV+DR++L   KKL   + E EIL+MLDHPFL
Sbjct  63    LGSGDLGNVYLCQIRNPVVGLPQCFYAMKVVDREALAIRKKLQRAEMEKEILAMLDHPFL  122

Query  1139  PTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLG  960
             PTLY   + SHY+CL+M+FC  GDL++  ++Q G R S+ S +FYAAE L+ALEYLH +G
Sbjct  123   PTLYTEFDASHYSCLVMEFCPGGDLYAARQRQPGKRFSIASAKFYAAETLLALEYLHMMG  182

Query  959   IVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQL------------ETLTRVPLGSGG  816
             IVYRDLKPEN+L+REDGHIML+DFDL  + D+ P+L             T   VP  +  
Sbjct  183   IVYRDLKPENVLVREDGHIMLTDFDLSLKCDVIPKLLRSKTRLERSIKSTKRSVPACTAP  242

Query  815   RK----CGFLGerrreETVT--------------EFVAEPTTAFSRSCVGTHEYLAPELI  690
              +    C     ++++ TVT              E VAEP  A S+S VGTHEYLAPE+I
Sbjct  243   MQPVLSCFLSSSKKKKATVTTVIRENVEVEENDPELVAEPIDAKSKSFVGTHEYLAPEVI  302

Query  689   SGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETP  516
              G GHG+ VDWW FGV +YE+L+G TPFKG + E TL NI   + + F   A    +E  
Sbjct  303   LGQGHGSAVDWWTFGVFLYEMLYGRTPFKGENNEKTLVNILK-QPLSFPRIAVSSSKEFE  361

Query  515   AMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
              M   +DLI +LLVK+P KR+G   G+ +IKRH FF G+ W LIR+ RPPE
Sbjct  362   EMVKVQDLISKLLVKNPSKRIGSCMGSVEIKRHEFFKGVNWALIRSVRPPE  412



>ref|XP_007041112.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007041113.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX96943.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX96944.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=446

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 186/381 (49%), Positives = 244/381 (64%), Gaps = 24/381 (6%)
 Frame = -3

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             S+  NL  +PHR     +SAI++A T +S   L  R  +L R +GSG++G V+LCRL + 
Sbjct  45    SSPENLSLKPHRSSDFAYSAIRSA-TFASKTGLTFRDFRLLRRIGSGDIGTVYLCRLANA  103

Query  1253  -EHSDFALKVIDRDSL-TAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFC  1080
              E   +A+KV+D+++L   KK+   + E +IL MLDHPFLPTLYA  E SH++C++M++C
Sbjct  104   DEKCYYAMKVVDKEALEMKKKVQRAEMEKKILKMLDHPFLPTLYAEFEASHFSCIVMEYC  163

Query  1079  SNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIM  900
             S GDLHSL  KQ   R S+ S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R DGHIM
Sbjct  164   SGGDLHSLRHKQPQKRFSLSSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIM  223

Query  899   LSDFDLCFRADIFPQLETLTRVPLGSGGRK------------CGF--LGerrreETVTE-  765
             LSDFDL   +D  P +E+ +  P  +  +             C F  L   ++ +T+T  
Sbjct  224   LSDFDLSLCSDAIPAVESPSSSPDPTSPQNQPCTRPQPSRLSCLFRRLFRSKKIQTLTPS  283

Query  764   ---FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSS  594
                FVAEP  A SRS VGTHEY++PE+ SG  HGN VDWWA G+ +YE+++G TPF   S
Sbjct  284   KLFFVAEPVAARSRSFVGTHEYVSPEVASGGSHGNAVDWWALGIFIYEMIYGRTPFAAPS  343

Query  593   KESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHP  414
              E TLRNI   R + F        + +   A+DLI  LL KDP  RLG  +GA D+K HP
Sbjct  344   NELTLRNIVK-RPLTFPTHPP--SSLSEHHARDLISGLLNKDPNSRLGSKRGAADVKTHP  400

Query  413   FFNGIKWPLIRTYRPPEPRGL  351
             FF G+ + LIR+  PPE  GL
Sbjct  401   FFKGLNFALIRSLTPPEIPGL  421



>ref|XP_006842816.1| hypothetical protein AMTR_s00081p00063880 [Amborella trichopoda]
 gb|ERN04491.1| hypothetical protein AMTR_s00081p00063880 [Amborella trichopoda]
Length=465

 Score =   332 bits (852),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 179/409 (44%), Positives = 249/409 (61%), Gaps = 33/409 (8%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD-YEHSDFAL  1233
             +PH+ + + W A++ A  +S  G + L   +L + +GSG++G V+LCRLR       +A+
Sbjct  53    KPHKANQAAWEAMREAQMVS--GQVGLDSFRLLKRLGSGDIGIVYLCRLRPPLPEFYYAM  110

Query  1232  KVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+DR++L  + KL   + E EIL +LDHPFLPTLYA  EVSHY+CL+M++C  GDL SL
Sbjct  111   KVVDREALVHRNKLQRAKVEGEILGVLDHPFLPTLYAQFEVSHYSCLVMEYCPGGDLLSL  170

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q   R ++ + RFYAAEVL+ALEYLH +G+V+RDLKPEN+L+R DGHIMLSDFDL  
Sbjct  171   RQRQPSRRFTISAARFYAAEVLLALEYLHMMGVVFRDLKPENVLVRGDGHIMLSDFDLSL  230

Query  875   RADIFPQL------ETLTRVPLGSGGRKCGF------------------LGerrreETVT  768
             + D+ P+L        LT          C                      +    +   
Sbjct  231   KCDVVPKLLLPKPSNPLTTNTNAKTASSCALPLQPMLTCFSSNEKNANKNKKIHGLDFQA  290

Query  767   EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKE  588
             E V EP +A S+S VGTHEYLAPE+ISG GHG+ VDWW FGV +YELL+G TPF+G S E
Sbjct  291   ELVVEPLSARSKSFVGTHEYLAPEVISGLGHGSAVDWWTFGVFLYELLYGKTPFRGESNE  350

Query  587   STLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFF  408
              TL NI   +    + +    +    + A+DLI RLL K+P+KR+G A G+ +IK+H FF
Sbjct  351   KTLMNI--MKKPLGFPNMISIDNEGFSEARDLISRLLAKNPKKRIGSALGSVEIKKHGFF  408

Query  407   NGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGHL  261
              G+ W LIR+ +PP+     L+ +K    +   +   R+R   KR G L
Sbjct  409   RGVNWALIRSVKPPQVPNEQLRLNKENNRMVAKNVRERQR---KRQGDL  454



>ref|XP_011024047.1| PREDICTED: protein kinase PINOID 2 [Populus euphratica]
Length=488

 Score =   333 bits (853),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 185/420 (44%), Positives = 256/420 (61%), Gaps = 52/420 (12%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEHSD  1242
             +PH+ + + W AIK      + G + L H +L R +GSG++G V+LC++R+         
Sbjct  62    KPHKANQAAWQAIKRLQ--RATGRVGLDHFRLLRRLGSGDIGNVYLCQIRNPVVGLPQCF  119

Query  1241  FALKVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             +A+KV+D+++L  + KL   + E EIL MLDHPFLPTLYA  E SHY+CL+ ++C  GDL
Sbjct  120   YAMKVVDKEALAIRNKLQRAEMEKEILGMLDHPFLPTLYAEFEASHYSCLVTEYCPGGDL  179

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             ++  ++Q   R S+ S +FYAAE L+ALEYLH +GIVYRDLKPEN+L+REDGHIMLSDFD
Sbjct  180   YAARQRQPWKRFSISSAKFYAAETLLALEYLHMMGIVYRDLKPENVLVREDGHIMLSDFD  239

Query  884   LCFRADIFPQL---------------ETLTRVPL--------------GSGGRKCGFLGe  792
             L F+ D+ P+L               ET +  PL               S  +K      
Sbjct  240   LSFKCDVVPKLLRSKPSLEAIVLHKNETTSFAPLTFCATPLHPVLSCFSSSNKKRKPRIT  299

Query  791   rrreETV----------TEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGV  642
                 E +          TE VAEP +A S+S VGTHEYLAPE+ISG GHG+ VDWW  GV
Sbjct  300   TTIREQIDRQGYDEEVDTELVAEPISARSKSFVGTHEYLAPEVISGQGHGSAVDWWTLGV  359

Query  641   LMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIERLLVKD  468
              +YE+L+G TPFKG + E TL NI   + + F     +  +E   M   +DL+ +LLVK+
Sbjct  360   FLYEMLYGRTPFKGENNEKTLINILK-QPLTFPRIGVNSSKEFEEMLKLQDLVGKLLVKN  418

Query  467   PRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRRR  291
             P++R+G  KG+ +IKRH FF G+ W LIR+ +PPE P  L   R +S+AH+  +S   R+
Sbjct  419   PKRRIGSLKGSVEIKRHEFFKGVNWALIRSVKPPESPSDLC--RFRSRAHIPMLSKKERQ  476



>gb|ABU68435.1| putative serine/threonine protein kinase [Populus tomentosa]
Length=487

 Score =   332 bits (852),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 185/419 (44%), Positives = 255/419 (61%), Gaps = 51/419 (12%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEHSD  1242
             +PH+ + + W AIK      + G + L H +L R +GSG++G V+LC++R+         
Sbjct  62    KPHKANQAAWQAIKRLQ--RATGRVGLDHFRLLRRLGSGDIGNVYLCQIRNPVVGLPQCF  119

Query  1241  FALKVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             +A+KV+D+++L  + KL   + E EIL MLDHPFLPTLYA  E SHY+CL+ ++C  GDL
Sbjct  120   YAMKVVDKEALAIRNKLQRAEMEKEILGMLDHPFLPTLYAEFEASHYSCLVTEYCPGGDL  179

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             ++  ++Q   R S+ S +FYAAE L+ALEYLH +GIVYRDLKPEN+L+REDGHIMLSDFD
Sbjct  180   YAARQRQPWKRFSISSAKFYAAETLLALEYLHMMGIVYRDLKPENVLVREDGHIMLSDFD  239

Query  884   LCFRADIFPQL---------------ETLTRVP------------LGSGGRKCGFLGerr  786
             L F+ D+ P+L               ET +  P              S  +K        
Sbjct  240   LSFKCDVVPKLLRSKPSLEAIVRHKNETTSFAPFCATPIHPVLSCFSSSNKKRKPRITTT  299

Query  785   reETV-----------TEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
               E V           TE VAEP +A S+S VGTHEYLAPE+ISG GHG+ VDWW  GV 
Sbjct  300   IRERVDDQGYDEDVVDTELVAEPISARSKSFVGTHEYLAPEVISGQGHGSAVDWWTLGVF  359

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIERLLVKDP  465
             +YE+L+G TPFKG + E TL NI   + + F     +  +E   M   +DL+ +LLVK+P
Sbjct  360   LYEMLYGRTPFKGENNEKTLINILK-QPLTFPRIGVNSSKEFEEMVKLQDLVGKLLVKNP  418

Query  464   RKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRRR  291
             ++R+G  KG+ +IKRH FF G+ W LIR+ +PPE P  L   R +S+AH+  +S   R+
Sbjct  419   KRRIGSLKGSVEIKRHEFFKGVNWALIRSIKPPESPSDLC--RFRSRAHIPMLSKKERQ  475



>ref|XP_001764163.1| predicted protein [Physcomitrella patens]
 gb|EDQ71004.1| predicted protein [Physcomitrella patens]
Length=435

 Score =   330 bits (847),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 186/395 (47%), Positives = 241/395 (61%), Gaps = 51/395 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             S+PH+ +  NW AI+A    + DG+L L H KL R +G G++G V+LC LR  +   FA+
Sbjct  1     SKPHKSNDINWEAIQALR--ARDGSLGLSHFKLLRRLGCGDIGSVYLCELRGMD-CYFAM  57

Query  1232  KVIDRDSL-TAKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ +L T KKLS  QTE EIL+ LDHPFLPTLYAH + + ++CL+M++CS GDLHSL
Sbjct  58    KVMDKSALATRKKLSRAQTEKEILASLDHPFLPTLYAHFDTAQFSCLVMEYCSGGDLHSL  117

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              +KQAG   S  + +FYAAE+L+ALEYLH +G+VYRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  118   RQKQAGKCFSDMAAKFYAAEILLALEYLHMMGVVYRDLKPENVLVREDGHIMLSDFDLSL  177

Query  875   RADIFPQL----ETLTRVPLGSGGRKCGFLGerrreE-----------------------  777
             R  + P L      L  +P  +G R    +     ++                       
Sbjct  178   RCAVNPSLIMAQPNLAALPSRNGRRATSEIWMLEPQQVALQSCVPMISSQYRFRKPMSLR  237

Query  776   -----------------TVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAF  648
                              ++ E V EPT   S S VGTHEYLAPE+ISG+GHG+ VDWW F
Sbjct  238   SKRSNRSDNDKGTASPPSMPELVVEPTEVRSMSFVGTHEYLAPEIISGDGHGSSVDWWTF  297

Query  647   GVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKD  468
             G+ +YELL+  TPFKG+  E TL N+ S   + F  +      P    AKDLI  LL+KD
Sbjct  298   GIFLYELLYAKTPFKGADNELTLTNVVS-HPLIFPPNTDTVNVP--DCAKDLIRGLLMKD  354

Query  467   PRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             P KR+G  +GA +IK HPFF G+ W LIR   PPE
Sbjct  355   PMKRIGSIRGAGEIKAHPFFEGVNWALIRCACPPE  389



>ref|XP_003549773.1| PREDICTED: protein kinase PINOID 2-like [Glycine max]
Length=490

 Score =   332 bits (851),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 182/390 (47%), Positives = 244/390 (63%), Gaps = 43/390 (11%)
 Frame = -3

Query  1415  HSRPHRKHGSNWSAIKAAATLSSD-GAlhlrhlklhrLVGSGNLGRVFLCRLRD----YE  1251
             H++PH+ + + W A++    L  D G + L H +L R +GSG++G V+LC++R+      
Sbjct  69    HAKPHKANHAAWEAMR---RLRRDKGQVGLDHFRLLRRLGSGDIGNVYLCQIRNPIVGLP  125

Query  1250  HSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
                +A+KV+DR++L   KKL   + E EIL+MLDHPFLPTLY   + SHY+CLLM+FC  
Sbjct  126   QCFYAMKVVDREALAIRKKLQRAEMEKEILAMLDHPFLPTLYTEFDASHYSCLLMEFCPG  185

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDL++  ++Q G R S+ S +FYAAE L+ALEYLH +GIVYRDLKPEN+L+REDGHIML+
Sbjct  186   GDLYAARQRQPGKRFSIASSKFYAAETLLALEYLHMMGIVYRDLKPENVLVREDGHIMLT  245

Query  893   DFDLCFRADIFPQ-LETLTRVPLGSGGRK-----CG---------FLGerrreETVT---  768
             DFDL  + D+ P+ L + TR+       K     C          FL   R+++  T   
Sbjct  246   DFDLSLKCDVVPKLLRSKTRLERSIKSTKRSMPACTAPMQPVLSCFLSSSRKKKKATVTT  305

Query  767   -------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYEL  627
                          E VAEP  A S+S VGTHEYLAPE+I G GHG+ VDWW FGV +YE+
Sbjct  306   VIRENVEVEENDPELVAEPIDAKSKSFVGTHEYLAPEVILGQGHGSAVDWWTFGVFLYEM  365

Query  626   LFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIERLLVKDPRKRL  453
             L+G TPFKG + E TL NI   + + F        +E   M   +DLI +LLVK+P KR+
Sbjct  366   LYGRTPFKGENNEKTLVNILK-QPLAFPRIVVGTSKEFEEMVNVQDLISKLLVKNPSKRI  424

Query  452   GCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             G   G+ +IKRH FF G+ W LIR  RPPE
Sbjct  425   GSLMGSVEIKRHEFFKGVNWALIRAVRPPE  454



>ref|XP_006450984.1| hypothetical protein CICLE_v10008122mg [Citrus clementina]
 ref|XP_006475803.1| PREDICTED: protein kinase PINOID 2-like [Citrus sinensis]
 gb|ESR64224.1| hypothetical protein CICLE_v10008122mg [Citrus clementina]
 gb|KDO80309.1| hypothetical protein CISIN_1g010140mg [Citrus sinensis]
Length=489

 Score =   332 bits (851),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 187/425 (44%), Positives = 256/425 (60%), Gaps = 61/425 (14%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEHSD  1242
             +PH+ + + W A+K      + G + L H +L R +GSG++G V+LC++R+         
Sbjct  59    KPHKANQAAWEAMKRLR--RAQGRVGLDHFRLLRRLGSGDIGNVYLCQIRNPMVGLPQCF  116

Query  1241  FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             +A+KV+DR++L   KKL     E  IL+MLDHPFLPTLYA  E SHY+CL+M++C  GDL
Sbjct  117   YAMKVVDREALAIRKKLHRADMEKVILTMLDHPFLPTLYAEFEASHYSCLVMEYCPGGDL  176

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             ++  ++Q G R  + S +FYAAE L+ALEYLH +GIVYRDLKPEN+L+REDGHIMLSDFD
Sbjct  177   YAARQRQPGKRFGISSAKFYAAETLLALEYLHMMGIVYRDLKPENVLVREDGHIMLSDFD  236

Query  884   LCFRADIFPQL-------ETLTR----------VPLG---------SGGRKCGFLGerrr  783
             L F+ D+ P+L       E + +           P+          S G+K      +++
Sbjct  237   LSFKCDVVPKLLRPKLSFEAIEKYEKCSIPSCATPMQPVLSCFSSVSHGKK-----NKKK  291

Query  782   eETVT-------------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVD  660
               TVT                   E VAEP  A S+S VGTHEYLAPE+ISG GHG+ VD
Sbjct  292   AVTVTTIREQVDGDHHDQELLDDPEVVAEPINARSKSFVGTHEYLAPEVISGQGHGSAVD  351

Query  659   WWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIE  486
             WW  GV +YE+L+GTTPFKG + E TL NI   + + F        +E   +   +DLI 
Sbjct  352   WWTLGVFLYEMLYGTTPFKGENNEKTLINILK-KPLTFPRIGVSSSKEFEEVVKLQDLIS  410

Query  485   RLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGV  309
             +LLVK+P+KR+G  KG+ +IKRH FF GI W LIR+ +PPE P   +  + K K +V  +
Sbjct  411   KLLVKNPKKRIGSLKGSVEIKRHEFFKGINWALIRSIKPPEVPNNDLYCKIKKKVYVPKL  470

Query  308   SSPRR  294
             S   R
Sbjct  471   SKQER  475



>ref|XP_004485993.1| PREDICTED: protein kinase PINOID-like [Cicer arietinum]
Length=458

 Score =   331 bits (848),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 191/419 (46%), Positives = 254/419 (61%), Gaps = 42/419 (10%)
 Frame = -3

Query  1439  PSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLR  1260
             P S+  +L  +PHR     ++AI+ ++    D         L R +GSG++G V+LCRLR
Sbjct  47    PISSPESLSIKPHRSSDFAYTAIRKSSLTFRD-------FHLLRRIGSGDIGTVYLCRLR  99

Query  1259  DYEHSD----FALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYAHLEVSHYTCL  1095
             D +  D    +A+KV+D+D++  KK SH  + E +IL MLDHPFLP+LYA  E SH++C+
Sbjct  100   DSDDDDPASYYAMKVVDKDAVAIKKKSHRAEMERKILKMLDHPFLPSLYAEFEASHFSCI  159

Query  1094  LMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIRE  915
             +M+FCS GDLHSL  +   NR S+ S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R 
Sbjct  160   VMEFCSGGDLHSLRHRHHRNRFSLSSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRS  219

Query  914   DGHIMLSDFDL--CFRA--------DIFPQLETL----TR-----VPLGSGGRKCGFLGe  792
             DGHIMLSDFDL  C  A        D FP+ E L    TR      P     ++     +
Sbjct  220   DGHIMLSDFDLSMCSHAIPSVESSPDCFPKDEALDVSCTRPHSNLTPFACLSKRLFRSRK  279

Query  791   rrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTT  612
              +  ++   FVAEP  A S S VGTHEY++PE+ SG  HGN VDWW+FG+ +YE+++G T
Sbjct  280   VQTFQSNRLFVAEPVEARSCSFVGTHEYVSPEVASGKSHGNAVDWWSFGIFIYEMVYGRT  339

Query  611   PFKGSSKESTLRNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDPRKRLGCAK  441
             PF G S E+TLRNI   + + F        TP+      A++L+  LL KDP +RLG  +
Sbjct  340   PFAGPSNEATLRNIIK-KPLSF-----PTATPSSTLEMHARNLVSGLLNKDPNRRLGSKR  393

Query  440   GATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSSPRRRRCWWKRLGH  264
             GA D+K HPFF G+   LIR   PPE  G  L+R K+    T   +  +R C   R  H
Sbjct  394   GAADVKMHPFFVGLNLALIRMVTPPEVPG--LRRHKTTPLFTVKDNNGKRSCSSSRQQH  450



>gb|EMS53056.1| Protein kinase G11A [Triticum urartu]
Length=587

 Score =   335 bits (859),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 185/371 (50%), Positives = 240/371 (65%), Gaps = 16/371 (4%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ + S W AI+   T   DG L L H KL + +G G++G V+L  L   + S FA+K
Sbjct  202   KPHKANDSRWEAIQMIRT--RDGILGLSHFKLLKKLGCGDIGSVYLSELTGTK-SYFAMK  258

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ SLT  KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L 
Sbjct  259   VMDKASLTGRKKLLRAQTEKEILQCLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTLR  318

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             +KQ G      +V+FY AE+L+A+EYLH LGI+YRDLKPENIL+R+DGHIMLSDFDL  R
Sbjct  319   QKQRGKYFPEQAVKFYVAEILLAMEYLHMLGIIYRDLKPENILVRDDGHIMLSDFDLSLR  378

Query  872   ADIFPQLETLTRVPLGSGGRKCGFLGerrreETV---TEFVAEPTTAFSRSCVGTHEYLA  702
                     T    P      K     +      V    E +AEP+ A S S VGTHEYLA
Sbjct  379   CTPSCTAPTTCFGPRFFSKSKKDRKPKPEVVNQVRPWPELMAEPSDARSMSFVGTHEYLA  438

Query  701   PELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERE  522
             PE+I G GHG+ VDWW FG+ +YELLFG TPFKGS   +TL N+   + +RF       E
Sbjct  439   PEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVIG-QPLRF------PE  491

Query  521   TPAMA-AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLV  348
              P ++ +A+DLI  LLVK+P++RLGC +GAT+IK+HPFF G+ W LIR   PPE P+ + 
Sbjct  492   YPVVSFSARDLIRGLLVKEPQQRLGCKRGATEIKQHPFFEGVNWALIRCASPPEVPKPVE  551

Query  347   LKRSKSKAHVT  315
             ++R  +K  V+
Sbjct  552   IERQTTKLPVS  562



>ref|XP_008242730.1| PREDICTED: protein kinase PINOID 2 [Prunus mume]
Length=493

 Score =   331 bits (849),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 200/457 (44%), Positives = 271/457 (59%), Gaps = 63/457 (14%)
 Frame = -3

Query  1583  DSDLDLSFTSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSSNIPNLHSRP  1404
             +SD D   +SC+SIT  D + S  S+L+ SS   S     S+ + A   SS       +P
Sbjct  9     ESDYD---SSCSSITVPDSSRSWMSNLSFSSRRRSSVSVCSSATEASLISSA-----QKP  60

Query  1403  HRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEHSDFA  1236
             H+ + + W A++     S+ G + L H +L R +GSG++G V+LC++R+         +A
Sbjct  61    HKANQAAWEAMRRLR--STKGRVGLDHFRLLRRLGSGDIGNVYLCQIRNPVVGLPQCFYA  118

Query  1235  LKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             +KV+DR++L   KKL   + E EIL MLDHPFLPTLYA  + SHY+CL+M+FC  GDL++
Sbjct  119   MKVVDREALAIRKKLHRAEMEKEILDMLDHPFLPTLYAEFDASHYSCLVMEFCPGGDLYA  178

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
               ++  G   S+ S RFYAAE L+ALEYLH +GIVYRDLKPEN+L+REDGHIMLSDFDL 
Sbjct  179   ARQRLPGKCFSISSARFYAAETLLALEYLHMMGIVYRDLKPENVLVREDGHIMLSDFDLS  238

Query  878   FRADIFPQLETLTRVPLGSGGRK-------------------CGFLGerrreETVT----  768
              + D+ P+L    ++ L S  R                    C     ++++ TVT    
Sbjct  239   LKCDVVPKL-LRRKMDLESNQRNVKSSSMPYCVAAPMQPVLSCFSSSNKKKKGTVTTITE  297

Query  767   ---------------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWA  651
                                  E VAEP  A S+S VGTHEYLAPE+ISG GHG+ VDWW 
Sbjct  298   QVGADNNHDNNDDDNHQELDPEMVAEPIEARSKSFVGTHEYLAPEVISGQGHGSAVDWWT  357

Query  650   FGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIERLL  477
             FGV +YE+L+G TPFKG + E TL NI   + +RF        +E   M   +DLI +LL
Sbjct  358   FGVFLYEMLYGRTPFKGENNEKTLINILK-QPLRFPRVGVSSNKEFEEMVKVQDLISKLL  416

Query  476   VKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP  366
             VK+P+KR+G  KG+ +IKRH FF G+ W LIR+ RPP
Sbjct  417   VKNPKKRIGSLKGSVEIKRHDFFKGVNWALIRSVRPP  453



>ref|XP_004287358.1| PREDICTED: protein kinase PINOID 2-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   332 bits (850),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 186/417 (45%), Positives = 247/417 (59%), Gaps = 68/417 (16%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATL-SSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD-------  1257
             S+ H+ H +N +A +A   L SS G + L H +L R +GSG++G V+LC++R+       
Sbjct  53    SQTHKPHKANQAAWEAMRRLRSSKGRVGLDHFRLLRRLGSGDIGNVYLCQIRNPAAAVAG  112

Query  1256  ----YEHSDFALKVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLL  1092
                      +A+KV+DR++L  + KL   + E EIL MLDHPFLPTLYA  + SHY+CL+
Sbjct  113   LQPKQPQCFYAMKVVDREALAIRNKLHRAEMEKEILDMLDHPFLPTLYADFDASHYSCLV  172

Query  1091  MDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIRED  912
             M+FC  GDL++  ++  G R S+ S RFYAAE L+ALEYLH +GIVYRDLKPEN+L+RED
Sbjct  173   MEFCPGGDLYAARQRLPGKRFSLSSARFYAAETLLALEYLHMMGIVYRDLKPENVLVRED  232

Query  911   GHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRK-------------------CGFLGer  789
             GHIMLSDFDL  + D+ P+L    ++ L S   K                   C F   +
Sbjct  233   GHIMLSDFDLSLKCDVVPKL-MRRKLDLESNTEKIVKSSSMPSCAAPMQPVLSCIFSASK  291

Query  788   rreETVT-------------------------EFVAEPTTAFSRSCVGTHEYLAPELISG  684
             ++  TVT                         E VAEP  A S+S VGTHEYLAPE+ISG
Sbjct  292   KKRATVTTITEHVGDTDDHDDAQGVNQLVLDPELVAEPINARSKSFVGTHEYLAPEVISG  351

Query  683   NGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAST---------RGVRFYADDG  531
              GHG+ VDWW FGV +YE+L+G TPFKG + E TL NI               R      
Sbjct  352   QGHGSAVDWWTFGVFLYEMLYGRTPFKGENNEKTLINILKQPLSFPKLVLNDNRVTNSSS  411

Query  530   ERETPA-MAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
              +E  A MA  +DL+ +LLVK+P+KR+G  KG+ +IKRH FF G+ W LIR+ RPP+
Sbjct  412   SKEFEAEMAKVQDLVSKLLVKNPKKRIGSLKGSVEIKRHEFFKGVNWALIRSVRPPQ  468



>gb|EYU43241.1| hypothetical protein MIMGU_mgv1a006813mg [Erythranthe guttata]
Length=430

 Score =   328 bits (842),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 176/363 (48%), Positives = 232/363 (64%), Gaps = 22/363 (6%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY--EHSDFA  1236
             RPHR   S++ AI++ A L+       R   L R +GSG++GRV+LCRLR    E   +A
Sbjct  58    RPHRSSDSSFQAIRSKANLT------FRDFSLVRQIGSGDIGRVYLCRLRASAEEGRLYA  111

Query  1235  LKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             +KV+D + L   KK    +TE +I+ +LDHPFLPTLYA  E S+++C++M++CS GDLHS
Sbjct  112   MKVVDNEVLAFKKKTRRAETERKIMRLLDHPFLPTLYAEFEASNFSCVVMEYCSGGDLHS  171

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             L  KQ   R S+ S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R DGHIML+DFDL 
Sbjct  172   LRHKQPQKRFSLSSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIMLTDFDLS  231

Query  878   FRADIFPQLETLTRVP-----------LGSGGRKCGFLGerrreETVTE-FVAEPTTAFS  735
               +D  P +E     P                  C F  ++ +       FVAEP +A S
Sbjct  232   LCSDAIPAVEYPNFSPDPLSSPKSPNSSSLTPFSCLFRSKKIQSLATNRLFVAEPVSARS  291

Query  734   RSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRG  555
              S VGTHEY+APE+ SG  HGN VDWWAFG+ +YE+++G TPF G + E+TLR IA  R 
Sbjct  292   CSFVGTHEYVAPEVASGGSHGNAVDWWAFGIFIYEMVYGRTPFAGPTNEATLRGIAK-RP  350

Query  554   VRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTY  375
             + F +D       +   A+DLI RLL KDP +RLG  +G+ ++K HPFF G+ + LIR+ 
Sbjct  351   LTFPSDVPPCGGASEMHARDLITRLLNKDPNRRLGSKRGSAEVKTHPFFKGLNFALIRSV  410

Query  374   RPP  366
              PP
Sbjct  411   TPP  413



>gb|KDP32368.1| hypothetical protein JCGZ_13293 [Jatropha curcas]
Length=495

 Score =   330 bits (847),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 180/409 (44%), Positives = 245/409 (60%), Gaps = 52/409 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEHS  1245
              +PH+ + + W AIK      ++G + L H +L R +GSG+LG V+LC++R+        
Sbjct  53    QKPHKANQAAWEAIKRLQI--ANGRVGLDHFRLLRRLGSGDLGNVYLCQIRNPVVGLPQC  110

Query  1244  DFALKVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGD  1068
              +A+KV+D+++L  + KL   + E EIL MLDHPFLPTLYA  E SHY+CLLM++C  GD
Sbjct  111   FYAMKVVDKEALAIRNKLQRAEMEKEILGMLDHPFLPTLYAEFEASHYSCLLMEYCPGGD  170

Query  1067  LHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDF  888
             L++  ++QAG R S+ S +FYAAE L+A+EYLH +GIVYRDLKPEN+L+REDGHIMLSDF
Sbjct  171   LYAARQRQAGRRFSISSAKFYAAETLLAIEYLHMMGIVYRDLKPENVLVREDGHIMLSDF  230

Query  887   DLCFRADIFPQL--------ETLTRVPLGSGGRKC--------------------GFLGe  792
             DL  + D+ P+L          +  +        C                        +
Sbjct  231   DLSLKCDVVPRLLQSSKPNNSKIEAIDQDYKNEACFTPSCTTPIQPVLSCFSSSRNKKKK  290

Query  791   rrreETVTEFV--------------AEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWW  654
               R  T+TE V              AEP  A S+S VGTHEYLAPE+ISG GHG+ VDWW
Sbjct  291   ATRVTTITERVDNHHHQEINDPELVAEPINARSKSFVGTHEYLAPEVISGQGHGSAVDWW  350

Query  653   AFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIERL  480
               GV +YE+L+G TPFKG + E TL NI   + + F        +E   M   +DLI +L
Sbjct  351   TLGVFLYEMLYGRTPFKGENNERTLINILK-QPLTFPRIVVSSNKEFEEMVKVQDLISKL  409

Query  479   LVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSK  333
             L+K+P+KR+G  KG+ +IKRH FF G+ W LIR+ RPPE    + K S+
Sbjct  410   LIKNPKKRIGSLKGSVEIKRHEFFKGVNWALIRSVRPPEVPNDICKISR  458



>ref|XP_006836303.1| hypothetical protein AMTR_s00092p00027310 [Amborella trichopoda]
 gb|ERM99156.1| hypothetical protein AMTR_s00092p00027310 [Amborella trichopoda]
Length=434

 Score =   328 bits (841),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 182/391 (47%), Positives = 244/391 (62%), Gaps = 27/391 (7%)
 Frame = -3

Query  1451  TAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFL  1272
             T  +P + IP +  +PH+ H S W AIKAA      G L+ R  +L R +GSG++G V+L
Sbjct  42    TGKSPENQIPAIPLKPHKTHDSAWEAIKAAKI--KHGGLNFRDFRLIRRLGSGDIGNVYL  99

Query  1271  CRLRDYEHSDFALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYAHLEVSHYTCL  1095
              RLR  ++  +A+KV+D+++L AKK  H  + E +IL+MLDHPFLPTLYA  E S+++C+
Sbjct  100   SRLRGGDYY-YAMKVVDKEALEAKKKLHRAEMERKILAMLDHPFLPTLYAEFEASNFSCV  158

Query  1094  LMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIRE  915
             +M+FCS GDLH+L   Q   R S+ S RFYAAEVL+ALEYLH LGI+YRDLKPEN+L+R 
Sbjct  159   VMEFCSGGDLHTLRHSQKRKRFSLSSARFYAAEVLLALEYLHMLGIIYRDLKPENVLLRS  218

Query  914   DGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRK----------------CGFLGerrr  783
             DGHIMLSDFDL  ++           +P+ S   +                C    + ++
Sbjct  219   DGHIMLSDFDLSLKST---ATNASLEIPVASPANRNSPEKWPDDDVAPSCLCFLRPKLKK  275

Query  782   eETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFK  603
                  EF+AEP  A S S VGTHEY++PE+ SG  HGN VDWWA+G+ +YEL++G TPF 
Sbjct  276   PAINREFIAEPVHARSSSFVGTHEYISPEVASGGAHGNAVDWWAYGIFLYELVYGCTPFS  335

Query  602   GSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIK  423
             G +   TLRNI   R + F        T    A + LI  LL KDPRKRLG  +GA +IK
Sbjct  336   GENNSVTLRNIVK-RPLTFPPGISLERT-LETALRSLITGLLEKDPRKRLGSKRGAAEIK  393

Query  422   RHPFFNGIKWPLIRTYRPPEPRGLVLKRSKS  330
               PFF G+ + LIR+  PPE  G   +R+K+
Sbjct  394   TQPFFRGLNFALIRSATPPEIPG--FRRTKT  422



>ref|XP_011096652.1| PREDICTED: protein kinase PINOID [Sesamum indicum]
Length=436

 Score =   328 bits (841),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 181/380 (48%), Positives = 242/380 (64%), Gaps = 29/380 (8%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD--FA  1236
             RPHR   S++ AI+    LS       R   L R +GSG++GRV+LCRLR  E     +A
Sbjct  55    RPHRSSDSSFQAIRLKTNLS------FRDFSLVRQIGSGDIGRVYLCRLRGAEDEGRLYA  108

Query  1235  LKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             +KV+D + L+ KK +   +TE +I+ +LDHPFLPTL+A    SH++C++M++CS GDLHS
Sbjct  109   MKVVDNEVLSLKKKTQRAETERKIMRLLDHPFLPTLFAEFAASHFSCVVMEYCSGGDLHS  168

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             L  KQ   R S+ S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R DGHIML+DFDL 
Sbjct  169   LRHKQPQKRFSLGSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIMLTDFDLS  228

Query  878   FRADIFPQLET--------LTRVPLGSGGRKCGF------LGerrreETVTE---FVAEP  750
               +D  P +E+        L+     S      F      L   ++ +T+     FVAEP
Sbjct  229   LCSDAVPAVESPEFSPDPLLSHTTARSSSSLTPFSCISERLFRSKKIQTLAANRLFVAEP  288

Query  749   TTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNI  570
              TA S S VGTHEY+APE+ SG  HGN VDWWAFG+ +YE+++G TPF G + E+TLRNI
Sbjct  289   VTARSCSFVGTHEYVAPEVASGRSHGNAVDWWAFGIFIYEMIYGRTPFAGVNNEATLRNI  348

Query  569   ASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWP  390
             A  + + F    G   + +   A+DLI  LL KDP +RLG  +GA D+K HPFF G+ + 
Sbjct  349   AK-KPLTF--PTGTPCSTSEMHARDLISGLLNKDPGRRLGSKRGAADVKTHPFFKGLNFA  405

Query  389   LIRTYRPPEPRGLVLKRSKS  330
             LIR+  PP   G+  +R+ +
Sbjct  406   LIRSVTPPGVAGIRRQRTAA  425



>gb|EPS60744.1| hypothetical protein M569_14057 [Genlisea aurea]
Length=454

 Score =   329 bits (843),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 177/366 (48%), Positives = 234/366 (64%), Gaps = 32/366 (9%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             S+PH+ +   W AI+    +  DG L++ H +L + +G G++G V+L  LR      FAL
Sbjct  68    SKPHQGNDFRWEAIRG--VICRDGELNVGHFRLVKKLGFGDIGTVYLAELRGV-RCLFAL  124

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D++ L + KK++  +TE +IL+ LDHPFLPTLY+H E   + CLLM+FCS GDLH L
Sbjct  125   KVMDKEGLVSRKKMTRAETEKDILASLDHPFLPTLYSHFETDKFYCLLMEFCSGGDLHFL  184

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G R S  + RFYA+EVL++LEYLH +G++YRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  185   RQRQPGRRFSEKAARFYASEVLLSLEYLHMMGVIYRDLKPENVLVREDGHIMLSDFDLSL  244

Query  875   RADIFPQLETLTRVPLGSGGRKCG--------------FLGerrreET--VTEFVAEPTT  744
             +  + P L       + S  RK                FL  R         E +AEPT 
Sbjct  245   KCHVNPTL-------ISSSSRKTNCKNPCVEPSCFRPPFLAVRPDGSNPKQPELIAEPTG  297

Query  743   AFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIAS  564
             A S S VGTHEYLAPE+I G+GHG+ VDWW FG+ +YEL++G TPFKG     TL N+  
Sbjct  298   ARSMSFVGTHEYLAPEIIRGDGHGSAVDWWTFGIFLYELVYGKTPFKGDCNRETLFNVVG  357

Query  563   TRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLI  384
              + ++F     E   P   AAKDLI  LLVK+P KRLG  +GA +IKRHPFF  + WPLI
Sbjct  358   -KNLKF----PEGSNPVGFAAKDLIRGLLVKEPHKRLGFKRGANEIKRHPFFQTVNWPLI  412

Query  383   RTYRPP  366
             R+ +PP
Sbjct  413   RSAQPP  418



>ref|XP_007201967.1| hypothetical protein PRUPE_ppa004745mg [Prunus persica]
 gb|EMJ03166.1| hypothetical protein PRUPE_ppa004745mg [Prunus persica]
Length=493

 Score =   330 bits (846),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 184/404 (46%), Positives = 247/404 (61%), Gaps = 54/404 (13%)
 Frame = -3

Query  1421  NLHSRPHRKHGSNWSAIKAAATL-SSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----  1257
             +L S  H+ H +N +A +A   L S+ G + L H +L R +GSG++G V+LC++R+    
Sbjct  52    SLISSAHKPHKANQAAWEAMRRLRSTKGRVGLDHFRLLRRLGSGDIGNVYLCQIRNPVVG  111

Query  1256  YEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFC  1080
                  +A+KV+DR++L   KKL   + E EIL MLDHPFLPTLYA  + SHY+CL+M+FC
Sbjct  112   LPQCFYAMKVVDREALAIRKKLHRAEMEKEILDMLDHPFLPTLYAEFDASHYSCLVMEFC  171

Query  1079  SNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIM  900
               GDL++  ++  G   S+ S RFYAAE L+ALEYLH +GIVYRDLKPEN+L+REDGHIM
Sbjct  172   PGGDLYAARQRLPGKCFSISSARFYAAETLLALEYLHMMGIVYRDLKPENVLVREDGHIM  231

Query  899   LSDFDLCFRADIFPQLETLTRVPLGSGGRK-------------------CGFLGerrreE  777
             LSDFDL  + D+ P+L    ++ L S  +                    C     ++++ 
Sbjct  232   LSDFDLSLKCDVVPKL-LRRKMDLESNQKNVKSSSMPYCVAAPMQPVLSCFSASNKKKKG  290

Query  776   TVT-------------------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHG  672
             TVT                         E VAEP  A S+S VGTHEYLAPE+ISG GHG
Sbjct  291   TVTTITEQVGADNNHDNNDDDHHQELDPEMVAEPIEARSKSFVGTHEYLAPEVISGQGHG  350

Query  671   NGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAK  498
             + VDWW FGV +YE+L+G TPFKG + E TL NI   + +RF        +E   M   +
Sbjct  351   SAVDWWTFGVFLYEMLYGRTPFKGENNEKTLINILK-QPLRFPRVGVSNSKEFEEMVKVQ  409

Query  497   DLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP  366
             DLI +LLVK+P+KR+G  KG+ +IKRH FF G+ W LIR+ RPP
Sbjct  410   DLISKLLVKNPKKRIGSLKGSVEIKRHDFFKGVNWALIRSVRPP  453



>ref|XP_009621538.1| PREDICTED: protein kinase PINOID [Nicotiana tomentosiformis]
Length=442

 Score =   328 bits (840),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 180/387 (47%), Positives = 241/387 (62%), Gaps = 22/387 (6%)
 Frame = -3

Query  1439  PSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLR  1260
             PSS   N   +PHR   S + AI++         L  R   L R +GSG++GRV+LCRLR
Sbjct  51    PSSPEQNPTLKPHRSSDSCFQAIRSVGK-----GLCFRDFSLVRQIGSGDIGRVYLCRLR  105

Query  1259  DYEHSD-----FALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTC  1098
             +          +A+KV+D + L   KK+   +TE +I+ MLDHPFLPTLYA  E SH++C
Sbjct  106   NAADEAAKERLYAMKVVDNEVLALKKKVQRAETERKIIKMLDHPFLPTLYAEFEASHFSC  165

Query  1097  LLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIR  918
             ++M++CS GDLHSL  KQ   R S+++ RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R
Sbjct  166   VVMEYCSGGDLHSLRHKQPHKRFSLNTSRFYAAEVLVALEYLHMLGIIYRDLKPENVLVR  225

Query  917   EDGHIMLSDFDLCFRADIFPQLET--------LTRVPLGSGGRKCGFLGerrreETVTEF  762
              DGHIML+DFDL   +D    +E+         +  P      +     + +   T   F
Sbjct  226   SDGHIMLTDFDLSLCSDSIAAVESPDFAYESSTSPPPFFCISNRLFRSKKVQSFSTNRLF  285

Query  761   VAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKEST  582
             VAEP TA S S VGTHEY+APE+ SG  HGN VDWWA G+ +YE+++G TPF G+S E+T
Sbjct  286   VAEPVTARSCSFVGTHEYVAPEVASGRSHGNAVDWWALGIFIYEMIYGRTPFAGTSNEAT  345

Query  581   LRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNG  402
             LR+I   + + F  +     T + A A+DLI  LL KDP +RLG  +GA D+K HPFF G
Sbjct  346   LRSIVK-KPLTFPTN--APATTSEAHARDLISGLLNKDPNRRLGSKRGAADVKIHPFFKG  402

Query  401   IKWPLIRTYRPPEPRGLVLKRSKSKAH  321
             + + LIR+  PP   G   +++ S  H
Sbjct  403   LNFALIRSVTPPSAPGTRTEKTMSSHH  429



>ref|XP_006346118.1| PREDICTED: protein kinase G11A-like isoform X1 [Solanum tuberosum]
 ref|XP_006346119.1| PREDICTED: protein kinase G11A-like isoform X2 [Solanum tuberosum]
 ref|XP_006346120.1| PREDICTED: protein kinase G11A-like isoform X3 [Solanum tuberosum]
 ref|XP_006346121.1| PREDICTED: protein kinase G11A-like isoform X4 [Solanum tuberosum]
Length=604

 Score =   333 bits (853),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 191/405 (47%), Positives = 246/405 (61%), Gaps = 62/405 (15%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFL---CRLRDYEHSD  1242
             ++PH+ + S W AI+A  T   DGAL LRH +L + +GSG++G V+L   C  + Y    
Sbjct  182   NKPHKANDSRWEAIQAIRT--KDGALDLRHFRLLKKLGSGDIGSVYLSELCGTKCY----  235

Query  1241  FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             FA+KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY+H E   ++CL+M+FC  GDL
Sbjct  236   FAMKVMDKASLASRKKLLRAQTEREILQSLDHPFLPTLYSHFETEKFSCLVMEFCPGGDL  295

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             H+L ++Q G   S  +V+FY AEVL++LEYLH LGIVYRDLKPEN+L+REDGHIMLSDFD
Sbjct  296   HTLRQRQPGKHFSEQAVKFYVAEVLLSLEYLHMLGIVYRDLKPENVLVREDGHIMLSDFD  355

Query  884   LCFRADIFPQL---ETLTRVPLGSGGRKC-------------------------------  807
             L  R  + P L    +L   PL      C                               
Sbjct  356   LSLRCAVSPTLVKSTSLEGEPLRKNSAYCVQPACIEPSCIQPSCAVPTTCFGPRLFSSKS  415

Query  806   -------GFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAF  648
                      +G   +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW F
Sbjct  416   KKEKKSKNEIG--NQVSPLPELMAEPTGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTF  473

Query  647   GVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVK  471
             G+ +YELLFG TPFKGS    TL N+   + +RF       ETP ++ +A+DLI  LLVK
Sbjct  474   GIFLYELLFGKTPFKGSGNRQTLFNVVG-QPLRF------PETPVVSFSARDLIRGLLVK  526

Query  470   DPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             +P+ RL   +GAT+IK+HPFF G+ W LIR   PPE PR +  +R
Sbjct  527   EPQHRLAYKRGATEIKQHPFFEGVNWALIRCASPPEIPRPVEFER  571



>ref|XP_009407829.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Musa 
acuminata subsp. malaccensis]
Length=705

 Score =   335 bits (860),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 191/424 (45%), Positives = 254/424 (60%), Gaps = 56/424 (13%)
 Frame = -3

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRL---  1263
             SN+    ++PH+ + S W AI   A  + DG L + H +L + +G G++G V+L  L   
Sbjct  277   SNVTGSANKPHKGNDSRWKAI--LAVRARDGILGMSHFRLLKRLGCGDIGSVYLSELSGT  334

Query  1262  RDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMD  1086
             R Y    FA+KV+D+ SL + KKL+  QTE EIL +LDHPFLPTLY H E   ++CL+M+
Sbjct  335   RCY----FAIKVMDKASLASRKKLTRAQTEREILQLLDHPFLPTLYTHFETDRFSCLVME  390

Query  1085  FCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGH  906
             FC  GDLH+L ++Q G   S  + RFYAAEVL+ALEYLH LGIVYRDLKPEN+L+R+DGH
Sbjct  391   FCPGGDLHTLRQRQPGKHFSEYAARFYAAEVLLALEYLHMLGIVYRDLKPENVLVRDDGH  450

Query  905   IMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerrr-------------------  783
             IMLSDFDL  R  + P L  ++        R  G    +                     
Sbjct  451   IMLSDFDLSLRCAVSPTLIKISSFDSDFSKRSAGAFCVQPACVEPSSVCIQSSCFIPKIF  510

Query  782   ------------------eETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDW  657
                                  + + VAEPT+A S S VGTHEYLAPE+I G GHG+ VDW
Sbjct  511   PQRNKEKERKPKTESMHHSSALPQLVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDW  570

Query  656   WAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERL  480
             W FG+L++ELL+G TPFKGS   +TL N+   + +RF       ETP+ + A++DLI+ L
Sbjct  571   WTFGILLHELLYGKTPFKGSGNRATLFNVVGQQ-LRF------PETPSTSYASRDLIKGL  623

Query  479   LVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSS  303
             LVK+P+ RLG  +GAT+IK+HPFF G+ W LIR   PPE PR + ++ S       GV S
Sbjct  624   LVKEPQHRLGVKRGATEIKQHPFFEGVNWALIRCSTPPEVPRRVEMELSLKFGVAEGVES  683

Query  302   PRRR  291
               +R
Sbjct  684   SSKR  687



>ref|XP_010241157.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nelumbo 
nucifera]
 ref|XP_010241158.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nelumbo 
nucifera]
Length=614

 Score =   333 bits (853),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 191/420 (45%), Positives = 251/420 (60%), Gaps = 60/420 (14%)
 Frame = -3

Query  1466  LSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNL  1287
             +S  ST  + SSN+    S+PH+ + S W AI+A    + DG L   H +L + +G G++
Sbjct  180   VSDESTCSSISSNV----SKPHKANDSRWEAIQAVR--AKDGVLGFSHFRLLKRLGCGDI  233

Query  1286  GRVFLCRLRDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVS  1110
             G V+L  L   +   FA+K++D+ SL + KKL   QTE EIL  LDHPFLPTLY H E  
Sbjct  234   GSVYLSELSGTK-CYFAMKIMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETD  292

Query  1109  HYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPEN  930
              ++CL+M+FC  GDLH+L ++Q G   S  +V+FY AEVL+ALEYLH LGIVYRDLKPEN
Sbjct  293   KFSCLVMEFCPGGDLHTLRQRQPGKHFSEQAVKFYVAEVLLALEYLHMLGIVYRDLKPEN  352

Query  929   ILIREDGHIMLSDFDLCFRADIFPQL--------ETLTRVPLGSGGRKC-----------  807
             +L+REDGHIMLSDFDL  R  + P L        E L R P+      C           
Sbjct  353   VLVREDGHIMLSDFDLSLRCAVSPTLVKSSSLDSEPLRRNPVYCVQPACIEPTCIQPSCV  412

Query  806   ----------------------GFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPEL  693
                                     +G   +   + E +AEPT A S S VGTHEYLAPE+
Sbjct  413   APTTCFSPRLFSSKSKKDRKPKNEIG--NQVSPLPELIAEPTGARSMSFVGTHEYLAPEI  470

Query  692   ISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPA  513
             I G GHG+ VDWW FG+ +YELLFG TPFKGS   +TL N+   + +RF       E+P 
Sbjct  471   IKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPV  523

Query  512   MA-AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             ++  A+DLI  LLVK+P+ RL   +GAT+IK+HPFF G+ W LIR   PPE P+ + ++R
Sbjct  524   VSFQARDLIRGLLVKEPQHRLAFKRGATEIKQHPFFEGVNWALIRCASPPEIPKPVEIER  583



>ref|XP_004244035.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Solanum 
lycopersicum]
 ref|XP_010324244.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Solanum 
lycopersicum]
 ref|XP_010324245.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Solanum 
lycopersicum]
Length=604

 Score =   332 bits (852),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 190/403 (47%), Positives = 245/403 (61%), Gaps = 58/403 (14%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFL---CRLRDYEHSD  1242
             ++PH+ + S W AI+A  T   DGAL LRH +L + +GSG++G V+L   C  + Y    
Sbjct  182   NKPHKANDSRWEAIQAIRT--KDGALDLRHFRLLKKLGSGDIGSVYLSELCGTKCY----  235

Query  1241  FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             FA+KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY+H E   ++CL+M+FC  GDL
Sbjct  236   FAMKVMDKASLASRKKLLRAQTEREILQSLDHPFLPTLYSHFETEKFSCLVMEFCPGGDL  295

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             H+L ++Q G   S  +V+FY AEVL++LEYLH LGIVYRDLKPEN+L+REDGHIMLSDFD
Sbjct  296   HTLRQRQPGKHFSEQAVKFYVAEVLLSLEYLHMLGIVYRDLKPENVLVREDGHIMLSDFD  355

Query  884   LCFRADIFPQL---ETLTRVPLGSGGRKC--------GFLGerrreET------------  774
             L  R  + P L    +L   PL      C          +       T            
Sbjct  356   LSLRCAVSPTLVKSSSLEGEPLRKNSAYCVQPACIEPSCIQPSCAVTTTCFGPRLFSSKS  415

Query  773   ----------------VTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGV  642
                             + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+
Sbjct  416   KKEKKSKNEIGNQVSPLPELIAEPTGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGI  475

Query  641   LMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDP  465
              +YELLFG TPFKGS    TL N+   + +RF       E+P ++ +A+DLI  LLVK+P
Sbjct  476   FLYELLFGKTPFKGSGNRQTLFNVVG-QPLRF------PESPVVSFSARDLIRGLLVKEP  528

Query  464   RKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             + RL   +GAT+IK+HPFF G+ W LIR   PPE PR +  +R
Sbjct  529   QHRLAYKRGATEIKQHPFFEGVNWALIRCASPPEIPRPVEFER  571



>gb|AAS57526.1| serine/threonine protein kinase [Pisum sativum]
Length=445

 Score =   327 bits (838),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 191/397 (48%), Positives = 245/397 (62%), Gaps = 43/397 (11%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY-------E  1251
             +PHR     +SAI+ +     D         L R +GSG++G V+LCRLRD        E
Sbjct  46    KPHRSSDFAYSAIRKSGLTFRD-------FHLLRRIGSGDIGTVYLCRLRDSSVNYINDE  98

Query  1250  HSDF--ALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFC  1080
              S F  A+KV+D+D++  KK SH  + E +IL MLDHPFLP+LYA  E S+++C++M+FC
Sbjct  99    DSSFYYAMKVVDKDAVALKKKSHRAEMERKILKMLDHPFLPSLYAEFEASNFSCIVMEFC  158

Query  1079  SNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIM  900
             S GDLHSL  +   NR S+ S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R DGHIM
Sbjct  159   SGGDLHSLRHRHPRNRFSLSSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIM  218

Query  899   LSDFDLCFRADIFPQLE----------TLTRVPLGSGGRKC--GFLGerrreETVTE---  765
             LSDFDL   +   P +E          + TR    S   KC    L   R+ +T      
Sbjct  219   LSDFDLSLCSHAIPAVELSPDDPPLDVSCTRPHSISSPFKCLSKRLFRSRKVQTFQSNRL  278

Query  764   FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKES  585
             FVAEP  A S S VGTHEY++PE+ SGN HGN VDWW+FG+ +YE+++G TPF G S E+
Sbjct  279   FVAEPVEARSCSFVGTHEYVSPEVASGNSHGNAVDWWSFGIFIYEMVYGRTPFAGPSNEA  338

Query  584   TLRNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDPRKRLGCAKGATDIKRHP  414
             TLRNI   + + F        TP+      A+DLI  LL KDP +RLG  +GA D+K HP
Sbjct  339   TLRNIIK-KPLSF-----PTATPSSTLEMHARDLISGLLNKDPNRRLGLKRGAADVKMHP  392

Query  413   FFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSS  303
             FF G+   LIR   PPE  G  L+R+K+   V+G  S
Sbjct  393   FFVGLNLALIRMVTPPEVPG--LRRNKTTPFVSGKDS  427



>ref|XP_009606402.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606403.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606404.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606405.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606406.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606407.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606408.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606409.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606410.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606411.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
Length=587

 Score =   332 bits (850),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 189/405 (47%), Positives = 245/405 (60%), Gaps = 62/405 (15%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFL---CRLRDYEHSD  1242
             ++PH+ + S W AI+A  T   DG L LRH +L + +GSG++G V+L   C  + Y    
Sbjct  166   NKPHKANDSRWEAIQAIRT--KDGMLDLRHFRLLKKLGSGDIGSVYLSELCGTKCY----  219

Query  1241  FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             FA+KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY+H E   ++CL+M+FC  GDL
Sbjct  220   FAMKVMDKASLASRKKLLRAQTEREILQSLDHPFLPTLYSHFETEKFSCLVMEFCPGGDL  279

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             H+L ++Q G   S  +V+FY AEVL+A+EYLH LGIVYRDLKPEN+L+REDGHIMLSDFD
Sbjct  280   HTLRQRQPGKHFSEQAVKFYVAEVLLAMEYLHMLGIVYRDLKPENVLVREDGHIMLSDFD  339

Query  884   LCFRADIFPQL---ETLTRVPLGSGGRKC-------------------------------  807
             L  R  + P L    +L   PL      C                               
Sbjct  340   LSLRCTVSPTLVKSSSLETEPLRKNSAYCVQPACIEPSCIQPSCAVPTTCFGPRLFSSKS  399

Query  806   -------GFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAF  648
                      +G   +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW F
Sbjct  400   KKEKKSKNEIG--NQVSPLPELIAEPTGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTF  457

Query  647   GVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVK  471
             G+ +YELLFG TPFKGS    TL N+   + +RF       E+P ++ +A+DLI  LLVK
Sbjct  458   GIFLYELLFGKTPFKGSGNRQTLFNVVG-QPLRF------PESPVVSFSARDLIRGLLVK  510

Query  470   DPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             +P+ RL   +GAT+IK+HPFF G+ W LIR   PPE PR +  +R
Sbjct  511   EPQHRLAYKRGATEIKQHPFFEGVNWALIRCASPPEIPRPVEFER  555



>ref|XP_009368813.1| PREDICTED: protein kinase PINOID 2 [Pyrus x bretschneideri]
Length=493

 Score =   328 bits (841),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 185/403 (46%), Positives = 244/403 (61%), Gaps = 52/403 (13%)
 Frame = -3

Query  1421  NLHSRPHRKHGSNWSAIKAAATL-SSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----  1257
             +L S  H+ H +N  A +A   L SS G + L H +L R +GSG++G V+LC++R+    
Sbjct  52    SLLSSAHKPHKANQPAWEAMRRLRSSKGRVGLDHFRLLRRLGSGDIGNVYLCQIRNPVVG  111

Query  1256  YEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFC  1080
                  +A+KV+DR++L   KKL   + E EIL MLDHPFLPTLYA  + SHY+CL+M+FC
Sbjct  112   LPQCFYAMKVVDREALAIRKKLHRAEMEKEILDMLDHPFLPTLYAEFDASHYSCLVMEFC  171

Query  1079  SNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIM  900
               GDL +  ++  G   S+ S RFYAAE L+ALEYLH +GIVYRDLKPEN+L+REDGHIM
Sbjct  172   PGGDLFAARQRLPGKCFSISSARFYAAETLLALEYLHMMGIVYRDLKPENVLVREDGHIM  231

Query  899   LSDFDLCFRADIFP-------QLETLTRVPLGSGGRKCGF-----------LGerrreET  774
             LSDFDL  + D+ P       +LE+  +    S    C                ++++ T
Sbjct  232   LSDFDLSLKCDVVPKLLRRKSELESDQKSAKSSSMSYCAAAPMQPVLSCFSASHKKKKGT  291

Query  773   VT-------------------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGN  669
             VT                         E VAEP  A S+S VGTHEYLAPE+ISG GHG+
Sbjct  292   VTTITEQVGADNDVNHDYDDDYKELNPEMVAEPIHARSKSFVGTHEYLAPEVISGQGHGS  351

Query  668   GVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKD  495
              VDWW FGV +YE+L+G TPFKG + E TL NI   + +RF        +E   M   +D
Sbjct  352   AVDWWTFGVFLYEMLYGRTPFKGENNEKTLINILK-QPLRFPRVVVSSSKELEEMVRVQD  410

Query  494   LIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP  366
             LI +LLVK+P+KR+G  KG+ +IKRH FF G+ W LIR+ RPP
Sbjct  411   LISKLLVKNPKKRIGSLKGSVEIKRHDFFKGVNWALIRSVRPP  453



>ref|XP_010919725.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Elaeis 
guineensis]
Length=703

 Score =   334 bits (857),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 195/433 (45%), Positives = 254/433 (59%), Gaps = 74/433 (17%)
 Frame = -3

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRL---  1263
             SNI    ++PH+ +   W AI   A  + DG L + H +L + +G G++G V+L  L   
Sbjct  275   SNITGSANKPHKGNDPRWKAI--LAVRARDGILGMSHFRLLKRLGCGDIGSVYLSELSGT  332

Query  1262  RDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMD  1086
             R Y    FA+KV+D+ SL + KKL+  QTE EIL +LDHPFLPTLY H E   ++CL+M+
Sbjct  333   RCY----FAMKVMDKASLASRKKLTRAQTEREILQLLDHPFLPTLYTHFETDRFSCLVME  388

Query  1085  FCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGH  906
             FC  GDLH+L ++Q G   S  + RFYAAEVL+ALEYLH LG+VYRDLKPEN+L+R+DGH
Sbjct  389   FCPGGDLHTLRQRQPGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGH  448

Query  905   IMLSDFDL---------------------------------------------CFRADIF  861
             IMLSDFDL                                             CF   +F
Sbjct  449   IMLSDFDLSLRCAVSPTLIKTSSLDSDPSKRAGGAFCVQPACIEPSSVCIQPACFMPKLF  508

Query  860   PQL-ETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISG  684
             PQ  +  TR P    G++           T+ E VAEPTTA S S VGTHEYLAPE+I G
Sbjct  509   PQKSKKKTRKPRAEPGQQV---------TTLPELVAEPTTARSMSFVGTHEYLAPEIIKG  559

Query  683   NGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-  507
              GHG+ VDWW FG+ ++ELL+G TPFKGS   +TL N+   + +RF       E P+ + 
Sbjct  560   EGHGSAVDWWTFGIFLHELLYGKTPFKGSGNRATLFNVVGQQ-LRF------SEAPSTSY  612

Query  506   AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKS  330
             A++DLI  LLVK+P+ RLG  +GAT+IK+HPFF G+ W LIR   PPE PR +  +    
Sbjct  613   ASRDLIRGLLVKEPQHRLGVKRGATEIKQHPFFEGVNWALIRCSTPPEVPRPVETELPLK  672

Query  329   KAHVTGVSSPRRR  291
                V GV S  +R
Sbjct  673   FGVVEGVGSSSKR  685



>ref|XP_011085221.1| PREDICTED: protein kinase PINOID-like [Sesamum indicum]
Length=437

 Score =   326 bits (836),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 184/389 (47%), Positives = 245/389 (63%), Gaps = 35/389 (9%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY--EHSDFA  1236
             +PHR   S++ AI+    LS       R   L R +GSG++GRV+LCRLR    E   +A
Sbjct  56    KPHRSSDSSFQAIRFKTNLS------FRDFSLVRQIGSGDIGRVYLCRLRGPVDEGRLYA  109

Query  1235  LKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             +KV+D + L  KK +   +TE +I+ +LDHPFLPTL+A  E S+++C++M++CS GDLHS
Sbjct  110   MKVVDNEVLAMKKKTQRAETERKIMKLLDHPFLPTLFAEFEASNFSCVVMEYCSGGDLHS  169

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             L  +Q   R S+ S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R DGHIML+DFDL 
Sbjct  170   LRYRQPQKRFSLSSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIMLTDFDLS  229

Query  878   FRADIFPQLET--LTRVPLGS------GGRKCGF------LGerrreETVTE---FVAEP  750
               +D  P +E+   +  PL S       G    F      L   ++ +T+     FVAEP
Sbjct  230   LCSDAIPAVESPAFSPDPLSSPKAVHGSGSLTPFSCISTRLFRSKKIQTLAANRLFVAEP  289

Query  749   TTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNI  570
               A S S VGTHEY+APE+ SG  HGN VDWWA G+ MYE+++G TPF G + ++TLRNI
Sbjct  290   IAARSCSFVGTHEYVAPEVASGGSHGNAVDWWALGIFMYEMIYGRTPFAGETNQATLRNI  349

Query  569   ASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGI  399
             A  + + F       ETP  A+   A+DLI  LL KDP +RLG  +GA D+K HPFF G+
Sbjct  350   AK-KPLAF-----PNETPCGASEMHARDLISGLLNKDPNRRLGSKRGAADVKTHPFFKGL  403

Query  398   KWPLIRTYRPPEPRGLVLKRSKSKAHVTG  312
              + LIR+  PP   G   K++ +  H T 
Sbjct  404   NFALIRSATPPYVPGSQTKKTAALRHGTA  432



>ref|NP_001053471.1| Os04g0546300 [Oryza sativa Japonica Group]
 emb|CAD41468.3| OSJNBa0079A21.12 [Oryza sativa Japonica Group]
 dbj|BAF15385.1| Os04g0546300 [Oryza sativa Japonica Group]
 gb|EAZ31528.1| hypothetical protein OsJ_15668 [Oryza sativa Japonica Group]
Length=695

 Score =   334 bits (856),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 189/400 (47%), Positives = 247/400 (62%), Gaps = 55/400 (14%)
 Frame = -3

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRL---R  1260
             NI    S+PH+ +   W AI A  T   DG L + H +L + +G G++G V+L  L   R
Sbjct  269   NITGGASKPHKGNDPRWKAIHAVRT--RDGVLGMSHFRLLKRLGCGDIGSVYLSELSGTR  326

Query  1259  DYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDF  1083
              Y    FA+KV+D+ SL + KKL+  QTE EIL +LDHPFLPTLY H E   ++CL+M+F
Sbjct  327   CY----FAMKVMDKASLASRKKLNRAQTEREILQLLDHPFLPTLYTHFETDRFSCLVMEF  382

Query  1082  CSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHI  903
             C  GDLH+L ++QAG   S  + RFYAAEVL+ALEYLH LG+VYRDLKPEN+L+R+DGHI
Sbjct  383   CPGGDLHTLRQRQAGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGHI  442

Query  902   MLSDFDLCFRADIFPQL---ETLTRVPLGSGGRKC--------------------GFLGe  792
             MLSDFDL  R  + P L         P  +GG  C                       G+
Sbjct  443   MLSDFDLSLRCAVSPTLIRASAFDSDPRRAGGSFCVQPVCMEPTSVCIQPACFMPKLFGQ  502

Query  791   rr-------------reETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWA  651
             +                 T+ E VAEPT+A S S VGTHEYLAPE+I G GHG+ VDWW 
Sbjct  503   KSKKKTKKTRSELGPSATTMPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWT  562

Query  650   FGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLV  474
             FG+ ++ELL+G TPFKGS   +TL N+   + +RF       E+P+ + A++DLI+ LLV
Sbjct  563   FGIFLHELLYGKTPFKGSGNRATLFNVVGQQ-LRF------PESPSTSYASRDLIKGLLV  615

Query  473   KDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PR  357
             K+P+ RLG  +GAT+IK+HPFF G+ W LIR   PP+ PR
Sbjct  616   KEPQHRLGVKRGATEIKQHPFFEGVNWALIRCSTPPDVPR  655



>ref|XP_006431047.1| hypothetical protein CICLE_v10011523mg [Citrus clementina]
 gb|ESR44287.1| hypothetical protein CICLE_v10011523mg [Citrus clementina]
Length=506

 Score =   328 bits (842),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 183/390 (47%), Positives = 237/390 (61%), Gaps = 49/390 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             S+PH+ +G  W A++     S DG L L H +L + +G G++G V+L  LRD     FA+
Sbjct  85    SKPHKGNGMKWDAVQCVK--SKDGDLGLGHFRLLKKLGCGDIGSVYLAELRDM-GCLFAM  141

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+  L   KKL   QTE EILS+LDHPFLPTLY+H E   ++CLLM+FCS GDLH+L
Sbjct  142   KVMDKGMLAGRKKLMRAQTEREILSLLDHPFLPTLYSHFETDKFSCLLMEFCSGGDLHTL  201

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   S  + RFYA+EVL+ALEYLH +G+VYRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  202   RQRQPGKHFSEQATRFYASEVLLALEYLHMMGVVYRDLKPENVLVREDGHIMLSDFDLSL  261

Query  875   RADIFPQLETLTRVP----------------------------LGSGGRKCGFLGerrre  780
             R  + P+L   +  P                            L     K  FL  +  +
Sbjct  262   RCFVSPKLVQSSDDPACRISSYCIQPSCIDPACKLPVCVEPSCLQPSCFKPRFLNSKTTK  321

Query  779   E-----------TVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                         ++   +AEPT+A S S VGTHEYLAPE+I G+GHG+ VDWW FG+  Y
Sbjct  322   VKSEKTSLTNSDSLPVLIAEPTSARSMSFVGTHEYLAPEIIRGDGHGSAVDWWTFGIFFY  381

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRL  453
             ELL G TPFKG+    TL N+   + ++F        +    AAKDLI  LLVKDP+KRL
Sbjct  382   ELLLGRTPFKGNGNRETLFNVVG-QPLKF-----PEGSSISFAAKDLIRGLLVKDPQKRL  435

Query  452   GCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             G  +GAT+IK+HPFF  + W LIR+  PPE
Sbjct  436   GFKRGATEIKQHPFFESVNWALIRSTHPPE  465



>ref|XP_009774023.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana 
sylvestris]
Length=587

 Score =   331 bits (848),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 189/405 (47%), Positives = 245/405 (60%), Gaps = 62/405 (15%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFL---CRLRDYEHSD  1242
             ++PH+ + S W AI+A  T   DG L LRH +L + +GSG++G V+L   C  + Y    
Sbjct  166   NKPHKANDSRWEAIQAIRT--KDGMLDLRHFRLLKKLGSGDIGSVYLSELCGTKCY----  219

Query  1241  FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             FA+KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY+H E   ++CL+M+FC  GDL
Sbjct  220   FAMKVMDKASLASRKKLLRAQTEREILQSLDHPFLPTLYSHFETEKFSCLVMEFCPGGDL  279

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             H+L ++Q G   S  +V+FY AEVL+A+EYLH LGIVYRDLKPEN+L+REDGHIMLSDFD
Sbjct  280   HTLRQRQPGKHFSEQAVKFYVAEVLLAMEYLHMLGIVYRDLKPENVLVREDGHIMLSDFD  339

Query  884   LCFRADIFPQL---ETLTRVPLGSGGRKC-------------------------------  807
             L  R  + P L    +L   PL      C                               
Sbjct  340   LSLRCTVSPTLVKSSSLETEPLRKNSAYCVQPACIEPSCIQPSCAVPTTCFGPRLFSSKS  399

Query  806   -------GFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAF  648
                      +G   +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW F
Sbjct  400   KKEKKSKNEIG--NQVSPLPELIAEPTGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTF  457

Query  647   GVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVK  471
             G+ +YELLFG TPFKGS    TL N+   + +RF       E+P ++ +A+DLI  LLVK
Sbjct  458   GIFLYELLFGKTPFKGSGNRQTLFNVVG-QPLRF------PESPVVSFSARDLIRGLLVK  510

Query  470   DPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             +P+ RL   +GAT+IK+HPFF G+ W LIR   PPE PR +  +R
Sbjct  511   EPQHRLAYKRGATEIKQHPFFEGVNWALIRCASPPEIPRPVEFER  555



>emb|CAH67259.1| OSIGBa0101C23.11 [Oryza sativa Indica Group]
Length=695

 Score =   333 bits (855),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 189/400 (47%), Positives = 247/400 (62%), Gaps = 55/400 (14%)
 Frame = -3

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRL---R  1260
             NI    S+PH+ +   W AI A  T   DG L + H +L + +G G++G V+L  L   R
Sbjct  269   NITGGASKPHKGNDPRWKAIHAVRT--RDGVLGMSHFRLLKRLGCGDIGSVYLSELSGTR  326

Query  1259  DYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDF  1083
              Y    FA+KV+D+ SL + KKL+  QTE EIL +LDHPFLPTLY H E   ++CL+M+F
Sbjct  327   CY----FAMKVMDKASLASRKKLNRAQTEREILQLLDHPFLPTLYTHFETDRFSCLVMEF  382

Query  1082  CSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHI  903
             C  GDLH+L ++QAG   S  + RFYAAEVL+ALEYLH LG+VYRDLKPEN+L+R+DGHI
Sbjct  383   CPGGDLHTLRQRQAGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGHI  442

Query  902   MLSDFDLCFRADIFPQL---ETLTRVPLGSGGRKC--------------------GFLGe  792
             MLSDFDL  R  + P L         P  +GG  C                       G+
Sbjct  443   MLSDFDLSLRCAVSPTLIRASAFDSDPRRAGGSFCVQPVCMEPTSVCIQPACFMPKLFGQ  502

Query  791   rr-------------reETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWA  651
             +                 T+ E VAEPT+A S S VGTHEYLAPE+I G GHG+ VDWW 
Sbjct  503   KSKKKTKKTRSELGPSATTMPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWT  562

Query  650   FGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLV  474
             FG+ ++ELL+G TPFKGS   +TL N+   + +RF       E+P+ + A++DLI+ LLV
Sbjct  563   FGIFLHELLYGKTPFKGSGNRATLFNVVGQQ-LRF------PESPSTSYASRDLIKGLLV  615

Query  473   KDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PR  357
             K+P+ RLG  +GAT+IK+HPFF G+ W LIR   PP+ PR
Sbjct  616   KEPQHRLGVKRGATEIKQHPFFEGVNWALIRCSTPPDVPR  655



>ref|XP_003593887.1| Protein kinase G11A [Medicago truncatula]
 gb|AES64138.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=454

 Score =   326 bits (836),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 182/405 (45%), Positives = 246/405 (61%), Gaps = 46/405 (11%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD----  1242
             +PHR     ++AI+ +     D         L R +G+G++G V+LCRLRD   ++    
Sbjct  57    KPHRSSDFAYTAIRKSGLTFRD-------FHLLRRIGAGDIGTVYLCRLRDSSSNELLYD  109

Query  1241  -----FALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFC  1080
                  +A+KV+D+D++  KK SH  + E +IL MLDHPFLP+LYA  E SH++C++M+FC
Sbjct  110   DNTSFYAMKVVDKDAVALKKKSHRAEMERKILKMLDHPFLPSLYAEFEASHFSCIVMEFC  169

Query  1079  SNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIM  900
             S GDLHSL  +   NR S+ S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R DGHIM
Sbjct  170   SGGDLHSLRHRHHRNRFSLSSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIM  229

Query  899   LSDFDLCFRADIFPQLE-------------TLTR-----VPLGSGGRKCGFLGerrreET  774
             LSDFDL   +   P +E             T TR      P     ++     + +  ++
Sbjct  230   LSDFDLSLISHAIPAVESSPDISPDDPPEFTCTRPRSIATPFACLSKQLFRSKKVQSFQS  289

Query  773   VTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSS  594
                FVAEP  A S S VGTHEY++PE+ SGN HGN VDWW+FG+ +YE+++G TPF G +
Sbjct  290   NRLFVAEPVEARSCSFVGTHEYVSPEVASGNSHGNAVDWWSFGIFIYEMVYGRTPFAGPT  349

Query  593   KESTLRNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDPRKRLGCAKGATDIK  423
              E+TLRNI   + + F        TP+ A    A+DL+ RLL KDP +RLG  +GA ++K
Sbjct  350   NEATLRNIIK-KPLCF-----PTATPSSALEMHARDLVSRLLNKDPSRRLGSKRGAAEVK  403

Query  422   RHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSSPRRRR  288
              HPFF G+   LIR   PPE  G  L+R K+     G  S  R++
Sbjct  404   SHPFFVGLNLALIRMVTPPEVPG--LRRQKTTPLGNGSRSSSRQQ  446



>ref|XP_004248326.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Solanum lycopersicum]
 ref|XP_010327213.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Solanum lycopersicum]
Length=613

 Score =   331 bits (849),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 189/421 (45%), Positives = 252/421 (60%), Gaps = 62/421 (15%)
 Frame = -3

Query  1466  LSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNL  1287
             +S  ST  + S+ I    ++PH+ + S W AI+A    + DG L LRH +L + +GSG++
Sbjct  177   VSDESTCSSFSTTI----NKPHKANDSRWEAIQA--IRAKDGTLDLRHFRLLKKLGSGDI  230

Query  1286  GRVFL---CRLRDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHL  1119
             G V+L   C  + Y    FA+KV+D+ SL   KKL   QTE EIL  LDHPFLPTLY H 
Sbjct  231   GSVYLSELCGTKCY----FAMKVMDKASLAGRKKLLRAQTEREILQSLDHPFLPTLYTHF  286

Query  1118  EVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLK  939
             E   ++CL+M+FC  GDLH+L ++Q G   S  +V+FY AE+L+A+EYLH LGIVYRDLK
Sbjct  287   ETEKFSCLVMEFCPGGDLHTLRQRQPGKHFSEQAVKFYVAEILLAMEYLHMLGIVYRDLK  346

Query  938   PENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFL-------------  798
             PEN+L+REDGHIMLSDFDL  R  + P L  L+ + +    +  G+              
Sbjct  347   PENVLVREDGHIMLSDFDLSLRCAVSPTLVKLSSIDVEPLRKNSGYCVQPTCIEPSCIQP  406

Query  797   --------------------------GerrreETVTEFVAEPTTAFSRSCVGTHEYLAPE  696
                                           +   + E +AEPT A S S VGTHEYLAPE
Sbjct  407   SCAVTTSCFGPRFFSSKSKKEKKSKNDTGNQVSPLPELMAEPTGARSMSFVGTHEYLAPE  466

Query  695   LISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETP  516
             +I G GHG+ VDWW FG+ +YELLFG TPFKGS   +TL N+   + +RF       E+P
Sbjct  467   IIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESP  519

Query  515   AMA-AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLK  342
              ++ +A+DLI  LLVK+P+ RL   +GAT+IK+HPFF G+ W LIR   PPE PR +  +
Sbjct  520   VVSFSARDLIRGLLVKEPQNRLAYKRGATEIKQHPFFEGVNWALIRCASPPEIPRPVEFE  579

Query  341   R  339
             R
Sbjct  580   R  580



>emb|CDY30488.1| BnaA04g25890D [Brassica napus]
Length=618

 Score =   331 bits (849),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 184/371 (50%), Positives = 243/371 (65%), Gaps = 28/371 (8%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ +   W+AI   A  + DG L + H KL R +G G++G V+L  L       FA+
Sbjct  214   NKPHKGNDPRWNAI--TAVRARDGVLGMSHFKLLRRLGCGDIGSVYLAELSG-TRCVFAV  270

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL   KKLS  QTE EIL +LDHPFLPTLYAH E   ++CL+M++C  GDLH+L
Sbjct  271   KVMDKASLEDRKKLSRAQTEREILQLLDHPFLPTLYAHFETDRFSCLVMEYCPGGDLHAL  330

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   S  + RFYAAEVL+ALEYLH LG+VYRDLKPEN+L+R+DGHIMLSDFDL  
Sbjct  331   RQRQPGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGHIMLSDFDLSL  390

Query  875   RADIFPQLETLTRVPLGSGGRKCGFLGerrreETVT-----------EFVAEPTTAFSRS  729
             R  + P   TL +       ++  F   + R +T T           E VAEP T  S S
Sbjct  391   RCAVSP---TLIKTFDSDPSKRGAFCNNKTRSKTQTDVFRPHSGSLPELVAEPNTR-SMS  446

Query  728   CVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVR  549
              VGTHEYLAPE+I G GHG+ VDWW FG+ ++ELL+G TPFKGS   +TL N+   + ++
Sbjct  447   FVGTHEYLAPEIIKGEGHGSAVDWWTFGIFVHELLYGKTPFKGSGNRATLFNVVGEQ-LQ  505

Query  548   FYADDGERETPAMA-AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYR  372
             F       E+PA + A +DL++ LLVKDP+ RLG  +GAT+IK+HPFF G+ W LIR   
Sbjct  506   F------PESPATSYAGRDLVQALLVKDPKNRLGTKRGATEIKQHPFFEGVNWALIRCGT  559

Query  371   PPE-PRGLVLK  342
             PPE PR + ++
Sbjct  560   PPEVPRQMEVE  570



>ref|XP_006352558.1| PREDICTED: protein kinase G11A-like isoform X1 [Solanum tuberosum]
 ref|XP_006352559.1| PREDICTED: protein kinase G11A-like isoform X2 [Solanum tuberosum]
 ref|XP_006352560.1| PREDICTED: protein kinase G11A-like isoform X3 [Solanum tuberosum]
 ref|XP_006352561.1| PREDICTED: protein kinase G11A-like isoform X4 [Solanum tuberosum]
Length=613

 Score =   331 bits (849),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 189/421 (45%), Positives = 253/421 (60%), Gaps = 62/421 (15%)
 Frame = -3

Query  1466  LSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNL  1287
             +S  ST  + S++I    ++PH+ + S W AI+A    + DG L LRH +L + +GSG++
Sbjct  177   VSDESTCSSFSTSI----NKPHKANDSRWEAIQA--IRAKDGTLDLRHFRLLKKLGSGDI  230

Query  1286  GRVFL---CRLRDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHL  1119
             G V+L   C  + Y    FA+KV+D+ SL   KKL   QTE EIL  LDHPFLPTLY H 
Sbjct  231   GSVYLSELCGTKCY----FAMKVMDKASLAGRKKLLRAQTEREILQSLDHPFLPTLYTHF  286

Query  1118  EVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLK  939
             E   ++CL+M+FC  GDLH+L ++Q G   S  +V+FY AE+L+A+EYLH LGIVYRDLK
Sbjct  287   ETEKFSCLVMEFCPGGDLHTLRQRQPGKHFSEQAVKFYVAEILLAMEYLHMLGIVYRDLK  346

Query  938   PENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFL-------------  798
             PEN+L+REDGHIMLSDFDL  R  + P L  L+ + +    +  G+              
Sbjct  347   PENVLVREDGHIMLSDFDLSLRCTVSPTLVKLSSLDVEPLRKNSGYCVQPACIEPSCIQP  406

Query  797   --------------------------GerrreETVTEFVAEPTTAFSRSCVGTHEYLAPE  696
                                           +   + E +AEPT A S S VGTHEYLAPE
Sbjct  407   SCAVTTTCFGPRFFSSKSKKEKKSKNDTGNQVSPLPELMAEPTGARSMSFVGTHEYLAPE  466

Query  695   LISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETP  516
             +I G GHG+ VDWW FG+ +YELLFG TPFKGS   +TL N+   + +RF       E+P
Sbjct  467   IIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESP  519

Query  515   AMA-AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLK  342
              ++ +A+DLI  LLVK+P+ RL   +GAT+IK+HPFF G+ W LIR   PPE PR +  +
Sbjct  520   VVSFSARDLIRGLLVKEPQNRLAYKRGATEIKQHPFFEGVNWALIRCASPPEIPRPVEFE  579

Query  341   R  339
             R
Sbjct  580   R  580



>ref|XP_008337325.1| PREDICTED: protein kinase PINOID 2-like [Malus domestica]
Length=493

 Score =   327 bits (839),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 244/403 (61%), Gaps = 52/403 (13%)
 Frame = -3

Query  1421  NLHSRPHRKHGSNWSAIKAAATL-SSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----  1257
             +L S  H+ H +N  A +A   L SS G + L H +L R +GSG++G V+LC++R+    
Sbjct  52    SLLSSAHKPHKANQPAWEAMRRLRSSKGRVGLDHFRLLRRLGSGDIGNVYLCQIRNPVVG  111

Query  1256  YEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFC  1080
                  +A+KV+DR++L   KKL   + E EIL MLDHPFLPTLYA  + SHY+CL+M+FC
Sbjct  112   LPQCFYAMKVVDREALAIRKKLHRAEMEKEILDMLDHPFLPTLYAEFDASHYSCLVMEFC  171

Query  1079  SNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIM  900
               GDL +  ++  G   S+ S RFYAAE L+ALEYLH +GIVYRDLKPEN+L+REDGHIM
Sbjct  172   PGGDLFAARQRLPGKCFSISSARFYAAETLLALEYLHMMGIVYRDLKPENVLVREDGHIM  231

Query  899   LSDFDLCFRADIFP-------QLETLTRVPLGSGGRKCGF-----------LGerrreET  774
             LSDFDL  + D+ P       +LE+  +    S    C                ++++ T
Sbjct  232   LSDFDLSLKCDVVPKLLRRKXELESDQKSAKSSSMSYCAAAPMQPVLSCFSASHKKKKGT  291

Query  773   VT-------------------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGN  669
             VT                         E VAEP  A S+S VGTHEYLAPE+ISG GHG+
Sbjct  292   VTTITEQVGADNDVNHDYDDDYKELNPEMVAEPIHARSKSFVGTHEYLAPEVISGQGHGS  351

Query  668   GVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKD  495
              VDWW FGV +YE+L+G TPFKG + E TL NI   + +RF        +E   M   +D
Sbjct  352   AVDWWTFGVFLYEMLYGRTPFKGENNEKTLINILK-QPLRFPRVVVSSSKELEEMVRVQD  410

Query  494   LIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP  366
             LI +LLVK+P+KR+G  KG+ +IKRH FF G+ W L+R+ RPP
Sbjct  411   LISKLLVKNPKKRIGSLKGSVEIKRHDFFKGVNWALVRSVRPP  453



>gb|KFK36364.1| hypothetical protein AALP_AA4G113900 [Arabis alpina]
Length=440

 Score =   325 bits (834),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 194/401 (48%), Positives = 241/401 (60%), Gaps = 41/401 (10%)
 Frame = -3

Query  1439  PSSNIPN----LHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFL  1272
             P S IP     L  +PHR     +S I+          L  R  +L R +G+G++G V+L
Sbjct  36    PPSTIPEEETFLSLKPHRSSDFAYSEIRR----RRKHGLTFRDFRLMRRIGAGDIGTVYL  91

Query  1271  CRL----------RDYEHSDFALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYA  1125
             CRL           D + S FA+KV+D+++L  KK  H  + E  IL MLDHPFLPTLYA
Sbjct  92    CRLARENEEEEEEEDKQSSYFAMKVVDKEALVLKKKMHRAEMEKTILKMLDHPFLPTLYA  151

Query  1124  HLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRD  945
               E SH++C++M++CS GDLHSL  KQ   R S+ S RFYAAEVLVALEYLH LGI+YRD
Sbjct  152   EFEASHFSCIVMEYCSGGDLHSLRHKQPHRRFSLSSSRFYAAEVLVALEYLHMLGIIYRD  211

Query  944   LKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLG---SGGRKCGFLG-------  795
             LKPENIL+R DGHIMLSDFDL   +D    +E+ T  P     S  R+   +        
Sbjct  212   LKPENILVRSDGHIMLSDFDLSLCSDSIAAVESSTSSPENLPRSSPRRLTRIARLFHRVL  271

Query  794   errreETVTE---FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELL  624
               ++ +TV     FVAEP TA S S VGTHEY+APE+ SG  HGN VDWWAFGV +YE+L
Sbjct  272   RSKKVQTVEPNRLFVAEPVTARSGSFVGTHEYVAPEVASGGSHGNAVDWWAFGVFLYEIL  331

Query  623   FGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA---AAKDLIERLLVKDPRKRL  453
             +G TPF G S +  LRNI   R + F  D     +PA      A+ LI  LL KDP KRL
Sbjct  332   YGRTPFAGPSNDVILRNIVK-RPLAFPTD-----SPATMFELHARSLISGLLNKDPTKRL  385

Query  452   GCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKS  330
             G  +GA ++K HPFF G+ + LIRT  PPE    V K  KS
Sbjct  386   GSRRGAAEVKVHPFFKGLNFALIRTLTPPEIPSDVRKTKKS  426



>ref|XP_002881348.1| hypothetical protein ARALYDRAFT_321182 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57607.1| hypothetical protein ARALYDRAFT_321182 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   325 bits (832),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/355 (50%), Positives = 225/355 (63%), Gaps = 27/355 (8%)
 Frame = -3

Query  1304  VGSGNLGRVFLCRLRDYEH----SDFALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFL  1140
             +G+G++G V+LCRL   E     S FA+KV+D+++L  KK  H  + E  IL MLDHPFL
Sbjct  84    IGAGDIGTVYLCRLAGDEEESRSSYFAMKVVDKEALALKKKMHRAEMEKTILKMLDHPFL  143

Query  1139  PTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLG  960
             PTLYA  E SH++C++M++CS GDLHSL  +Q   R S+ S RFYAAEVLVALEYLH LG
Sbjct  144   PTLYAEFEASHFSCIVMEYCSGGDLHSLRHRQPTRRFSLSSARFYAAEVLVALEYLHMLG  203

Query  959   IVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVP----------LGSGGRK  810
             I+YRDLKPENIL+R DGHIMLSDFDL   +D    +E+ +  P          L    R 
Sbjct  204   IIYRDLKPENILVRSDGHIMLSDFDLSLCSDSIAAVESTSSSPENHQLRSPRRLTRLARL  263

Query  809   CGFLGerrreETVTE---FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                +   ++ +T+     FVAEP TA S S VGTHEY+APE+ SG  HGN VDWWAFGV 
Sbjct  264   FHRVMRSKKVQTLEPNRLFVAEPVTARSGSFVGTHEYVAPEVASGGSHGNAVDWWAFGVF  323

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA---AAKDLIERLLVKD  468
             +YE+++G TPF   + +  LRNI   R + F  D     +PA      A++LI  LL KD
Sbjct  324   LYEMIYGKTPFVAPTNDVILRNIVK-RQLSFPTD-----SPATMFELHARNLISGLLTKD  377

Query  467   PRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSS  303
             P KRLG  +GA ++K HPFF G+ + LIRT  PPE    V+K+    A   G SS
Sbjct  378   PTKRLGSRRGAAEVKVHPFFKGLNFALIRTLTPPEIPSSVVKKPMKSARFGGRSS  432



>ref|XP_010933596.1| PREDICTED: serine/threonine-protein kinase D6PKL1 [Elaeis guineensis]
Length=704

 Score =   333 bits (853),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 191/411 (46%), Positives = 247/411 (60%), Gaps = 75/411 (18%)
 Frame = -3

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRL---  1263
             SNI    S+PH+ +   W AI   A  + DG L + H +L + +G G++G V+L  L   
Sbjct  277   SNITGSASKPHKGNDPRWKAI--LAVRARDGILGMSHFRLLKRLGCGDIGSVYLSELSGT  334

Query  1262  RDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMD  1086
             R Y    FA+KV+D+ SL + KKL+  QTE EIL +LDHPFLPTLY H E   ++CL+M+
Sbjct  335   RCY----FAMKVMDKASLASRKKLTRAQTEREILQLLDHPFLPTLYTHFETDRFSCLVME  390

Query  1085  FCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGH  906
             FC  GDLH+L ++Q G   S  + RFYAAEVL+ALEYLH LG+VYRDLKPEN+L+R+DGH
Sbjct  391   FCPGGDLHTLRQRQPGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGH  450

Query  905   IMLSDFDL---------------------------------------------CFRADIF  861
             IMLSDFDL                                             CF   +F
Sbjct  451   IMLSDFDLSLRCAVSPTLIKTSSLDSDPSRRAGGAFCIQPACIEPSSVCIQPACFMPKLF  510

Query  860   PQL-ETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISG  684
             PQ  +  TR P    G++           T+ E VAEPTTA S S VGTHEYLAPE+I G
Sbjct  511   PQKSKKKTRKPRAELGQQV----------TLPELVAEPTTARSMSFVGTHEYLAPEIIKG  560

Query  683   NGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-  507
              GHG+ VDWW FG+ ++ELL+G TPFKGS   +TL N+   + +RF       E+P+ + 
Sbjct  561   EGHGSAVDWWTFGIFLHELLYGKTPFKGSGNRATLFNVVGQQ-LRF------PESPSTSY  613

Query  506   AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PR  357
             A++DLI  LLVK+P+ RLG  +GAT+IK+HPFF G+ W LIR   PPE PR
Sbjct  614   ASRDLIRGLLVKEPQHRLGVKRGATEIKQHPFFEGVNWALIRCSTPPEVPR  664



>dbj|BAJ98113.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   326 bits (836),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 183/410 (45%), Positives = 235/410 (57%), Gaps = 59/410 (14%)
 Frame = -3

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
               P+ HS+PH+ + + W AI      ++DG + L H +L R +GSG+LG V+LC LR+  
Sbjct  42    ETPSRHSKPHKANHAEWEAIARVRAATADGCVGLDHFRLVRRLGSGDLGNVYLCELREPP  101

Query  1250  HSD-------FALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCL  1095
             H         +A+KV+D+D+L   KKL   + E EIL  LDHPFLPTLYA  E SHY CL
Sbjct  102   HRPSSSGCLYYAMKVVDKDALAFRKKLRRAEVEREILRALDHPFLPTLYADFEASHYACL  161

Query  1094  LMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIRE  915
             +M+FC  GDLH   ++Q G R +V S RFYAAE ++ALEYLH +G+VYRDLKPEN+L+R 
Sbjct  162   VMEFCPGGDLHVARQRQPGRRFTVASARFYAAETVLALEYLHMMGVVYRDLKPENVLVRA  221

Query  914   DGHIMLSDFDLCFRA-DIFPQLETLTR------------------VPLGSGGRKCGFLG-  795
             DGHIMLSDFDL  +  D+ P+L    R                  VP       C F G 
Sbjct  222   DGHIMLSDFDLSLKCDDVVPKLLRQPRGDDAGANPSSTNGHSSSCVPPIQPVLSCLFNGV  281

Query  794   ------------------------errreETVTEFVAEPTTAFSRSCVGTHEYLAPELIS  687
                                     E  +     E V EP  A S+S VGTHEYLAPE+IS
Sbjct  282   TRKRQVPMPGAAAVDADADADEHSESEQTSDPAEVVVEPVAARSKSFVGTHEYLAPEVIS  341

Query  686   GNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF-----YADDGERE  522
             G GHG+ VDWW  GV MYE+++G TPFKG++ E TL NI S R   F          ERE
Sbjct  342   GQGHGSAVDWWTLGVFMYEMVYGWTPFKGATNEETLANIVSKRPAAFPQAATSMSGAERE  401

Query  521   TPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYR  372
                +  A+DL+  LL K+P KRLG   G+ ++KRH FF G+ W L+R+ R
Sbjct  402   E--LLWAQDLMAGLLAKNPGKRLGSCTGSGEVKRHGFFKGVNWALVRSVR  449



>gb|KCW55957.1| hypothetical protein EUGRSUZ_I01739 [Eucalyptus grandis]
Length=517

 Score =   327 bits (838),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 188/395 (48%), Positives = 247/395 (63%), Gaps = 29/395 (7%)
 Frame = -3

Query  1436  SSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD  1257
             SSN  ++ S+P +     W AI+AA   S  G L L H +L + +G G++G V+L  L+D
Sbjct  117   SSNFSSIMSKPRKARDRRWEAIQAAE--SRHGLLGLEHFRLLKKLGCGDVGSVYLSELKD  174

Query  1256  YEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFC  1080
                S FA+KV+D+ +LT  KKLS  Q E EIL  LDHPFLPTLY H E   ++CL+++FC
Sbjct  175   -SGSYFAVKVMDKPALTNRKKLSRAQVEREILQSLDHPFLPTLYMHFETEKFSCLVLEFC  233

Query  1079  SNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIM  900
               GDLH L ++Q G      + RFYAAEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIM
Sbjct  234   PGGDLHKLRQRQPGKYFLEHAARFYAAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIM  293

Query  899   LSDFDLCFRADIFPQL-ETLTRVPLGSGGRKCG---------FL---GerrreETVTEFV  759
             L DFDL  R  + P L E+   +        C          FL    +  +     E V
Sbjct  294   LVDFDLSLRCSVSPTLVESSNLISETGSSTSCAQPSCFMPRFFLRKPRKDNKSMQKPELV  353

Query  758   AEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTL  579
             AEP+ A S S VGTHEYLAPE+I   GHG+ VDWW FG+ +YELLFG TPFKG+   STL
Sbjct  354   AEPSDARSMSFVGTHEYLAPEIIKSEGHGSAVDWWTFGIFLYELLFGRTPFKGAGNRSTL  413

Query  578   RNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNG  402
              NI   + ++F       E+P+++ AA+DLI+ LLVKDP+ RL  ++GAT++K+H FF  
Sbjct  414   LNIIG-QHLKF------PESPSVSFAARDLIQSLLVKDPKHRLAYSRGATEVKQHQFFRS  466

Query  401   IKWPLIRTYRPP-EPRGL---VLKRSKSKAHVTGV  309
             I W LIR   PP  PR +   ++K +  +AH  G 
Sbjct  467   INWALIRCASPPLVPRQVTDGLMKDATERAHGVGA  501



>ref|XP_006652602.1| PREDICTED: protein kinase G11A-like [Oryza brachyantha]
Length=693

 Score =   332 bits (851),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 188/400 (47%), Positives = 247/400 (62%), Gaps = 55/400 (14%)
 Frame = -3

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRL---R  1260
             NI    S+PH+ +   W AI A  T   DG L + H +L + +G G++G V+L  L   R
Sbjct  267   NITGGASKPHKGNDPRWKAIHAVRT--RDGVLGMSHFRLLKRLGCGDIGSVYLSELSGTR  324

Query  1259  DYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDF  1083
              Y    FA+KV+D+ SL + KKL+  QTE EIL +LDHPFLPTLY H E   ++CL+M+F
Sbjct  325   CY----FAMKVMDKASLASRKKLNRAQTEREILQLLDHPFLPTLYTHFETDRFSCLVMEF  380

Query  1082  CSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHI  903
             C  GDLH+L ++Q G   S  + RFYAAEVL+ALEYLH LG+VYRDLKPEN+L+R+DGHI
Sbjct  381   CPGGDLHTLRQRQPGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGHI  440

Query  902   MLSDFDLCFRADIFPQL---ETLTRVPLGSGGRKC--------------------GFLGe  792
             MLSDFDL  R  + P L         P  +GG  C                       G+
Sbjct  441   MLSDFDLSLRCAVSPTLIRASAFDSDPRRAGGSFCVQPACMEPTSACIQPACFMPKLFGQ  500

Query  791   r-------------rreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWA  651
             +             +   T+ E VAEPT+A S S VGTHEYLAPE+I G GHG+ VDWW 
Sbjct  501   KSKKKTKKTRSELGQSATTLPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWT  560

Query  650   FGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLV  474
             FG+ ++ELL+G TPFKGS   +TL N+   + +RF       E+P+ + A++DLI+ LLV
Sbjct  561   FGIFLHELLYGKTPFKGSGNRATLFNVVGQQ-LRF------PESPSTSYASRDLIKGLLV  613

Query  473   KDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PR  357
             K+P+ RLG  +GAT+IK+HPFF G+ W LIR   PP+ PR
Sbjct  614   KEPQHRLGVKRGATEIKQHPFFEGVNWALIRCSTPPDVPR  653



>ref|XP_008656317.1| PREDICTED: protein kinase G11A-like [Zea mays]
 gb|AFW82050.1| putative protein kinase superfamily protein [Zea mays]
Length=530

 Score =   327 bits (839),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 183/405 (45%), Positives = 244/405 (60%), Gaps = 43/405 (11%)
 Frame = -3

Query  1475  NERLSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGS  1296
             N   S+++ +G   +N+     R H    S W AI+ A T S D  L+L H +L + +G 
Sbjct  83    NSMESSSTASGTTPANV-----RRHTGGDSRWDAIQLATT-SQDAPLNLAHFRLLKRLGY  136

Query  1295  GNLGRVFLCRLRDYEHSDFALKVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYAHL  1119
             G++G V+L  LR    + FA+KV+D+ S+ ++ K++  QTE EIL +LDHPFLPTLY H 
Sbjct  137   GDIGSVYLAELR-ASRAFFAMKVMDKASIVSRNKVARAQTEREILGLLDHPFLPTLYTHF  195

Query  1118  EVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLK  939
             E   + CL+M++CS G+LHSL +KQ G   S  + RFY AEVL+A+EYLH LGIVYRDLK
Sbjct  196   ETDKFYCLVMEYCSGGNLHSLRQKQPGKHFSEPAARFYVAEVLLAMEYLHMLGIVYRDLK  255

Query  938   PENILIREDGHIMLSDFDLCFRADIFPQL----ETLTRVPLGSG----------------  819
             PEN+L+REDGHIMLSDFDL  R  + P L     ++     G G                
Sbjct  256   PENVLVREDGHIMLSDFDLSLRCSVCPTLVKSSSSVHSTGTGRGVDVADGDVITANQGCI  315

Query  818   -------------GRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNG  678
                           RK              EF AEPT   S S VGTHEYLAPE+I G G
Sbjct  316   QPSSFFPRILPRRTRKPSKSDLGLSGPIAVEFNAEPTDVRSMSFVGTHEYLAPEIIRGEG  375

Query  677   HGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAA-A  501
             HG+ VDWW  G+ +YELL G+TPFKG+   +TL N+   + +RF + DG    PA+++ A
Sbjct  376   HGSAVDWWTLGIFLYELLHGSTPFKGAGNRATLCNVIE-QPLRFPSSDGAPGAPAVSSVA  434

Query  500   KDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP  366
             +DLI  LLVKDP+KR+   +GAT+IK+HPFF G+ W L+R+  PP
Sbjct  435   RDLIRGLLVKDPQKRIAFTRGATEIKQHPFFEGVNWALVRSMTPP  479



>ref|XP_009401494.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401495.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401496.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   330 bits (846),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 189/402 (47%), Positives = 245/402 (61%), Gaps = 54/402 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ + S W AI+     + DG L L H +L + +G G++G V+L  L     S FA+
Sbjct  210   NKPHKANDSRWEAIQMVR--ARDGILGLSHFRLLKRLGCGDIGSVYLSELSGT-RSYFAM  266

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY+H E   ++CL+M+FCS GDLH+L
Sbjct  267   KVMDKGSLASRKKLLRAQTEREILQCLDHPFLPTLYSHFETDKFSCLVMEFCSGGDLHTL  326

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G R S  +V+FY AEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  327   RQRQPGKRFSEQAVKFYVAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSL  386

Query  875   RADIFPQL--------ETLTR------------------VPLGSGGRKC---GFLGerr-  786
             R  + P L        ETL R                   P       C    F   +  
Sbjct  387   RCAVSPTLIKSSNPESETLRRNNTVYCVQPACVEPPSCIQPACVAPTTCFGPRFFSSKSK  446

Query  785   -----------reETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                        +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ 
Sbjct  447   KDRRPKHEIGNQVSPLPELIAEPTDAHSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIF  506

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPR  462
             +YELLFG TPFKGS   +TL N+   + +RF       ++P ++ AA+DLI  LLVK+P 
Sbjct  507   LYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PDSPVVSFAARDLIRGLLVKEPH  559

Query  461   KRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
              RL   +GAT+IK+HPFF G+ W LIR   PPE PR + ++R
Sbjct  560   HRLAYKRGATEIKQHPFFEGVNWALIRCASPPEIPRHVEIER  601



>ref|XP_002266700.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Vitis vinifera]
 ref|XP_010644600.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Vitis vinifera]
 ref|XP_010644601.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Vitis vinifera]
 ref|XP_010644602.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Vitis vinifera]
Length=611

 Score =   330 bits (845),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 186/401 (46%), Positives = 244/401 (61%), Gaps = 56/401 (14%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ + S W AI+     + DGAL L H +L + +G G++G V+L  L+  +   FA+K
Sbjct  190   KPHKANDSRWEAIQVVR--AKDGALGLNHFRLLKRLGCGDIGSVYLSELKGTK-CYFAMK  246

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L 
Sbjct  247   VMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETEKFSCLVMEFCPGGDLHTLR  306

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             ++Q G   S  +V+FY AEVL+ALEYLH LGIVYRDLKPEN+L+REDGHIMLSDFDL  R
Sbjct  307   QRQPGKHFSEQAVKFYVAEVLLALEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDLSLR  366

Query  872   ADIFPQL--------ETLTRVPLGSGGRKC------------------------------  807
               + P L        E L R P+      C                              
Sbjct  367   CTVSPTLVKSSSFDTEPLRRNPVYCVQPTCIEPSCIQPSCVAPTTCFSPRLFSSKSKKDR  426

Query  806   ---GFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLM  636
                  +G   +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +
Sbjct  427   KPKNEIG--NQVSPLPELIAEPTGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFL  484

Query  635   YELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRK  459
             YELLFG TPFKGS   +TL N+   + +RF       E+P ++ +A+DLI  LLVK+P+ 
Sbjct  485   YELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFSARDLIRGLLVKEPQH  537

Query  458   RLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             RL   +GAT+IK+HPFF G+ W LIR   PPE P+ + ++R
Sbjct  538   RLAYKRGATEIKQHPFFEGVNWALIRCASPPEIPKPVEIER  578



>ref|XP_004134809.1| PREDICTED: protein kinase G11A-like [Cucumis sativus]
 ref|XP_004167101.1| PREDICTED: protein kinase G11A-like [Cucumis sativus]
 gb|KGN49028.1| hypothetical protein Csa_6G510950 [Cucumis sativus]
Length=612

 Score =   330 bits (845),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 185/399 (46%), Positives = 244/399 (61%), Gaps = 52/399 (13%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ +   W AI+     + DGA+ L H +L + +G G++G V+L  LR  +   FA+K
Sbjct  190   KPHKANDLRWEAIQVVR--AKDGAMGLGHFRLLKKLGCGDIGSVYLSELRGTK-CHFAMK  246

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+++L + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L 
Sbjct  247   VMDKNTLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETEKFSCLVMEFCPGGDLHTLR  306

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             ++Q G   +  +V+FY AEVL+ALEYLH LGIVYRDLKPEN+L+REDGHIMLSDFDL  R
Sbjct  307   QRQPGKHFAEQAVKFYVAEVLLALEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDLSLR  366

Query  872   ADIFPQL--------ETLTR---------------------VPL----------GSGGRK  810
               + P L        E L +                     VP            S   +
Sbjct  367   CAVNPTLVKNLSAESEALRKNTGYCVQPACIEPSCIQPSCVVPTTCFSPRLFSSKSKKER  426

Query  809   CGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYE  630
                +    +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +YE
Sbjct  427   KPKIDLGNQVSPLPELIAEPTDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYE  486

Query  629   LLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKRL  453
             LLFG TPFKGS   +TL NI   + +RF       + P ++ AAKDLI  LLVK+P++RL
Sbjct  487   LLFGKTPFKGSGNRATLFNIVG-QPLRF------PDAPVVSFAAKDLIRGLLVKEPQQRL  539

Query  452   GCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
                +GAT+IK+HPFF G+ W LIR   PPE PR + ++R
Sbjct  540   AYKRGATEIKQHPFFEGVNWALIRCATPPEIPRPVEIER  578



>ref|NP_181012.1| protein serine/threonine kinase PINOID [Arabidopsis thaliana]
 sp|O64682.1|PID_ARATH RecName: Full=Protein kinase PINOID; AltName: Full=Protein kinase 
ABRUPTUS [Arabidopsis thaliana]
 gb|AAC26704.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAF40202.1| protein kinase PINOID [Arabidopsis thaliana]
 gb|AEC09003.1| protein kinase PINOID [Arabidopsis thaliana]
Length=438

 Score =   324 bits (830),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 188/404 (47%), Positives = 242/404 (60%), Gaps = 35/404 (9%)
 Frame = -3

Query  1439  PSSNIPNLHS----RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFL  1272
             P S IP   S    +PHR     ++ I+          L  R  +L R +G+G++G V+L
Sbjct  36    PPSTIPEEESFLSLKPHRSSDFAYAEIRR----RKKQGLTFRDFRLMRRIGAGDIGTVYL  91

Query  1271  CRLRDYEH----SDFALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYAHLEVSH  1107
             CRL   E     S FA+KV+D+++L  KK  H  + E  IL MLDHPFLPTLYA  E SH
Sbjct  92    CRLAGDEEESRSSYFAMKVVDKEALALKKKMHRAEMEKTILKMLDHPFLPTLYAEFEASH  151

Query  1106  YTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENI  927
             ++C++M++CS GDLHSL  +Q   R S+ S RFYAAEVLVALEYLH LGI+YRDLKPENI
Sbjct  152   FSCIVMEYCSGGDLHSLRHRQPHRRFSLSSARFYAAEVLVALEYLHMLGIIYRDLKPENI  211

Query  926   LIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGS---GGRKCGFLGerrreETVTE---  765
             L+R DGHIMLSDFDL   +D    +E+ +  P        R+   L    +    ++   
Sbjct  212   LVRSDGHIMLSDFDLSLCSDSIAAVESSSSSPENQQLRSPRRFTRLARLFQRVLRSKKVQ  271

Query  764   -------FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPF  606
                    FVAEP TA S S VGTHEY+APE+ SG  HGN VDWWAFGV +YE+++G TPF
Sbjct  272   TLEPTRLFVAEPVTARSGSFVGTHEYVAPEVASGGSHGNAVDWWAFGVFLYEMIYGKTPF  331

Query  605   KGSSKESTLRNIASTRGVRFYADDGERETPAMA---AAKDLIERLLVKDPRKRLGCAKGA  435
                + +  LRNI   R + F  D     +PA      A++LI  LL KDP KRLG  +GA
Sbjct  332   VAPTNDVILRNIVK-RQLSFPTD-----SPATMFELHARNLISGLLNKDPTKRLGSRRGA  385

Query  434   TDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSS  303
              ++K HPFF G+ + LIRT  PPE    V+K+    A  +G SS
Sbjct  386   AEVKVHPFFKGLNFALIRTLTPPEIPSSVVKKPMKSATFSGRSS  429



>ref|XP_010057774.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Eucalyptus 
grandis]
 ref|XP_010057775.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Eucalyptus 
grandis]
 gb|KCW75072.1| hypothetical protein EUGRSUZ_E03840 [Eucalyptus grandis]
 gb|KCW75073.1| hypothetical protein EUGRSUZ_E03840 [Eucalyptus grandis]
Length=613

 Score =   330 bits (845),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 187/409 (46%), Positives = 247/409 (60%), Gaps = 57/409 (14%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ +   W AI+A  T   DG L L H +L + +G G++G V+L  L   +  DFA+K
Sbjct  193   KPHQANDLRWEAIQAVRT--RDGILGLNHFRLLKRLGCGDIGSVYLSELSGTK-CDFAMK  249

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLHSL 
Sbjct  250   VMDKASLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHSLR  309

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             ++Q G      +V+FY AEVL+ALEYLH LGI+YRDLKPEN+L+R+DGHIMLSDFDL  R
Sbjct  310   QRQPGKHFPEQAVKFYVAEVLLALEYLHMLGIIYRDLKPENVLVRDDGHIMLSDFDLSLR  369

Query  872   ADIFPQL--------ETLTRVPLGSGGRKC------------------------------  807
               + P L        E+L + P+      C                              
Sbjct  370   CTVSPTLVRSSFMVAESLKKNPVYCAQPTCIEPSCIQPSCVLPTTCFSPRLFSSKSKKER  429

Query  806   ----GFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                   +G   +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ 
Sbjct  430   KSKNNEMG--NQVRPLPELMAEPTEARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIF  487

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPR  462
             +YELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA+DLI  LLVK+P+
Sbjct  488   LYELLFGRTPFKGSGNRATLFNVVG-QPLRF------PESPIVSFAARDLIRGLLVKEPQ  540

Query  461   KRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHV  318
              RL   +GAT+IK+HPFF+G+ W LIR   PPE P+ + L+R  + A +
Sbjct  541   NRLAYKRGATEIKQHPFFDGLNWALIRCATPPEIPKPVELERIPASATI  589



>ref|XP_010504934.1| PREDICTED: protein kinase PINOID [Camelina sativa]
Length=443

 Score =   324 bits (830),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 221/356 (62%), Gaps = 28/356 (8%)
 Frame = -3

Query  1304  VGSGNLGRVFLCRLRDYEH----SDFALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFL  1140
             +G+G++G V+LCRL   E     S FA+KV+D+++L  KK  H  + E  IL MLDHPFL
Sbjct  85    IGAGDIGTVYLCRLAGEEEESRSSYFAMKVVDKEALALKKKMHRAEMEKTILKMLDHPFL  144

Query  1139  PTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLG  960
             PTLYA  E SH++C++M++CS GDLHSL  KQ   R ++ S RFYAAEVLVALEYLH LG
Sbjct  145   PTLYAEFEASHFSCIVMEYCSGGDLHSLRHKQPHRRFTLSSTRFYAAEVLVALEYLHMLG  204

Query  959   IVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGS----GGRKCGFLGe  792
             I+YRDLKPENIL+R DGHIMLSDFDL  R+D    +E+ +  P         R+   L  
Sbjct  205   IIYRDLKPENILVRSDGHIMLSDFDLSLRSDSIAAVESSSSSPENQQQLRSPRRLTRLAR  264

Query  791   rrreETVTE----------FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGV  642
                    ++          FVAEP TA S S VGTHEY+APE+ SG  HGN VDWWAFGV
Sbjct  265   LFHRVLRSKKVQTLEPNRLFVAEPVTARSGSFVGTHEYVAPEVASGGSHGNAVDWWAFGV  324

Query  641   LMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA---AAKDLIERLLVK  471
              +YE+++G TPF   + +  LRNI   R + F  D     +PA      A+ LI  LL K
Sbjct  325   FLYEMIYGKTPFVAPTNDVILRNIVK-RQLSFPTD-----SPATMFELHARSLISGLLNK  378

Query  470   DPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSS  303
             DP KRLG  +GA ++K HPFF G+ + LIRT  PPE     +KR    A   G SS
Sbjct  379   DPTKRLGSRRGAAEVKVHPFFKGLNFALIRTLTPPEIPSSGVKRPVKSATFGGRSS  434



>emb|CDY23458.1| BnaC04g49860D [Brassica napus]
Length=646

 Score =   330 bits (846),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 182/366 (50%), Positives = 240/366 (66%), Gaps = 20/366 (5%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ +   W+AI   A  + DG L + H KL R +G G++G V+L  L       FA+
Sbjct  254   NKPHKGNDPRWNAI--TAVRARDGVLGMSHFKLLRRLGCGDIGSVYLAELSGT-RCVFAV  310

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL   KKL+  QTE EIL +LDHPFLPTLYAH E   ++CL+M++C  GDLH+L
Sbjct  311   KVMDKASLEDRKKLNRAQTEREILQLLDHPFLPTLYAHFETDRFSCLVMEYCPGGDLHAL  370

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   S  + RFYAAEVL+ALEYLH LG+VYRDLKPEN+L+R+DGHIMLSDFDL  
Sbjct  371   RQRQPGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGHIMLSDFDLSL  430

Query  875   RADIFPQL-ETLTRVPLGSGG----RKCGFLGerrreE-TVTEFVAEPTTAFSRSCVGTH  714
             R  + P L +T    P   G       C           ++ E VAEP T  S S VGTH
Sbjct  431   RCAVSPTLIKTFDSDPSKRGAFCVQPSCMMEPTTSSHSGSLPELVAEPNTR-SMSFVGTH  489

Query  713   EYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADD  534
             EYLAPE+I G GHG+ VDWW FG+ ++ELL+G TPFKGS   +TL N+   + ++F    
Sbjct  490   EYLAPEIIKGEGHGSAVDWWTFGIFVHELLYGKTPFKGSGNRATLFNVVGEQ-LKF----  544

Query  533   GERETPAMA-AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-P  360
                E+PA + A +DL++ LLVKDP+ RLG  +GAT+IK+HPFF G+ W LIR   PPE P
Sbjct  545   --PESPATSYAGRDLVQALLVKDPKNRLGTKRGATEIKQHPFFEGVNWALIRCGTPPEVP  602

Query  359   RGLVLK  342
             R + ++
Sbjct  603   RQMEIE  608



>ref|XP_009790589.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana 
sylvestris]
 ref|XP_009790590.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana 
sylvestris]
 ref|XP_009790591.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana 
sylvestris]
 ref|XP_009790592.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana 
sylvestris]
Length=589

 Score =   328 bits (841),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 184/402 (46%), Positives = 242/402 (60%), Gaps = 58/402 (14%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFL---CRLRDYEHSDF  1239
             +PH+ + S W AI+A    + DG L LRH +L + +GSG++G V+L   C  + Y    F
Sbjct  169   KPHKANDSRWEAIQA--IRAKDGGLDLRHFRLLKKLGSGDIGSVYLSELCGTKCY----F  222

Query  1238  ALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLH  1062
             A+KV+D+ SL   KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH
Sbjct  223   AMKVMDKASLAGRKKLLRAQTEREILQSLDHPFLPTLYTHFETEKFSCLVMEFCPGGDLH  282

Query  1061  SLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDL  882
             +L ++Q G   S  +V+FY AE+L+A+EYLH LGIVYRDLKPEN+L+REDGHIMLSDFDL
Sbjct  283   TLRQRQPGKHFSEQAVKFYVAEILLAMEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDL  342

Query  881   CFRADIFPQLETLTRVPLGSGGRKCGFL--------------------------------  798
               R  + P L  L+ +      +  G+                                 
Sbjct  343   SLRCAVSPTLVKLSSLDAEPLQKNSGYCVQPACIEPSCIQPSCAVPTTCFGPRFFSSKSK  402

Query  797   -------GerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                        +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ 
Sbjct  403   KEKKSKNDTGNQVSPLPELMAEPTGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIF  462

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPR  462
             +YELLFG TPFKGS   +TL N+   + +RF       E+P ++ +A+DLI  LLVK+P+
Sbjct  463   LYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFSARDLIRGLLVKEPQ  515

Query  461   KRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
              RL   +GAT+IK+HPFF G+ W LIR   PPE PR +  +R
Sbjct  516   HRLAYKRGATEIKQHPFFEGVNWALIRCASPPEIPRPVEFER  557



>gb|KDO72425.1| hypothetical protein CISIN_1g010603mg [Citrus sinensis]
Length=506

 Score =   326 bits (835),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 182/390 (47%), Positives = 236/390 (61%), Gaps = 49/390 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             S+PH+ +   W A++     S DG L L H +L + +G G++G V+L  LRD     FA+
Sbjct  85    SKPHKGNDMKWDAVQCVK--SKDGDLGLGHFRLLKKLGCGDIGSVYLAELRDM-GCLFAM  141

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+  L   KKL   QTE EILS+LDHPFLPTLY+H E   ++CLLM+FCS GDLH+L
Sbjct  142   KVMDKGMLAGRKKLMRAQTEREILSLLDHPFLPTLYSHFETDKFSCLLMEFCSGGDLHTL  201

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   S  + RFYA+EVL+ALEYLH +G+VYRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  202   RQRQPGKHFSEQATRFYASEVLLALEYLHMMGVVYRDLKPENVLVREDGHIMLSDFDLSL  261

Query  875   RADIFPQLETLTRVP----------------------------LGSGGRKCGFLGerrre  780
             R  + P+L   +  P                            L     K  FL  +  +
Sbjct  262   RCFVSPKLVQSSDDPACRISSYCIQPSCIDPACKLPVCVEPSCLQPSCFKPRFLNSKTTK  321

Query  779   E-----------TVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                         ++   +AEPT+A S S VGTHEYLAPE+I G+GHG+ VDWW FG+  Y
Sbjct  322   VKSEKTSLTNSDSLPVLIAEPTSARSMSFVGTHEYLAPEIIRGDGHGSAVDWWTFGIFFY  381

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRL  453
             ELL G TPFKG+    TL N+   + ++F        +    AAKDLI  LLVKDP+KRL
Sbjct  382   ELLLGRTPFKGNGNRETLFNVVG-QPLKF-----PEGSSISFAAKDLIRGLLVKDPQKRL  435

Query  452   GCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             G  +GAT+IK+HPFF  + W LIR+  PPE
Sbjct  436   GFKRGATEIKQHPFFESVNWALIRSTHPPE  465



>ref|XP_007211600.1| hypothetical protein PRUPE_ppa005458mg [Prunus persica]
 gb|EMJ12799.1| hypothetical protein PRUPE_ppa005458mg [Prunus persica]
Length=460

 Score =   324 bits (831),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 181/402 (45%), Positives = 240/402 (60%), Gaps = 50/402 (12%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD----  1242
             +PHR     +SAI++  T     AL  R  +L R +G+G++G V+LC LR    S     
Sbjct  50    KPHRSSDFAYSAIRSKKT-----ALTFRDFRLLRRIGAGDIGTVYLCTLRGTGSSPADQD  104

Query  1241  ----------FALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYAHLEVSHYTCL  1095
                       +A+KV+D+++L  KK  H  + E +IL MLDHPFLPTLYA  E SH++C+
Sbjct  105   RESSSSSSCFYAMKVVDKEALALKKKVHRAEMERKILKMLDHPFLPTLYAEFEASHFSCI  164

Query  1094  LMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIRE  915
             +M++CS GDLHSL  KQ   R S+ S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R 
Sbjct  165   VMEYCSGGDLHSLRHKQPNKRFSLTSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRS  224

Query  914   DGHIMLSDFDLCFRADIFPQLE---------------------TLTRVPLGSGGRKCGFL  798
             DGHIMLSDFDL   +D  P +E                     T T  P      +    
Sbjct  225   DGHIMLSDFDLSLCSDAIPAVESPDSYSDSGSLSTPSYTRPRKTTTLTPFSCLSTRLFRS  284

Query  797   GerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFG  618
              + +       FVAEP  A SRS VGTHEY++PE+ SG+ HGN VDWWAFG+ +YEL++G
Sbjct  285   RKVQTLSPNRLFVAEPVAARSRSFVGTHEYVSPEVASGSSHGNAVDWWAFGIFLYELIYG  344

Query  617   TTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDPRKRLGC  447
              TPF   S E+TLRNI   + + F        TP+ A    A+DLI   L KDP +RLG 
Sbjct  345   RTPFAAPSNENTLRNIVK-KPLAF-----PTPTPSSALEGHARDLISGFLNKDPERRLGS  398

Query  446   AKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAH  321
              +GA D+K+HPFF GI   L+R+  PP   GL+ +++ + ++
Sbjct  399   KRGAADVKKHPFFKGINLALVRSLTPPMIPGLIRRQNTTPSY  440



>gb|EPS68752.1| hypothetical protein M569_06017, partial [Genlisea aurea]
Length=415

 Score =   322 bits (826),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 182/384 (47%), Positives = 233/384 (61%), Gaps = 44/384 (11%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             S+PHR +   W AI   A  S DG L L   +L R +G G++G V+L  L   +   FA+
Sbjct  40    SKPHRGNDPRWKAI--LAVRSRDGILGLSQFRLLRRLGCGDIGSVYLSELSSTKRF-FAM  96

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ +L + KKL+  QTE +IL +LDHPFLPTLYAH E   ++CL+M++C  GDLH L
Sbjct  97    KVMDKSNLASRKKLNRAQTERDILQLLDHPFLPTLYAHFETDRFSCLVMEYCPGGDLHIL  156

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   S  + RFYAAEVL++LEYLH LGI+YRDLKPEN+L+R+DGHIMLSDFDL  
Sbjct  157   RQRQPGKHFSEYAARFYAAEVLLSLEYLHMLGIIYRDLKPENVLVRDDGHIMLSDFDLSL  216

Query  875   RADIFPQL---------ETLTRVPLGSGGRKCGFLGerrreETVT---------------  768
             R    P L         +   R    S  +   FL  R     +                
Sbjct  217   RCSFSPTLIKTGSAFGSDPSKRAAAASCIQPVCFLPRRIFSHKIKKKSRVEPGASSSSSS  276

Query  767   --------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTT  612
                     E  AEPT+A S S VGTHEYLAPE+I G GHGN VDWW FG+ +YELL G T
Sbjct  277   SSSDLCLPELAAEPTSARSMSFVGTHEYLAPEIIKGEGHGNAVDWWTFGIFLYELLHGRT  336

Query  611   PFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKRLGCAKGA  435
             PFKGS   +TL N+   + VRF       ++PA + A++DLI +LLVK+P  RLG  +GA
Sbjct  337   PFKGSGNRATLFNVIGQQ-VRF------PDSPATSYASRDLIRKLLVKEPANRLGVRRGA  389

Query  434   TDIKRHPFFNGIKWPLIRTYRPPE  363
              +IK+HPFF G+ W LIR   PPE
Sbjct  390   AEIKQHPFFEGVNWALIRCSTPPE  413



>gb|KDP34968.1| hypothetical protein JCGZ_09256 [Jatropha curcas]
Length=458

 Score =   324 bits (830),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 187/408 (46%), Positives = 247/408 (61%), Gaps = 45/408 (11%)
 Frame = -3

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             S+  NL  +PHR     +SAI++A T      L  R  +L R +G+G++G V+LCRL + 
Sbjct  48    SSPENLTLKPHRSSDFAYSAIRSA-TFRRKTGLTFRDFRLIRRIGAGDIGTVYLCRL-NR  105

Query  1253  EHSD---------------FALKVIDRDSLTAKK-LSHVQTEAEILSMLDHPFLPTLYAH  1122
             EH+                +A+KV+D+++L  KK +   + E +IL MLDHPFLP+LYA 
Sbjct  106   EHNKNEEYEDEDEDDRLCFYAMKVVDKEALAVKKKVQRAEMERKILKMLDHPFLPSLYAE  165

Query  1121  LEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDL  942
              E SH++C++M++CS GDLHSL  KQ   R S+ S RFYAAEVLVALEYLH LGI+YRDL
Sbjct  166   FEASHFSCIVMEYCSGGDLHSLRHKQPHKRFSLSSARFYAAEVLVALEYLHMLGIIYRDL  225

Query  941   KPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGF-------------  801
             KPEN+L+R DGHIMLSDFDL   +D  P +E+ T  P  +      +             
Sbjct  226   KPENVLVRSDGHIMLSDFDLSLCSDAIPAVESPTFSPDSTSPSARTYTRSHSSKTFSCLL  285

Query  800   --LGerrreETVTE---FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLM  636
               L   ++ +T+     FVAEP  A S S VGTHEY+APE+ +G  HGN VDWWAFG+ +
Sbjct  286   NRLFRSKKIQTLNPNRLFVAEPVAARSCSFVGTHEYVAPEVAAGGSHGNAVDWWAFGIFI  345

Query  635   YELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDP  465
             YEL++G TPF   S E TLRNI   + + F        TP  +    A+DLI RLL KDP
Sbjct  346   YELIYGRTPFAAPSNELTLRNIVK-KPLTF-----PTHTPYSSLEHHARDLISRLLNKDP  399

Query  464   RKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAH  321
               RLG  +GA ++K HPFF G+ + LIRT  PPE  GL  +R+    H
Sbjct  400   NNRLGSKRGAAEVKSHPFFKGLNFALIRTVTPPEIPGLRRQRTAPFHH  447



>ref|XP_010923729.1| PREDICTED: protein kinase PINOID-like [Elaeis guineensis]
Length=433

 Score =   323 bits (828),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 187/377 (50%), Positives = 234/377 (62%), Gaps = 48/377 (13%)
 Frame = -3

Query  1421  NLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHS-  1245
              L ++PHR     W AI++         L  R  KL R +GSG++G VFLCRLR+     
Sbjct  57    GLTTKPHRSSDPAWVAIRSRLP----ARLGPRDFKLVRRIGSGDIGTVFLCRLREERRCP  112

Query  1244  ------DFALKVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYAHLEVS-HYTCLLM  1089
                   ++A+KV+D+ +L  K KL    TE  IL +LDHPFLPTLYA  + S H++C++M
Sbjct  113   EVAPVCEYAMKVVDQLALAKKNKLERAATEKRILRILDHPFLPTLYADFDASPHFSCVVM  172

Query  1088  DFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDG  909
             ++CS GDLH+L  +Q G R SV + RFYAAEVL+ALEYLH LGIVYRDLKPENILIR DG
Sbjct  173   EYCSGGDLHTLRHRQPGLRFSVTAARFYAAEVLLALEYLHMLGIVYRDLKPENILIRSDG  232

Query  908   HIMLSDFDLCFRADIFPQLETL----------------TRVPLGSGGRKCGFLGerrreE  777
             HIMLSDFDL  ++   P +E L                 R PLGS   +           
Sbjct  233   HIMLSDFDLSLQSTASPTVEPLDPTAPDPSCLPHRLFRARRPLGSLPDR-----------  281

Query  776   TVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGS  597
                 FVAEP  A S S VGTHEY+APE+ SG  HG+ VDWWA+GV +YELL+G TPF G 
Sbjct  282   ---RFVAEPLAARSGSFVGTHEYVAPEVASGLTHGSAVDWWAYGVFLYELLYGRTPFAGP  338

Query  596   SKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRH  417
             + E+TLRNI   + + F A  G    PA +AA+DLI  LLVKDP  RLG  +GA D+K H
Sbjct  339   TNEATLRNIVK-QPLAFPAARG----PADSAARDLISGLLVKDPASRLGSRRGAADVKAH  393

Query  416   PFFNGIKWPLIRTYRPP  366
             PFF G+   L+R+ RPP
Sbjct  394   PFFKGLNLALLRSSRPP  410



>ref|XP_010049971.1| PREDICTED: protein kinase PINOID 2 [Eucalyptus grandis]
Length=513

 Score =   326 bits (835),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 182/411 (44%), Positives = 243/411 (59%), Gaps = 58/411 (14%)
 Frame = -3

Query  1415  HSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY------  1254
             H +PH+ + + W A+    + ++ G + L H +L R +GSG++G V+LC++R+       
Sbjct  67    HLKPHKSNHAAWEAMSRLRSSAAAGRIGLDHFRLLRRLGSGDIGNVYLCQIRNVAAGALT  126

Query  1253  -EHSD-------FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYT  1101
              +H         +A+KV+DR++L A KKL     E EIL MLDHPFLPTLYA  +  HY+
Sbjct  127   AQHRSQHPRPCFYAMKVVDREALAARKKLQRADMEKEILGMLDHPFLPTLYAEFDAKHYS  186

Query  1100  CLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILI  921
             CL+M+FC  GDL++   +Q G R S+ + +FYAAE+L+ALEYLH +GI+YRDLKPEN+L+
Sbjct  187   CLVMEFCPGGDLYAARLRQPGRRFSLSTAKFYAAEILLALEYLHMMGIIYRDLKPENVLV  246

Query  920   REDGHIMLSDFDLCFRADIFPQL------ETLT------RVP---------LGSGGRKCG  804
             R+DGHIMLSDFDL  + D+ P+L       T+T      R P         L    R   
Sbjct  247   RDDGHIMLSDFDLSLKCDVVPKLIRHHRPVTITRDFDADRAPSCTSPIEPVLSCLLRSSS  306

Query  803   FLGerrreETVT-------------------EFVAEPTTAFSRSCVGTHEYLAPELISGN  681
                      T+T                   E VAEP  A SRS VGTHEYLAPE+ISG 
Sbjct  307   RRKRPTVTTTITLRPDTDGHPDEDNYYYYDAELVAEPVAARSRSFVGTHEYLAPEVISGQ  366

Query  680   GHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNI--ASTRGVRFYADDGERETPAMA  507
             GHG+ VDWW  G+ +YE+L+G TPFKG + E TL NI  A     R       RE   M 
Sbjct  367   GHGSAVDWWTLGIFLYEMLYGRTPFKGENNERTLVNILKAPLTFPRIGVSSA-REYEEMV  425

Query  506   AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRG  354
               +DLI +LL K+P+KRLG A+G+ ++KRH FF  + W LIRT RPPE  G
Sbjct  426   RVQDLIAKLLAKNPKKRLGSARGSVEVKRHEFFRDVNWALIRTVRPPEVPG  476



>ref|XP_009759284.1| PREDICTED: protein kinase PINOID [Nicotiana sylvestris]
Length=439

 Score =   323 bits (828),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 177/372 (48%), Positives = 234/372 (63%), Gaps = 22/372 (6%)
 Frame = -3

Query  1439  PSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLR  1260
             PSS   N   +PHR   S + AI++         L  R   L R +GSG++GRV+LCRLR
Sbjct  48    PSSPEQNPTLKPHRSSDSCFQAIRSVGK-----GLCFRDFSLVRQIGSGDIGRVYLCRLR  102

Query  1259  DYEHSD-----FALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYAHLEVSHYTC  1098
             +          +A+KV+D + L  KK     +TE +I+ MLDHPFLPTLYA  E SH++C
Sbjct  103   NAADEAAKERLYAMKVVDNEVLALKKKDQRAETERKIIKMLDHPFLPTLYAEFEASHFSC  162

Query  1097  LLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIR  918
             ++M++CS GDLHSL  KQ   R S+++ RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R
Sbjct  163   VVMEYCSGGDLHSLRHKQPHKRFSLNTSRFYAAEVLVALEYLHMLGIIYRDLKPENVLVR  222

Query  917   EDGHIMLSDFDLCFRADIFPQLET--------LTRVPLGSGGRKCGFLGerrreETVTEF  762
              DGHIML+DFDL   +D    +E+         +  P      +     + +   T   F
Sbjct  223   SDGHIMLTDFDLSLCSDSIAAVESPDFAYESSTSPPPFFCISNRLFRSKKVQSFSTNRLF  282

Query  761   VAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKEST  582
             VAEP TA S S VGTHEY+APE+ SG  HGN VDWWA G+ +YE+++G TPF G+S E+T
Sbjct  283   VAEPVTARSCSFVGTHEYVAPEVASGRSHGNAVDWWALGIFIYEMVYGRTPFAGASNEAT  342

Query  581   LRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNG  402
             LR+I   + + F  +     T + A A+DLI  LL KDP +RLG  +GA D+K HPFF G
Sbjct  343   LRSIVK-KPLTFPTN--APATTSEAHARDLISGLLNKDPNRRLGSKRGAADVKTHPFFKG  399

Query  401   IKWPLIRTYRPP  366
             + + LIR+  PP
Sbjct  400   LNFALIRSVTPP  411



>ref|XP_006294230.1| hypothetical protein CARUB_v10023227mg [Capsella rubella]
 gb|EOA27128.1| hypothetical protein CARUB_v10023227mg [Capsella rubella]
Length=441

 Score =   323 bits (827),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 176/355 (50%), Positives = 221/355 (62%), Gaps = 27/355 (8%)
 Frame = -3

Query  1304  VGSGNLGRVFLCRLRDYEH----SDFALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFL  1140
             +G+G++G V+LCRL   E     S FA+KV+D+++L  KK  H  + E  IL MLDHPFL
Sbjct  84    IGAGDIGTVYLCRLAGDEEESRSSYFAMKVVDKEALALKKKMHRAEMEKSILKMLDHPFL  143

Query  1139  PTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLG  960
             PTLYA  E SH++C++M++CS GDLHSL  KQ   R ++ S RFYAAEVLVALEYLH LG
Sbjct  144   PTLYAEFEASHFSCIVMEYCSGGDLHSLRHKQPHRRFTLSSARFYAAEVLVALEYLHMLG  203

Query  959   IVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLG---SGGRKCGFLGer  789
             I+YRDLKPENIL+R DGHIMLSDFDL   +D    +E+ +  P        R+   L   
Sbjct  204   IIYRDLKPENILVRSDGHIMLSDFDLSLCSDSIAAVESSSSSPENHQLRSPRRLTRLARL  263

Query  788   rreETVTE----------FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                   ++          FVAEP TA S S VGTHEY+APE+ SG  HGN VDWWAFGV 
Sbjct  264   FHRVLRSKKVQTLEPNRLFVAEPVTARSGSFVGTHEYVAPEVASGGSHGNAVDWWAFGVF  323

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA---AAKDLIERLLVKD  468
             +YE+++G TPF   + +  LRNI   R + F  D     +PA      A+ LI  LL KD
Sbjct  324   LYEMIYGKTPFVAPTNDVILRNIVK-RQLSFPTD-----SPATMFELHARSLISGLLNKD  377

Query  467   PRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSS  303
             P KRLG  +GA ++K HPFF G+ + LIRT  PPE    V+KR    A   G SS
Sbjct  378   PTKRLGSKRGAAEVKVHPFFKGLNFALIRTLTPPEIPSSVVKRPVKSATFGGRSS  432



>ref|XP_006283574.1| hypothetical protein CARUB_v10004626mg [Capsella rubella]
 gb|EOA16472.1| hypothetical protein CARUB_v10004626mg [Capsella rubella]
Length=505

 Score =   325 bits (832),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 181/406 (45%), Positives = 244/406 (60%), Gaps = 54/406 (13%)
 Frame = -3

Query  1466  LSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNL  1287
             +S  ST  + SSN     ++PH+ +   W AI+A  T    G L L H +L + +G G++
Sbjct  81    ISDESTCSSLSSN-----NKPHKANDVRWEAIQAVRT--KHGILGLNHFRLLKRLGCGDI  133

Query  1286  GRVFLCRLRDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVS  1110
             G V L  L       FA+KV+D+ +L + KKL   QTE EIL  LDHPFLPTLY+H E  
Sbjct  134   GTVHLAELHG-TRCYFAMKVMDKGALASRKKLLRAQTEREILQCLDHPFLPTLYSHFETD  192

Query  1109  HYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPEN  930
              ++CL+M+FC  GDLH+L ++Q G R S  + +FY AEVL+A+EYLH LGI+YRDLKPEN
Sbjct  193   KFSCLVMEFCPGGDLHTLRQRQPGKRFSEQAAKFYVAEVLLAMEYLHMLGIIYRDLKPEN  252

Query  929   ILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerr------------  786
             +L+REDGH+MLSDFDL  R  + P +   T + +  G R  G+  +              
Sbjct  253   VLVREDGHVMLSDFDLSLRCTVSPTVVRSTAL-VSEGQRNSGYCAQPACIQQPSCISAPT  311

Query  785   ------------------------reETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNG  678
                                     +   + E +AEPT+A S S VGTHEYLAPE+I G G
Sbjct  312   TCFSPRFFSSKSKKDKKMKNETGNQVSPLPELIAEPTSARSMSFVGTHEYLAPEIIKGEG  371

Query  677   HGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AA  501
             HG+ VDWW FG+ +YELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA
Sbjct  372   HGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAA  424

Query  500   KDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             +DLI  LLVK+P+ RL   +GAT++K+HPFF G+ W L+R   PPE
Sbjct  425   RDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCASPPE  470



>gb|AAA33905.1| G11A protein, partial [Oryza sativa]
Length=531

 Score =   325 bits (834),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 185/402 (46%), Positives = 239/402 (59%), Gaps = 55/402 (14%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ + S W AI+   T   DG L L H KL + +G G++G V+L  L   E S FA+
Sbjct  114   TKPHKANDSRWEAIQMIRT--RDGILGLSHFKLLKKLGCGDIGSVYLSELSGTE-SYFAM  170

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  171   KVMDKASLASRKKLLRAQTEKEILQCLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTL  230

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G      +V+FY AE+L+A+EYLH LGI+YRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  231   RQRQRGKYFPEQAVKFYVAEILLAMEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSL  290

Query  875   RADIFPQLETLTRVPLGSGGRK-----CGFLGerrreETVTEFVAEPTTAF---------  738
             R  + P L   +  P     RK     C           +    A PTT F         
Sbjct  291   RCAVSPTL-IRSSNPDAEALRKNNQAYCVQPACVEPSCMIQPSCATPTTCFGPRFFSKSK  349

Query  737   ---------------------------SRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                                        S S VGTHEYLAPE+I G GHG+ VDWW FG+ 
Sbjct  350   KDRKPKPEVVNQVSPWPELIAEPSDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIF  409

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPR  462
             +YELLFG TPFKGS   +TL N+   + +RF       E P ++ +A+DLI  LLVK+P+
Sbjct  410   LYELLFGKTPFKGSGNRATLFNVIG-QPLRF------PEYPVVSFSARDLIRGLLVKEPQ  462

Query  461   KRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             +RLGC +GAT+IK+HPFF G+ W LIR   PPE PR + ++R
Sbjct  463   QRLGCKRGATEIKQHPFFEGVNWALIRCASPPEVPRPVEIER  504



>ref|XP_008385824.1| PREDICTED: protein kinase PINOID 2-like [Malus domestica]
Length=500

 Score =   324 bits (831),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 198/456 (43%), Positives = 262/456 (57%), Gaps = 67/456 (15%)
 Frame = -3

Query  1559  TSCASITTTDrtlsarsslarssltlSFNERLSATSTAGNPSSNIPNLHSRPHRKHGSNW  1380
             +SC+SIT  D + S  S+L+ SS   S     S+ + A         LHS  H+ H +N 
Sbjct  14    SSCSSITVPDSSRSWMSNLSFSSRRPSSVSVCSSATEAC--------LHSSAHKPHKANQ  65

Query  1379  SAIKAAATL-SSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEHSDFALKVIDRD  1215
             +A +A   L SS G + L H +L R +GSG++G V+LC++R+         +A+KV+DR+
Sbjct  66    AAWEAMRRLRSSKGRVGLEHFRLLRRLGSGDIGNVYLCQIRNPVVGLPQCFYAMKVVDRE  125

Query  1214  SLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAG  1038
             +L   KKL   + E EIL MLDHPFLPTLYA  + SHY+CL+M+FC  GDL+   +    
Sbjct  126   ALAIRKKLHRAEMEKEILDMLDHPFLPTLYAEFDASHYSCLVMEFCPGGDLYVARQGLPR  185

Query  1037  NRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRADIFP  858
                S+ S RFYAAE L+ALEYLH +GIVYRDLKPEN+L+REDGHIMLSDFDL  + D+ P
Sbjct  186   KCFSISSARFYAAETLLALEYLHMMGIVYRDLKPENVLVREDGHIMLSDFDLSLKCDVVP  245

Query  857   -------QLETLTRVPLGSGGRKCG--------------FLGerrreETVTEFV------  759
                    +LE+  +    S    C                  ++    T+TE V      
Sbjct  246   KLLRRKSELESNQKSAKSSSMSYCAAAPMQPVLSCFSASHKEKKGTVTTITEQVGAGNHV  305

Query  758   -----------------------AEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAF  648
                                    AEP  A S+S VGTHEYLAPE+ISG GHG+ VDWW F
Sbjct  306   NHDHHDTNHDYDDDYQELNPEMVAEPIHARSKSFVGTHEYLAPEVISGQGHGSAVDWWTF  365

Query  647   GVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIERLLV  474
             GV +YE+L+G TPFKG + E TL NI   + +RF        +E   M   +DLI +LLV
Sbjct  366   GVFLYEMLYGRTPFKGENNEKTLINILK-QPLRFPRVVVSSSKELEEMVKVQDLISKLLV  424

Query  473   KDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP  366
             K+P+KR+G  KG+ +IKRH FF G+ W LIR+ RPP
Sbjct  425   KNPKKRIGSLKGSVEIKRHDFFKGVNWALIRSVRPP  460



>gb|KHG17055.1| Protein kinase PINOID -like protein [Gossypium arboreum]
Length=437

 Score =   322 bits (826),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 183/382 (48%), Positives = 239/382 (63%), Gaps = 34/382 (9%)
 Frame = -3

Query  1421  NLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY-EHS  1245
             NL  +PHR     +SAI++A T +    L  R  +L R +GSG++G V+LC+L D  E  
Sbjct  41    NLSLKPHRSSDLAYSAIRSA-TFARKTGLTSRDFQLIRRIGSGDIGTVYLCQLADADEKC  99

Query  1244  DFALKVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGD  1068
              +A+KV+D+++L  K K+   + E +IL MLDHPFLPTLYA  E SH++C++M++CS GD
Sbjct  100   CYAMKVVDKEALAMKNKVQRAEMEKKILKMLDHPFLPTLYAEFEASHFSCIVMEYCSGGD  159

Query  1067  LHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDF  888
             LHSL  KQ   R S+ S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R DGHIMLSDF
Sbjct  160   LHSLRHKQPQKRFSLSSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIMLSDF  219

Query  887   DLCFRADIFPQLETL--------------TRVPLGSGGRKCGFLGerrreETVTE-----  765
             DL   +D    +E+               +R P  +    C F    R ++  T      
Sbjct  220   DLSLCSDAIAAVESPSSSPDPTPPQNHRSSRPP--TTPLSCLFHRFFRSKKIQTLAPNNL  277

Query  764   -FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKE  588
              FVAEP TA SRS VGTHEY++PE+ +G  HGN VDWW+ G+ +YE+++G TPF   S E
Sbjct  278   FFVAEPVTARSRSFVGTHEYISPEVAAGGSHGNAVDWWSLGIFIYEMIYGGTPFAAPSNE  337

Query  587   STLRNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDPRKRLGCAKGATDIKRH  417
              TLRNI   R + F        +PA      A+DLI  LL K+P  RLG  +GA D+K H
Sbjct  338   VTLRNIVK-RPLTF-----PTHSPASLLEHHARDLISGLLNKEPNTRLGSKRGAADVKIH  391

Query  416   PFFNGIKWPLIRTYRPPEPRGL  351
             PFF G+ + LIR+  PPE  GL
Sbjct  392   PFFKGLNFALIRSLTPPEIPGL  413



>emb|CDY43662.1| BnaA04g20290D [Brassica napus]
Length=439

 Score =   322 bits (826),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 177/352 (50%), Positives = 223/352 (63%), Gaps = 22/352 (6%)
 Frame = -3

Query  1304  VGSGNLGRVFLCRLR-DYEHSD---FALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFL  1140
             +G+G++G V+LCRL  D E S    FA+KV+D ++L  KK  H  + E +IL MLDHPFL
Sbjct  84    IGAGDIGTVYLCRLAGDQEESRSSYFAMKVVDNEALAMKKKMHRAEMEKKILKMLDHPFL  143

Query  1139  PTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLG  960
             P+LYA  E SH++C++M++CS GDLHSL  KQ  +R S+ S RFYAAEVLVALEYLH LG
Sbjct  144   PSLYAEFEASHFSCIVMEYCSGGDLHSLRHKQPQHRFSLSSARFYAAEVLVALEYLHMLG  203

Query  959   IVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLG---SGGRKCGFLGer  789
             I+YRDLKPENIL+R DGHIMLSDFDL   +D    +E+ +  P     S  R+   L + 
Sbjct  204   IIYRDLKPENILVRSDGHIMLSDFDLSLCSDSIAAVESSSSTPENYPHSSPRRLTRLAKL  263

Query  788   rreETVTE----------FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                   ++          FVAEP TA S S VGTHEY+APE+ SG  HGN VDWWAFGV 
Sbjct  264   FNRVLRSKKVQTLEPNRLFVAEPVTARSGSFVGTHEYVAPEVASGGSHGNAVDWWAFGVF  323

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRK  459
             +YE+++G TPF   + +  LRNI   R + F  D     T     A+ LI  LL KDP K
Sbjct  324   LYEIIYGRTPFAAPTNDVILRNIVK-RPLSFPTDSA--ATMFELHARSLISGLLNKDPSK  380

Query  458   RLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSS  303
             RLG  +GA ++K HPFF G+ + LIRT  PPE    V +R K  A   G SS
Sbjct  381   RLGSRRGAAEVKVHPFFKGLNFALIRTMTPPEVPSDV-RRPKKSATFGGRSS  431



>ref|XP_010516616.1| PREDICTED: protein kinase PINOID-like [Camelina sativa]
Length=443

 Score =   322 bits (826),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 221/356 (62%), Gaps = 28/356 (8%)
 Frame = -3

Query  1304  VGSGNLGRVFLCRLRDYEH----SDFALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFL  1140
             +G+G++G V+LCRL   E     S FA+KV+D+++L  KK  H  + E  IL MLDHPFL
Sbjct  85    IGAGDIGTVYLCRLAGEEEESRSSYFAMKVVDKEALALKKKMHRAEMEKTILKMLDHPFL  144

Query  1139  PTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLG  960
             PTLYA  E SH++C++M++CS GDLHSL  KQ   R ++ S RFYAAEVLVALEYLH LG
Sbjct  145   PTLYAEFEASHFSCIVMEYCSGGDLHSLRHKQPHRRFTLSSTRFYAAEVLVALEYLHMLG  204

Query  959   IVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGS----GGRKCGFLGe  792
             I+YRDLKPENIL+R DGHIMLSDFDL  R+D    +E+ +  P         R+   L  
Sbjct  205   IIYRDLKPENILVRSDGHIMLSDFDLSLRSDSIAAVESSSSSPENQQQLRSPRRLTRLAR  264

Query  791   rrreETVTE----------FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGV  642
                    ++          FVAEP TA S S VGTHEY+APE+ SG  HGN VDWWAFGV
Sbjct  265   LFHRVLRSKKVQTLEPNRLFVAEPVTARSGSFVGTHEYVAPEVASGGSHGNAVDWWAFGV  324

Query  641   LMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA---AAKDLIERLLVK  471
              +YE+++G TPF   + +  LRNI   R + F  +     +PA      A+ LI  LL K
Sbjct  325   FLYEMIYGKTPFVAPTNDVILRNIVK-RQLSFPTN-----SPATMFELHARSLISGLLNK  378

Query  470   DPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSS  303
             DP KRLG  +GA ++K HPFF G+ + LIRT  PPE     +KR    A   G SS
Sbjct  379   DPTKRLGSRRGAAEVKVHPFFKGLNFALIRTLTPPEIPSSGVKRPVKSATFGGRSS  434



>gb|KHG10317.1| hypothetical protein F383_15240 [Gossypium arboreum]
Length=563

 Score =   326 bits (836),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 184/400 (46%), Positives = 242/400 (61%), Gaps = 52/400 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ +   W AI+A    + DG L L H +L + +G G++G V+L  L   +   FA+
Sbjct  145   NKPHKANDIRWEAIQAVR--AKDGVLGLNHFRLLKRLGYGDIGSVYLSELSGTK-CYFAM  201

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  202   KVMDKASLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETEKFSCLVMEFCPGGDLHTL  261

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   +  +V+FY AEVL++LEYLH LGIVYRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  262   RQRQPGKHFTEQAVKFYVAEVLLSLEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDLSL  321

Query  875   RADIFPQL---ETLTRVPLGSGGRKC------------------------GFLGerr---  786
             R  + P L    TL   PL      C                         F   +    
Sbjct  322   RCTVSPTLIKSSTLESEPLRKNSGYCVQPACIEPACIQPSCVAPTTCFSPRFFSSKSKKD  381

Query  785   ---------reETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                      +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +Y
Sbjct  382   RKPKNDMGNQVSPLPELIAEPTNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLY  441

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELLFG TPFKGS   +TL N+   + +RF       E+P ++ +AKDLI  LLVK+P+ R
Sbjct  442   ELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFSAKDLIRGLLVKEPQHR  494

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             L   +GAT+IK+HPFF G+ W LIR   PPE P+ + ++R
Sbjct  495   LAYKRGATEIKQHPFFEGVNWALIRCASPPEIPKPVEIER  534



>ref|XP_008225548.1| PREDICTED: protein kinase PINOID [Prunus mume]
Length=460

 Score =   323 bits (827),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 181/402 (45%), Positives = 240/402 (60%), Gaps = 50/402 (12%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD----  1242
             +PHR     +SAI++  T     A   R  +L R +G+G++G V+LC LR    S     
Sbjct  50    KPHRSSDFAYSAIRSKKT-----APTFRDFRLLRRIGAGDIGTVYLCTLRGTGSSPADQD  104

Query  1241  ----------FALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYAHLEVSHYTCL  1095
                       +A+KV+D+++L  KK  H  + E +IL MLDHPFLPTLYA  E SH++C+
Sbjct  105   RESSSSSSCFYAMKVVDKEALALKKKVHRAEMERKILKMLDHPFLPTLYAEFEASHFSCI  164

Query  1094  LMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIRE  915
             +M++CS GDLHSL  KQ   R S+ S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R 
Sbjct  165   VMEYCSGGDLHSLRHKQPNKRFSLTSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRS  224

Query  914   DGHIMLSDFDLCFRADIFPQLE--------------TLTRVPLGSGGRKCGFLGerrreE  777
             DGHIMLSDFDL   +D  P +E              + TR    +       L  R    
Sbjct  225   DGHIMLSDFDLSLCSDAIPAVESPDSYSDSRSLSTPSYTRPQQTTALTPFSCLSTRLFRS  284

Query  776   TVTE-------FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFG  618
                +       FVAEP  A SRS VGTHEY++PE+ SG+ HGN VDWWAFG+ +YEL++G
Sbjct  285   RKVQTLSPNRLFVAEPVAARSRSFVGTHEYVSPEVASGSSHGNAVDWWAFGIFLYELIYG  344

Query  617   TTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDPRKRLGC  447
              TPF   S E+TLRNI   + + F        TP+ A    A+DLI   L KDP +RLG 
Sbjct  345   RTPFAAPSNENTLRNIVK-KPLAF-----PTPTPSSALEGHARDLISGFLNKDPERRLGS  398

Query  446   AKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAH  321
              +GA D+K+HPFF GI   L+R+  PP   GL+ +++ + ++
Sbjct  399   KRGAADVKKHPFFKGINLALVRSLTPPMIPGLIRRQNTTPSY  440



>ref|XP_002983674.1| hypothetical protein SELMODRAFT_234346 [Selaginella moellendorffii]
 gb|EFJ15170.1| hypothetical protein SELMODRAFT_234346 [Selaginella moellendorffii]
Length=514

 Score =   324 bits (831),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 189/413 (46%), Positives = 250/413 (61%), Gaps = 52/413 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ +   W AI+ A T   +G L L H +L + +G G++G V+L  LR      FA+
Sbjct  80    NKPHKANDKRWEAIQVART--REGLLGLSHFRLLKRLGCGDIGSVYLAELRSTS-CYFAM  136

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KK+   QTE EILS+LDHPFLPTLY H E   ++CL+M+FC+ GDLH+L
Sbjct  137   KVMDKGSLASRKKVLRAQTEKEILSLLDHPFLPTLYTHFETDKFSCLVMEFCTGGDLHTL  196

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q     +  + RFYA+EVL+ALEYLH LGIVYRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  197   RQRQPNKHFTEQAARFYASEVLLALEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDLSL  256

Query  875   RADIFPQL--------ETLTRVPLGSGGRKC--------------GFLGerrreET----  774
             R  + P L        + L R+PL      C               FL     + +    
Sbjct  257   RCVVSPTLVKSAALDGDPLRRLPLYCVQPSCVQPACIQPVCAQPSCFLPRLLPQISKKGR  316

Query  773   ------------VTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYE  630
                         + E VAEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +YE
Sbjct  317   KSKNDVGNQVSPLPELVAEPTGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYE  376

Query  629   LLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLG  450
             LL G TPFKG+   +TL N+   + ++F  +  E   P    A+DLI  LLVKDP+ RLG
Sbjct  377   LLHGKTPFKGTGNRATLFNVVG-QPLKF-PEASEVGFP----ARDLIRGLLVKDPQHRLG  430

Query  449   CAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGL---VLKRSKSKAHVTGVSS  303
               +GAT+IK+HPFF G+ W LIR+  PPE PR     V++ + +   V+G  S
Sbjct  431   SKRGATEIKQHPFFEGVNWALIRSTAPPEVPRPFEPEVVRSTSTAQAVSGEKS  483



>ref|XP_002990535.1| hypothetical protein SELMODRAFT_185313 [Selaginella moellendorffii]
 gb|EFJ08412.1| hypothetical protein SELMODRAFT_185313 [Selaginella moellendorffii]
Length=514

 Score =   324 bits (831),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 189/413 (46%), Positives = 250/413 (61%), Gaps = 52/413 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ +   W AI+ A T   +G L L H +L + +G G++G V+L  LR      FA+
Sbjct  80    NKPHKANDKRWEAIQVART--REGLLGLSHFRLLKRLGCGDIGSVYLAELRSTS-CYFAM  136

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KK+   QTE EILS+LDHPFLPTLY H E   ++CL+M+FC+ GDLH+L
Sbjct  137   KVMDKGSLASRKKVLRAQTEKEILSLLDHPFLPTLYTHFETDKFSCLVMEFCTGGDLHTL  196

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q     +  + RFYA+EVL+ALEYLH LGIVYRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  197   RQRQPNKHFTEQAARFYASEVLLALEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDLSL  256

Query  875   RADIFPQL--------ETLTRVPLGSGGRKC--------------GFLGerrreET----  774
             R  + P L        + L R+PL      C               FL     + +    
Sbjct  257   RCVVSPTLVKSAALDGDPLRRLPLYCVQPSCVQPACIQPVCAQPSCFLPRLLPQISKKGR  316

Query  773   ------------VTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYE  630
                         + E VAEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +YE
Sbjct  317   KSKNDVGNQVSPLPELVAEPTGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYE  376

Query  629   LLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLG  450
             LL G TPFKG+   +TL N+   + ++F  +  E   P    A+DLI  LLVKDP+ RLG
Sbjct  377   LLHGKTPFKGTGNRATLFNVVG-QPLKF-PEASEVGFP----ARDLIRGLLVKDPQHRLG  430

Query  449   CAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGL---VLKRSKSKAHVTGVSS  303
               +GAT+IK+HPFF G+ W LIR+  PPE PR     V++ + +   V+G  S
Sbjct  431   SKRGATEIKQHPFFEGVNWALIRSTAPPEVPRPFEPEVVRSTSTAQAVSGEKS  483



>emb|CDX84294.1| BnaC04g10560D [Brassica napus]
Length=439

 Score =   322 bits (824),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 225/355 (63%), Gaps = 28/355 (8%)
 Frame = -3

Query  1304  VGSGNLGRVFLCRLRDYEH----SDFALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFL  1140
             VG+G++G V+LCRL   E     S FA+KV+D+++L  KK  H  + E +IL MLDHPFL
Sbjct  84    VGAGDIGTVYLCRLAGDEEESRRSYFAMKVVDKEALALKKKMHRAEMEKKILKMLDHPFL  143

Query  1139  PTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLG  960
             PTLYA  E SH++C++M++CS GDLHSL  +Q   R S+ S RFYAAEVLVALEYLH LG
Sbjct  144   PTLYAEFEASHFSCIVMEYCSGGDLHSLRHRQPDGRFSLSSARFYAAEVLVALEYLHMLG  203

Query  959   IVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLG---SGGRKCGFLGer  789
             I+YRDLKPENIL+R DGHIMLSDFDL   +D    +E+ +  P     S  R+   L + 
Sbjct  204   IIYRDLKPENILVRSDGHIMLSDFDLSLCSDSIAAVESSSSSPENQPRSSPRRLTRLAKL  263

Query  788   rreETVTE----------FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                   ++          FVAEP +A S S VGTHEY+APE+ SG  HGN VDWWAFGV 
Sbjct  264   FHRVLRSKKVQTLEPNRLFVAEPVSARSGSFVGTHEYVAPEVASGGSHGNAVDWWAFGVF  323

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA---AAKDLIERLLVKD  468
             +YE+++G TPF   + +  LRNI   R + F  D     TPA      A+ LI  LL KD
Sbjct  324   LYEIIYGRTPFAAPTNDVILRNIVK-RQLTFPTD-----TPATMFELHARSLISGLLNKD  377

Query  467   PRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSS  303
             P KRLG  +GA ++K HPFF G+ + LIRT  PPE    V +R K  A  +G S+
Sbjct  378   PTKRLGSRRGAAEVKVHPFFKGLNFALIRTLTPPEIPSDV-RRPKKAATFSGRSN  431



>ref|XP_008224641.1| PREDICTED: protein kinase G11A [Prunus mume]
Length=616

 Score =   327 bits (839),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 186/400 (47%), Positives = 240/400 (60%), Gaps = 53/400 (13%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ +   W AI+A  T   DG L L H +L + +G G++G V+L  L   +   FA+K
Sbjct  192   KPHKANDLRWEAIQAVRT--RDGVLGLGHFRLLKRLGCGDIGSVYLSELSGTK-CYFAMK  248

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L 
Sbjct  249   VMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTLR  308

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             ++Q G   S  +V+FY AEVL+ALEYLH LGIVYRDLKPEN+L+REDGHIMLSDFDL  R
Sbjct  309   QRQPGKHFSEQAVKFYVAEVLLALEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDLSLR  368

Query  872   ADIFPQL--------ETLTRVPLGSGGRKCGFLGerrreETVT-----------------  768
               + P L        E L + P+      C       +   V                  
Sbjct  369   CAVSPTLVKTSSMEFEPLRKNPVYCVQPACIEPPSCIQPSCVAPTTCFSPRLFSSKSKKD  428

Query  767   ---------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                            E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +Y
Sbjct  429   RKPKNEIGNQVRPLPELIAEPTDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLY  488

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA+DLI  LLVK+P+ R
Sbjct  489   ELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAARDLIRGLLVKEPQHR  541

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             L   +GAT+IK+HPFF G+ W LIR   PPE P+ + ++R
Sbjct  542   LAYKRGATEIKQHPFFEGVNWALIRCATPPEIPKPVEIER  581



>ref|XP_010029109.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Eucalyptus 
grandis]
Length=615

 Score =   327 bits (838),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 188/395 (48%), Positives = 247/395 (63%), Gaps = 29/395 (7%)
 Frame = -3

Query  1436  SSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD  1257
             SSN  ++ S+P +     W AI+AA   S  G L L H +L + +G G++G V+L  L+D
Sbjct  215   SSNFSSIMSKPRKARDRRWEAIQAAE--SRHGLLGLEHFRLLKKLGCGDVGSVYLSELKD  272

Query  1256  YEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFC  1080
                S FA+KV+D+ +LT  KKLS  Q E EIL  LDHPFLPTLY H E   ++CL+++FC
Sbjct  273   -SGSYFAVKVMDKPALTNRKKLSRAQVEREILQSLDHPFLPTLYMHFETEKFSCLVLEFC  331

Query  1079  SNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIM  900
               GDLH L ++Q G      + RFYAAEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIM
Sbjct  332   PGGDLHKLRQRQPGKYFLEHAARFYAAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIM  391

Query  899   LSDFDLCFRADIFPQL-ETLTRVPLGSGGRKCG---------FL---GerrreETVTEFV  759
             L DFDL  R  + P L E+   +        C          FL    +  +     E V
Sbjct  392   LVDFDLSLRCSVSPTLVESSNLISETGSSTSCAQPSCFMPRFFLRKPRKDNKSMQKPELV  451

Query  758   AEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTL  579
             AEP+ A S S VGTHEYLAPE+I   GHG+ VDWW FG+ +YELLFG TPFKG+   STL
Sbjct  452   AEPSDARSMSFVGTHEYLAPEIIKSEGHGSAVDWWTFGIFLYELLFGRTPFKGAGNRSTL  511

Query  578   RNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNG  402
              NI   + ++F       E+P+++ AA+DLI+ LLVKDP+ RL  ++GAT++K+H FF  
Sbjct  512   LNIIG-QHLKF------PESPSVSFAARDLIQSLLVKDPKHRLAYSRGATEVKQHQFFRS  564

Query  401   IKWPLIRTYRPP-EPRGL---VLKRSKSKAHVTGV  309
             I W LIR   PP  PR +   ++K +  +AH  G 
Sbjct  565   INWALIRCASPPLVPRQVTDGLMKDATERAHGVGA  599



>gb|KHF99558.1| Protein kinase PINOID -like protein [Gossypium arboreum]
Length=445

 Score =   322 bits (825),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 181/381 (48%), Positives = 240/381 (63%), Gaps = 24/381 (6%)
 Frame = -3

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             +N  NL  +PHR     +SAI++  T +    L  R  +L R +GSG++G V+LCRL D 
Sbjct  46    TNPENLSLKPHRSSDFAYSAIRSV-TFARKTGLTFRDFRLLRHIGSGDIGTVYLCRLADV  104

Query  1253  -EHSDFALKVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFC  1080
              E   +A+KV+D++ L  K K+   + E +IL MLDHPFLPTLYA  E S+++C++M++C
Sbjct  105   DEKCCYAMKVVDKEVLVMKNKVHRAEMEKKILKMLDHPFLPTLYAEFEASNFSCIVMEYC  164

Query  1079  SNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIM  900
             S GDLHSL  KQ   R S++S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R DGHIM
Sbjct  165   SGGDLHSLRHKQPQKRFSLNSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIM  224

Query  899   LSDFDLCFRADIFPQLE--TLTRVPLGSGGRKCG------------FLGerrreETVTE-  765
             LSDFDL   +D  P +E  + +  P+    + C              L   ++ ET+ + 
Sbjct  225   LSDFDLSLCSDAIPAVESPSSSPDPMPPQNQSCNRPQPTRLSRLFRRLLRSKKIETLAQS  284

Query  764   ---FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSS  594
                FVAEP  A SRS VGTHEY++PE+ SG  HGN VDWW+FG+ +YE+++G TPF   S
Sbjct  285   KPFFVAEPVAARSRSFVGTHEYVSPEVASGGSHGNAVDWWSFGIFIYEMIYGRTPFAAPS  344

Query  593   KESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHP  414
              E TLRNI   + + F        +     A+DLI  LL KDP  RLG  +GA D+K HP
Sbjct  345   NELTLRNIVK-KPLAFPTHSS--SSLLEHHARDLISGLLNKDPNARLGSKRGAADVKTHP  401

Query  413   FFNGIKWPLIRTYRPPEPRGL  351
             FF  + + LIR+  PPE  GL
Sbjct  402   FFKVLNFALIRSVTPPEVPGL  422



>ref|XP_007214796.1| hypothetical protein PRUPE_ppa002965mg [Prunus persica]
 ref|XP_007214797.1| hypothetical protein PRUPE_ppa002965mg [Prunus persica]
 gb|EMJ15995.1| hypothetical protein PRUPE_ppa002965mg [Prunus persica]
 gb|EMJ15996.1| hypothetical protein PRUPE_ppa002965mg [Prunus persica]
Length=616

 Score =   327 bits (838),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 186/400 (47%), Positives = 240/400 (60%), Gaps = 53/400 (13%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ +   W AI+A  T   DG L L H +L + +G G++G V+L  L   +   FA+K
Sbjct  192   KPHKANDLRWEAIQAVRT--RDGVLGLGHFRLLKRLGCGDIGSVYLSELSGTK-CYFAMK  248

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L 
Sbjct  249   VMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTLR  308

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             ++Q G   S  +V+FY AEVL+ALEYLH LGIVYRDLKPEN+L+REDGHIMLSDFDL  R
Sbjct  309   QRQPGKHFSEQAVKFYVAEVLLALEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDLSLR  368

Query  872   ADIFPQL--------ETLTRVPLGSGGRKCGFLGerrreETVT-----------------  768
               + P L        E L + P+      C       +   V                  
Sbjct  369   CAVSPTLVKTSSMEFEPLRKNPVYCVQPACIEPPSCIQPSCVAPTTCFSPRLFSSKSKKD  428

Query  767   ---------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                            E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +Y
Sbjct  429   RKPKNEIGNQVRPLPELIAEPTDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLY  488

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA+DLI  LLVK+P+ R
Sbjct  489   ELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAARDLIRGLLVKEPQHR  541

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             L   +GAT+IK+HPFF G+ W LIR   PPE P+ + ++R
Sbjct  542   LAYKRGATEIKQHPFFEGVNWALIRCATPPEIPKPVEIER  581



>ref|XP_004508525.1| PREDICTED: protein kinase PINOID 2-like [Cicer arietinum]
Length=490

 Score =   323 bits (828),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 180/404 (45%), Positives = 239/404 (59%), Gaps = 57/404 (14%)
 Frame = -3

Query  1415  HSRPHRKHGSNWSAIKAAATLSSD-GAlhlrhlklhrLVGSGNLGRVFLCRLRD----YE  1251
             H +PH+ +   W A+   + L  D G L L H +L R +GSG++G V+LC++R+      
Sbjct  54    HVKPHKANQVAWEAM---SRLRKDRGRLGLDHFRLLRRLGSGDIGNVYLCQIRNPVVGLA  110

Query  1250  HSDFALKVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
                +A+KV+DR++L  + KL   + E EIL MLDHPFLPTLY   + SHY+CL+M+FC  
Sbjct  111   QCFYAMKVVDREALAIRNKLQRAEMEKEILGMLDHPFLPTLYTDFDASHYSCLVMEFCPG  170

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDL++  ++Q GNR S+ S +FYAAE L+A+EYLH +GIVYRDLKPEN+L+REDGHIMLS
Sbjct  171   GDLYAARQRQPGNRFSISSTKFYAAETLLAIEYLHMMGIVYRDLKPENVLVREDGHIMLS  230

Query  893   DFDLCFRADIFPQ-LETLTR--------VPLGSGGRKC---------GFLGerrreETVT  768
             DFDL  + D+ P+ L T TR            S    C          FL    + +T  
Sbjct  231   DFDLSLKCDVVPKLLRTKTRSERSIKTTTKRTSSPNSCISPMQPVLSCFLSSTNKNKTTV  290

Query  767   ---------------------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGN  669
                                        E VAEP  A S+S VGTHEYLAPE+I G GHG+
Sbjct  291   ITENVNHHQSQLDLDHFDFDFDFDFDPELVAEPIDARSKSFVGTHEYLAPEVILGQGHGS  350

Query  668   GVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKD  495
              VDWW FGV +YE+L+G TPFKG + E TL NI   + + F         E   M   +D
Sbjct  351   AVDWWTFGVFLYEMLYGRTPFKGENNEKTLVNILK-QPLTFPRIGVSSSYEFEEMVKVQD  409

Query  494   LIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             LI +LLVK+P KR+G   G+ +IK+H FF G+ W LIR+ +PPE
Sbjct  410   LISKLLVKNPNKRIGSCLGSVEIKKHEFFKGVNWALIRSVKPPE  453



>ref|XP_006482514.1| PREDICTED: protein kinase PVPK-1-like [Citrus sinensis]
Length=506

 Score =   324 bits (830),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 182/390 (47%), Positives = 235/390 (60%), Gaps = 49/390 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             S+PH+ +   W A++     S DG L L H +L + +G G++G V+L  LRD     FA+
Sbjct  85    SKPHKGNDMKWDAVQCVK--SKDGDLGLGHFRLLKKLGCGDIGSVYLAELRDM-GCLFAM  141

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+  L   KKL   QTE EILS+LDHPFLPTLY+H E   ++CLLM+FCS GDLH+L
Sbjct  142   KVMDKGMLAGRKKLMRAQTEREILSLLDHPFLPTLYSHFETDKFSCLLMEFCSGGDLHTL  201

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   S  + RFYA+EVL+ALEYLH +G+VYRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  202   RQRQPGKHFSEQATRFYASEVLLALEYLHMMGVVYRDLKPENVLVREDGHIMLSDFDLSL  261

Query  875   RADIFPQLETLTRVP----------------------------LGSGGRKCGFLGerrre  780
             R  + P+L   +  P                            L     K  FL  +  +
Sbjct  262   RCFVSPKLVQSSDDPACRISSYCIQPSCIDPACKLPVCVEPSCLQPSCFKPRFLKSKTTK  321

Query  779   E-----------TVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                         ++   +AEPT+A S S VGTHEYLAPE+I G+GHG+ VDWW FG+  Y
Sbjct  322   VKSEKTSLTNSDSLPVLIAEPTSARSMSFVGTHEYLAPEIIRGDGHGSAVDWWTFGIFFY  381

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRL  453
             ELL G TPFKG+    TL N+   + ++F        +    AAKDLI  LLVKDP KRL
Sbjct  382   ELLLGRTPFKGNGNRETLFNVVG-QPLKF-----PEGSSISFAAKDLIRGLLVKDPPKRL  435

Query  452   GCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             G  +GAT+IK+HPFF  + W LIR+  PPE
Sbjct  436   GFKRGATEIKQHPFFESVNWALIRSTHPPE  465



>ref|XP_008794475.1| PREDICTED: protein kinase PINOID-like [Phoenix dactylifera]
 ref|XP_008794476.1| PREDICTED: protein kinase PINOID-like [Phoenix dactylifera]
Length=439

 Score =   322 bits (824),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 187/379 (49%), Positives = 241/379 (64%), Gaps = 29/379 (8%)
 Frame = -3

Query  1454  STAGNPSSNIPNLHSRPHRKHGSNWSAIKA--AATLSSDGAlhlrhlklhrLVGSGNLGR  1281
             S+ G    +   L ++PHR     W+AI++   A L +      R  KL R +GSG+LG 
Sbjct  51    SSGGQRPCSPSGLATKPHRSSDPAWAAIRSRLPARLGA------RDFKLIRRIGSGDLGT  104

Query  1280  VFLCRLRDYEHS-------DFALKVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYA  1125
             V+LCRLR+           ++A+KV+D+ +L  K KL    TE  IL +LDHPFLPTLYA
Sbjct  105   VYLCRLREEPRCPEAAPACEYAIKVVDKLALGKKNKLERAATEKRILRVLDHPFLPTLYA  164

Query  1124  HLEVS-HYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYR  948
               + S H++C++M++CS GDLH+L  +Q G R SV + RFYAAEVL+ALEYLH LGIVYR
Sbjct  165   DFDASPHFSCVVMEYCSGGDLHTLRHRQPGLRFSVTAARFYAAEVLLALEYLHMLGIVYR  224

Query  947   DLKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKC---GFLGerrreE  777
             DLKPENILIR DGHIMLSDFDL  ++   P +E L   P       C        R+   
Sbjct  225   DLKPENILIRSDGHIMLSDFDLSLQSTASPTVEPLD--PTAPADPSCLPHRLFHTRKPPG  282

Query  776   TVTE--FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFK  603
             ++ +  FVAEP  A S S VGTHEY+APE+ SG  HG+ VDWWA+GV +YELL+G TPF 
Sbjct  283   SLPDRRFVAEPVAARSCSFVGTHEYVAPEVASGLSHGSAVDWWAYGVFLYELLYGRTPFA  342

Query  602   GSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIK  423
             G + E+TLR+I   + + F A  G    PA + A+DLI  LLVKDP  RLG   GA D+K
Sbjct  343   GPTNEATLRSIVK-QPLAFPAARG----PADSTARDLISGLLVKDPAFRLGSKGGAADVK  397

Query  422   RHPFFNGIKWPLIRTYRPP  366
              HPFF G+   L+R+YRPP
Sbjct  398   AHPFFEGLNLALLRSYRPP  416



>ref|XP_010448241.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Camelina 
sativa]
 ref|XP_010448242.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Camelina 
sativa]
Length=504

 Score =   323 bits (829),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 244/406 (60%), Gaps = 54/406 (13%)
 Frame = -3

Query  1466  LSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNL  1287
             +S  ST  + S+N     ++PH+ +   W AI+A  T    G L L H +L + +G G++
Sbjct  81    ISDESTCSSLSNN-----NKPHKANDVRWEAIQAVRT--KHGILGLNHFRLLKRLGCGDI  133

Query  1286  GRVFLCRLRDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVS  1110
             G V L  L       FA+KV+D+ +L + KKL   QTE EIL  LDHPFLPTLY+H E  
Sbjct  134   GTVHLAELHG-TRCYFAMKVMDKGALASRKKLLRAQTEREILQCLDHPFLPTLYSHFETD  192

Query  1109  HYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPEN  930
              ++CL+M+FC  GDLH+L ++Q G R S  + +FY AEVL+A+EYLH LGI+YRDLKPEN
Sbjct  193   KFSCLVMEFCPGGDLHTLRQRQPGKRFSEQAAKFYVAEVLLAMEYLHMLGIIYRDLKPEN  252

Query  929   ILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerr------------  786
             +L+REDGH+MLSDFDL  R  + P +   T + +  G R  G+  +              
Sbjct  253   VLVREDGHVMLSDFDLSLRCTVSPTVVRSTAL-VSEGQRNSGYCAQPACVQQPSCISAPT  311

Query  785   ------------------------reETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNG  678
                                     +   + E +AEPT+A S S VGTHEYLAPE+I G G
Sbjct  312   TCFSPRFFSSKSKKDKKMKNETGNQVSPLPELIAEPTSARSMSFVGTHEYLAPEIIKGEG  371

Query  677   HGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AA  501
             HG+ VDWW FG+ +YELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA
Sbjct  372   HGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAA  424

Query  500   KDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             +DLI  LLVK+P+ RL   +GAT++K+HPFF G+ W L+R   PPE
Sbjct  425   RDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCASPPE  470



>ref|XP_009374840.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Pyrus x bretschneideri]
 ref|XP_009374841.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Pyrus x bretschneideri]
 ref|XP_009374842.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Pyrus x bretschneideri]
Length=607

 Score =   327 bits (837),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 186/400 (47%), Positives = 241/400 (60%), Gaps = 53/400 (13%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ +   W AI+A  T   DGAL L H +L + +G G++G V+L  L   +   FA+K
Sbjct  181   KPHKANDLRWEAIQAVRT--RDGALGLGHFRLLKRLGCGDIGSVYLSELSGTK-CYFAMK  237

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L 
Sbjct  238   VMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTLR  297

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             ++Q G   S  +V+FY AEVL++LEYLH LGIVYRDLKPEN+L+REDGHIMLSDFDL  R
Sbjct  298   QRQPGKHFSEQAVKFYVAEVLLSLEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDLSLR  357

Query  872   ADIFPQL--------ETLTRVPLGSGGRKCGFLGerrreETVT-----------------  768
               + P L        E L + P+      C       +   V                  
Sbjct  358   CAVSPTLVKTSSMEFEPLRKNPVYCVQPACIEPPSCIQPSCVAPTTCFGPRLFSSKSKKD  417

Query  767   ---------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                            E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +Y
Sbjct  418   KKSKNEIGNQVRPLPELIAEPTDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLY  477

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA+DLI  LLVK+P+ R
Sbjct  478   ELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAARDLIRGLLVKEPQHR  530

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             L   +GAT+IK+HPFF G+ W LIR   PP+ PR + ++R
Sbjct  531   LAYKRGATEIKQHPFFEGVNWALIRCATPPDIPRPVEIER  570



>ref|XP_008384194.1| PREDICTED: protein kinase G11A [Malus domestica]
 ref|XP_008384195.1| PREDICTED: protein kinase G11A [Malus domestica]
Length=607

 Score =   327 bits (837),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 194/439 (44%), Positives = 257/439 (59%), Gaps = 57/439 (13%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ +   W AI+A  T   DGAL L H +L + +G G++G V+L  L   +   FA+K
Sbjct  181   KPHKANDLRWEAIQAVRT--RDGALGLGHFRLLKRLGCGDIGSVYLSELSGTK-CYFAMK  237

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L 
Sbjct  238   VMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTLR  297

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             ++Q G   S  +V+FY AEVL++LEYLH LGIVYRDLKPEN+L+REDGHIMLSDFDL  R
Sbjct  298   QRQPGKHFSEQAVKFYVAEVLLSLEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDLSLR  357

Query  872   ADIFPQL--------ETLTRVPLGSGGRKCGFLGerrreETVT-----------------  768
               + P L        E L + P+      C       +   V                  
Sbjct  358   CAVSPTLVKTXSMEFEPLRKNPVYCVQPACIEPPSCIQPSCVAPTTCFGPRLFSSKSKKD  417

Query  767   ---------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                            E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +Y
Sbjct  418   KKSKNEIGNQVRPLPELIAEPTDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLY  477

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA+DLI  LLVK+P+ R
Sbjct  478   ELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAARDLIRGLLVKEPQHR  530

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRRRRCWW  279
             L   +GAT+IK+HPFF G+ W LIR   PP+ P+ + ++R  +    T  SS + +    
Sbjct  531   LAYKRGATEIKQHPFFEGVNWALIRCATPPDIPKPVEIERIPAP---TASSSEKEKAPPT  587

Query  278   KRLGHLVRIKGSKHNLNFN  222
               +   V+ KGS + L F+
Sbjct  588   PTIASPVQ-KGSDNYLEFD  605



>ref|XP_010433468.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Camelina 
sativa]
 ref|XP_010433469.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Camelina 
sativa]
Length=504

 Score =   323 bits (829),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 244/406 (60%), Gaps = 54/406 (13%)
 Frame = -3

Query  1466  LSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNL  1287
             +S  ST  + S+N     ++PH+ +   W AI+A  T    G L L H +L + +G G++
Sbjct  81    ISDESTCSSLSNN-----NKPHKANDVRWEAIQAVRT--KHGILGLNHFRLLKRLGCGDI  133

Query  1286  GRVFLCRLRDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVS  1110
             G V L  L       FA+KV+D+ +L + KKL   QTE EIL  LDHPFLPTLY+H E  
Sbjct  134   GTVHLAELHG-TRCYFAMKVMDKGALASRKKLLRAQTEREILQCLDHPFLPTLYSHFETD  192

Query  1109  HYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPEN  930
              ++CL+M+FC  GDLH+L ++Q G R S  + +FY AEVL+A+EYLH LGI+YRDLKPEN
Sbjct  193   KFSCLVMEFCPGGDLHTLRQRQPGKRFSEQAAKFYVAEVLLAMEYLHMLGIIYRDLKPEN  252

Query  929   ILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerr------------  786
             +L+REDGH+MLSDFDL  R  + P +   T + +  G R  G+  +              
Sbjct  253   VLVREDGHVMLSDFDLSLRCTVSPTVVRSTAL-VSEGQRSSGYCAQPACVQQPSCISAPT  311

Query  785   ------------------------reETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNG  678
                                     +   + E +AEPT+A S S VGTHEYLAPE+I G G
Sbjct  312   TCFSPRFFSSKSKKDKKMKNETGNQVSPLPELIAEPTSARSMSFVGTHEYLAPEIIKGEG  371

Query  677   HGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AA  501
             HG+ VDWW FG+ +YELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA
Sbjct  372   HGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAA  424

Query  500   KDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             +DLI  LLVK+P+ RL   +GAT++K+HPFF G+ W L+R   PPE
Sbjct  425   RDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCASPPE  470



>ref|XP_001777627.1| predicted protein [Physcomitrella patens]
 gb|EDQ57529.1| predicted protein [Physcomitrella patens]
Length=440

 Score =   321 bits (823),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 186/393 (47%), Positives = 235/393 (60%), Gaps = 53/393 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             S+PH+ +   W  I+A      DGAL L H KL + +G G++G V+L  LR   HS FA+
Sbjct  28    SKPHKANDKRWEGIQAIRI--RDGALGLSHFKLLKRLGCGDIGSVYLAELRG-GHSHFAM  84

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   + CL+M+FCS GDLH+L
Sbjct  85    KVMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFESEKFLCLVMEFCSGGDLHTL  144

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   S  + RFYAAEVL+ALEYLH +G+VYRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  145   RQRQPGKHFSEQAARFYAAEVLLALEYLHMMGVVYRDLKPENVLVREDGHIMLSDFDLSL  204

Query  875   RADIFPQLETLT--------------------RVPLGSGGRK------------------  810
             +  + P L   T                      P  +GG +                  
Sbjct  205   KCVVSPTLVRSTVHESRDGKGSGAYCMQPAACAEPACTGGFEDGKSPKPSPGKSKSKSKA  264

Query  809   -CGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
              CG         ++ E +AEPT A S S VGTHEYLAPE+I G+GHG+ VDWW FG+ +Y
Sbjct  265   DCG-----HSVSSLPELIAEPTGARSMSFVGTHEYLAPEIIKGDGHGSAVDWWTFGIFLY  319

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRL  453
             ELLFG TPFKGS   +TL N+   + ++F  D    +     AA+DLI  LL+K+P  RL
Sbjct  320   ELLFGKTPFKGSGNRATLFNVVG-QPLKF-PDSATGQVS--FAARDLIRGLLMKEPVLRL  375

Query  452   GCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PR  357
                +GA +IK HPFF G+ W LIR   PPE PR
Sbjct  376   ASKRGAGEIKAHPFFEGVNWALIRCTNPPEVPR  408



>ref|XP_009388967.1| PREDICTED: protein kinase PINOID-like [Musa acuminata subsp. 
malaccensis]
Length=442

 Score =   321 bits (823),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 187/385 (49%), Positives = 245/385 (64%), Gaps = 16/385 (4%)
 Frame = -3

Query  1466  LSATSTAGNPSSNIP----NLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVG  1299
             ++A +    PS + P     L ++PHR    +W+AI++  +      L  R  K+ R +G
Sbjct  45    VAAAAALELPSGDRPLAASRLPAKPHRWSDPSWAAIRSRNSAGLHANLGPRDFKIVRRIG  104

Query  1298  SGNLGRVFLCRLRDYEHS-DFALKVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYA  1125
             SG++G V+LCRLR+   +  +A+KV+D+ +L  K KL    TE  IL +LDHPFLPTLYA
Sbjct  105   SGDIGTVYLCRLREEASACVYAMKVVDKLALAKKNKLERAATEKRILRVLDHPFLPTLYA  164

Query  1124  HLEVS-HYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYR  948
               + S HY+C++M++CS GDLH+L  +Q   R SV + RFYAAEVL+ALEYLH LGIVYR
Sbjct  165   DFDASPHYSCVVMEYCSGGDLHTLRHRQPRLRFSVAATRFYAAEVLLALEYLHMLGIVYR  224

Query  947   DLKPENILIREDGHIMLSDFDLCFRADIFPQLETL---TRVPLGSGGRKCGFLGerrreE  777
             DLKPENILIR DGHIMLSDFDL   +   P LE          G       FL  R    
Sbjct  225   DLKPENILIRSDGHIMLSDFDLSLESTASPTLEQFDAADEAAFGDDFSCIPFLARRPVRT  284

Query  776   TVT--EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFK  603
             +     FVAEP +A S S VGTHEY+APE+ SG  HG+ VDWWAFGVL+YELL+  TPF 
Sbjct  285   SAPCRRFVAEPISARSGSFVGTHEYVAPEVASGRHHGSAVDWWAFGVLLYELLYSRTPFA  344

Query  602   GSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIK  423
             GS+ ESTLRNI   + + F        + + +AA+DLI  LL+KDP  RLG   G+ ++K
Sbjct  345   GSNNESTLRNIVK-QPLTF---PPSSSSCSSSAARDLITCLLLKDPAARLGSRGGSAEVK  400

Query  422   RHPFFNGIKWPLIRTYRPPEPRGLV  348
              HPFF G+ + L+R++RPP   GLV
Sbjct  401   AHPFFKGLNFALMRSHRPPVIPGLV  425



>ref|XP_003563941.1| PREDICTED: protein kinase G11A-like [Brachypodium distachyon]
Length=563

 Score =   325 bits (833),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 186/402 (46%), Positives = 239/402 (59%), Gaps = 55/402 (14%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ + S W AI+     S DG L L H KL + +G G++G V+L  L   + S FA+K
Sbjct  142   KPHKANDSRWEAIQI--IRSRDGNLGLSHFKLLKKLGCGDIGSVYLSELSGTK-SYFAMK  198

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ SLT  KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L 
Sbjct  199   VMDKASLTGRKKLLRAQTEKEILQCLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTLR  258

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             ++Q G      +V+FY AE+L+A+EYLH LGI+YRDLKPENIL+REDGHIMLSDFDL  R
Sbjct  259   QRQRGKYFPEQAVKFYVAEILLAMEYLHMLGIIYRDLKPENILVREDGHIMLSDFDLSLR  318

Query  872   ADIFPQLETLTRVPLGSGGRK-----CGFLGerrreETVTEFVAEPTTAF----------  738
               + P L   +  P     RK     C                A PTT F          
Sbjct  319   CAVSPTL-IRSSNPDTEALRKNSQAYCAQPACVEPSCMTQPSCAAPTTCFGPRFFSKSKK  377

Query  737   --------------------------SRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLM  636
                                       S S VGTHEYLAPE+I G GHG+ VDWW FG+ +
Sbjct  378   DRKPKPEVVNQVRPWPELMAEPSDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFL  437

Query  635   YELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRK  459
             YELLFG TPFKGS+  +TL N+   + +RF       E P ++ +A+DLI  LLVK+P++
Sbjct  438   YELLFGKTPFKGSANRATLFNVIG-QPLRF------PEYPVVSFSARDLIRGLLVKEPQQ  490

Query  458   RLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRS  336
             RLGC +GAT+IK+HPFF G+ W LIR   PPE PR + ++R+
Sbjct  491   RLGCKRGATEIKQHPFFEGVNWALIRCASPPEIPRPVEIERA  532



>ref|XP_010438725.1| PREDICTED: serine/threonine-protein kinase D6PKL1 [Camelina sativa]
Length=504

 Score =   323 bits (828),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 244/406 (60%), Gaps = 54/406 (13%)
 Frame = -3

Query  1466  LSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNL  1287
             +S  ST  + S+N     ++PH+ +   W AI+A  T    G L L H +L + +G G++
Sbjct  81    ISDESTCSSLSNN-----NKPHKANDVRWEAIQAVRT--KHGILGLNHFRLLKRLGCGDI  133

Query  1286  GRVFLCRLRDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVS  1110
             G V L  L       FA+KV+D+ +L + KKL   QTE EIL  LDHPFLPTLY+H E  
Sbjct  134   GTVHLAELHG-TRCYFAMKVMDKGALASRKKLLRAQTEREILQCLDHPFLPTLYSHFETD  192

Query  1109  HYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPEN  930
              ++CL+M+FC  GDLH+L ++Q G R S  + +FY AEVL+A+EYLH LGI+YRDLKPEN
Sbjct  193   KFSCLVMEFCPGGDLHTLRQRQPGKRFSEQAAKFYVAEVLLAMEYLHMLGIIYRDLKPEN  252

Query  929   ILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerr------------  786
             +L+REDGH+MLSDFDL  R  + P +   T + +  G R  G+  +              
Sbjct  253   VLVREDGHVMLSDFDLSLRCTVSPTVVRSTAL-VSEGQRSSGYCAQPACVQQPSCISAPT  311

Query  785   ------------------------reETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNG  678
                                     +   + E +AEPT+A S S VGTHEYLAPE+I G G
Sbjct  312   TCFSPRFFSSKSKKDKKMKNETGNQVSPLPELIAEPTSARSMSFVGTHEYLAPEIIKGEG  371

Query  677   HGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AA  501
             HG+ VDWW FG+ +YELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA
Sbjct  372   HGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAA  424

Query  500   KDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             +DLI  LLVK+P+ RL   +GAT++K+HPFF G+ W L+R   PPE
Sbjct  425   RDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCASPPE  470



>ref|XP_004304710.1| PREDICTED: protein kinase PINOID-like [Fragaria vesca subsp. 
vesca]
Length=449

 Score =   322 bits (824),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 190/416 (46%), Positives = 251/416 (60%), Gaps = 43/416 (10%)
 Frame = -3

Query  1469  RLSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGN  1290
             RLS  +TA +      NL  +PHR     +S I+A  +     +L  R  +LHR +GSG+
Sbjct  28    RLSFDATASSDFFGTENLAIKPHRSSDFAYSVIRAKKS-----SLTYRDFRLHRRIGSGD  82

Query  1289  LGRVFLCRLRDYEHSD------FALKVIDRDSLTAKKLS-HVQTEAEILSMLDHPFLPTL  1131
             +G V+LC LR  +         +A+KV+D+++L  KK     + E +IL MLDHPFLPTL
Sbjct  83    IGTVYLCSLRSPDSDSSSLSCFYAMKVVDKEALALKKKEPRAEMERKILKMLDHPFLPTL  142

Query  1130  YAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVY  951
             YA  E SH++C++M++CS GDLHSL  KQ   R S+ S RFYAAEVLVALEYLH LG++Y
Sbjct  143   YAEFEASHFSCIVMEYCSGGDLHSLRHKQPNRRFSLTSARFYAAEVLVALEYLHMLGVIY  202

Query  950   RDLKPENILIREDGHIMLSDFDLCFRADIFPQLE---------TLTRVPLGSGGRKCGFL  798
             RDLKPEN+L+R DGHIMLSDFDL   +D  P +E         +++  P  +      FL
Sbjct  203   RDLKPENVLVRSDGHIMLSDFDLSLCSDAIPAVESPDSSPFPDSISTTPSYTRPHPSSFL  262

Query  797   G----------errreETVTE---FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDW  657
                          R+ +T++    FVAEP  A S S VGTHEY+APE+ SG  HGN VDW
Sbjct  263   TPFSCLSNRLFRSRKVQTLSPNRLFVAEPVAARSCSFVGTHEYVAPEVASGRSHGNAVDW  322

Query  656   WAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAA---AKDLIE  486
             WAFG+ +YE+++G TPF   S E TLRNI  +  + F        TP+ A    A+DLI 
Sbjct  323   WAFGIFLYEMIYGRTPFAAPSNEITLRNIVKS-SLTF-----PTATPSSAVEGHARDLIS  376

Query  485   RLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHV  318
              LL KDP +RLG  +GA D+K+HPFF GI   LIR+ RPP   GL  +++    H 
Sbjct  377   GLLDKDPERRLGSKRGAADVKKHPFFKGINLALIRSLRPPMIPGLRRQQTTPYFHA  432



>ref|XP_007147579.1| hypothetical protein PHAVU_006G136500g [Phaseolus vulgaris]
 ref|XP_007147580.1| hypothetical protein PHAVU_006G136500g [Phaseolus vulgaris]
 gb|ESW19573.1| hypothetical protein PHAVU_006G136500g [Phaseolus vulgaris]
 gb|ESW19574.1| hypothetical protein PHAVU_006G136500g [Phaseolus vulgaris]
Length=612

 Score =   327 bits (837),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 192/442 (43%), Positives = 251/442 (57%), Gaps = 64/442 (14%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ +   W AI+A    S DGAL L H +L + +G G++G V+L  L   +   FA+
Sbjct  188   NKPHKANDLRWEAIQAVR--SRDGALGLGHFRLLKRLGCGDIGSVYLSELSGTK-CYFAM  244

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  245   KVMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETEKFSCLVMEFCPGGDLHTL  304

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              +KQ G      +V+FY AEVL+ALEYLH LGIVYRDLKPEN+L+R+DGHIMLSDFDL  
Sbjct  305   RQKQPGKHFPEQAVKFYVAEVLLALEYLHMLGIVYRDLKPENVLVRDDGHIMLSDFDLSL  364

Query  875   RADIFPQLETLTRV---PLGSGGRKC----------------------------------  807
             R  + P L   +     PL      C                                  
Sbjct  365   RCAVSPTLVKTSNTDSEPLRKNSAYCVQPACIEPPSCIQPSCVAPTTCFSPRLFSSKSKK  424

Query  806   ---GFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLM  636
                       +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +
Sbjct  425   DRKAKTEIGNQVSPLPELIAEPTDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFL  484

Query  635   YELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRK  459
             YELLFG TPFKGS   +TL N+   + +RF       E P ++ AA+DLI  LLVK+P+ 
Sbjct  485   YELLFGKTPFKGSGNRATLFNVVG-QPLRF------PEAPVVSFAARDLIRGLLVKEPQH  537

Query  458   RLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRRRRCW  282
             RL   +GAT+IK+HPFF G+ W LIR   PPE P+ +  ++         + SP      
Sbjct  538   RLAYKRGATEIKQHPFFEGVNWALIRCATPPEIPKTVEFEK---------IPSPASSGAG  588

Query  281   WKRLGHL--VRIKGSKHNLNFN  222
              K + H+     KGS + L F+
Sbjct  589   EKAVNHMSIANQKGSDNYLEFD  610



>ref|XP_009141394.1| PREDICTED: protein kinase PINOID [Brassica rapa]
Length=439

 Score =   321 bits (823),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 223/352 (63%), Gaps = 22/352 (6%)
 Frame = -3

Query  1304  VGSGNLGRVFLCRLR-DYEHSD---FALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFL  1140
             +G+G++G V+LCRL  D E S    FA+KV+D ++L  KK  H  + E +IL MLDHPFL
Sbjct  84    IGAGDIGTVYLCRLAGDQEESRSSYFAMKVVDNEALAMKKKMHRAEMEKKILKMLDHPFL  143

Query  1139  PTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLG  960
             P+LYA  E SH++C++M++CS GDLHSL  +Q  +R S+ S RFYAAEVLVALEYLH LG
Sbjct  144   PSLYAEFEASHFSCIVMEYCSGGDLHSLRHRQPQHRFSLSSARFYAAEVLVALEYLHMLG  203

Query  959   IVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLG---SGGRKCGFLGer  789
             I+YRDLKPENIL+R DGHIMLSDFDL   +D    +E+ +  P     S  R+   L + 
Sbjct  204   IIYRDLKPENILVRSDGHIMLSDFDLSLCSDSIAAVESSSSTPENYPHSSPRRLTRLAKL  263

Query  788   rreETVTE----------FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                   ++          FVAEP TA S S VGTHEY+APE+ SG  HGN VDWWAFGV 
Sbjct  264   FNRVLRSKKVQTLEPNRLFVAEPVTARSGSFVGTHEYVAPEVASGGSHGNAVDWWAFGVF  323

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRK  459
             +YE+++G TPF   + +  LRNI   R + F  D     T     A+ LI  LL KDP K
Sbjct  324   LYEIIYGRTPFAAPTNDVILRNIVK-RPLSFPTDSA--ATMFELHARSLISGLLNKDPSK  380

Query  458   RLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSS  303
             RLG  +GA ++K HPFF G+ + LIRT  PPE    V +R K  A   G SS
Sbjct  381   RLGSRRGAAEVKVHPFFKGLNFALIRTMTPPEVPSDV-RRPKKSATFGGRSS  431



>emb|CDP20597.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   323 bits (829),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 182/389 (47%), Positives = 245/389 (63%), Gaps = 47/389 (12%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             S+PH+ +   W AI++   L+ DG L L H +L + +G G++G V+L  LR  +   FA+
Sbjct  100   SKPHKGNDIRWDAIQSV--LARDGQLGLGHFRLLKKLGFGDIGSVYLAELRGMK-CLFAM  156

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ +L   KKL   QTE EIL +LDHPFLP+LY+H E   ++CLLM+FCS GDLH L
Sbjct  157   KVMDKGTLAGRKKLVRAQTEREILGLLDHPFLPSLYSHFETEKFSCLLMEFCSGGDLHLL  216

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   +  + RFYA+EVL+ALEYLH +G+VYRDLKPEN+++REDGHIMLSDFDL  
Sbjct  217   RQRQPGRHFTEQAARFYASEVLLALEYLHMMGVVYRDLKPENVMVREDGHIMLSDFDLSL  276

Query  875   RADIFPQLETLT----------------RVPL-----------------GSGGRKC-GFL  798
             R  + P L + T                ++P+                  S   K  G  
Sbjct  277   RCYVSPTLVSSTTELSCKISSYCIQPSCKLPVCVEPSCFQPSCFRPSLFNSKTLKLRGEC  336

Query  797   GerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFG  618
                   +++   +AEPT A S S VGTHEYLAPE+I G+GHG+ VDWW FG+ +YELL G
Sbjct  337   TPAVASDSLPVLIAEPTAARSMSFVGTHEYLAPEIIRGDGHGSAVDWWTFGIFLYELLHG  396

Query  617   TTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKRLGCAK  441
              TP+KG+    TL N+   + ++F       E+P ++ AAKDLI  LL KDP+KRLG  K
Sbjct  397   KTPYKGNGNRETLFNVVG-QPLKF------PESPTVSFAAKDLIRGLLAKDPQKRLGFKK  449

Query  440   GATDIKRHPFFNGIKWPLIRTYRPPE-PR  357
             GAT+IK+HPFF G+ W LIR+ +PPE PR
Sbjct  450   GATEIKQHPFFQGVNWALIRSTQPPEIPR  478



>gb|KHN27762.1| Protein kinase G11A [Glycine soja]
Length=283

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 167/257 (65%), Positives = 194/257 (75%), Gaps = 13/257 (5%)
 Frame = -3

Query  995  VLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLE-------TLTR  837
            VLVALEYLH+LGIVYRDLKPEN+L+REDGH+MLSDFDLCF++D+ P ++           
Sbjct  32   VLVALEYLHALGIVYRDLKPENVLMREDGHVMLSDFDLCFKSDVAPCVDFRAHSPPPPGP  91

Query  836  VPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDW  657
               G     C    +RR+E+ V EFVAEP TAFSRS VGTHEYLAPEL+SGNGHGNGVDW
Sbjct  92   PTNGCFSYNCHRSQDRRKEKLVAEFVAEPVTAFSRSSVGTHEYLAPELVSGNGHGNGVDW  151

Query  656  WAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLL  477
            WAFGV +YELL+GTTPFKG SKE TLR IAS++ VRF     ERE P M  A+DLIE+LL
Sbjct  152  WAFGVFVYELLYGTTPFKGCSKEGTLRKIASSKDVRF-VHVAEREEPGMTEARDLIEKLL  210

Query  476  VKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSSPR  297
            VKDP+KRLGCAKGAT+IKRH FF+GIKWPLIRTYRPPE +GL ++R+KSK          
Sbjct  211  VKDPKKRLGCAKGATEIKRHRFFDGIKWPLIRTYRPPELKGL-MRRNKSKVSCKSKRWWW  269

Query  296  RRRCWWKRLGHLVRIKG  246
                  KRLGH+VR KG
Sbjct  270  WW----KRLGHVVRTKG  282



>ref|XP_010509727.1| PREDICTED: protein kinase PINOID-like [Camelina sativa]
Length=443

 Score =   321 bits (823),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 220/356 (62%), Gaps = 28/356 (8%)
 Frame = -3

Query  1304  VGSGNLGRVFLCRLRDYEH----SDFALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFL  1140
             +G+G++G V+LCRL   E     S FA+KV+D+++L  KK  H  + E  IL MLDHPFL
Sbjct  85    IGAGDIGTVYLCRLAGDEEESRSSYFAMKVVDKEALALKKKMHRAEMEKTILKMLDHPFL  144

Query  1139  PTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLG  960
             PTLYA  E SH++C++M++CS GDLHSL  KQ   R ++ S RFYAAEVLVALEYLH LG
Sbjct  145   PTLYAEFEASHFSCIVMEYCSGGDLHSLRHKQPHRRFTLSSTRFYAAEVLVALEYLHMLG  204

Query  959   IVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGS----GGRKCGFLGe  792
             I+YRDLKPENIL+R DGHIMLSDFDL  R+D    +E+ +  P         R+   L  
Sbjct  205   IIYRDLKPENILVRSDGHIMLSDFDLSLRSDSIAAVESSSSSPENQQQLRSPRRLTRLAR  264

Query  791   rrreETVTE----------FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGV  642
                    ++          FVAEP TA S S VGTHEY+APE+ S   HGN VDWWAFGV
Sbjct  265   LFHRVLRSKKVQTLEPNRLFVAEPVTARSGSFVGTHEYVAPEVASDGSHGNAVDWWAFGV  324

Query  641   LMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA---AAKDLIERLLVK  471
              +YE+++G TPF   + +  LRNI   R + F  D     +PA      A+ LI  LL K
Sbjct  325   FLYEMIYGKTPFVAPTNDVILRNIVK-RQLSFPTD-----SPATMFELHARSLISGLLNK  378

Query  470   DPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSS  303
             DP KRLG  +GA ++K HPFF G+ + LIRT  PPE     +KR    A   G SS
Sbjct  379   DPTKRLGSRRGAAEVKVHPFFKGLNFALIRTLTPPEIPSSGVKRPVKSATFGGRSS  434



>ref|XP_003609262.1| Protein kinase G11A [Medicago truncatula]
 gb|AES91459.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=490

 Score =   323 bits (827),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 174/395 (44%), Positives = 234/395 (59%), Gaps = 47/395 (12%)
 Frame = -3

Query  1415  HSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRD----YEH  1248
             +++PH+ +   W A+         G + L H +L + +GSG++G V+LC++R+       
Sbjct  64    NAKPHKANQVAWEAMSRLRL--DQGRVGLDHFRLLKRLGSGDIGNVYLCQIRNPVVGLPQ  121

Query  1247  SDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNG  1071
               +A+KV+DR++L   KKL   + E EIL MLDHPFLPTLY   + SHY+CL+M+FC  G
Sbjct  122   CFYAMKVVDREALAIRKKLQRAEMEKEILGMLDHPFLPTLYTDFDASHYSCLVMEFCPGG  181

Query  1070  DLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSD  891
             DL++  ++Q G R S+ S +FYAAE L+ALEYLH +GIVYRDLKPEN+L+REDGHIMLSD
Sbjct  182   DLYACRQRQPGKRFSLSSSKFYAAETLLALEYLHMMGIVYRDLKPENVLVREDGHIMLSD  241

Query  890   FDLCFRADIFPQL----ETLTRVPLGSGGRKCGFLGerrreETV----------------  771
             FDL  + D+ P+L      L R    +   +C         + V                
Sbjct  242   FDLSLKCDVVPKLLRSKTRLERSIKTTTTMRCSTPSCISPMQPVLSCFLSSSTKKKKTKL  301

Query  770   -----------------TEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGV  642
                               +FVAEP  A S+S VGTHEYLAPE+I G GHG+ VDWW FGV
Sbjct  302   ETVIRENVQEEFEVDLDPDFVAEPIEARSKSFVGTHEYLAPEVILGQGHGSAVDWWTFGV  361

Query  641   LMYELLFGTTPFKGSSKESTLRNIASTRGVRF--YADDGERETPAMAAAKDLIERLLVKD  468
              +YE+L+G TPFKG + E TL NI   + + F         E   M   +DLI +LLVK+
Sbjct  362   FLYEMLYGRTPFKGENNEKTLVNILK-QPLTFPRIGVSSNYEFEEMVKVQDLISKLLVKN  420

Query  467   PRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             P KR+G   G+ +IKRH FF G+ W LIR+ RPPE
Sbjct  421   PSKRIGSCLGSVEIKRHEFFKGVNWALIRSVRPPE  455



>emb|CBI34999.3| unnamed protein product [Vitis vinifera]
Length=497

 Score =   323 bits (827),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 177/373 (47%), Positives = 229/373 (61%), Gaps = 32/373 (9%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             S+PHR +   W AI+     + DG + L H +L + +G G++G V+L  LR      FA+
Sbjct  117   SKPHRGNDIRWDAIQCVK--AKDGDMGLCHFRLLKKLGCGDIGSVYLAELRGMS-CLFAM  173

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+  L   KKL   QTE EIL +LDHPFLPTLY+H E   ++CLLM+FCS GDLH+L
Sbjct  174   KVMDKGMLEERKKLMRAQTEREILGLLDHPFLPTLYSHFETEKFSCLLMEFCSGGDLHTL  233

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   S  + RFYA+EVL+ALEYLH LG+VYRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  234   RQRQPGKHFSEQAARFYASEVLLALEYLHMLGVVYRDLKPENVLVREDGHIMLSDFDLSL  293

Query  875   RADIFPQLETLTRVPLGSGGRKC----------------------GFLGerrreETVTEF  762
             R  + P L   +  P       C                               +++   
Sbjct  294   RCYVSPTLVQTSSDPSFRISSYCIQPSCIDPACKLSVCAKSRKPRSERLSLTNLDSLPML  353

Query  761   VAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKEST  582
             +AEPT A S S VGTHEYLAPE+I G+GHG+ VDWW FG+ +YELL G TPFKG+    T
Sbjct  354   IAEPTGARSMSFVGTHEYLAPEIIRGDGHGSAVDWWTFGIFLYELLHGRTPFKGNGNRET  413

Query  581   LRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNG  402
             L N+   + ++F        +    AAKDLI  LLVKDP+KRLG  +GAT+IK+HPFF  
Sbjct  414   LFNVVG-QSLKF-----AEGSSISFAAKDLIRGLLVKDPQKRLGYKRGATEIKQHPFFES  467

Query  401   IKWPLIRTYRPPE  363
             + W LIR+  PP+
Sbjct  468   VNWALIRSTHPPQ  480



>ref|XP_002869601.1| hypothetical protein ARALYDRAFT_492147 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45860.1| hypothetical protein ARALYDRAFT_492147 [Arabidopsis lyrata subsp. 
lyrata]
Length=510

 Score =   323 bits (828),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 183/409 (45%), Positives = 245/409 (60%), Gaps = 60/409 (15%)
 Frame = -3

Query  1466  LSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNL  1287
             +S  ST  + SSN     ++PH+ +   W AI+A  T    G L L H +L + +G G++
Sbjct  86    ISDESTCSSLSSN-----NKPHKANDVRWEAIQAVRT--KHGVLGLNHFRLLKRLGCGDI  138

Query  1286  GRVFLCRL---RDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHL  1119
             G V L  L   R Y    FA+KV+D+ +L + KKL   QTE EIL  LDHPFLPTLY+H 
Sbjct  139   GTVHLAELHGTRCY----FAMKVMDKGALASRKKLLRAQTEREILQCLDHPFLPTLYSHF  194

Query  1118  EVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLK  939
             E   ++CL+M+FC  GDLH+L ++Q G R S  + +FY AEVL+A+EYLH LGI+YRDLK
Sbjct  195   ETEKFSCLVMEFCPGGDLHTLRQRQPGKRFSEQAAKFYVAEVLLAMEYLHMLGIIYRDLK  254

Query  938   PENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerr---------  786
             PEN+L+R+DGH+MLSDFDL  R  + P +   T V    G R  G+  +           
Sbjct  255   PENVLVRDDGHVMLSDFDLSLRCTVSPTVVRST-VLASEGQRNSGYCAQPACIQQPSCIS  313

Query  785   ---------------------------reETVTEFVAEPTTAFSRSCVGTHEYLAPELIS  687
                                        +   + E +AEPT+A S S VGTHEYLAPE+I 
Sbjct  314   APTTCFSPRFFSSKSKKDKKMKNETGNQVSPLPELIAEPTSARSMSFVGTHEYLAPEIIK  373

Query  686   GNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA  507
             G GHG+ VDWW FG+ +YELLFG TPFKGS   +TL N+   + +RF       E+P ++
Sbjct  374   GEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVS  426

Query  506   -AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
              AA+DLI  LLVK+P+ RL   +GAT++K+HPFF G+ W L+R   PPE
Sbjct  427   FAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCASPPE  475



>ref|XP_010252801.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nelumbo 
nucifera]
 ref|XP_010252802.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nelumbo 
nucifera]
Length=608

 Score =   326 bits (836),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 184/399 (46%), Positives = 239/399 (60%), Gaps = 52/399 (13%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ + S W AI+A    + DG L L H +L + +G G++G V+L  L   +   FA+K
Sbjct  191   KPHKANDSRWEAIQAVR--ARDGVLGLSHFRLLKRLGCGDIGSVYLSELTGTK-CYFAMK  247

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L 
Sbjct  248   VMDKGSLASRKKLLRAQTEREILQCLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTLR  307

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             ++Q G   S  +V+FY AEVL+ALEYLH LGIVYRDLKPEN+L+REDGHIMLSDFDL  R
Sbjct  308   QRQPGKHFSEQAVKFYVAEVLLALEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDLSLR  367

Query  872   ADIFPQL--------ETLTRVPLGSGGRKCGFLGerrreETV------------------  771
               + P L        E   + P+      C      +    V                  
Sbjct  368   CAVSPTLVRSSSLESEPFRKNPMYCVQPACIEPSCIQPSCVVPTTCFSPRLFSSKSKKER  427

Query  770   -------------TEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYE  630
                           E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +YE
Sbjct  428   KPKNEIGNQVSPLPELIAEPTGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYE  487

Query  629   LLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKRL  453
             LLFG TPFKGS   +TL N+   + +RF       E+P ++  A+DLI  LLVK+P+ RL
Sbjct  488   LLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFQARDLIRGLLVKEPQHRL  540

Query  452   GCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
                +GAT+IK+HPFF G+ W LIR   PPE P+ + ++R
Sbjct  541   AYKRGATEIKQHPFFEGVNWALIRCASPPEIPKPVEIER  579



>gb|EMT31913.1| Protein kinase G11A [Aegilops tauschii]
Length=558

 Score =   325 bits (832),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 185/414 (45%), Positives = 245/414 (59%), Gaps = 53/414 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ + S W AI+     S +G L L   +L + +GSG++G V+L  L   + S FA+
Sbjct  139   TKPHKGNDSRWEAIQVVK--SREGVLGLNQFRLLKKLGSGDIGSVYLSELSGTK-SHFAM  195

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  196   KVMDKTSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTL  255

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   S  + +FY AEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIML+DFDL  
Sbjct  256   RQRQPGKHFSEQAAKFYVAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIMLTDFDLSL  315

Query  875   RADIFPQ--------LETLTR-----------------VPLGSGGRK-------------  810
             R  + P         L+ L R                 VP    G +             
Sbjct  316   RCSVSPTVIRGANPGLDALQRNNAAYCVQPACIQPSCVVPTTCFGPRFFSKSKSKSKSKK  375

Query  809   -CGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                      +     E +AEPT A S S VGTHEYLAPE++ G GHG+ VDWW FG+ +Y
Sbjct  376   EKPKPDIVNQVNLFPEMIAEPTDARSMSFVGTHEYLAPEIVKGEGHGSAVDWWTFGIFLY  435

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELLFG TPFKGS   +TL N+   + +RF       E+P ++ +A+D+I  LLVKDP+ R
Sbjct  436   ELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPLVSFSARDMIRGLLVKDPQHR  488

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLK-RSKSKAHVTGVSSP  300
             LG  +GAT+IK+HPFF G+ W LIR   PP+ P+ + L  R K      G  +P
Sbjct  489   LGHKRGATEIKQHPFFEGVNWALIRCASPPDIPKPVELDCRPKQAPAANGKVAP  542



>gb|EMS45607.1| Protein kinase G11A [Triticum urartu]
Length=558

 Score =   324 bits (831),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 185/414 (45%), Positives = 245/414 (59%), Gaps = 53/414 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ + S W AI+     S +G L L   +L + +GSG++G V+L  L   + S FA+
Sbjct  139   TKPHKGNDSRWEAIQVVK--SREGVLGLNQFRLLKKLGSGDIGSVYLSELSGTK-SHFAM  195

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  196   KVMDKTSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTL  255

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   S  + +FY AEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIML+DFDL  
Sbjct  256   RQRQPGKHFSEQAAKFYVAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIMLTDFDLSL  315

Query  875   RADIFPQ--------LETLTR-----------------VPLGSGGRK-------------  810
             R  + P         L+ L R                 VP    G +             
Sbjct  316   RCSVSPTVIRGANPGLDALQRNNAAYCVQPACIQPSCVVPTTCFGPRFFSKSKSKSKSKK  375

Query  809   -CGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                      +     E +AEPT A S S VGTHEYLAPE++ G GHG+ VDWW FG+ +Y
Sbjct  376   EKPKPDIVNQVNLFPEMIAEPTDARSMSFVGTHEYLAPEIVKGEGHGSAVDWWTFGIFLY  435

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELLFG TPFKGS   +TL N+   + +RF       E+P ++ +A+D+I  LLVKDP+ R
Sbjct  436   ELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPLVSFSARDMIRGLLVKDPQHR  488

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLK-RSKSKAHVTGVSSP  300
             LG  +GAT+IK+HPFF G+ W LIR   PP+ P+ + L  R K      G  +P
Sbjct  489   LGHKRGATEIKQHPFFEGVNWALIRCASPPDIPKPVELDCRPKQAPSANGKVAP  542



>ref|XP_009796083.1| PREDICTED: serine/threonine-protein kinase D6PKL1 [Nicotiana 
sylvestris]
Length=704

 Score =   328 bits (842),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 188/401 (47%), Positives = 248/401 (62%), Gaps = 53/401 (13%)
 Frame = -3

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRL---  1263
             SNI    ++PH+ +   W AI   A  + DG L + H +L + +G G++G V+L  L   
Sbjct  277   SNITGSANKPHKGNDPRWKAI--LAIRARDGILGMSHFRLLKRLGCGDIGSVYLSELSGT  334

Query  1262  RDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMD  1086
             R Y    FA+KV+D+ SL + KKL+  QTE EIL +LDHPFLPTLY H E   ++CL+M+
Sbjct  335   RCY----FAMKVMDKASLASRKKLTRAQTEREILQLLDHPFLPTLYTHFETDRFSCLVME  390

Query  1085  FCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGH  906
             +C  GDLH+L ++Q G   S  + RFYAAEVL+ALEYLH LG+VYRDLKPEN+L+R+DGH
Sbjct  391   YCPGGDLHTLRQRQPGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGH  450

Query  905   IMLSDFDLCFRADIFPQL-ETLTRVPLGSGGRKC----------------GFLGerrreE  777
             IMLSDFDL  R  + P L  T +  P   G   C                 FL     ++
Sbjct  451   IMLSDFDLSLRCAVSPTLIRTSSGDPSKKGAAFCVQPACIEPTSVCIQPACFLPRIFNQK  510

Query  776   T-----------------VTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAF  648
             +                 + E VAEPT+A S S VGTHEYLAPE+I G GHG+ VDWW F
Sbjct  511   SKKRSPKPRAETGPPANALPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTF  570

Query  647   GVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVK  471
             G+ ++ELL+G TPFKGS   +TL N+   + +RF       E+PA + A++DLI  LLVK
Sbjct  571   GIFLHELLYGKTPFKGSGNRATLFNVVGQQ-LRF------PESPATSYASRDLIRGLLVK  623

Query  470   DPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGL  351
             +P+ RLG  +GAT+IK+HPFF G+ W LIR   PPE PR +
Sbjct  624   EPQNRLGVKRGATEIKQHPFFEGVNWALIRCSTPPEVPRPI  664



>ref|XP_010092339.1| Protein kinase G11A [Morus notabilis]
 gb|EXB51015.1| Protein kinase G11A [Morus notabilis]
Length=597

 Score =   325 bits (834),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 182/391 (47%), Positives = 236/391 (60%), Gaps = 51/391 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ +   W AI+     S +G L+  H +L + +G G++G V+L  LR  +   FA+
Sbjct  176   NKPHKANDIRWEAIQVVR--SKEGGLNFGHFRLLKKLGCGDIGSVYLSELRGTK-CYFAM  232

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   Y+CL+M+FC  GDLH+L
Sbjct  233   KVMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETEKYSCLVMEFCPGGDLHTL  292

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   +  +V+FY AEVL+ALEYLH LGIVYRDLKPEN+L+R+DGHIMLSDFDL  
Sbjct  293   RQRQPGKHFTEQAVKFYVAEVLLALEYLHMLGIVYRDLKPENVLVRDDGHIMLSDFDLSL  352

Query  875   RADIFPQL--------ETLTRVPLGSGGRKC-------------------GFLGerr---  786
             R  + P L        E L R P+      C                    F   +    
Sbjct  353   RCAVSPTLVKSAAPESEPLRRNPVYCVQPACIEPSCIQPSCVVPTTCFGPRFFSSKSKKD  412

Query  785   ---------reETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                      +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +Y
Sbjct  413   RKPKNEVGNQVTPLPELIAEPTNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLY  472

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELLFG TPFKGS   +TL N+   + +RF       E P ++ +A+DLI  LLVK+P+ R
Sbjct  473   ELLFGKTPFKGSGNRATLFNVVG-QPLRF------PEAPVVSFSARDLIRGLLVKEPQHR  525

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             L   +GAT+IK+HPFF GI W LIR   PPE
Sbjct  526   LAFKRGATEIKQHPFFEGINWALIRCASPPE  556



>ref|XP_008383433.1| PREDICTED: protein kinase PINOID [Malus domestica]
Length=455

 Score =   321 bits (822),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 187/428 (44%), Positives = 247/428 (58%), Gaps = 42/428 (10%)
 Frame = -3

Query  1469  RLSATSTAGNPSSNIP--NLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGS  1296
             RLS  + A   +S++    L  +PHR     +SAI++  T     AL  R   LHR +G+
Sbjct  28    RLSFDAAATTTTSDLAAETLCLKPHRSSDFAYSAIRSKKT-----ALTFRDFHLHRRIGA  82

Query  1295  GNLGRVFLCRLR----------DYEHSD----FALKVIDRDSLTAKKLSH-VQTEAEILS  1161
             G++G V+LC LR          D E S     +A+KV+D+++L  KK     + E +IL 
Sbjct  83    GDIGTVYLCTLRSSDSPSPADQDPESSSSSCLYAMKVVDKEALALKKKEQRAEMERKILK  142

Query  1160  MLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVAL  981
             MLDHPFLPTLYA  E SH++C++M++CS GDLHSL  KQ   R S++S RFYAAEVLVAL
Sbjct  143   MLDHPFLPTLYAEFEASHFSCIVMEYCSGGDLHSLRHKQPHKRFSLNSARFYAAEVLVAL  202

Query  980   EYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLE----------------  849
             EYLH LGI+YRDLKPEN+L+R DGHIMLSDFD    +D  P +E                
Sbjct  203   EYLHMLGIIYRDLKPENVLVRSDGHIMLSDFDXSMCSDAIPAVESPDSAAFSTPSCTRPH  262

Query  848   -TLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHG  672
              T    P      +     + +       FVAEP TA S+S VGTHEY+ PE+ SG  HG
Sbjct  263   QTAALTPFSCLSNRLFRSRKVQTLSPNRLFVAEPVTARSQSFVGTHEYVTPEVASGGSHG  322

Query  671   NGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDL  492
             N VDWWAFG+ +YEL++G TPF   S E+TLRNI   + + F       E      A+DL
Sbjct  323   NAVDWWAFGIFLYELIYGHTPFAAPSNETTLRNIVK-KPLTFPTSTPSSELEGH--ARDL  379

Query  491   IERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTG  312
             I   L KDP +RLG  +GA D+K+HPFF GI   L+R+  PP   GL+ +++ +  +   
Sbjct  380   ISGFLNKDPDQRLGSKRGAADVKKHPFFKGINLALVRSITPPMIPGLIRRQNTTPYYQAK  439

Query  311   VSSPRRRR  288
                 R  R
Sbjct  440   SEDGRNNR  447



>ref|XP_004236648.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Solanum lycopersicum]
 ref|XP_010319220.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Solanum lycopersicum]
Length=607

 Score =   326 bits (835),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 180/400 (45%), Positives = 242/400 (61%), Gaps = 52/400 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ +   W AI+A    S DG+L L H +L + +G G++G V+L  L   +   FA+
Sbjct  185   NKPHKTNDVRWEAIQAVR--SKDGSLGLSHFRLLKRLGCGDIGSVYLAELSGTK-CYFAM  241

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EILS LDHPFLP+LY+H E   ++CL+M+FC  GDLH+L
Sbjct  242   KVMDKASLASRKKLLRAQTEREILSSLDHPFLPSLYSHFETDKFSCLVMEFCPGGDLHTL  301

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   S  +V+FY AEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  302   RQRQPGKHFSEQAVKFYVAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSL  361

Query  875   RADIFPQLETLTRVPLGSGGRKCGFL----------------------------------  798
                  P L   + + L    +  G+                                   
Sbjct  362   CCSFSPTLVKTSSLELEPLKKNSGYCVQPACIEPSCIQPSCVVPTTCFSRRIFSSKSKKD  421

Query  797   -----GerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                      +   + E +AEPT+A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +Y
Sbjct  422   RKPKNDVGNQVRPLPELMAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLY  481

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA+DLI  LL+K+P+ R
Sbjct  482   ELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAARDLIRGLLIKEPQNR  534

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             L   +GAT+IK+HPFF G+ W LIR   PPE P+ +  +R
Sbjct  535   LAYKRGATEIKQHPFFEGVNWALIRCASPPEVPKPVEFER  574



>ref|XP_002307848.1| CsPK1.1 family protein [Populus trichocarpa]
 gb|EEE91371.1| CsPK1.1 family protein [Populus trichocarpa]
Length=501

 Score =   322 bits (826),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 188/422 (45%), Positives = 250/422 (59%), Gaps = 61/422 (14%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ +   W AI+A    + DG L L H +L + +G G++G V+L  L   +   FA+K
Sbjct  81    KPHKANDLRWEAIQAVR--AKDGVLGLSHFRLLKRLGCGDIGSVYLSELSGTK-CYFAMK  137

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CLLM+FC  GDLH+L 
Sbjct  138   VMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETDKFSCLLMEFCPGGDLHTLR  197

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             ++Q G      +V+FY AEVL+ALEYLH LGI+YRDLKPEN+L+R+DGHIMLSDFDL  R
Sbjct  198   QRQPGKHFQEQAVKFYVAEVLLALEYLHMLGIIYRDLKPENVLVRDDGHIMLSDFDLSLR  257

Query  872   ADIFPQL--------ETLTRVPLGSGGRKC------------------------------  807
               + P L        E L + P+      C                              
Sbjct  258   CTVSPTLVKTASLESEPLRKNPVYCVQPACIEPSCIQPSCVAPTTCFGPRLFSSKSKKDR  317

Query  806   ---GFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLM  636
                  LG   +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +
Sbjct  318   KPKNELG--NQVSPLPELMAEPTDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFL  375

Query  635   YELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRK  459
             YELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA+DLI  LLVK+P+ 
Sbjct  376   YELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAARDLIRGLLVKEPQH  428

Query  458   RLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR-----SKSKAHVTGVSSPR  297
             RL   +GAT+IK+HPFF G+ W LIR   PPE P+ + ++R     S S+   T  ++P 
Sbjct  429   RLAYKRGATEIKQHPFFEGVNWALIRCATPPEIPKPVEIERIPGPASTSEKAATVAAAPG  488

Query  296   RR  291
             ++
Sbjct  489   QK  490



>dbj|BAK06792.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=580

 Score =   325 bits (833),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 185/408 (45%), Positives = 239/408 (59%), Gaps = 53/408 (13%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ + S W AI+   T   DG L L H KL + +G G++G V+L  L   + S FA+K
Sbjct  158   KPHKANDSRWEAIQMIRT--RDGILGLSHFKLLKKLGCGDIGSVYLSELTGTK-SYFAMK  214

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ SLT  KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L 
Sbjct  215   VMDKASLTGRKKLLRAQTEKEILQCLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTLR  274

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             +KQ G      +V+FY AE+L+A+EYLH LGI+YRDLKPENIL+R+DGHIMLSDFDL  R
Sbjct  275   QKQRGKYFPEQAVKFYVAEILLAMEYLHMLGIIYRDLKPENILVRDDGHIMLSDFDLSLR  334

Query  872   ADIFPQL----ETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAF-----------  738
               + P L       T     S    C           +      PTT F           
Sbjct  335   CTVSPTLIRSSNPETEALRKSSQAYCAQPVCAEPSCMIQPSCTAPTTCFGPRFFSKSKKD  394

Query  737   -------------------------SRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                                      S S VGTHEYLAPE+I G GHG+ VDWW FG+ +Y
Sbjct  395   RKPKPEVVNQVRPWPELMAEPSDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLY  454

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELLFG TPFKGS   +TL N+   + +RF       E P ++ +A+DLI  LLVK+P++R
Sbjct  455   ELLFGKTPFKGSGNRATLFNVIG-QPLRF------PEYPVVSFSARDLIRGLLVKEPQQR  507

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVT  315
             LGC +GAT+IK+HPFF G+ W LIR   PPE P+ + ++R  +K  V+
Sbjct  508   LGCKRGATEIKQHPFFEGVNWALIRCASPPEVPKPVDIERQTTKLPVS  555



>ref|XP_007159618.1| hypothetical protein PHAVU_002G252500g [Phaseolus vulgaris]
 gb|ESW31612.1| hypothetical protein PHAVU_002G252500g [Phaseolus vulgaris]
Length=475

 Score =   322 bits (824),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 187/408 (46%), Positives = 244/408 (60%), Gaps = 49/408 (12%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD----  1242
             +PHR     +SAI++A T     AL  R   L R +G+G++G V+LCRLR+   +     
Sbjct  56    KPHRSSDFAYSAIRSA-TFRRKAALTFRDFHLLRRIGAGDIGTVYLCRLRNRHFNSPGED  114

Query  1241  --------FALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLM  1089
                     +A+KV+D+D++  KK S   + E +IL MLDHPFLPTLYA  E SH++C++M
Sbjct  115   EEDEACCLYAMKVVDKDAVALKKKSQRAEMERKILKMLDHPFLPTLYAEFEASHFSCIVM  174

Query  1088  DFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDG  909
             +FCS GDLH+L  K   NR  + S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R DG
Sbjct  175   EFCSGGDLHTLRFKHPHNRFPLSSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDG  234

Query  908   HIMLSDFDLCFRADIFPQLETLTRVPLGSGG-------------RKCGFL---------G  795
             HIMLSDFD+   +D  P +E+   + L S               R   F+         G
Sbjct  235   HIMLSDFDISLCSDAIPAVESSDSLHLPSPNPLPYTYTHSHTPPRSHSFISPFSCFSNRG  294

Query  794   errreETVTE----FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYEL  627
              R  +    E    FVAEP +A S S VGTHEY++PE+ SG  HGN VDWW+FGV +YEL
Sbjct  295   FRSHDMRAVEPNLLFVAEPVSARSCSFVGTHEYVSPEVASGKSHGNAVDWWSFGVFIYEL  354

Query  626   LFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDPRKR  456
             ++G TP+ G SKE+TLRNI   + + F        TPA      A+DLI  LL KDP +R
Sbjct  355   IYGRTPYAGPSKEATLRNIVK-KPLAF-----PTATPASCLELHARDLISGLLNKDPARR  408

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTG  312
             LG  +GA D+K+HPFF G+   LIR   PP+  G    ++ S   V G
Sbjct  409   LGSKRGAADVKKHPFFRGLNLALIRMQTPPQVPGSRRTKTTSLYPVKG  456



>ref|XP_004293409.1| PREDICTED: protein kinase G11A-like [Fragaria vesca subsp. vesca]
Length=612

 Score =   326 bits (835),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 186/419 (44%), Positives = 249/419 (59%), Gaps = 57/419 (14%)
 Frame = -3

Query  1466  LSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNL  1287
             +S  ST  + S++I    S+PH+ +   W AI+A    + DG + L H +L + +G G++
Sbjct  172   VSDESTCSSFSTSI----SKPHKANDLRWEAIQAVR--ARDGVMGLGHFRLLKRLGCGDI  225

Query  1286  GRVFLCRLRDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVS  1110
             G V+L  L   +   FA+KV+D++SL + KKL   QTE EIL  LDHPFLPTLY H E  
Sbjct  226   GSVYLSELSGTK-CYFAMKVMDKESLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETD  284

Query  1109  HYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPEN  930
              ++CL+M+FC  GDLH+L ++Q G   S  +V+FY AEVL+++EYLH LGIVYRDLKPEN
Sbjct  285   KFSCLVMEFCPGGDLHTLRQRQPGKHFSEQAVKFYVAEVLLSMEYLHMLGIVYRDLKPEN  344

Query  929   ILIREDGHIMLSDFDLCFRADIFPQL---ETLTRVPLGSGGRKCGFLGerrreETVT---  768
             +L+REDGHIMLSDFDL  R  + P L    ++   PL      C           +    
Sbjct  345   VLVREDGHIMLSDFDLSLRCVVSPTLVKTASMEFEPLRKNSAYCVQPACIEPPSCIQPSC  404

Query  767   ----------------------------------EFVAEPTTAFSRSCVGTHEYLAPELI  690
                                               E +AEPT A S S VGTHEYLAPE+I
Sbjct  405   VAPTTCFSPRLFSSKSKKDKKPKNEIGNQVRPLPELMAEPTDARSMSFVGTHEYLAPEII  464

Query  689   SGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAM  510
              G GHG+ VDWW FG+ +YELLFG TPFKGS   +TL N+   + +RF       E+P +
Sbjct  465   KGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLYNVVG-QPLRF------PESPVV  517

Query  509   A-AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             + AA+DLI  LLVK+P+ RL   +GAT+IK+HPFF G+ W LIR   PPE P+ + ++R
Sbjct  518   SFAARDLIRGLLVKEPQNRLAYKRGATEIKQHPFFEGVNWALIRCATPPEIPKPVEIER  576



>ref|XP_006413161.1| hypothetical protein EUTSA_v10024951mg [Eutrema salsugineum]
 gb|ESQ54614.1| hypothetical protein EUTSA_v10024951mg [Eutrema salsugineum]
Length=512

 Score =   323 bits (827),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 185/419 (44%), Positives = 250/419 (60%), Gaps = 60/419 (14%)
 Frame = -3

Query  1466  LSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNL  1287
             +S  ST  + SSN     ++PH+ +   W AI+   T    G L L H +L + +G G++
Sbjct  86    ISDESTCSSLSSN-----NKPHKANDVRWEAIQVIRT--KHGVLGLNHFRLLKRLGCGDI  138

Query  1286  GRVFLCRL---RDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHL  1119
             G V L  L   R Y    FA+KV+D+ +L + KKL   QTE EIL  LDHPFLPTLY+H 
Sbjct  139   GTVHLAELHGTRCY----FAMKVMDKGALASRKKLLRSQTEREILQCLDHPFLPTLYSHF  194

Query  1118  EVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLK  939
             E   ++CL+M+FC  GDLH+L +KQ G R S  + +FY AEVL+A+EYLH LGI+YRDLK
Sbjct  195   ETEKFSCLVMEFCPGGDLHTLKQKQPGKRFSEQAAKFYVAEVLLAMEYLHMLGIIYRDLK  254

Query  938   PENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerr---------  786
             PEN+L+R+DGH+MLSDFDL  R  + P +   T +   +  R  G+  +           
Sbjct  255   PENVLVRDDGHVMLSDFDLSLRCTVSPTVVRSTSLVSETLQRNSGYCAQPACIQQPSCIS  314

Query  785   ---------------------------reETVTEFVAEPTTAFSRSCVGTHEYLAPELIS  687
                                        +   + E +AEPT+A S S VGTHEYLAPE+I 
Sbjct  315   APTTCFSPRFFSSKSKKDKKMKNETGNQVSPLPELIAEPTSARSMSFVGTHEYLAPEIIK  374

Query  686   GNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA  507
             G GHG+ VDWW FG+ +YELLFG TPFKGS   +TL N+   + +RF       E+P ++
Sbjct  375   GEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVS  427

Query  506   -AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRS  336
              AA+DLI  LLVK+P+ RL   +GAT+IK+HPFF G+ W L+R   PPE P+ + L+ S
Sbjct  428   FAARDLIRSLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCASPPEIPKPVDLESS  486



>emb|CDP05644.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   321 bits (822),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 176/377 (47%), Positives = 233/377 (62%), Gaps = 25/377 (7%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD--FA  1236
             +PHR   S++ A+  +A  S    L  R   L R +GSG++ RV+LCRLR        +A
Sbjct  70    KPHRSSDSSFQALLRSAAFSR--RLSFRDFSLVRQIGSGDISRVYLCRLRGGPERGRLYA  127

Query  1235  LKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             +KV+D + L   KK+   +TE +I+ MLDHPFLPTLYA  E SH++C++M++CS GDLHS
Sbjct  128   MKVVDNEILAMKKKIQRAETERKIMKMLDHPFLPTLYAEFEASHFSCVVMEYCSGGDLHS  187

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             L  KQ   R S+ S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R DGHIML+DFDL 
Sbjct  188   LRHKQPHKRFSISSSRFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIMLTDFDLS  247

Query  878   FRADIFPQLET-----------------LTRVPLGSGGRKCGFLGerrreETVTEFVAEP  750
               +D  P +E+                  T  P      +     + +   T   FVAEP
Sbjct  248   LCSDAIPAVESPDFISDPSSSPSLDSQPRTPTPFSCISNRLFRSRKIQTLSTNRLFVAEP  307

Query  749   TTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNI  570
              +A S S VGTHEY+APE+ SG  HGN VDWWA G+ +YE+++G TPF G S E+TLRNI
Sbjct  308   VSARSCSFVGTHEYVAPEVASGRSHGNAVDWWALGIFIYEMIYGRTPFAGPSNEATLRNI  367

Query  569   ASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWP  390
                + + F  D     + +   A++LI  LL KDP +RLG  +GA D+K HPFF G+ + 
Sbjct  368   VK-KPLAFPTD--APNSLSEYHARNLISGLLNKDPNRRLGSKRGAADVKTHPFFKGLNFA  424

Query  389   LIRTYRPPEPRGLVLKR  339
             LIR+  PP   G+  K+
Sbjct  425   LIRSVTPPGVPGMSGKQ  441



>ref|XP_007026392.1| D6 protein kinase like 2 [Theobroma cacao]
 gb|EOY29014.1| D6 protein kinase like 2 [Theobroma cacao]
Length=614

 Score =   326 bits (835),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 183/402 (46%), Positives = 241/402 (60%), Gaps = 56/402 (14%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ +   W AI+A    + DG L L   +L + +G G++G V+L  L   +   FA+
Sbjct  191   NKPHKANDLRWEAIQAVR--ARDGVLGLSRFRLLKRLGCGDIGSVYLSELSGTK-CYFAM  247

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  248   KVMDKASLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETEKFSCLVMEFCPGGDLHTL  307

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              +KQ G      +V+FY AEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  308   RQKQPGKHFPEQAVKFYVAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSL  367

Query  875   RADIFPQL--------ETLTRVPLGSGGRKC-----------------------------  807
             R  + P L        E L + P+      C                             
Sbjct  368   RCAVSPTLVKTSSLESEPLRKNPVYCVQPACIEPSCIQPSCVAPTTCFSPRLFSSKSKKD  427

Query  806   ----GFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                   +G   +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ 
Sbjct  428   RKPKNEIG--NQVSPLPELIAEPTDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIF  485

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPR  462
             +YELL+G TPFKGS   +TL N+   + +RF       E+P ++ AA+DLI  LLVK+P+
Sbjct  486   LYELLYGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAARDLIRGLLVKEPQ  538

Query  461   KRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
              RL   +GAT+IK+HPFF G+ W LIR   PPE P+ + L+R
Sbjct  539   HRLAYKRGATEIKQHPFFEGVNWALIRCATPPEIPKPVELER  580



>emb|CBI16666.3| unnamed protein product [Vitis vinifera]
Length=617

 Score =   326 bits (835),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 189/404 (47%), Positives = 244/404 (60%), Gaps = 58/404 (14%)
 Frame = -3

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRL---  1263
             SNI    ++PH+ +   W AI   A  + DG L + H +L R +G G++G V+L  L   
Sbjct  183   SNITGSANKPHKGNDPRWKAI--LAIRARDGILGMSHFRLLRRLGCGDIGSVYLSELSGT  240

Query  1262  RDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMD  1086
             R Y    FA+KV+D+ SL + KKL+  QTE EIL +LDHPFLPTLY H E   ++CL+M+
Sbjct  241   RCY----FAMKVMDKASLASRKKLTRAQTEREILQLLDHPFLPTLYTHFETDRFSCLVME  296

Query  1085  FCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGH  906
             FC  GDLH+L ++Q G   S  + RFYAAEVL+ALEYLH LG+VYRDLKPEN+L+R+DGH
Sbjct  297   FCPGGDLHTLRQRQPGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGH  356

Query  905   IMLSDFDLCFRADIFPQLETLTRV-----PLGSGGRKC----------------GFLGer  789
             IMLSDFDL  R  + P L   +         G+GG  C                 F+   
Sbjct  357   IMLSDFDLSLRCAVSPTLIKTSSFDSDPSKRGTGGAFCVQPACIEPSSVCIQPACFIPRI  416

Query  788   ------------------rreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGV  663
                                   T+ E VAEPT A S S VGTHEYLAPE+I G GHG+ V
Sbjct  417   FPQKNSKKKTRRPRAEPGLPASTLPELVAEPTAARSMSFVGTHEYLAPEIIKGEGHGSAV  476

Query  662   DWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIE  486
             DWW FG+ ++ELL+G TPFKGS   +TL N+   + +RF       + PA + A++DLI 
Sbjct  477   DWWTFGIFLHELLYGKTPFKGSGNRATLFNVVGQQ-LRF------PDAPATSYASRDLIR  529

Query  485   RLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PR  357
              LLVK+P+ RLG  +GAT+IK+HPFF G+ W LIR   PPE PR
Sbjct  530   GLLVKEPQHRLGVKRGATEIKQHPFFEGVNWALIRCSTPPEIPR  573



>ref|XP_003577034.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Brachypodium 
distachyon]
Length=567

 Score =   324 bits (831),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 189/419 (45%), Positives = 246/419 (59%), Gaps = 52/419 (12%)
 Frame = -3

Query  1469  RLSATSTAGNPS--SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGS  1296
             R SA S   + S  S+I +  S+PH+ + S W AI+   T   +G+L L H +L + +G 
Sbjct  133   RASAGSDVSDDSTCSSICSSASKPHKSNDSRWEAIQMIRT--KEGSLGLSHFRLLKRLGC  190

Query  1295  GNLGRVFLCRLRDYEHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHL  1119
             G++G V+L  L   +   FA+K++D+ SL   KKL   QTE EIL  LDHPFLPTLY H 
Sbjct  191   GDIGSVYLSELSGSKCC-FAMKIMDKASLAGRKKLLRAQTEREILQCLDHPFLPTLYTHF  249

Query  1118  EVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLK  939
             E   ++CL+M+FC  GDLH+L +KQ G      + +FY AEVL+ALEYLH LGI+YRDLK
Sbjct  250   ETDKFSCLVMEFCPGGDLHTLRQKQPGKYFPEQAAKFYVAEVLLALEYLHMLGIIYRDLK  309

Query  938   PENILIREDGHIMLSDFDLCFRADIFPQLETLTRV---PLGSGGRKCGFLGerrreETVT  768
             PEN+L+REDGHIMLSDFDL  R D+ P L   +     P   G   C      +     T
Sbjct  310   PENVLVREDGHIMLSDFDLSLRCDVNPTLLKSSNPGVDPNQKGNPVCIEPACIQPSCVTT  369

Query  767   ----------------------------------EFVAEPTTAFSRSCVGTHEYLAPELI  690
                                               E VAEPT A S S VGTHEYLAPE+I
Sbjct  370   TTCFSPRLFSSKSKREKKEKKAKADIASQVRPLPELVAEPTDARSMSFVGTHEYLAPEII  429

Query  689   SGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAM  510
              G GHG+ VDWW FG+ +YELLFG TPFKGS   +TL N+   + +RF       E+P +
Sbjct  430   KGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVV  482

Query  509   A-AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
               AA+DLI  LL+K+P+ RL   +GAT+IK+HPFF G+ W LIR   PP+ P+ + + R
Sbjct  483   GFAARDLIRGLLIKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCATPPDIPKPVEIPR  541



>ref|XP_010088105.1| Protein kinase PINOID [Morus notabilis]
 gb|EXB31424.1| Protein kinase PINOID [Morus notabilis]
Length=487

 Score =   322 bits (824),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 187/400 (47%), Positives = 241/400 (60%), Gaps = 47/400 (12%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD----  1242
             +PHR     +SAI++A T      L  R  +L R +GSG++G V+LC LR  +  +    
Sbjct  73    KPHRSSDFAYSAIRSA-TFGRKSGLTFRDFRLIRRIGSGDIGTVYLCCLRSSDDGEEDGD  131

Query  1241  ----FALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
                 +A+KV+D+++L  KK  H  + E +IL MLDHPFLPTLYA  E SH++C++M+FCS
Sbjct  132   CPCFYAMKVVDKENLAVKKKVHRAEMEKKILKMLDHPFLPTLYAEFEASHFSCIVMEFCS  191

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
              GDLHSL  KQ   R S++S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R DGHIML
Sbjct  192   GGDLHSLRHKQPQKRFSLNSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIML  251

Query  896   SDFDLCFRADIFPQLETLTRVPLG------SGGR----------------KC--GFLGer  789
             SDFDL   +D  P +E+    P        S  R                 C    L   
Sbjct  252   SDFDLSLCSDAIPAVESPESSPYAASPSTPSNARPHTTTAPSTSASLTPFSCFPNRLFRS  311

Query  788   rreETVTE----FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLF  621
             RR +T+T     FVAEP  A S S VGTHEY++PE+ SG  HGN VDWWA+G+ +YE+++
Sbjct  312   RRVQTLTANHRLFVAEPVAARSCSFVGTHEYVSPEVASGGSHGNAVDWWAYGIFIYEMIY  371

Query  620   GTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDPRKRLG  450
             G TPF   S E+TL NI     V          TP  A    A+DLI  LL KDP +RLG
Sbjct  372   GRTPFAAQSNEATLLNIVKKPLV------FPNPTPRSALEHHARDLISGLLDKDPTRRLG  425

Query  449   CAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKS  330
               +GA D+K+HPFF G+   LIR+  PP+  GL  +R+ S
Sbjct  426   SKRGAADVKKHPFFKGLNLALIRSSLPPDVPGLRRQRTTS  465



>ref|XP_006350249.1| PREDICTED: protein kinase G11A-like [Solanum tuberosum]
Length=607

 Score =   325 bits (833),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 180/400 (45%), Positives = 242/400 (61%), Gaps = 52/400 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ +   W AI+A    S DG+L L H +L + +G G++G V+L  L   +   FA+
Sbjct  185   NKPHKTNDVRWEAIQAVR--SKDGSLGLSHFRLLKRLGCGDIGSVYLAELSGTK-CYFAM  241

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EILS LDHPFLP+LY+H E   ++CL+M+FC  GDLH+L
Sbjct  242   KVMDKASLASRKKLLRAQTEREILSSLDHPFLPSLYSHFETDKFSCLVMEFCPGGDLHTL  301

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   S  +V+FY AEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  302   RQRQPGKHFSEQAVKFYVAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSL  361

Query  875   RADIFPQLETLTRVPLGSGGRKCGFL----------------------------------  798
                  P L   + + L    +  G+                                   
Sbjct  362   CCSFSPTLVKTSSLELEPLRKNSGYCVQPACIEPSCIQPSCVVPTTCFSRRIFSSKSKKD  421

Query  797   -----GerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                      +   + E +AEPT+A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +Y
Sbjct  422   RKPKNDVGNQVRPLPELMAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLY  481

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA+DLI  LL+K+P+ R
Sbjct  482   ELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAARDLIRGLLIKEPQNR  534

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             L   +GAT+IK+HPFF G+ W LIR   PPE P+ +  +R
Sbjct  535   LAYKRGATEIKQHPFFEGVNWALIRCASPPEVPKPVEFER  574



>emb|CBI34860.3| unnamed protein product [Vitis vinifera]
Length=556

 Score =   323 bits (829),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 224/351 (64%), Gaps = 46/351 (13%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ + + W AI+A    S DG L L H +L + +G G++G V+L  L     S FA+K
Sbjct  222   KPHKANDTRWEAIQAVR--SRDGVLGLNHFRLLKKLGCGDIGTVYLSEL-SCTRSYFAMK  278

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ +L + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L 
Sbjct  279   VMDKGALASRKKLLRAQTEREILQSLDHPFLPTLYTHFETEKFSCLVMEFCPGGDLHALR  338

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             ++Q G   S  + RFY AEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIMLSDFDL  R
Sbjct  339   QRQPGKYFSEHAARFYVAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSLR  398

Query  872   ADIFPQLETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPEL  693
               +                                  +AEPTTA S S VGTHEYLAPE+
Sbjct  399   CAL----------------------------------IAEPTTARSMSFVGTHEYLAPEI  424

Query  692   ISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPA  513
             I G GHG+ VDWW FG+ +YELLFG TPFKG+   +TL N+   + +RF       E+PA
Sbjct  425   IKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNVVG-QPLRF------PESPA  477

Query  512   MA-AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             ++ AA+DLI  LLVK+P+ RL   +GAT++K+HPFF  + W LIR   PP+
Sbjct  478   VSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCTNPPD  528



>ref|XP_009143752.1| PREDICTED: protein kinase PINOID [Brassica rapa]
Length=439

 Score =   320 bits (819),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 224/355 (63%), Gaps = 28/355 (8%)
 Frame = -3

Query  1304  VGSGNLGRVFLCRLRDYEH----SDFALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFL  1140
             +G+G++G V+LCRL   E     S FA+KV+D+++L  KK  H  + E +IL MLDHPFL
Sbjct  84    IGAGDIGTVYLCRLAGEEEESRRSYFAMKVVDKEALALKKKMHRAEMEKKILKMLDHPFL  143

Query  1139  PTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLG  960
             PTLYA  E SH++C++M++CS GDLHSL  +Q   R S+ S RFYAAEVLVALEYLH LG
Sbjct  144   PTLYAEFEASHFSCIVMEYCSGGDLHSLRHRQPDGRFSLSSARFYAAEVLVALEYLHMLG  203

Query  959   IVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLG---SGGRKCGFLGer  789
             I+YRDLKPENIL+R DGHIMLSDFDL   +D    +E+ +  P     S  R+   L + 
Sbjct  204   IIYRDLKPENILVRSDGHIMLSDFDLSLCSDSIAAVESSSSSPENQPRSSPRRLTRLAKL  263

Query  788   rreETVTE----------FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                   ++          FVAEP TA S S VGTHEY+APE+ SG  HGN VDW AFGV 
Sbjct  264   FHRVLRSKKVQTLEPNRLFVAEPVTARSGSFVGTHEYVAPEVASGGSHGNAVDWRAFGVF  323

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA---AAKDLIERLLVKD  468
             +YE+++G TPF   + +  LRNI   R + F  D     TPA      A+ LI  LL KD
Sbjct  324   LYEIIYGRTPFAAPTNDVILRNIVK-RQLTFPTD-----TPATMFELHARSLISGLLNKD  377

Query  467   PRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSS  303
             P KRLG  +GA ++K HPFF G+ + LIRT  PPE    V +R K  A  +G SS
Sbjct  378   PTKRLGSRRGAAEVKVHPFFKGLNFALIRTLTPPEIPSDV-RRPKKAATFSGRSS  431



>ref|XP_009399199.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Musa 
acuminata subsp. malaccensis]
Length=604

 Score =   325 bits (832),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 178/392 (45%), Positives = 234/392 (60%), Gaps = 49/392 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ +   W AI+A      DG L + H +    +G+G++G V+L +L       FA+
Sbjct  185   NKPHQANDGRWDAIRAVR--ERDGYLGMNHFRFLDRLGNGDVGCVYLAKLTGTRFL-FAM  241

Query  1232  KVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+  L   KKLS  QTE EIL  LDHPFLPTLYAH E ++++CL+M+FC  GDLHSL
Sbjct  242   KVMDKAVLAWRKKLSRSQTEREILQCLDHPFLPTLYAHFETNNFSCLVMEFCPGGDLHSL  301

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   + ++ RFY AEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  302   QQRQPGKCFTEEAARFYVAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSL  361

Query  875   RADIFPQLETLTRVPLGSGGRKCGFLGerrreET--------------------------  774
             R  +FP L   T+  L S      +      E T                          
Sbjct  362   RCAVFPTLVKSTKTDLCSSKSSGKYAQPSCVEPTCMQHSCLQPTCFSPRFIGLGRPKAKK  421

Query  773   ------------VTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYE  630
                         + E +AEP+ A S+S VGTHEYLAPE+I G GHG+ VDWW  G+  YE
Sbjct  422   AIPSEVGDSGSVLPELIAEPSNAHSKSFVGTHEYLAPEIIKGEGHGSAVDWWTLGIFFYE  481

Query  629   LLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLG  450
             LLFG TPFKGS   +TL N+ +   ++F         P   AA+DLI+ LLVK+P++R  
Sbjct  482   LLFGKTPFKGSGNRATLFNVVA-EPLKF-----PESPPVSFAARDLIKGLLVKEPQQRFA  535

Query  449   CAKGATDIKRHPFFNGIKWPLIRTYRPPE-PR  357
             C +GA ++K+HPFF+ I W LIR   PPE PR
Sbjct  536   CRRGAAEVKQHPFFHSINWALIRCTSPPEVPR  567



>emb|CDX74691.1| BnaA05g04370D [Brassica napus]
Length=557

 Score =   323 bits (828),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 188/421 (45%), Positives = 248/421 (59%), Gaps = 53/421 (13%)
 Frame = -3

Query  1478  FNERLSATSTAGNPSS--NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrL  1305
             F  R S +S     SS  N     ++PH+ +   W+AI A  T   DG L + H KL + 
Sbjct  113   FESRASDSSCLSEESSWSNFTGSLNKPHKGNDPRWNAILAVRT--RDGVLGMSHFKLLKR  170

Query  1304  VGSGNLGRVFLCRLRDYEHSDFALKVIDRDSL-TAKKLSHVQTEAEILSMLDHPFLPTLY  1128
             +G G++G V+L  L       FA+KV+D+ SL   KKL+  QTE EIL +LDHPFLPTLY
Sbjct  171   LGCGDIGSVYLAELSG-TRCHFAVKVMDKASLENRKKLNRAQTEREILQLLDHPFLPTLY  229

Query  1127  AHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYR  948
              H E   ++CL+M++C  GDLH+L ++Q G   S  + RFYAAEVL+ALEYLH LG+VYR
Sbjct  230   THFETDRFSCLVMEYCPGGDLHTLRQRQPGKHFSEYAARFYAAEVLLALEYLHMLGVVYR  289

Query  947   DLKPENILIREDGHIMLSDFDLCFRADIFPQL-ETLTRVPLGSGG---------------  816
             DLKPEN+L+R+DGHIMLSDFDL  R  + P L +T    P   G                
Sbjct  290   DLKPENVLVRDDGHIMLSDFDLSLRCAVSPTLIKTFDSDPSKRGAFCVQPACIEPTSSCI  349

Query  815   ---------------------RKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAP  699
                                   +  F        ++ E VAEP T  S S VGTHEYLAP
Sbjct  350   IQPSCFLPRRIFPTKKNKTRKTQTDFFKSHHSGGSLPELVAEPNTR-SMSFVGTHEYLAP  408

Query  698   ELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERET  519
             E+I G GHG+ VDWW FG+ ++ELL+G TPFKGS   +TL N+   + ++F       E+
Sbjct  409   EIIKGEGHGSAVDWWTFGIFVHELLYGKTPFKGSGNRATLFNVVGEQ-LKF------PES  461

Query  518   PAMA-AAKDLIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVL  345
             PA + A +DL++ LLVKDP+ RLG  +GAT+IK+HPFF G+ W LIR   PPE PR + +
Sbjct  462   PATSYAGRDLVQALLVKDPKSRLGTKRGATEIKQHPFFEGVNWALIRCSTPPEVPRQMEV  521

Query  344   K  342
             +
Sbjct  522   E  522



>ref|XP_009377468.1| PREDICTED: protein kinase PINOID-like [Pyrus x bretschneideri]
Length=445

 Score =   320 bits (819),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 182/400 (46%), Positives = 239/400 (60%), Gaps = 38/400 (10%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLR----------  1260
             +PHR     +SAI++  T     AL  R   LHR +G+G++G V+LC LR          
Sbjct  50    KPHRSSDFAYSAIRSKKT-----ALTFRDFHLHRRIGAGDIGTVYLCTLRSSDSPSPADQ  104

Query  1259  DYEHSD----FALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYAHLEVSHYTCL  1095
             D E S     +A+KV+D+++L  KK     + E +IL MLDHPFLPTLYA  E SH++C+
Sbjct  105   DPESSSSSCLYAMKVVDKEALALKKKEQRAEMERKILKMLDHPFLPTLYAEFEASHFSCI  164

Query  1094  LMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIRE  915
             +M++CS GDLHSL  KQ   R S++S RFYA EVLVALEYLH LGI+YRDLKPEN+L+R 
Sbjct  165   VMEYCSGGDLHSLRHKQPHKRFSLNSARFYATEVLVALEYLHMLGIIYRDLKPENVLVRS  224

Query  914   DGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerrreETVTEFV--------  759
             DGHIMLSDFDL   +D  P +E+    P  S            +   +T F         
Sbjct  225   DGHIMLSDFDLSMCSDAIPAVESPDSYP-DSAAFSTPSRTRPHQTVALTPFSCLSNRLFG  283

Query  758   AEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFGTTPFKGSSKESTL  579
             AEP  A S+S VGTHEY+ PE+ SG  HGN VDWWAFG+ +YEL++G TPF   S E+TL
Sbjct  284   AEPVAARSQSFVGTHEYVTPEVASGRSHGNAVDWWAFGIFLYELVYGRTPFAAPSNETTL  343

Query  578   RNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDPRKRLGCAKGATDIKRHPFF  408
             RNI   + + F        TP+ A    A+DLI   L KDP +RLG  +GA D+K+HPFF
Sbjct  344   RNIVK-KPLTF-----PTSTPSSALEGHARDLISGFLNKDPDRRLGSKRGAADVKKHPFF  397

Query  407   NGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSSPRRRR  288
              GI   L+R+  PP   GL+ +++ +  +       R  R
Sbjct  398   KGINLALVRSIAPPMIPGLIRRQNTTPYYQAKSEDGRNNR  437



>ref|XP_004504155.1| PREDICTED: protein kinase PINOID-like [Cicer arietinum]
Length=460

 Score =   320 bits (820),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 241/403 (60%), Gaps = 42/403 (10%)
 Frame = -3

Query  1469  RLSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGN  1290
             RLS      +P S    L  +PHR     +SAI++A T     AL  R   L R +G+G+
Sbjct  37    RLSFDLLPASPES----LSIKPHRSSDYAYSAIRSA-TFRRKSALTFRDFNLIRRIGAGD  91

Query  1289  LGRVFLCRLR--------DYEHSDFALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLP  1137
             +G V+LCRLR        + E + +A+KV+D+D++  KK +   + E +IL M+DHPFLP
Sbjct  92    IGTVYLCRLRNGNEQFESEEEDALYAMKVVDKDAVALKKKTQRAEMERKILKMIDHPFLP  151

Query  1136  TLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGI  957
             TLYA  E SH++C++M+FCS GD+HSL  K   NRL +   RFYAAEVLVALEYLH LGI
Sbjct  152   TLYAEFEASHFSCIVMEFCSGGDIHSLRHKHPHNRLPLSHARFYAAEVLVALEYLHMLGI  211

Query  956   VYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLET--------------LTR-----V  834
             +YRDLKPEN+L+R DGHIMLSDFDL   +D  P +E+               TR      
Sbjct  212   IYRDLKPENVLVRSDGHIMLSDFDLSLCSDAIPAVESSDCLQDSAFQSALPYTRSRSFPT  271

Query  833   PLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWW  654
             P      +     + +  +    FVAEP +A S S VGTHEY++PE+ +GN HGN VDWW
Sbjct  272   PFTCFSNRFFRSRKVQTIQPNRLFVAEPVSARSCSFVGTHEYVSPEVAAGNSHGNAVDWW  331

Query  653   AFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAA---AKDLIER  483
             +FG+ +YEL++G TPF   S + TLRNI     + F        TP+      A+DLI  
Sbjct  332   SFGIFIYELIYGRTPFAAPSNKDTLRNILKN-PLSF-----PTATPSSTLELHARDLISG  385

Query  482   LLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRG  354
             LL KDP +RLG  +GA D+K+HPFF GI   LIR   PPE  G
Sbjct  386   LLNKDPAQRLGSKRGAADVKKHPFFKGINLALIRMLTPPEVPG  428



>ref|XP_006380864.1| hypothetical protein POPTR_0006s00570g [Populus trichocarpa]
 gb|ERP58661.1| hypothetical protein POPTR_0006s00570g [Populus trichocarpa]
Length=611

 Score =   325 bits (832),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 188/422 (45%), Positives = 250/422 (59%), Gaps = 61/422 (14%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ +   W AI+A    + DG L L H +L + +G G++G V+L  L   +   FA+K
Sbjct  191   KPHKANDLRWEAIQAVR--AKDGVLGLSHFRLLKRLGCGDIGSVYLSELSGTK-CYFAMK  247

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CLLM+FC  GDLH+L 
Sbjct  248   VMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETDKFSCLLMEFCPGGDLHTLR  307

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             ++Q G      +V+FY AEVL+ALEYLH LGI+YRDLKPEN+L+R+DGHIMLSDFDL  R
Sbjct  308   QRQPGKHFQEQAVKFYVAEVLLALEYLHMLGIIYRDLKPENVLVRDDGHIMLSDFDLSLR  367

Query  872   ADIFPQL--------ETLTRVPLGSGGRKC------------------------------  807
               + P L        E L + P+      C                              
Sbjct  368   CTVSPTLVKTASLESEPLRKNPVYCVQPACIEPSCIQPSCVAPTTCFGPRLFSSKSKKDR  427

Query  806   ---GFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLM  636
                  LG   +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +
Sbjct  428   KPKNELG--NQVSPLPELMAEPTDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFL  485

Query  635   YELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRK  459
             YELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA+DLI  LLVK+P+ 
Sbjct  486   YELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAARDLIRGLLVKEPQH  538

Query  458   RLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR-----SKSKAHVTGVSSPR  297
             RL   +GAT+IK+HPFF G+ W LIR   PPE P+ + ++R     S S+   T  ++P 
Sbjct  539   RLAYKRGATEIKQHPFFEGVNWALIRCATPPEIPKPVEIERIPGPASTSEKAATVAAAPG  598

Query  296   RR  291
             ++
Sbjct  599   QK  600



>ref|NP_001151806.1| LOC100285441 [Zea mays]
 ref|XP_008662056.1| PREDICTED: LOC100285441 isoform X1 [Zea mays]
 ref|XP_008662057.1| PREDICTED: LOC100285441 isoform X1 [Zea mays]
 gb|ACG44362.1| protein kinase G11A [Zea mays]
 gb|ACN25761.1| unknown [Zea mays]
 gb|AFW59048.1| putative protein kinase superfamily protein isoform 1 [Zea mays]
 gb|AFW59049.1| putative protein kinase superfamily protein isoform 2 [Zea mays]
Length=685

 Score =   327 bits (837),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 184/394 (47%), Positives = 245/394 (62%), Gaps = 55/394 (14%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRL---RDYEHSD  1242
             S+PH+ +   W AI A  T   D  L + H +L + +G G++G V+L  L   R Y    
Sbjct  265   SKPHKGNDPRWKAIHAVRT--RDSVLGMSHFRLLKRLGCGDIGSVYLSELSGTRCY----  318

Query  1241  FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             FA+KV+D+ SL + KKL+  QTE EIL +LDHPFLPTLY H E   ++CL+M+FC  GDL
Sbjct  319   FAMKVMDKASLASRKKLNRAQTEREILQLLDHPFLPTLYTHFETDRFSCLVMEFCPGGDL  378

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             H+L ++Q G   S  + RFYAAEVL+ALEYLH LG+VYRDLKPEN+L+R+DGHIMLSDFD
Sbjct  379   HTLRQRQPGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGHIMLSDFD  438

Query  884   LCFRADIFPQL---ETLTRVPLGSGGRKC--------------------GFLGerrreE-  777
             L  R  + P L         P  +GG  C                     F G++ +++ 
Sbjct  439   LSLRCAVSPTLIRTSAFDSDPRRAGGSFCVQPACIEPTSACIQPACFLPKFFGQKSKKKT  498

Query  776   ------------TVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                         T+ E VAEPT+A S S VGTHEYLAPE+I G GHG+ VDWW FG+ ++
Sbjct  499   RKARSELGHNAGTLPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLH  558

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELL+G TPFKGS   +TL N+   + ++F       E+P+ + +++DLI  LLVK+P+ R
Sbjct  559   ELLYGKTPFKGSGNRATLFNVVGQQ-LKF------PESPSTSYSSRDLIRGLLVKEPQSR  611

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PR  357
             LG  +GAT+IK+H FF G+ W LIR   PPE PR
Sbjct  612   LGVKRGATEIKQHAFFEGVNWALIRCSTPPEVPR  645



>ref|XP_009625904.1| PREDICTED: serine/threonine-protein kinase D6PK-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009625905.1| PREDICTED: serine/threonine-protein kinase D6PK-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009625906.1| PREDICTED: serine/threonine-protein kinase D6PK-like isoform 
X2 [Nicotiana tomentosiformis]
Length=589

 Score =   324 bits (830),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 182/402 (45%), Positives = 242/402 (60%), Gaps = 58/402 (14%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFL---CRLRDYEHSDF  1239
             +PH+ + S W AI++    + +G L LRH +L + +GSG++G V+L   C  + Y    F
Sbjct  169   KPHKANDSRWEAIQS--IRAKNGGLDLRHFRLLKKLGSGDIGSVYLSELCGTKCY----F  222

Query  1238  ALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLH  1062
             A+KV+D+ SL   KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH
Sbjct  223   AMKVMDKASLAGRKKLLRAQTEREILQSLDHPFLPTLYTHFETEKFSCLVMEFCPGGDLH  282

Query  1061  SLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDL  882
             +L ++Q G   S  +V+FY AE+L++LEYLH LGIVYRDLKPEN+L+REDGHIMLSDFDL
Sbjct  283   TLRQRQPGKHFSEQAVKFYVAEILLSLEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDL  342

Query  881   CFRADIFPQLETLTRVPLGSGGRKCGFL--------------------------------  798
               R  + P L  L+ +      +  G+                                 
Sbjct  343   SLRCAVSPTLVKLSSLDAEPLRKNSGYCVQPSCIEPSCIQPSCAVPTTCFGPRFFSSKSK  402

Query  797   -------GerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                        +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ 
Sbjct  403   KEKKSKNDTGNQVSPLPELMAEPTGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIF  462

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPR  462
             +YELLFG TPFKGS   +TL N+   + +RF       E+P ++ +A+DLI  LLVK+P+
Sbjct  463   LYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFSARDLIRGLLVKEPQ  515

Query  461   KRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
              RL   +GAT+IK+HPFF G+ W LIR   PPE PR +  +R
Sbjct  516   HRLAYKRGATEIKQHPFFEGVNWALIRCASPPEIPRPVEFER  557



>ref|XP_009399531.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399532.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399533.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399534.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
Length=604

 Score =   324 bits (831),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 187/419 (45%), Positives = 250/419 (60%), Gaps = 53/419 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ + S W AIK     S DG L L H +L + +G G++G V+L  L   + S FA+
Sbjct  186   TKPHKTNDSRWEAIKMIR--SRDGVLGLTHFRLLKKLGCGDIGSVYLSELSGTK-SFFAM  242

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             K++D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  243   KLMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTL  302

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   S  +V+FY AE+L+ALEYLH LGI+YRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  303   RQRQPGKHFSEQAVKFYVAEILLALEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSL  362

Query  875   RADIFPQL--------ETLTR-----------------VPLGSGGRKC---GFLGerrre  780
             R  + P L        E+  R                  P       C    F    +  
Sbjct  363   RCTVRPTLIKSSNPDSESFRRNNPTYCVQPACIEPSCIQPSCVAPTTCFGPRFFSISKDR  422

Query  779   ETVTE----------FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYE  630
             ++  E           +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ MYE
Sbjct  423   KSKPEIGNQVRPLPELIAEPTDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFMYE  482

Query  629   LLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKRL  453
             LLFG TPFKGS   +TL N+   + +RF       E+P ++ AA++LI  LLVK+P+ R 
Sbjct  483   LLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPTVSFAARELIRGLLVKEPQHRF  535

Query  452   GCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTG--VSSPRRRRC  285
                +GA++IK+HPFF G+ W LIR   PPE P+ + ++R       TG  V++   ++C
Sbjct  536   AYKRGASEIKQHPFFEGVNWALIRCASPPEIPKSIDIERLSKPTVSTGEKVAATANQKC  594



>ref|XP_002530422.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF31953.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=612

 Score =   324 bits (831),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 184/401 (46%), Positives = 241/401 (60%), Gaps = 56/401 (14%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ +   W AI+A    + DG L L H +L + +G G++G V+L  L   +   FA+K
Sbjct  192   KPHKANDLRWEAIQAVR--AKDGVLGLSHFRLLKRLGCGDIGSVYLSELSGTK-CYFAMK  248

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L 
Sbjct  249   VMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTLR  308

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             ++Q G      +V+FY AEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIMLSDFDL  R
Sbjct  309   QRQPGKHFPEQAVKFYIAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSLR  368

Query  872   ADIFPQL--------ETLTRVPLGSGGRKC------------------------------  807
               + P L        E L + P+      C                              
Sbjct  369   CAVSPTLVKTSSLESEPLRKNPVYCVQPACIEPSCIQPSCVAPTTCFSPRLFSSKSKKDR  428

Query  806   ---GFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLM  636
                  LG   +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +
Sbjct  429   KPKSELG--NQVSPLPELIAEPTDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFL  486

Query  635   YELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRK  459
             YELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA+DLI  LLVK+P+ 
Sbjct  487   YELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAARDLIRGLLVKEPQH  539

Query  458   RLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             RL   +GAT+IK+HPFF G+ W LIR   PPE P+ + ++R
Sbjct  540   RLAYKRGATEIKQHPFFEGVNWALIRCATPPEIPKPVEVER  580



>ref|XP_008358790.1| PREDICTED: protein kinase G11A-like [Malus domestica]
 ref|XP_008358791.1| PREDICTED: protein kinase G11A-like [Malus domestica]
 ref|XP_008358793.1| PREDICTED: protein kinase G11A-like [Malus domestica]
Length=607

 Score =   324 bits (830),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 193/439 (44%), Positives = 256/439 (58%), Gaps = 57/439 (13%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFALK  1230
             +PH+ +   W AI+A  T   DGAL L H +L + +G G++G V+L  L   +   FA+K
Sbjct  181   KPHKANDLRWEAIQAVRT--RDGALGLGHFRLLKRLGCGDIGSVYLSELSGTK-CYFAMK  237

Query  1229  VIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSLL  1053
             V+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+ +FC  GDLH+L 
Sbjct  238   VMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETDKFSCLVXEFCPGGDLHTLR  297

Query  1052  RKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFR  873
             ++Q G   S  +V+FY AEVL++LEYLH LGIVYRDLKPEN+L+REDGHIMLSDFDL  R
Sbjct  298   QRQPGKHFSEQAVKFYVAEVLLSLEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDLSLR  357

Query  872   ADIFPQL--------ETLTRVPLGSGGRKCGFLGerrreETVT-----------------  768
               + P L        E L + P+      C       +   V                  
Sbjct  358   CAVSPTLVKTXSMEFEPLRKNPVYCVQPACIEPPSCIQPSCVAPTTCFGPRLFSSKSKKD  417

Query  767   ---------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                            E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +Y
Sbjct  418   KKSKNEIGNQVRPLPELIAEPTDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLY  477

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELLFG TPFKGS   +TL N+   + +RF       E+P ++ AA+DLI  LLVK+P+ R
Sbjct  478   ELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAARDLIRGLLVKEPQHR  530

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRRRRCWW  279
             L   +GAT+IK+HPFF G+ W LIR   PP+ P+ + ++R  +    T  SS + +    
Sbjct  531   LAYKRGATEIKQHPFFEGVNWALIRCATPPDIPKPVEIERIPAP---TASSSEKEKAPPT  587

Query  278   KRLGHLVRIKGSKHNLNFN  222
               +   V+ KGS + L F+
Sbjct  588   PTIASPVQ-KGSDNYLEFD  605



>emb|CDP13698.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   324 bits (830),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 187/412 (45%), Positives = 244/412 (59%), Gaps = 58/412 (14%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFL---CRLRDYEHSD  1242
             ++PH+ + S W AI+A    S +G L LRH +L + +G G++G V+L   C  + Y    
Sbjct  186   NKPHKANDSRWEAIQAVR--SKEGVLDLRHFRLLKKLGCGDIGSVYLSELCGTKCY----  239

Query  1241  FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             FA+KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDL
Sbjct  240   FAMKVMDKASLASRKKLLRAQTEREILQCLDHPFLPTLYTHFETEKFSCLVMEFCPGGDL  299

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             H+L ++Q G      +V+FY AEVL+ALEYLH LGIVYRDLKPEN+L+REDGHIMLSDFD
Sbjct  300   HTLRQRQPGKHFPEQAVKFYVAEVLLALEYLHMLGIVYRDLKPENVLVREDGHIMLSDFD  359

Query  884   LCFRADIFPQL--------ETLTRVPLGSGGRKCGFLGerrreETV--------------  771
             L  R  + P L        E L + P+      C      +    V              
Sbjct  360   LSLRCAVSPTLVKSSSLETEPLRKNPVYCVQPACIEPSCIQPSCVVPTTCFTPRIFSSKS  419

Query  770   -----------------TEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGV  642
                               E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+
Sbjct  420   KKERKPKNEIGNQVSPLPELIAEPTGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGI  479

Query  641   LMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDP  465
              +YELLFG TPFKGS   +TL N+   + +RF       E+P ++ +++DLI  LLVK+P
Sbjct  480   FLYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFSSRDLIRGLLVKEP  532

Query  464   RKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTG  312
             + RL   +GAT+IK+HPFF G+ W LIR   PPE PR   +++       TG
Sbjct  533   QHRLAYKRGATEIKQHPFFEGVNWALIRCASPPEIPRPFEIEKIPVPTASTG  584



>ref|XP_007133463.1| hypothetical protein PHAVU_011G1806000g, partial [Phaseolus vulgaris]
 gb|ESW05457.1| hypothetical protein PHAVU_011G1806000g, partial [Phaseolus vulgaris]
Length=488

 Score =   320 bits (821),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 186/443 (42%), Positives = 259/443 (58%), Gaps = 54/443 (12%)
 Frame = -3

Query  1463  SATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLG  1284
             S TS++     +I N H +PH +    W AI   A       L+L H +L + VG G++G
Sbjct  53    SGTSSSCESLESICNAHIKPHTRGDVRWDAINMVA---KGNDLNLSHFRLLKRVGYGDIG  109

Query  1283  RVFLCRLRDYEHSDFALKVIDRDSLTAK-KLSHVQTEAEILSMLDHPFLPTLYAHLEVSH  1107
              V+L  L++ + + FA+KV+D++SL ++ KL   QTE EIL +LDHPFLPTLY++ E + 
Sbjct  110   SVYLVELKESK-AFFAMKVMDKESLASRNKLLRAQTEREILGLLDHPFLPTLYSYFETTK  168

Query  1106  YTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENI  927
             Y CL+M+FCS+G LHSL  KQ     + ++ RFY +E+L+ALEYLH LGIVYRDLKPEN+
Sbjct  169   YYCLVMEFCSSGSLHSLRLKQPNKHFTEEATRFYCSEILLALEYLHMLGIVYRDLKPENV  228

Query  926   LIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGFLGerrreE----------  777
             L+R++GHIMLSDFDL  R  + P L   +     S G   G L + +             
Sbjct  229   LVRDEGHIMLSDFDLSLRCSVNPTLVKSSSAHESSNGPSGGILNDEQAIHGCKQPSSFFP  288

Query  776   ---------------------TVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVD  660
                                   + E +AEPT   S S VGTHEYLAPE+I G GHG+ VD
Sbjct  289   RILPSKKNHKSKSDFGLMVGGCLPELMAEPTNVRSMSFVGTHEYLAPEIIRGEGHGSAVD  348

Query  659   WWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIER  483
             WW FG+ +YELL G TPFKG+  ++TL N+   + +RF       E P+++  AKDLI+ 
Sbjct  349   WWTFGIFLYELLHGITPFKGAGNKATLFNVVG-QPLRF------PEKPSVSKVAKDLIQG  401

Query  482   LLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPP-EPRGLVLKRSKSKAHVTGVS  306
             LLVK+P+KR    +GAT+IK+HPFF+G+ W L+R+  PP  P  L   +   KA  + + 
Sbjct  402   LLVKEPQKRYAYKRGATEIKQHPFFHGVNWALVRSATPPIIPEPLDFSKYSRKAKYSPMD  461

Query  305   SPRRRRCWWKRLGHLVRIKGSKH  237
                      K++  +V    SKH
Sbjct  462   ---------KKIADIVASDKSKH  475



>ref|XP_003594321.1| Protein kinase [Medicago truncatula]
 gb|AES64572.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=604

 Score =   324 bits (830),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 188/440 (43%), Positives = 249/440 (57%), Gaps = 58/440 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ +   W AI+   T   DGAL L H +L + +G G++G V+L  L   +   FA+
Sbjct  178   NKPHKANDMRWEAIQVVRT--RDGALGLGHFRLLKRLGCGDIGSVYLSELSGTK-CYFAM  234

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  235   KVMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETEKFSCLVMEFCPGGDLHTL  294

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              +KQ G      +V+FY AEVL+A+EYLH LGIVYRDLKPEN+L+R+DGHIMLSDFDL  
Sbjct  295   RQKQPGKHFPEQAVKFYVAEVLLAMEYLHMLGIVYRDLKPENVLVRDDGHIMLSDFDLSL  354

Query  875   RADIFPQL---ETLTRVPLGSGGRKCGFLGerrreETVT---------------------  768
             R  + P L    ++   PL      C           +                      
Sbjct  355   RCAVSPTLVKSSSIDSEPLRKNTGYCAQPACIEPPSCIQPSCVAPTSCFSPRLFSSKSKK  414

Query  767   ----------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLM  636
                             E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW +G+ +
Sbjct  415   ERKAKTELGNQVSPLPELIAEPTDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTYGIFL  474

Query  635   YELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRK  459
             YELLFG TPFKGS   +TL N+   + +RF       E P ++ AA+DLI  LLVK+P+ 
Sbjct  475   YELLFGKTPFKGSGNRATLFNVVG-QPLRF------PEAPVVSFAARDLIRGLLVKEPQH  527

Query  458   RLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRRRRCW  282
             RL   +GAT+IK+HPFF G+ W LIR   PPE P+ +  ++  S A     +S    +  
Sbjct  528   RLAYKRGATEIKQHPFFEGVNWALIRCATPPEIPKAVEFEKIPSPA-----ASSAGEKAV  582

Query  281   WKRLGHLVRIKGSKHNLNFN  222
                +      KGS + L F+
Sbjct  583   VNHMSTAPNQKGSDNYLEFD  602



>ref|XP_001781978.1| predicted protein [Physcomitrella patens]
 gb|EDQ53202.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   318 bits (814),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 187/392 (48%), Positives = 239/392 (61%), Gaps = 48/392 (12%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             S+PH+ +   W  I+A      DGAL L H KL + +G G++G V+L  LR   HS FA+
Sbjct  33    SKPHKANDKRWEGIQAIRV--RDGALGLSHFKLLKRLGCGDIGSVYLAELRG-SHSHFAM  89

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   + CL+M+FCS GDLH+L
Sbjct  90    KVMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFESEKFLCLVMEFCSGGDLHTL  149

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   +  + RFYAAEVL+ALEYLH +G+VYRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  150   RQRQPGKHFTEQAARFYAAEVLLALEYLHMMGVVYRDLKPENVLVREDGHIMLSDFDLSL  209

Query  875   RADIFPQL--------------------ETLTRVPLGSG----GRKCGFLG---------  795
             +  + P L                     T    P  +G    G+  GF           
Sbjct  210   KCAVSPTLVKSIGHDSRDGKSSGSYCMQPTACAEPSCTGGFEVGQGAGFPSPGKPKTKSK  269

Query  794   --errreETVTEFVAEPTTAFSRSCVGTHEYLAPELI-SGNGHGNGVDWWAFGVLMYELL  624
                 +    + E +AEPT+A S S VGTHEYLAPE+I +G+GHG+ VDWW FG+ +YELL
Sbjct  270   AEGGQSVSPLPELIAEPTSARSMSFVGTHEYLAPEIIKAGDGHGSAVDWWTFGIFLYELL  329

Query  623   FGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKRLGC  447
             FG TPFKGS   +TL N+   + ++F     E  T  ++ AA+DLI  LLVK+P  RL  
Sbjct  330   FGKTPFKGSGNRATLFNVVG-QPLKFP----ESATGQVSFAARDLIRGLLVKEPVHRLAS  384

Query  446   AKGATDIKRHPFFNG-IKWPLIRTYRPPE-PR  357
              +GA +IK HPFF G + W LIR   PPE PR
Sbjct  385   KRGAGEIKAHPFFEGSVNWALIRCTSPPEVPR  416



>ref|NP_194391.1| D6 protein kinase like 1 [Arabidopsis thaliana]
 sp|Q9SUA3.1|D6KL1_ARATH RecName: Full=Serine/threonine-protein kinase D6PKL1; AltName: 
Full=Serine/threonine-protein kinase AGC1-2 [Arabidopsis thaliana]
 emb|CAB43857.1| putative protein kinase [Arabidopsis thaliana]
 emb|CAB79516.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAL36279.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM14187.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEE85226.1| D6 protein kinase like 1 [Arabidopsis thaliana]
Length=506

 Score =   321 bits (822),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 175/389 (45%), Positives = 236/389 (61%), Gaps = 49/389 (13%)
 Frame = -3

Query  1415  HSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFA  1236
             +++PH+ +   W AI+A  T    G L L H +L + +G G++G V L  L       FA
Sbjct  94    NNKPHKANDVRWEAIQAVRT--KHGVLGLNHFRLLKRLGCGDIGTVHLAELHG-TRCFFA  150

Query  1235  LKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             +KV+D+ +L + KKL   QTE EIL  LDHPFLPTLY+H E   ++CL+M+FC  GDLH+
Sbjct  151   MKVMDKGALASRKKLLRAQTEREILQCLDHPFLPTLYSHFETEKFSCLVMEFCPGGDLHT  210

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             L ++Q G R S  + +FY AEVL+A+EYLH LGI+YRDLKPEN+L+R+DGH+MLSDFDL 
Sbjct  211   LRQRQPGKRFSEQAAKFYVAEVLLAMEYLHMLGIIYRDLKPENVLVRDDGHVMLSDFDLS  270

Query  878   FRADIFPQLETLTRVPLGSGGRKCGFLGerr-----------------------------  786
              R  + P +   T V    G +  G+  +                               
Sbjct  271   LRCTVSPTVVRST-VLASEGQKNSGYCAQPACIQQPSCISAPTTCFSPRYFSSKSKKDKK  329

Query  785   -------reETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYEL  627
                    +   + E VAEPT+A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +YEL
Sbjct  330   MKNETGNQVSPLPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYEL  389

Query  626   LFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKRLG  450
             LFG TPFKGS   +TL N+   + +RF       E+P ++ AA+DLI  LLVK+P+ RL 
Sbjct  390   LFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAARDLIRSLLVKEPQHRLA  442

Query  449   CAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
               +GAT++K+HPFF G+ W L+R   PPE
Sbjct  443   YKRGATEMKQHPFFEGVNWALVRCASPPE  471



>ref|XP_004248529.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Solanum 
lycopersicum]
Length=697

 Score =   326 bits (836),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 181/413 (44%), Positives = 256/413 (62%), Gaps = 42/413 (10%)
 Frame = -3

Query  1433  SNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDY  1254
             SNI    ++PH+ +     AI   A  + DG L + + +L + +G G++G V+L  L + 
Sbjct  276   SNITGSANKPHKGNDPRCKAI--IAIRARDGILGMSNFRLVKKLGCGDIGTVYLSEL-NG  332

Query  1253  EHSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCS  1077
                DFA+KV+D+ SL + KKL+  +TE EIL +LDHPFLPTLY H E + ++CL+M++C 
Sbjct  333   TCCDFAMKVMDKASLASRKKLTRSRTEKEILQLLDHPFLPTLYTHFETNRFSCLVMEYCP  392

Query  1076  NGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIML  897
              GDLH+L ++Q G   S  S RFYAAEVL+ALEYLH LG++YRDLKPEN+L+R+DGHIML
Sbjct  393   GGDLHTLRQRQPGKHFSEYSARFYAAEVLLALEYLHMLGVLYRDLKPENVLVRDDGHIML  452

Query  896   SDFDLCFRADIFPQ-LETLTRVPLGSGGRKC-----------GFLGerrreET-------  774
             SDFDL  +  + P  + T +  P   G   C            FL     +++       
Sbjct  453   SDFDLSLKCSVSPMVIRTSSDDPSKRGAALCVQPACLAPTSTCFLPRIFSQKSKKRLQKP  512

Query  773   ----------VTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELL  624
                       + E VAEPT A S S VGTHEYLAPE+I G GHGN VDWW FG+ +YELL
Sbjct  513   RTEPGFPANAIPELVAEPTAARSMSFVGTHEYLAPEIIKGEGHGNAVDWWTFGIFLYELL  572

Query  623   FGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKRLGC  447
             +G TPFKGS   +T+ N+   + ++F       ++PA + A+++LI+ LL+K+P+ RLG 
Sbjct  573   YGKTPFKGSGNRATIFNVVGQQ-LKF------PDSPATSNASRNLIQGLLIKEPQHRLGV  625

Query  446   AKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRRR  291
              +GA++IK+HPFF G+ W LIR+  PPE PR + ++  +    V  V    +R
Sbjct  626   KRGASEIKQHPFFEGVNWALIRSSTPPEVPRQVEVEVPRKLKQVNPVEVCSKR  678



>ref|NP_001148103.1| LOC100281711 [Zea mays]
 gb|ACG29743.1| protein kinase G11A [Zea mays]
Length=583

 Score =   323 bits (828),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 239/403 (59%), Gaps = 56/403 (14%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ + S W AI+   T   DG L L H +L + +G G++G V+L  L   + S FA+
Sbjct  158   TKPHKANDSRWEAIQTVRT--RDGVLGLSHFRLLKRLGCGDIGSVYLSELNGTK-SYFAM  214

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  215   KVMDKASLASRKKLLRAQTEKEILQCLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHAL  274

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G      +V+FY AEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  275   RQRQPGKHFPEQAVKFYIAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSL  334

Query  875   RADIFPQLETLTRVPLGSGGRK-----CGFLGerrreETVTEFVAEPTTAF---------  738
             R  + P L   +  P     RK     C           V    A PTT F         
Sbjct  335   RCAVSPML-IRSSNPDAEALRKNSHGYCAQPACVEPSCVVQPSCAAPTTCFGPRLFSSKS  393

Query  737   ----------------------------SRSCVGTHEYLAPELISGNGHGNGVDWWAFGV  642
                                         S S VGTHEYLAPE+I G GHG+ VDWW FGV
Sbjct  394   KKERKPRPEAATPVNPWPELIAEPSDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGV  453

Query  641   LMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDP  465
              +YELLFG TPFKGSS  +TL N+   + +RF       E PA++ +A+DLI  LLVK+P
Sbjct  454   FLYELLFGKTPFKGSSNRATLFNVIGQQ-LRF------PEYPAVSFSARDLIRGLLVKEP  506

Query  464   RKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             ++RL   +GAT+IK+HPFF G+ W LIR   PPE P+ + ++R
Sbjct  507   QQRLAYKRGATEIKQHPFFEGVNWALIRCASPPEVPKPVEIER  549



>ref|NP_001288816.1| protein kinase PINOID [Brassica rapa]
 gb|AAB54117.1| putative serine/threonine protein kinase [Brassica rapa]
Length=439

 Score =   318 bits (816),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 176/355 (50%), Positives = 224/355 (63%), Gaps = 28/355 (8%)
 Frame = -3

Query  1304  VGSGNLGRVFLCRLR-DYEHSD---FALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFL  1140
             +G+G++G V+LCRL  D E S    FA+KV+D ++L  KK  H  + E +IL MLDHPFL
Sbjct  84    IGAGDIGTVYLCRLAGDQEESRSSYFAMKVVDNEALAMKKKMHRAEMEKKILKMLDHPFL  143

Query  1139  PTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLG  960
             P+LYA  E SH++C++M++CS GDLHSL  +Q  +R S+ S RFYAAEVLVALEYLH LG
Sbjct  144   PSLYAEFEASHFSCIVMEYCSGGDLHSLRHRQPQHRFSLSSARFYAAEVLVALEYLHMLG  203

Query  959   IVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLG---SGGRKCGFLGer  789
             I+YRDLKPENIL+R DGHIMLSDFDL   +D    +E+ +  P     S  R+   L + 
Sbjct  204   IIYRDLKPENILVRSDGHIMLSDFDLSLCSDSIAAVESSSSTPENYPHSSPRRLTRLAKL  263

Query  788   rreETVTE----------FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                   ++          FVAEP TA S S VGTHEY+APE+ SG  HGN VDWWAFGV 
Sbjct  264   FNRVLRSKKVQTLEPNRLFVAEPVTARSGSFVGTHEYVAPEVASGGSHGNAVDWWAFGVF  323

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA---AAKDLIERLLVKD  468
             +YE+++G TPF   + +  LRNI   R + F  D     +PA      A+ LI  LL KD
Sbjct  324   LYEIIYGRTPFAAPTNDVILRNIVK-RPLSFPTD-----SPATMFELHARSLISGLLNKD  377

Query  467   PRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKSKAHVTGVSS  303
             P  RLG  +GA ++K HPFF G+ + LIRT  PPE    V +R K  A   G SS
Sbjct  378   PSTRLGSRRGAAEVKVHPFFKGLNFALIRTMTPPEVPSDV-RRPKKSATFGGRSS  431



>ref|XP_008677207.1| PREDICTED: LOC100281711 isoform X1 [Zea mays]
 gb|AFW63632.1| putative protein kinase superfamily protein isoform 1 [Zea mays]
 gb|AFW63633.1| putative protein kinase superfamily protein isoform 2 [Zea mays]
Length=583

 Score =   323 bits (827),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 239/403 (59%), Gaps = 56/403 (14%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ + S W AI+   T   DG L L H +L + +G G++G V+L  L   + S FA+
Sbjct  158   TKPHKANDSRWEAIQTVRT--RDGVLGLSHFRLLKRLGCGDIGSVYLSELNGTK-SYFAM  214

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  215   KVMDKASLASRKKLLRAQTEKEILQCLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHAL  274

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G      +V+FY AEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  275   RQRQPGKHFPEQAVKFYIAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSL  334

Query  875   RADIFPQLETLTRVPLGSGGRK-----CGFLGerrreETVTEFVAEPTTAF---------  738
             R  + P L   +  P     RK     C           V    A PTT F         
Sbjct  335   RCAVSPTL-IRSSNPDAEALRKNSHGYCAQPACVEPSCVVQPSCAAPTTCFGPRLFSSKS  393

Query  737   ----------------------------SRSCVGTHEYLAPELISGNGHGNGVDWWAFGV  642
                                         S S VGTHEYLAPE+I G GHG+ VDWW FGV
Sbjct  394   KKERKPRPEAATPVNPWPELIAEPSDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGV  453

Query  641   LMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDP  465
              +YELLFG TPFKGSS  +TL N+   + +RF       E PA++ +A+DLI  LLVK+P
Sbjct  454   FLYELLFGKTPFKGSSNRATLFNVIGQQ-LRF------PEYPAVSFSARDLIRGLLVKEP  506

Query  464   RKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             ++RL   +GAT+IK+HPFF G+ W LIR   PPE P+ + ++R
Sbjct  507   QQRLAYKRGATEIKQHPFFEGVNWALIRCASPPEVPKPVEIER  549



>ref|XP_008784831.1| PREDICTED: protein kinase PINOID [Phoenix dactylifera]
Length=448

 Score =   318 bits (816),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 185/385 (48%), Positives = 239/385 (62%), Gaps = 21/385 (5%)
 Frame = -3

Query  1472  ERLSATSTAGNPSSNIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSG  1293
             E  + +S  G+   + P L S+PHR     W+AI++         L  R  KL R +GSG
Sbjct  45    EPAADSSGGGHCPCSPPGLASKPHRSSDPAWAAIRSRRGGGLPSRLGPRDFKLVRRIGSG  104

Query  1292  NLGRVFLCRLRDYEHSD------FALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPT  1134
             ++G V+LCRLR+           +A+KV+D+ +L  KK      TE  IL +LDHPFLPT
Sbjct  105   DIGTVYLCRLREERQCPEASPVCYAMKVVDKLALVKKKKLERAATEKRILRVLDHPFLPT  164

Query  1133  LYAHLEVS-HYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGI  957
             LYA  + S H++C++M++CS GDLH+L  +Q G R S+++ RFYAAEVL+ALEYLH LGI
Sbjct  165   LYADFDASPHFSCVVMEYCSGGDLHTLRHRQPGLRFSINAARFYAAEVLLALEYLHMLGI  224

Query  956   VYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLE-TLTRVPLGSGGRKCGFLG-----  795
             VYRDLKPENILIR DGHIMLSDFDL  ++   P LE T     +  G      L      
Sbjct  225   VYRDLKPENILIRSDGHIMLSDFDLSLQSTSSPTLEPTAASADVSDGVADPSCLPDRLFR  284

Query  794   --errreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLF  621
               +         FVAEP  A S S VGTHEY+APE+ +G  HG+ VDWWA+GVL+YELL+
Sbjct  285   PRKPAPSLPSRRFVAEPVAARSCSFVGTHEYVAPEVAAGRSHGSAVDWWAYGVLLYELLY  344

Query  620   GTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKRLGCAK  441
             G TPF G S ++TLRNI   +    +   G    PA +AA+DLI  LLVKDP  R G  +
Sbjct  345   GRTPFAGPSNDATLRNI--VKQPLAFPPAG---CPADSAARDLISGLLVKDPASRFGSIR  399

Query  440   GATDIKRHPFFNGIKWPLIRTYRPP  366
             GA D+K HPFF G+   L+R+YRPP
Sbjct  400   GAADVKTHPFFKGLNLALLRSYRPP  424



>ref|XP_010091920.1| Protein kinase G11A [Morus notabilis]
 gb|EXB47700.1| Protein kinase G11A [Morus notabilis]
Length=471

 Score =   319 bits (818),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 177/391 (45%), Positives = 235/391 (60%), Gaps = 48/391 (12%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             S+PH+ +   W AI+       DG L L   +L + +G G++G V+L  LR  +   FA+
Sbjct  47    SKPHKGNDIRWEAIQCVKG-GKDGELGLVDFRLLKKLGCGDIGSVYLAELRGSKGCLFAI  105

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+  L   KKL+  QTE +IL +LDHPFLPTLY+H E   ++ LLM+FCS GDLH+L
Sbjct  106   KVMDKGMLVGRKKLARAQTEKDILGLLDHPFLPTLYSHFETDKFSYLLMEFCSGGDLHTL  165

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q   R +  + RFYA+EVLVALEYLH +G+VYRDLKPEN+L+R+DGHIM+SDFDL  
Sbjct  166   RQRQPAKRFTEQAARFYASEVLVALEYLHMMGVVYRDLKPENVLVRDDGHIMISDFDLSL  225

Query  875   RADIFPQL------ETLTRVP-----------------------LGSGGRKCGFLGerrr  783
             R  + P L      ET  R+                        L     K  FL  +  
Sbjct  226   RCFVSPTLVQSDDAETACRISSYCIEPSCIDPAFKLPVCVQPSCLQPSCFKPRFLSSKTA  285

Query  782   eETVTE-----------FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLM  636
             +  + +            +AEPT A S S VGTHEYLAPE+I G+GHG+ VDWW FG+ +
Sbjct  286   KAKIEKTSSASLDSLPVLIAEPTNARSMSFVGTHEYLAPEIIRGDGHGSAVDWWTFGIFL  345

Query  635   YELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRKR  456
             YEL+ G TPFKG+    TL N+   + ++F        + A  AAKDLI  LLVKDP+KR
Sbjct  346   YELIHGRTPFKGNGNRVTLLNVVG-QSLKF-----PEGSNASFAAKDLIRGLLVKDPQKR  399

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             LG  +GAT+IK+HPFF  + W LIR+  PPE
Sbjct  400   LGFKRGATEIKQHPFFESVNWALIRSTHPPE  430



>gb|EYU27452.1| hypothetical protein MIMGU_mgv1a003783mg [Erythranthe guttata]
 gb|EYU27453.1| hypothetical protein MIMGU_mgv1a003783mg [Erythranthe guttata]
Length=564

 Score =   322 bits (826),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 185/402 (46%), Positives = 242/402 (60%), Gaps = 57/402 (14%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFL---CRLRDYEHSD  1242
             ++PH+ +   W AI+   T   DG L LRH +L + +G G++G V+L   C  + Y    
Sbjct  138   NKPHKANDVRWEAIQTVRT--KDGGLDLRHFRLLKKLGCGDIGSVYLSELCGTKCY----  191

Query  1241  FALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDL  1065
             FA+KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY+H E   ++CL+M+FC  GDL
Sbjct  192   FAMKVMDKASLASRKKLLRAQTEREILQCLDHPFLPTLYSHFETEKFSCLVMEFCPGGDL  251

Query  1064  HSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFD  885
             HSL ++Q G   S  +V+FY AEVL++LEYLH LGIVYRDLKPEN+L+R+DGHIMLSDFD
Sbjct  252   HSLRQRQPGKYFSEQAVKFYVAEVLLSLEYLHMLGIVYRDLKPENVLVRDDGHIMLSDFD  311

Query  884   LCFRADIFPQL-------ETLTR-------------VPLGSGGRKCGFL-----------  798
             L  R  + P L        T T+             VP    G    F            
Sbjct  312   LSLRCSVSPTLIKSSEADPTRTKNTNSAYCVQPSCVVPTSCVGPTTCFAPRFFSSSKSKK  371

Query  797   -------GerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                        +   + E +AEPT A S S VGTHEYLAPE++ G GHG+ VDWW FG+ 
Sbjct  372   DRNKTKNETVNQVTPLPELMAEPTDARSMSFVGTHEYLAPEIVKGEGHGSAVDWWTFGIF  431

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPR  462
             +YELLFG TPFKGS   +TL N+   + +RF       E P ++ AA+DLI  LLVK+P+
Sbjct  432   LYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PEAPVVSFAARDLIRGLLVKEPQ  484

Query  461   KRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
              RL   +GAT++K+HPFF G+ W LIR   PP+ PR +  +R
Sbjct  485   HRLAYKRGATEVKQHPFFEGVNWALIRCASPPDVPRPVDFER  526



>dbj|BAF02156.1| putative protein kinase [Arabidopsis thaliana]
Length=506

 Score =   320 bits (821),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 175/389 (45%), Positives = 235/389 (60%), Gaps = 49/389 (13%)
 Frame = -3

Query  1415  HSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFA  1236
             + +PH+ +   W AI+A  T    G L L H +L + +G G++G V L  L       FA
Sbjct  94    NDKPHKANDVRWEAIQAVRT--KHGVLGLNHFRLLKRLGCGDIGTVHLAELHG-TRCFFA  150

Query  1235  LKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHS  1059
             +KV+D+ +L + KKL   QTE EIL  LDHPFLPTLY+H E   ++CL+M+FC  GDLH+
Sbjct  151   MKVMDKGALASRKKLLRAQTEREILQCLDHPFLPTLYSHFETEKFSCLVMEFCPGGDLHT  210

Query  1058  LLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLC  879
             L ++Q G R S  + +FY AEVL+A+EYLH LGI+YRDLKPEN+L+R+DGH+MLSDFDL 
Sbjct  211   LRQRQPGKRFSEQAAKFYVAEVLLAMEYLHMLGIIYRDLKPENVLVRDDGHVMLSDFDLS  270

Query  878   FRADIFPQLETLTRVPLGSGGRKCGFLGerr-----------------------------  786
              R  + P +   T V    G +  G+  +                               
Sbjct  271   LRCTVSPTVVRST-VLASEGQKNSGYCAQPACIQQPSCISAPTTCFSPRYFSSKSKKDKK  329

Query  785   -------reETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYEL  627
                    +   + E VAEPT+A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +YEL
Sbjct  330   MKNETGNQVSPLPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYEL  389

Query  626   LFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKRLG  450
             LFG TPFKGS   +TL N+   + +RF       E+P ++ AA+DLI  LLVK+P+ RL 
Sbjct  390   LFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFAARDLIRSLLVKEPQHRLA  442

Query  449   CAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
               +GAT++K+HPFF G+ W L+R   PPE
Sbjct  443   YKRGATEMKQHPFFEGVNWALVRCASPPE  471



>ref|XP_003634855.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Vitis 
vinifera]
Length=620

 Score =   324 bits (830),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 183/409 (45%), Positives = 240/409 (59%), Gaps = 70/409 (17%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ + S W AI+A    + DG L L H +L + +G G++G V+L  L   + S FA+
Sbjct  189   NKPHKANDSRWEAIQAVR--ARDGVLGLSHFRLLKRLGCGDIGSVYLSELSGTK-SYFAM  245

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  246   KVMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETEKFSCLVMEFCPGGDLHTL  305

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDL--  882
              ++Q G   +  +V+FY AEVL+ALEYLH LGIVYRDLKPEN+L+R+DGHIMLSDFDL  
Sbjct  306   RQRQPGKHFTEQAVKFYVAEVLLALEYLHMLGIVYRDLKPENVLVRDDGHIMLSDFDLSL  365

Query  881   ----------------------------------------------CFRADIFPQLETLT  840
                                                           CF   +F       
Sbjct  366   RCAVSPTLVKTCSLESDPFRKNPVYCVQPACIEPSCIQPSCVAPTTCFTPRLFSSKSRKD  425

Query  839   RVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVD  660
             R P    G +   L          E +AEPT A S S VGTHEYLAPE+I G GHG+ VD
Sbjct  426   RKPKNEVGNQVSPL---------PELIAEPTGARSMSFVGTHEYLAPEIIKGEGHGSAVD  476

Query  659   WWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIER  483
             WW FG+ +YELLFG TPFKGS   +TL N+   + +RF       E+P ++ +A+DLI  
Sbjct  477   WWTFGIFLYELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFSARDLIRG  529

Query  482   LLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             LLVK+P+ RL   +GAT+IK+HPFF G+ W LIR   PPE P+ + ++R
Sbjct  530   LLVKEPQHRLAFKRGATEIKQHPFFEGVNWALIRCATPPEIPKPVEIER  578



>ref|XP_004486363.1| PREDICTED: protein kinase G11A-like isoform X1 [Cicer arietinum]
 ref|XP_004486364.1| PREDICTED: protein kinase G11A-like isoform X2 [Cicer arietinum]
 ref|XP_004486365.1| PREDICTED: protein kinase G11A-like isoform X3 [Cicer arietinum]
 ref|XP_004486366.1| PREDICTED: protein kinase G11A-like isoform X4 [Cicer arietinum]
 ref|XP_004486367.1| PREDICTED: protein kinase G11A-like isoform X5 [Cicer arietinum]
 ref|XP_004486368.1| PREDICTED: protein kinase G11A-like isoform X6 [Cicer arietinum]
 ref|XP_004486369.1| PREDICTED: protein kinase G11A-like isoform X7 [Cicer arietinum]
Length=608

 Score =   323 bits (829),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 189/440 (43%), Positives = 249/440 (57%), Gaps = 57/440 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ +   W AI+   T   DGAL L H +L + +G G++G V+L  L   +   FA+
Sbjct  181   NKPHKANDMRWEAIQVVRT--RDGALGLGHFRLLKRLGCGDIGSVYLSELSGTK-CYFAM  237

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  238   KVMDKGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETEKFSCLVMEFCPGGDLHTL  297

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              +KQ G      +V+FY AEVL+A+EYLH LGIVYRDLKPEN+L+R+DGHIMLSDFDL  
Sbjct  298   RQKQPGKHFPEQAVKFYVAEVLLAMEYLHMLGIVYRDLKPENVLVRDDGHIMLSDFDLSL  357

Query  875   RADIFPQL---ETLTRVPLGSGGRKCGFLGerrreETVT---------------------  768
             R  + P L    ++   PL      C           +                      
Sbjct  358   RCAVSPTLVKSSSIDSEPLRKNSVYCAQPACIEPPSCIQPSCVAPTSCFSPRLFSSKSKK  417

Query  767   ----------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLM  636
                             E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW +G+ +
Sbjct  418   DRKPKTELGNQVSPLPELIAEPTDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTYGIFL  477

Query  635   YELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRK  459
             YELLFG TPFKGS   +TL N+   + +RF       E P ++ AA+DLI  LLVK+P+ 
Sbjct  478   YELLFGKTPFKGSGNRATLFNVVG-QPLRF------PEAPVVSFAARDLIRGLLVKEPQH  530

Query  458   RLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKRSKSKAHVTGVSSPRRRRCW  282
             RL   +GAT+IK+HPFF G+ W LIR   PPE P+ +  ++  S A     SS   +   
Sbjct  531   RLAYKRGATEIKQHPFFEGVNWALIRCATPPEIPKPVEFEKIPSPAP----SSAGEKAVV  586

Query  281   WKRLGHLVRIKGSKHNLNFN  222
                +      KGS + L F+
Sbjct  587   NNHMSTASNQKGSDNYLEFD  606



>ref|XP_002526605.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF35764.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=465

 Score =   319 bits (817),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 180/401 (45%), Positives = 241/401 (60%), Gaps = 43/401 (11%)
 Frame = -3

Query  1421  NLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD  1242
             NL  +PHR   S +SAI++A T      L  R  +L R +GSG++G V+LCRL    ++ 
Sbjct  53    NLTLKPHRSSDSAYSAIRSA-TFRRKTGLTFRDFRLIRRIGSGDIGTVYLCRLTRKHNNQ  111

Query  1241  --------------------FALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTLYA  1125
                                 +A+KV+D+++L  KK  H  + E +IL MLDHPFLP+LYA
Sbjct  112   EEDDDFEDDHDDDDDEKLCFYAMKVVDKEALQVKKKVHRAEMERKILKMLDHPFLPSLYA  171

Query  1124  HLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRD  945
               E SH++C++M++CS GDL SL  KQ   R S+ S RFYAAEVLVALEYLH LGI+YRD
Sbjct  172   EFEASHFSCIVMEYCSGGDLLSLRHKQPYKRFSLSSARFYAAEVLVALEYLHMLGIIYRD  231

Query  944   LKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLGSGGRKCGF------------  801
             LKPEN+L+R DGHIMLSDFDL   +D  P +E+ +  P  +      +            
Sbjct  232   LKPENVLVRSDGHIMLSDFDLSLCSDAIPAVESPSLSPDSTSPSSLPYARSHSSKTFSCL  291

Query  800   ---LGerrreETVTE---FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                L   ++ +T+     FVAEP +A S S VGTHEY+APE+ SG  HGN VDWWAFG+ 
Sbjct  292   LNRLFRSKKIQTLCPNRLFVAEPVSARSCSFVGTHEYVAPEVASGGSHGNAVDWWAFGIF  351

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPRK  459
             +YEL++G TPF   S E TLRNI   + + F        +   + A++LI  LL KDP  
Sbjct  352   IYELMYGRTPFAAPSNEQTLRNIVK-KPLSFPTHSP--SSSLESHARNLISGLLNKDPNS  408

Query  458   RLGCAKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRS  336
             RLG  +G+ D+K HPFF G+ + LIRT  PP+  GL  +R+
Sbjct  409   RLGTKRGSADVKTHPFFKGLNFALIRTVTPPQVPGLRRQRT  449



>emb|CDY17273.1| BnaA05g09150D [Brassica napus]
Length=439

 Score =   318 bits (814),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 169/335 (50%), Positives = 215/335 (64%), Gaps = 27/335 (8%)
 Frame = -3

Query  1304  VGSGNLGRVFLCRL----RDYEHSDFALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFL  1140
             +G+G++G V+LCRL     +   S FA+KV+D+++L  KK  H  + E +IL MLDHPFL
Sbjct  84    IGAGDIGTVYLCRLAGDEEESRRSYFAMKVVDKEALALKKKMHRAEMEKKILKMLDHPFL  143

Query  1139  PTLYAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLG  960
             PTLYA  E SH++C++M++CS GDLHSL  +Q   R S+ S RFYAAEVLVALEYLH LG
Sbjct  144   PTLYAEFEASHFSCIVMEYCSGGDLHSLRHRQPDGRFSLSSARFYAAEVLVALEYLHMLG  203

Query  959   IVYRDLKPENILIREDGHIMLSDFDLCFRADIFPQLETLTRVPLG---SGGRKCGFLGer  789
             I+YRDLKPENIL+R DGHIMLSDFDL   +D    +E+ +  P     S  R+   L + 
Sbjct  204   IIYRDLKPENILVRSDGHIMLSDFDLSLCSDSIAAVESSSSSPENQPRSSPRRLTRLAKL  263

Query  788   rreETVTE----------FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVL  639
                   ++          FVAEP TA S S VGTHEY+APE+ SG  HGN VDWWAFGV 
Sbjct  264   FHRVLRSKKVQTLEPNRLFVAEPVTARSGSFVGTHEYVAPEVASGGSHGNAVDWWAFGVF  323

Query  638   MYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKD  468
             +YE+++G TPF   + +  LRNI   R + F  D     TPA      A+ LI  LL KD
Sbjct  324   LYEIIYGRTPFAAPTNDVILRNIVK-RQLTFPTD-----TPATMLELHARSLISGLLNKD  377

Query  467   PRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
               KRLG  +GA ++K HPFF G+ + LIRT  PPE
Sbjct  378   QTKRLGSRRGAAEVKVHPFFKGLNFALIRTLTPPE  412



>ref|XP_008778034.1| PREDICTED: protein kinase G11A-like [Phoenix dactylifera]
Length=616

 Score =   323 bits (829),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 184/393 (47%), Positives = 239/393 (61%), Gaps = 51/393 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ + + W AI+A    S DG L L H +L R +G G++G V+L  L     S+FA+
Sbjct  197   NKPHKANDARWEAIRA--VRSPDGYLGLHHFRLLRKLGCGDIGSVYLAELSG-TGSNFAM  253

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+  L + KKL+  QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  254   KVMDKAVLASRKKLARAQTEREILQCLDHPFLPTLYTHFETDKFSCLIMEFCPGGDLHTL  313

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   S ++ RFY AEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  314   RQRQPGKYFSENAARFYVAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSL  373

Query  875   RADIFPQLETLTRVPLGSG-----------------GRKC--------GFLGerrreETV  771
             R  + P L     +  GS                   R C         FL + +  +  
Sbjct  374   RCTVCPTLVKSVNLDFGSSKNAGYCVQPSCIKPTCIQRSCYQPTCFSPRFLNKTKNRKGT  433

Query  770   T-------------EFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYE  630
             +             E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +YE
Sbjct  434   SNLNEVCNQVIPLPELIAEPTNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYE  493

Query  629   LLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKRL  453
             LLFG TPFKGS   +TL N+     ++F       E P ++ AA+DLI  LLVK+P++RL
Sbjct  494   LLFGKTPFKGSGNRATLFNVVG-EPLKF------PELPTVSFAARDLIRGLLVKEPQQRL  546

Query  452   GCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PR  357
                +GA ++K+HPFF  I W LIR   PPE PR
Sbjct  547   AYRRGAAEVKQHPFFQSINWALIRCTSPPEVPR  579



>dbj|BAK01764.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=577

 Score =   322 bits (825),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 184/414 (44%), Positives = 245/414 (59%), Gaps = 53/414 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ + S   AI+     S +G L L   +L + +GSG++G V+L  L   + S FA+
Sbjct  158   TKPHKGNDSRCEAIQVVK--SREGVLGLNQFRLLKKLGSGDIGSVYLSELSGTK-SHFAM  214

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  215   KVMDKTSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTL  274

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q+G   S  + +FY AEVL+ALEYLH LGI+YRDLKPEN+L+REDGHIML+DFDL  
Sbjct  275   RQRQSGKHFSEQAAKFYVAEVLLALEYLHMLGIIYRDLKPENVLVREDGHIMLTDFDLSL  334

Query  875   RADIFPQ--------LETLTR-----------------VPLGSGGRK-------------  810
             R  + P         L+ L R                 VP    G +             
Sbjct  335   RCSVSPTVIRGANPGLDALQRNNAAYCVQPACIQPSCVVPTTCFGPRFFSKSKSKSKSKK  394

Query  809   -CGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                      +     E +AEPT A S S VGTHEYLAPE++ G GHG+ VDWW FG+ +Y
Sbjct  395   EKPKPDIANQVNLFPEMIAEPTDARSMSLVGTHEYLAPEIVKGEGHGSAVDWWTFGIFLY  454

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELLFG TPFKGS   +TL N+   + +RF       E+P ++ +A+D+I  LLVKDP+ R
Sbjct  455   ELLFGKTPFKGSGNRATLFNVVG-QPLRF------PESPLVSFSARDMIRGLLVKDPQHR  507

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLK-RSKSKAHVTGVSSP  300
             LG  +GAT+IK+HPFF G+ W LIR   PP+ P+ + L  R K      G  +P
Sbjct  508   LGHKRGATEIKQHPFFEGVNWALIRCASPPDIPKPVELDCRPKQAPSANGKVAP  561



>ref|XP_009386043.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
Length=706

 Score =   325 bits (834),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 185/407 (45%), Positives = 242/407 (59%), Gaps = 67/407 (16%)
 Frame = -3

Query  1430  NIPNLHSRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYE  1251
             NI    ++PH+ +   W AI   A  S DG L + H +L + +G G++G V+L  L    
Sbjct  278   NITGSANKPHKGNDPRWKAI--LAVRSRDGILGMSHFRLLKRLGCGDIGSVYLSELSST-  334

Query  1250  HSDFALKVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSN  1074
                FA+KV+D+ SL + KKL+  QTE EIL +LDHPFLPTLY H E   ++CL+M+FC  
Sbjct  335   RCYFAMKVMDKASLASRKKLTRAQTEREILQLLDHPFLPTLYTHFETDRFSCLVMEFCPG  394

Query  1073  GDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLS  894
             GDLH+L ++Q G   S  + RFYAAEVL+ALEYLH LG+VYRDLKPEN+L+R+DGHIMLS
Sbjct  395   GDLHTLRQRQPGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGHIMLS  454

Query  893   DFDL---------------------------------------------CFRADIFP-QL  852
             DFDL                                             CF   +FP + 
Sbjct  455   DFDLSLRCAVSPTLIKSSSFDSDPSKRAVGAFCVQPSCIEPSSVCVQPACFMPKLFPHKS  514

Query  851   ETLTRVPLGSGGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHG  672
             +  TR P     R+        +  T+ E V EPTTA S S VGTHEYLAPE+I G GHG
Sbjct  515   KKKTRKPWAEAPRQ--------QVATLPELVVEPTTARSMSFVGTHEYLAPEIIKGEGHG  566

Query  671   NGVDWWAFGVLMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKD  495
             + VDWW FG+ ++ELL+G TPFKGS   +TL N+   + +RF       +TP+ + A++D
Sbjct  567   SAVDWWTFGIFLHELLYGRTPFKGSGNRATLFNVVGQQ-LRF------PDTPSTSYASRD  619

Query  494   LIERLLVKDPRKRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PR  357
             LI  LLVK+P+ RLG  +GA +IK+HPFF G+ W LIR   PPE PR
Sbjct  620   LIRGLLVKEPQHRLGVKRGAAEIKQHPFFEGVNWALIRCSTPPEVPR  666



>ref|XP_008346147.1| PREDICTED: protein kinase PINOID-like [Malus domestica]
Length=460

 Score =   318 bits (815),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 178/387 (46%), Positives = 234/387 (60%), Gaps = 50/387 (13%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD----  1242
             +PHR     +SAI++  T     AL  R    HR +G+G++G V+LC LR  + S     
Sbjct  51    KPHRSSDFAYSAIRSKKT-----ALTFRDFHRHRRIGAGDIGTVYLCTLRSRDSSSPADQ  105

Query  1241  ----------FALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCL  1095
                       +A+KV+D+++L   KK+   + E +IL MLDHPFLPTLYA  E SH++C+
Sbjct  106   DTESSSSSCLYAMKVVDKEALAMKKKVQRAEMERKILKMLDHPFLPTLYAEFEASHFSCI  165

Query  1094  LMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIRE  915
             +M++CS GDLHSL   Q   R S++S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R 
Sbjct  166   VMEYCSGGDLHSLRHIQPHKRFSLNSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRS  225

Query  914   DGHIMLSDFDLCFRADIFPQLET------------------LTRVPLGSGGRKCGFLGer  789
             DGHIMLSDFDL   +D  P +E+                    R  L         L   
Sbjct  226   DGHIMLSDFDLSLCSDAIPAVESPDSYSDSASLSTPSYTRPQKRATLTPFSCLSNRLFRS  285

Query  788   rreETVTE---FVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFG  618
             R+ +T+++   FVAEP  A S+S VGTHEY+ PE+ SG  HGN VDWWAFG+ +YEL++G
Sbjct  286   RKVQTLSQNRLFVAEPVAARSQSFVGTHEYVTPEVASGRSHGNAVDWWAFGIFLYELVYG  345

Query  617   TTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDPRKRLGC  447
              TPF   S E+TLRNI   + + F        TP+ A    A+DLI   L KDP +RLG 
Sbjct  346   RTPFAAPSNETTLRNIVK-KPLTF-----PTSTPSSALEGHARDLISGFLNKDPDRRLGS  399

Query  446   AKGATDIKRHPFFNGIKWPLIRTYRPP  366
              +GA D+K+HPFF GI   L+R+  PP
Sbjct  400   KRGAADVKKHPFFKGINLALVRSLTPP  426



>ref|XP_007020448.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
 ref|XP_007020449.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
 ref|XP_007020450.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
 gb|EOY11973.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
 gb|EOY11974.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
 gb|EOY11975.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
Length=604

 Score =   322 bits (826),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 184/400 (46%), Positives = 241/400 (60%), Gaps = 52/400 (13%)
 Frame = -3

Query  1412  SRPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSDFAL  1233
             ++PH+ +   W AI+A  T   DG L L H KL + +G G++G V+L  L   +   FA+
Sbjct  186   NKPHKANDIRWEAIQAVRT--KDGVLGLNHFKLLKRLGCGDIGSVYLSELSGTK-CYFAM  242

Query  1232  KVIDRDSLTA-KKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCLLMDFCSNGDLHSL  1056
             KV+D+ SL + KKL   QTE EIL  LDHPFLPTLY H E   ++CL+M+FC  GDLH+L
Sbjct  243   KVMDKASLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTL  302

Query  1055  LRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCF  876
              ++Q G   +  +V+FY AEVL+ALEYLH LGIVYRDLKPEN+L+REDGHIMLSDFDL  
Sbjct  303   RQRQPGKHFTEQAVKFYVAEVLLALEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDLSL  362

Query  875   RADIFPQL---ETLTRVPLGSGGRKC------------------------GFLGerr---  786
             R  + P L    TL   PL      C                         F   +    
Sbjct  363   RCAVSPTLVKSSTLESEPLRRNTVYCVQPACIEPSCIQPSCVAPTTCFSPRFFSSKSKKD  422

Query  785   ---------reETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMY  633
                      +   + E +AEPT A S S VGTHEYLAPE+I G GHG+ VDWW FG+ +Y
Sbjct  423   RKPKNEMGNQVSPLPELIAEPTNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLY  482

Query  632   ELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMA-AAKDLIERLLVKDPRKR  456
             ELL+G TPFKGS   +TL N+   + +RF       E+P ++ +A+DLI  LLVK+P+ R
Sbjct  483   ELLYGKTPFKGSGNRATLFNVVG-QPLRF------PESPVVSFSARDLIRGLLVKEPQHR  535

Query  455   LGCAKGATDIKRHPFFNGIKWPLIRTYRPPE-PRGLVLKR  339
             L   +GAT+IK+H FF G+ W LIR   PPE P+ + ++R
Sbjct  536   LAYKRGATEIKQHLFFEGVNWALIRCASPPEIPKPVEIER  575



>ref|XP_009362264.1| PREDICTED: protein kinase PINOID-like [Pyrus x bretschneideri]
Length=460

 Score =   318 bits (814),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 179/399 (45%), Positives = 236/399 (59%), Gaps = 50/399 (13%)
 Frame = -3

Query  1409  RPHRKHGSNWSAIKAAATLSSDGAlhlrhlklhrLVGSGNLGRVFLCRLRDYEHSD----  1242
             +PHR     +SAI++  T     AL  R   LHR +G+G++G V+LC LR  + S     
Sbjct  51    KPHRSSDFAYSAIRSKKT-----ALTFRDFHLHRRIGAGDIGTVYLCTLRSSDSSSPADR  105

Query  1241  ----------FALKVIDRDSLT-AKKLSHVQTEAEILSMLDHPFLPTLYAHLEVSHYTCL  1095
                       +A+KV+D+D+L   KK+   + E +IL MLDHPFLPTLYA  E SH++C+
Sbjct  106   DTESSSSSCLYAMKVVDKDALAMKKKVQRAEMERKILKMLDHPFLPTLYAEFEASHFSCI  165

Query  1094  LMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIRE  915
             +M++CS GDLHSL   Q   R S++S RFYAAEVLVALEYLH LGI+YRDLKPEN+L+R 
Sbjct  166   VMEYCSGGDLHSLRHNQPQKRFSLNSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRS  225

Query  914   DGHIMLSDFDLCFRADIFPQLETL---------------------TRVPLGSGGRKCGFL  798
             DGHIMLSDFDL   +D  P +E+                      T  P      +    
Sbjct  226   DGHIMLSDFDLSLCSDAIPAVESPDSYSDSASSSTPSYTRPQQRATLTPFSCLSNRLFRS  285

Query  797   GerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGVLMYELLFG  618
              + R       FVAEP  A S+S VGTHEY+ PE+ SG  HGN VDWWAFG+ +YEL++G
Sbjct  286   RKVRTLPPNRLFVAEPVAARSQSFVGTHEYVTPEVASGRSHGNAVDWWAFGIFLYELVYG  345

Query  617   TTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAA---AKDLIERLLVKDPRKRLGC  447
              TPF   S E+TLRNI   + + F        TP+ A    A+DLI   L KDP +RLG 
Sbjct  346   RTPFAAPSNETTLRNIVK-KPLTF-----PTSTPSSALEGHARDLISGFLNKDPDRRLGS  399

Query  446   AKGATDIKRHPFFNGIKWPLIRTYRPPEPRGLVLKRSKS  330
              +GA D+K+HPFF GI   L+R+  PP   G + +++ +
Sbjct  400   KRGAADVKKHPFFKGINLALVRSLTPPMIPGSIRRQNTT  438



>ref|XP_007147932.1| hypothetical protein PHAVU_006G166800g [Phaseolus vulgaris]
 gb|ESW19926.1| hypothetical protein PHAVU_006G166800g [Phaseolus vulgaris]
Length=449

 Score =   317 bits (813),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 213/333 (64%), Gaps = 22/333 (7%)
 Frame = -3

Query  1304  VGSGNLGRVFLCRLR-DYEHSDFALKVIDRDSLTAKKLSH-VQTEAEILSMLDHPFLPTL  1131
             +G+G++G V+LCRLR D E   +A+KV+D++++  KK +   + E +IL M+DHPFLPTL
Sbjct  86    IGAGDIGTVYLCRLRHDEEECFYAMKVVDKEAVALKKKAQRAEMERKILKMVDHPFLPTL  145

Query  1130  YAHLEVSHYTCLLMDFCSNGDLHSLLRKQAGNRLSVDSVRFYAAEVLVALEYLHSLGIVY  951
             YA  E SH++C++M++CS GDLHSL       R S+ S RFYAAEVLVALEYLH LGI+Y
Sbjct  146   YAEFEASHFSCIVMEYCSGGDLHSLRHNHPNKRFSLSSARFYAAEVLVALEYLHMLGIIY  205

Query  950   RDLKPENILIREDGHIMLSDFDLCFRADIFPQLET--------------LTR---VPLGS  822
             RDLKPEN+L+R DGHIMLSDFDL   +   P +E+               TR    P   
Sbjct  206   RDLKPENVLVRSDGHIMLSDFDLSLCSHAIPAVESPDCSLDPAFARTLPYTRQYSTPFSC  265

Query  821   GGRKCGFLGerrreETVTEFVAEPTTAFSRSCVGTHEYLAPELISGNGHGNGVDWWAFGV  642
                +     + +  +    FVAEP  A S S VGTHEY++PE+ SGN HGN VDWW+FG+
Sbjct  266   LSNRVFRSRKVQTLQPNRLFVAEPVGARSCSFVGTHEYVSPEVASGNSHGNAVDWWSFGI  325

Query  641   LMYELLFGTTPFKGSSKESTLRNIASTRGVRFYADDGERETPAMAAAKDLIERLLVKDPR  462
              +YE+++  TPF GSS E+TLRNI     + F        T     A+DLI RLL KDP 
Sbjct  326   FIYEMVYSRTPFAGSSNEATLRNIIKN-SLAF--PTATPSTTLETHARDLISRLLNKDPN  382

Query  461   KRLGCAKGATDIKRHPFFNGIKWPLIRTYRPPE  363
             +RLG  +GA D+K+HPFF G+   LIR   PPE
Sbjct  383   RRLGSKRGAADVKKHPFFAGLNLALIRMVTPPE  415



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5262573346098