BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84544_g1_i1 len=177 path=[155:0-176]

Length=177
                                                                      Score     E

dbj|BAE79383.1|  unnamed protein product                                104   1e-24   Ipomoea batatas [batate]
dbj|BAE79384.1|  unnamed protein product                                103   2e-23   Ipomoea batatas [batate]
dbj|BAE79381.1|  unnamed protein product                              99.4    1e-22   Ipomoea batatas [batate]
ref|XP_010689461.1|  PREDICTED: uncharacterized protein LOC104903161  58.9    2e-08   
ref|XP_010490183.1|  PREDICTED: uncharacterized protein LOC104767918  57.0    2e-08   
ref|XP_010684563.1|  PREDICTED: uncharacterized protein LOC104899126  57.0    3e-08   
ref|XP_007037791.1|  Uncharacterized protein TCM_014510               58.5    3e-08   
ref|XP_010693748.1|  PREDICTED: uncharacterized protein LOC104906660  57.4    4e-08   
ref|XP_010666462.1|  PREDICTED: uncharacterized protein LOC104883615  57.4    5e-08   
gb|KHN17266.1|  hypothetical protein glysoja_010725                   54.3    7e-08   
emb|CCA66008.1|  hypothetical protein                                 57.4    1e-07   
ref|XP_010682321.1|  PREDICTED: uncharacterized protein LOC104897196  56.6    1e-07   
ref|XP_010682307.1|  PREDICTED: uncharacterized protein LOC104897180  55.5    2e-07   
ref|XP_010666674.1|  PREDICTED: uncharacterized protein LOC104883810  55.1    3e-07   
ref|XP_006295777.1|  hypothetical protein CARUB_v10024899mg           55.5    3e-07   
ref|XP_010423120.1|  PREDICTED: uncharacterized protein LOC104708268  53.9    6e-07   
ref|XP_010667256.1|  PREDICTED: uncharacterized protein LOC104884318  53.1    7e-07   
ref|XP_007040750.1|  Zinc ion binding,nucleic acid binding-like p...  53.9    9e-07   
ref|XP_010689252.1|  PREDICTED: uncharacterized protein LOC104902987  53.5    1e-06   
ref|XP_010424323.1|  PREDICTED: uncharacterized protein LOC104709398  52.8    1e-06   
ref|XP_010687130.1|  PREDICTED: uncharacterized protein LOC104901276  53.1    1e-06   
ref|XP_006281498.1|  hypothetical protein CARUB_v10027591mg           51.2    1e-06   
ref|XP_006382338.1|  hypothetical protein POPTR_0005s01170g           52.4    2e-06   
ref|XP_010694032.1|  PREDICTED: uncharacterized protein LOC104906902  51.2    3e-06   
ref|XP_002317857.1|  hypothetical protein POPTR_0012s00280g           52.0    3e-06   Populus trichocarpa [western balsam poplar]
gb|KHN48369.1|  hypothetical protein glysoja_049216                   49.3    4e-06   
ref|XP_006385277.1|  hypothetical protein POPTR_0003s02390g           51.6    4e-06   
ref|XP_006296651.1|  hypothetical protein CARUB_v10015577mg           51.6    7e-06   
ref|XP_006296775.1|  hypothetical protein CARUB_v10015820mg           51.6    7e-06   
gb|AEL30359.1|  RNA-directed DNA polymerase                           52.4    7e-06   
ref|XP_010684905.1|  PREDICTED: uncharacterized protein LOC104899417  50.4    8e-06   
gb|KHN35462.1|  hypothetical protein glysoja_032217                   48.9    1e-05   
ref|XP_010474089.1|  PREDICTED: uncharacterized protein LOC104753550  49.3    2e-05   
ref|XP_010680847.1|  PREDICTED: uncharacterized protein LOC104895900  49.3    2e-05   
gb|KDO36419.1|  hypothetical protein CISIN_1g044040mg                 47.8    3e-05   
ref|XP_009101980.1|  PREDICTED: uncharacterized protein LOC103828133  50.1    3e-05   
ref|XP_009129252.1|  PREDICTED: uncharacterized protein LOC103854088  50.1    3e-05   
ref|XP_010690660.1|  PREDICTED: uncharacterized protein LOC104904165  50.1    3e-05   
gb|KHN11702.1|  hypothetical protein glysoja_006155                   47.0    3e-05   
ref|XP_010418769.1|  PREDICTED: uncharacterized protein LOC104704363  49.7    3e-05   
ref|XP_009121310.1|  PREDICTED: uncharacterized protein LOC103846155  50.1    3e-05   
ref|XP_009126860.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  50.4    3e-05   
ref|XP_006388296.1|  hypothetical protein POPTR_0241s00200g           48.1    4e-05   
ref|XP_006286068.1|  hypothetical protein CARUB_v10007601mg           49.7    4e-05   
gb|KHN27042.1|  hypothetical protein glysoja_049797                   47.0    4e-05   
ref|XP_006296777.1|  hypothetical protein CARUB_v10015822mg           49.3    4e-05   
emb|CAB96840.1|  putative protein                                     47.8    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382318.1|  hypothetical protein POPTR_0005s00970g           47.4    4e-05   
ref|XP_010480590.1|  PREDICTED: uncharacterized protein LOC104759346  48.5    4e-05   
ref|XP_010513494.1|  PREDICTED: uncharacterized protein LOC104789504  48.9    5e-05   
gb|KHN04954.1|  hypothetical protein glysoja_013861                   48.1    5e-05   
ref|XP_009119466.1|  PREDICTED: uncharacterized protein LOC103844431  49.7    5e-05   
ref|XP_006301940.1|  hypothetical protein CARUB_v10022418mg           49.3    6e-05   
ref|XP_006287598.1|  hypothetical protein CARUB_v10000810mg           49.3    6e-05   
ref|XP_007021978.1|  Uncharacterized protein TCM_032108               46.6    6e-05   
ref|XP_010463327.1|  PREDICTED: uncharacterized protein LOC104743994  49.3    6e-05   
ref|XP_006295736.1|  hypothetical protein CARUB_v10024855mg           48.9    6e-05   
ref|XP_010463475.1|  PREDICTED: uncharacterized protein LOC104744160  48.1    7e-05   
ref|XP_006292963.1|  hypothetical protein CARUB_v10019240mg           48.5    8e-05   
ref|XP_006305928.1|  hypothetical protein CARUB_v10011149mg           47.8    9e-05   
ref|XP_006606936.1|  PREDICTED: uncharacterized protein LOC102668273  47.8    9e-05   
ref|XP_006293025.1|  hypothetical protein CARUB_v10019305mg           48.1    9e-05   
ref|XP_010692742.1|  PREDICTED: uncharacterized protein LOC104905804  46.2    1e-04   
ref|XP_006282338.1|  hypothetical protein CARUB_v10028633mg           48.1    1e-04   
ref|XP_009151454.1|  PREDICTED: uncharacterized protein LOC103874766  48.5    1e-04   
gb|KDO44000.1|  hypothetical protein CISIN_1g046515mg                 48.5    1e-04   
ref|XP_009141433.1|  PREDICTED: uncharacterized protein LOC103865384  48.1    1e-04   
ref|XP_003592894.1|  hypothetical protein MTR_2g005460                48.1    1e-04   
ref|XP_006295613.1|  hypothetical protein CARUB_v10024726mg           48.1    1e-04   
ref|NP_178215.1|  zinc ion binding / nucleic acid binding protein     48.1    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010659263.1|  PREDICTED: uncharacterized protein LOC104881299  48.5    1e-04   
emb|CAN60544.1|  hypothetical protein VITISV_006250                   48.5    1e-04   Vitis vinifera
emb|CCA65996.1|  hypothetical protein                                 48.1    1e-04   
ref|XP_009101806.1|  PREDICTED: uncharacterized protein LOC103827989  48.1    1e-04   
ref|XP_006285413.1|  hypothetical protein CARUB_v10006824mg           47.8    1e-04   
ref|XP_003630108.1|  hypothetical protein MTR_8g091870                47.8    2e-04   
ref|XP_006285607.1|  hypothetical protein CARUB_v10007057mg           47.8    2e-04   
ref|XP_009139888.1|  PREDICTED: uncharacterized protein LOC103863877  47.8    2e-04   
ref|XP_006299881.1|  hypothetical protein CARUB_v10016088mg           47.4    2e-04   
ref|XP_010520311.1|  PREDICTED: uncharacterized protein LOC104799464  47.4    2e-04   
ref|XP_006282222.1|  hypothetical protein CARUB_v10028495mg           47.4    2e-04   
ref|XP_009782149.1|  PREDICTED: uncharacterized protein LOC104230937  47.0    2e-04   
gb|AAD37019.2|  putative non-LTR retrolelement reverse transcriptase  47.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682918.1|  PREDICTED: uncharacterized protein LOC104897680  47.0    3e-04   
ref|XP_003604996.1|  hypothetical protein MTR_4g022640                47.0    3e-04   
ref|XP_010467351.1|  PREDICTED: uncharacterized protein LOC104747...  46.6    4e-04   
ref|XP_006279197.1|  hypothetical protein CARUB_v10016517mg           46.6    4e-04   
gb|KDO70278.1|  hypothetical protein CISIN_1g046866mg                 47.0    4e-04   
ref|XP_010467353.1|  PREDICTED: uncharacterized protein LOC104747...  46.2    4e-04   
ref|XP_010481113.1|  PREDICTED: uncharacterized protein LOC104759949  46.2    4e-04   
ref|XP_006380429.1|  hypothetical protein POPTR_0007s05790g           46.6    4e-04   
ref|XP_007206580.1|  hypothetical protein PRUPE_ppa020297mg           46.2    4e-04   
ref|XP_006295690.1|  hypothetical protein CARUB_v10024806mg           45.1    4e-04   
ref|XP_006601654.1|  PREDICTED: uncharacterized protein LOC100791212  46.2    6e-04   
gb|KHN33899.1|  hypothetical protein glysoja_031761                   45.1    6e-04   
ref|XP_006294233.1|  hypothetical protein CARUB_v10023230mg           45.8    7e-04   
emb|CDX88033.1|  BnaA06g26240D                                        45.8    8e-04   
dbj|BAB09815.1|  non-LTR retroelement reverse transcriptase-like      45.8    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286839.1|  hypothetical protein CARUB_v10003838mg           45.4    8e-04   
ref|XP_002529397.1|  conserved hypothetical protein                   42.7    0.001   Ricinus communis



>dbj|BAE79383.1| unnamed protein product [Ipomoea batatas]
Length=532

 Score =   104 bits (260),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -3

Query  166  NVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLVT  2
            NVLN + P+LW ++GRV++IDIG+GCFV RFD+K DYLHVLLDGPWKIFDNYL+T
Sbjct  116  NVLNQRAPSLWQLKGRVQIIDIGFGCFVMRFDDKKDYLHVLLDGPWKIFDNYLIT  170



>dbj|BAE79384.1| unnamed protein product [Ipomoea batatas]
Length=1898

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -3

Query  166  NVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLVT  2
            NVLN + P+LW ++GRV++IDIG+GCFV RFD+K DYLHVLLDGPW+IFDNYL+T
Sbjct  116  NVLNQRAPSLWQLKGRVQIIDIGFGCFVMRFDDKKDYLHVLLDGPWRIFDNYLIT  170



>dbj|BAE79381.1| unnamed protein product [Ipomoea batatas]
Length=532

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  166  NVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLVT  2
            NVLN + P+L  ++GRV++IDIG+GCFV RFD+K DYLHVLLDGPWKIFDNYL+T
Sbjct  116  NVLNQRAPSLRQLKGRVQIIDIGFGCFVMRFDDKKDYLHVLLDGPWKIFDNYLIT  170



>ref|XP_010689461.1| PREDICTED: uncharacterized protein LOC104903161 [Beta vulgaris 
subsp. vulgaris]
Length=353

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + + VL  +L   W+++G++ L D+GY  +V RF N  DY  VL  GPW I D+YL
Sbjct  134  LGYEVLMRRLNQKWSLKGQIALTDVGYAYYVVRFSNNEDYNFVLTQGPWMIGDSYL  189



>ref|XP_010490183.1| PREDICTED: uncharacterized protein LOC104767918 [Camelina sativa]
Length=236

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V  +VLN KL  LWN +G + + D+  G F+ RF+ + +YL  L  GPW++F +YL+
Sbjct  101  VGISVLNRKLKELWNPKGSMYVTDLLRGFFMVRFEREEEYLAALTGGPWRVFGSYLL  157



>ref|XP_010684563.1| PREDICTED: uncharacterized protein LOC104899126 [Beta vulgaris 
subsp. vulgaris]
Length=242

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            V +  L  KL   W+++G + L DIG   F+ARF N  DY HVL  GPW I DNYL
Sbjct  70   VGYMGLMRKLKKKWSLKGDLVLTDIGCNFFIARFTNAIDYHHVLTRGPWMIDDNYL  125



>ref|XP_007037791.1| Uncharacterized protein TCM_014510 [Theobroma cacao]
 gb|EOY22292.1| Uncharacterized protein TCM_014510 [Theobroma cacao]
Length=593

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            +++  L  ++  +W + G  + +D+  G +  RFDNK+DYL VL DGPW I D+YL
Sbjct  179  ISYTYLCTRVKQMWALLGDFQAVDLENGLYCFRFDNKSDYLQVLTDGPWIIADHYL  234



>ref|XP_010693748.1| PREDICTED: uncharacterized protein LOC104906660 [Beta vulgaris 
subsp. vulgaris]
Length=332

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            V +  L  KL   W+++G + L DIG+  F+ARF N  DY  VL  GPW I DNYL
Sbjct  160  VGYMGLMRKLKRKWSLKGDLSLTDIGHKYFIARFTNPADYHFVLTQGPWMIDDNYL  215



>ref|XP_010666462.1| PREDICTED: uncharacterized protein LOC104883615 [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -3

Query  160  LNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            L  KL   W+++G V L DIG+  ++ARF    DY HVL  GPW I DNYL
Sbjct  11   LMRKLKKKWSLKGDVTLTDIGFKFYIARFTIVEDYQHVLTQGPWMIDDNYL  61



>gb|KHN17266.1| hypothetical protein glysoja_010725, partial [Glycine soja]
Length=74

 Score = 54.3 bits (129),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            +   ++  KL  LW +    E++ IG G F  +FD+K D   V+ +GPW IFD+YL+
Sbjct  13   IGLQLMKEKLTRLWKLGSGFEMLHIGNGYFTVKFDSKEDRTKVIQEGPWIIFDHYLM  69



>emb|CCA66008.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=678

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            +++++L  +L   WN++G + L D+G+  +V RF+N  DY  VL  GPW I D+YL
Sbjct  149  LSYDILVRRLKYKWNLKGDIALTDVGHAYYVVRFNNMEDYDFVLTQGPWLIGDSYL  204



>ref|XP_010682321.1| PREDICTED: uncharacterized protein LOC104897196 [Beta vulgaris 
subsp. vulgaris]
Length=356

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + +  L  +L   W+++G + + DIG   ++ARF N+ DY HVL  GPW I DNYL
Sbjct  151  LGYMALMRRLKKKWSLKGDMTMTDIGCKFYIARFTNQDDYRHVLTQGPWMIEDNYL  206



>ref|XP_010682307.1| PREDICTED: uncharacterized protein LOC104897180 [Beta vulgaris 
subsp. vulgaris]
Length=322

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + +  L  +L   W ++G + L DIG+  F+ARF + +DY HVL  GPW + DNYL
Sbjct  54   IGYMSLMKRLKRKWELKGGLILTDIGHEYFIARFSDLSDYNHVLTQGPWVLDDNYL  109



>ref|XP_010666674.1| PREDICTED: uncharacterized protein LOC104883810 [Beta vulgaris 
subsp. vulgaris]
Length=298

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + ++VL  +L   W ++G + LID+G+  +V RF N  DY  VL  GPW I ++YL
Sbjct  131  LGYDVLMRRLKAKWTLKGEIALIDVGHAYYVVRFSNLEDYDFVLTQGPWMIGESYL  186



>ref|XP_006295777.1| hypothetical protein CARUB_v10024899mg, partial [Capsella rubella]
 gb|EOA28675.1| hypothetical protein CARUB_v10024899mg, partial [Capsella rubella]
Length=451

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  163  VLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            VLN KL  LW   GR+ ++D+    F+ RF+ + +YL+ L  GPW++F NYL+
Sbjct  94   VLNRKLKELWKPSGRMYVMDLPRHFFMVRFELEEEYLNALTGGPWRVFGNYLM  146



>ref|XP_010423120.1| PREDICTED: uncharacterized protein LOC104708268 [Camelina sativa]
Length=301

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            VN +VL+ +L  LW + G + ++D+    F+ RF ++ +YL  L  GPW++F +YL+
Sbjct  102  VNISVLSKRLRELWKLSGELHVMDLPRQFFLVRFGSEVEYLAALTGGPWRVFGSYLM  158



>ref|XP_010667256.1| PREDICTED: uncharacterized protein LOC104884318 [Beta vulgaris 
subsp. vulgaris]
Length=236

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + +  L  +L   WN++G + L DIG   ++ARF N  DY +VL  GPW I D+YL
Sbjct  101  LGYMALMRRLKKKWNLKGGMVLTDIGCKFYIARFTNMEDYQYVLTQGPWMIEDHYL  156



>ref|XP_007040750.1| Zinc ion binding,nucleic acid binding-like protein [Theobroma 
cacao]
 gb|EOY25251.1| Zinc ion binding,nucleic acid binding-like protein [Theobroma 
cacao]
Length=370

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLVT  2
            +N+  L  ++  LW++ G  +++D+  G +  RF NK+D+ HVL +GPW I  +YL T
Sbjct  94   INYTYLCIRVKQLWSLIGDFQVVDLDNGFYCVRFSNKSDFDHVLTEGPWFIAGHYLST  151



>ref|XP_010689252.1| PREDICTED: uncharacterized protein LOC104902987 [Beta vulgaris 
subsp. vulgaris]
Length=370

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + + VL  +L   W I+G + L D+G+  +V RF N  DY  VL  GPW I ++YL
Sbjct  131  LGYGVLMRRLKAKWTIKGEIALTDVGHAYYVVRFSNLEDYDFVLTQGPWMIGESYL  186



>ref|XP_010424323.1| PREDICTED: uncharacterized protein LOC104709398 [Camelina sativa]
Length=246

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLVT  2
            V+ +VL+ +L  +W   G++ ++D+    F+ RFD + +Y+  L  GPW++F +YL+T
Sbjct  108  VSVSVLSKRLREMWKPVGKMAMLDLPRNFFMIRFDVEAEYMAALTGGPWRVFGSYLLT  165



>ref|XP_010687130.1| PREDICTED: uncharacterized protein LOC104901276 [Beta vulgaris 
subsp. vulgaris]
Length=296

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + + VL  +L   W ++G + L D+G+  +V RF N  DY  VL  GPW I ++YL
Sbjct  129  LGYEVLMRRLREKWTLKGEITLTDVGHAYYVVRFSNMEDYDFVLTQGPWMIGESYL  184



>ref|XP_006281498.1| hypothetical protein CARUB_v10027591mg [Capsella rubella]
 gb|EOA14396.1| hypothetical protein CARUB_v10027591mg [Capsella rubella]
Length=155

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLVT  2
            ++   ++ KL  LW  +G + ++D+    F+ RF+ + +YL  L  GPW++F +YL+T
Sbjct  90   ISIAAMSRKLNELWKPRGAMHVLDLPRQFFMVRFEIEEEYLEALTGGPWRVFGSYLMT  147



>ref|XP_006382338.1| hypothetical protein POPTR_0005s01170g, partial [Populus trichocarpa]
 gb|ERP60135.1| hypothetical protein POPTR_0005s01170g, partial [Populus trichocarpa]
Length=270

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            V++  L  +L  +W IQG + L+D+G   F+ARF NK D    +  GPW + D+YL
Sbjct  86   VSYTFLLKRLQIIWKIQGDLNLVDLGNDFFLARFSNKEDRESAMSGGPWMVADHYL  141



>ref|XP_010694032.1| PREDICTED: uncharacterized protein LOC104906902 [Beta vulgaris 
subsp. vulgaris]
Length=226

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + +  L  +L   W ++G + L DIG+  F+ARF    DY HVL  GPW   DNYL
Sbjct  133  IGYMSLIKRLKKKWELKGGLTLTDIGHDYFIARFSLLDDYNHVLTQGPWMFDDNYL  188



>ref|XP_002317857.1| hypothetical protein POPTR_0012s00280g [Populus trichocarpa]
 gb|EEE96077.1| hypothetical protein POPTR_0012s00280g [Populus trichocarpa]
Length=288

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/56 (36%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + +  +N +L  +WN     EL+D+G+G F+ +F+ + D + V+  GPW I D+YL
Sbjct  114  IGYTQMNIRLKKVWNFAKGFELMDVGHGFFMVKFNQEMDRMKVMNGGPWMILDHYL  169



>gb|KHN48369.1| hypothetical protein glysoja_049216 [Glycine soja]
Length=86

 Score = 49.3 bits (116),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + +NV+  +L  LW +    +++DIG   ++ +FD   D   V+ +GPW IFD+YL
Sbjct  29   IGYNVMKGRLTRLWRLTVGFDIMDIGNNFYMVKFDTGMDKTKVMEEGPWMIFDHYL  84



>ref|XP_006385277.1| hypothetical protein POPTR_0003s02390g, partial [Populus trichocarpa]
 gb|ERP63074.1| hypothetical protein POPTR_0003s02390g, partial [Populus trichocarpa]
Length=285

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + F  LN +L NL  + G  EL+D+  G F+ +FD + D   V+ +GPW +FD++L
Sbjct  48   IGFYQLNTRLKNLLKLTGGFELMDVANGFFMVKFDLEMDKTKVINEGPWMVFDHHL  103



>ref|XP_006296651.1| hypothetical protein CARUB_v10015577mg, partial [Capsella rubella]
 gb|EOA29549.1| hypothetical protein CARUB_v10015577mg, partial [Capsella rubella]
Length=476

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V  + L+ KL  LW   G + ++D+   CF+ RFD + +Y   L  GPWK+F +YL+
Sbjct  90   VAISALSRKLRELWKPNGGMYVLDLPRQCFMIRFDREDEYHAALTGGPWKVFGSYLL  146



>ref|XP_006296775.1| hypothetical protein CARUB_v10015820mg [Capsella rubella]
 gb|EOA29673.1| hypothetical protein CARUB_v10015820mg [Capsella rubella]
Length=503

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V  + L+ KL  LW   G + ++D+   CF+ RFD + +Y   L  GPWK+F +YL+
Sbjct  90   VAISALSRKLRELWKPNGGMYVLDLPRQCFMIRFDREDEYHAALTGGPWKVFGSYLL  146



>gb|AEL30359.1| RNA-directed DNA polymerase [Arachis hypogaea]
Length=1613

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  169  FNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            +  L +KL  +W I+G  +L+D+G+G F+A+FD  TD   V+L GPW I  +Y+
Sbjct  105  YTALMHKLRIVWRIKGGFDLLDVGFGYFLAKFDIATDREKVILGGPWLIDGHYV  158



>ref|XP_010684905.1| PREDICTED: uncharacterized protein LOC104899417 [Beta vulgaris 
subsp. vulgaris]
Length=254

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/56 (38%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + + VL  +L   W+++G + L D+ +  +V RF N  DY  VL  GPW I ++YL
Sbjct  93   LGYEVLMRRLKAKWSLKGEIALTDVSHAYYVVRFSNLDDYDFVLTQGPWMIGESYL  148



>gb|KHN35462.1| hypothetical protein glysoja_032217, partial [Glycine soja]
Length=141

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            + +N +  KL  LW ++   E++DIG   F  +FD + D + V  + PW IFD+YL 
Sbjct  9    LGYNFMREKLRRLWKLKAGFEMLDIGNSFFTIKFDIEEDRIKVNQEDPWMIFDHYLT  65



>ref|XP_010474089.1| PREDICTED: uncharacterized protein LOC104753550 [Camelina sativa]
Length=227

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  163  VLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            VL  KL  LW  +G + ++D+    F+ RFD + +Y+  L  GPW+IF NYL+
Sbjct  112  VLQRKLRVLWKPKGAMYVMDLPRQFFMVRFDVEEEYMVALTGGPWRIFGNYLM  164



>ref|XP_010680847.1| PREDICTED: uncharacterized protein LOC104895900 [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 29/52 (56%), Gaps = 0/52 (0%)
 Frame = -3

Query  160  LNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            L  +L   WNI+G   L DI    +VARF N+ DY   L  GPW I DNYL 
Sbjct  110  LMRRLKKKWNIKGEFVLTDIACHYYVARFTNEADYQFFLTQGPWLIDDNYLT  161



>gb|KDO36419.1| hypothetical protein CISIN_1g044040mg, partial [Citrus sinensis]
Length=151

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLVT  2
            + + VL N+L  LWN+     +ID+    F+ RF  + D  HV   GPW +F +YL++
Sbjct  57   IGYKVLCNRLEALWNMSYDFSVIDLENNYFLVRFKREFDAQHVFTQGPWIVFGHYLMS  114



>ref|XP_009101980.1| PREDICTED: uncharacterized protein LOC103828133 [Brassica rapa]
Length=510

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V    LN KL  LW+ +G + ++D+    F+ RF+ + +YL  L  GPW+IF +YL+
Sbjct  90   VAIAALNRKLRELWSPKGAMYVMDLPRQFFMVRFEKEEEYLAALSGGPWRIFGSYLM  146



>ref|XP_009129252.1| PREDICTED: uncharacterized protein LOC103854088 [Brassica rapa]
Length=515

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V  + L+ KL  LWN +G + ++D+    F+ RF+ + +Y+  L  GPW++F +YL+
Sbjct  90   VAISALSRKLRELWNPKGAMYVMDLPRQFFMVRFEKEDEYMAALTGGPWRVFGSYLM  146



>ref|XP_010690660.1| PREDICTED: uncharacterized protein LOC104904165 [Beta vulgaris 
subsp. vulgaris]
Length=442

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            +N N L +++  +W  + R+E+ID+G G F+ +F N  D    L   PW I ++YL+
Sbjct  139  INRNFLVDRVNRMWKTKDRLEVIDLGQGIFLLKFHNSDDMERALYGSPWFILNHYLM  195



>gb|KHN11702.1| hypothetical protein glysoja_006155, partial [Glycine soja]
Length=70

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            +NF +L++++  LW +    +++DIG   F+ +FD K D + V+  GPW IF +YL
Sbjct  15   INFQMLHDQVTKLWRLVVGFDMVDIGNKYFMVKFDLKEDGIKVIEGGPWMIFYHYL  70



>ref|XP_010418769.1| PREDICTED: uncharacterized protein LOC104704363 [Camelina sativa]
Length=371

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/53 (38%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  163  VLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            VL+ KL  LW  +G + ++D+    F+ RF  + +Y+  L  GPW++F NYL+
Sbjct  73   VLSRKLRELWKPKGEMYVMDLPRQFFMVRFTQEDEYMGALTGGPWRVFGNYLM  125



>ref|XP_009121310.1| PREDICTED: uncharacterized protein LOC103846155 [Brassica rapa]
Length=515

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V  + L+ KL  LWN +G + ++D+    F+ RF+ + +Y+  L  GPW++F +YL+
Sbjct  90   VAISALSRKLRELWNPRGAMYVMDLPRQFFMVRFEKEDEYMAALTGGPWRVFGSYLM  146



>ref|XP_009126860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851737 
[Brassica rapa]
Length=1638

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -3

Query  160  LNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            LN KL  LWN +G + ++D+    F+ RF+ + +YL  L  GPW+ F +YL+
Sbjct  95   LNRKLRELWNPKGAMYVMDLPRQFFMVRFEKEEEYLAALTGGPWRAFGSYLM  146



>ref|XP_006388296.1| hypothetical protein POPTR_0241s00200g, partial [Populus trichocarpa]
 gb|ERP47210.1| hypothetical protein POPTR_0241s00200g, partial [Populus trichocarpa]
Length=212

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + F  LN +L NL  + G  EL+D+  G F+ +F  + D   V+ +GPW +FD++L
Sbjct  1    IGFYQLNTRLKNLSKLTGGFELMDVANGFFMVKFGLEVDKTKVINEGPWMVFDHHL  56



>ref|XP_006286068.1| hypothetical protein CARUB_v10007601mg, partial [Capsella rubella]
 gb|EOA18966.1| hypothetical protein CARUB_v10007601mg, partial [Capsella rubella]
Length=459

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/53 (38%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  163  VLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V++ KL  +W  QG + + D+ +  FV RF+ + +Y+  L  GPWK+F +YL+
Sbjct  91   VMSRKLKEMWRPQGAMVVTDLPHQFFVVRFELEEEYMAALTGGPWKMFGSYLM  143



>gb|KHN27042.1| hypothetical protein glysoja_049797, partial [Glycine soja]
Length=94

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            + +N++ +KL  +W ++   ++IDIG   FV + +   D   ++ +GPW IFD+YL+
Sbjct  30   IGYNIMKDKLSRIWKLKVGFDMIDIGNDFFVVKLNLDEDRKKIIENGPWMIFDHYLI  86



>ref|XP_006296777.1| hypothetical protein CARUB_v10015822mg, partial [Capsella rubella]
 gb|EOA29675.1| hypothetical protein CARUB_v10015822mg, partial [Capsella rubella]
Length=333

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -3

Query  160  LNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            L+ +L  LW   G + ++D+    F+ RFDN+ DY+ V+  GPW++F + L+
Sbjct  92   LSKRLRELWKPTGGMSVLDLPRQFFMVRFDNEADYMAVMTGGPWRLFGSVLM  143



>emb|CAB96840.1| putative protein [Arabidopsis thaliana]
 gb|AAQ65142.1| At5g10850 [Arabidopsis thaliana]
 dbj|BAD43953.1| putative protein [Arabidopsis thaliana]
Length=181

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/57 (32%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            +  + L+ KL  +W  +G + ++D+    F+ RF+ + +Y+  L  GPW+ FD YL+
Sbjct  106  MTISALSRKLREMWKPRGAMSVVDLPRKFFMIRFEAEEEYMAALTGGPWRAFDRYLM  162



>ref|XP_006382318.1| hypothetical protein POPTR_0005s00970g [Populus trichocarpa]
 gb|ERP60115.1| hypothetical protein POPTR_0005s00970g [Populus trichocarpa]
Length=163

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V++  L  +L  +W I G + L+D+G   F ARF NK D    +  GPW + D+YL 
Sbjct  86   VSYTFLLKRLQIIWKILGDLNLVDLGNDFFRARFSNKEDRESAMSGGPWMVADHYLT  142



>ref|XP_010480590.1| PREDICTED: uncharacterized protein LOC104759346 [Camelina sativa]
Length=254

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            ++  VL+ KL  LWN +G + ++D+    F+ RFD + ++L  L  GPWK F +YL+
Sbjct  90   ISIAVLSRKLRELWNPKGGMYVLDLPRQFFMIRFDIEEEFLAALTGGPWKAFGSYLM  146



>ref|XP_010513494.1| PREDICTED: uncharacterized protein LOC104789504 [Camelina sativa]
Length=326

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V+  VL+ KL  LW  +G + ++D+    F+ RF+ + +YL  L  GPW++F +YL+
Sbjct  103  VSIAVLSQKLRELWKPKGPMFVMDLPRQFFMVRFEREDEYLAALSGGPWRVFGSYLM  159



>gb|KHN04954.1| hypothetical protein glysoja_013861, partial [Glycine soja]
Length=243

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 18/57 (32%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            + F+V+  +L  +W +    E++DI +G ++  FD +   + ++ + PW IFDNYL+
Sbjct  73   IGFHVMKERLTRIWKLNAGFEILDIDHGYYMITFDQEAYRVKLIGEEPWMIFDNYLI  129



>ref|XP_009119466.1| PREDICTED: uncharacterized protein LOC103844431 [Brassica rapa]
Length=1834

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V    L+ KL  LWN +G + ++D+    F+ RF+ + +YL  L  GPW+ F +YL+
Sbjct  90   VPITALSRKLRELWNPKGSMYVMDLPRQFFMVRFEKEDEYLEALTGGPWRAFGSYLM  146



>ref|XP_006301940.1| hypothetical protein CARUB_v10022418mg, partial [Capsella rubella]
 gb|EOA34838.1| hypothetical protein CARUB_v10022418mg, partial [Capsella rubella]
Length=493

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  163  VLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            VL+ KL  +W  QG + + D+    FV RF+ + +Y+  L  GPWK+F +YL+
Sbjct  107  VLSRKLKEMWRPQGAMVVTDLPRQFFVVRFEFEEEYMAALTGGPWKMFGSYLM  159



>ref|XP_006287598.1| hypothetical protein CARUB_v10000810mg, partial [Capsella rubella]
 gb|EOA20496.1| hypothetical protein CARUB_v10000810mg, partial [Capsella rubella]
Length=493

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  163  VLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            VL+ KL  +W  QG + + D+    FV RF+ + +Y+  L  GPWK+F +YL+
Sbjct  107  VLSRKLKEMWRPQGAMVVTDLPRQFFVVRFEFEEEYMAALTGGPWKMFGSYLM  159



>ref|XP_007021978.1| Uncharacterized protein TCM_032108 [Theobroma cacao]
 gb|EOY13503.1| Uncharacterized protein TCM_032108 [Theobroma cacao]
Length=129

 Score = 46.6 bits (109),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            +++ VL +++ +LW+ +G+ +++D+    ++  F  + DYL  LLDGPW +   YL+
Sbjct  53   ISYKVLCDRIISLWSPKGKYKVVDLDEENYLVNFSLEEDYLKALLDGPWMVQGQYLI  109



>ref|XP_010463327.1| PREDICTED: uncharacterized protein LOC104743994 [Camelina sativa]
Length=851

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLVT  2
            V+ +VL  +L  +W   G + ++D+    F+ RFD + +Y+  L  GPW++F +YL+T
Sbjct  90   VSVSVLTKRLKEMWKPVGAMSVLDLPRQYFMIRFDVEAEYMVALTGGPWRMFGSYLLT  147



>ref|XP_006295736.1| hypothetical protein CARUB_v10024855mg [Capsella rubella]
 gb|EOA28634.1| hypothetical protein CARUB_v10024855mg [Capsella rubella]
Length=479

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 17/57 (30%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            ++   ++ +L  +W  +G + ++D+    F+ARF+++ +YL  L  GPW++F +YL+
Sbjct  79   ISIAAMSRRLKEMWKPKGAMHVLDLPRQFFMARFEHEEEYLEALTGGPWRMFGSYLM  135



>ref|XP_010463475.1| PREDICTED: uncharacterized protein LOC104744160 [Camelina sativa]
Length=264

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 18/57 (32%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            +  +VL+ +L  +W  +G + ++D+    F+ RF+ + +YL  L+ GPW+ F +YL+
Sbjct  58   IRLSVLSRRLREMWKPKGAMYVMDLPRQFFMVRFEQEDEYLAALIGGPWRAFGSYLM  114



>ref|XP_006292963.1| hypothetical protein CARUB_v10019240mg, partial [Capsella rubella]
 gb|EOA25861.1| hypothetical protein CARUB_v10019240mg, partial [Capsella rubella]
Length=405

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -3

Query  160  LNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            ++ KL  LW  +G + + D+    F+ RFD + +Y+  L  GPWK+F +YL+
Sbjct  63   MSRKLRELWKPKGAMHVTDLPRQFFMVRFDMEEEYMEALTGGPWKVFGSYLM  114



>ref|XP_006305928.1| hypothetical protein CARUB_v10011149mg [Capsella rubella]
 gb|EOA38826.1| hypothetical protein CARUB_v10011149mg [Capsella rubella]
Length=245

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V+  VL+ KL  +W   G + ++D+    F+ RF+ + +YL  L  GPWK F +YL+
Sbjct  62   VSLQVLSRKLKEMWEPIGAIYVVDLPRQFFMVRFELEEEYLTALTGGPWKAFGSYLM  118



>ref|XP_006606936.1| PREDICTED: uncharacterized protein LOC102668273 [Glycine max]
Length=280

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            + F+V+  +L  +W +    E++DI +G ++  FD +   + ++ + PW IFDNYL+
Sbjct  83   IGFHVMKERLTRIWKLNAGFEILDIDHGYYMVTFDQEAYRVKLIGEEPWMIFDNYLI  139



>ref|XP_006293025.1| hypothetical protein CARUB_v10019305mg, partial [Capsella rubella]
 gb|EOA25923.1| hypothetical protein CARUB_v10019305mg, partial [Capsella rubella]
Length=361

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V+  VL  KL  +W  +G + ++D+    F+ RF+ + +YL  L  GPW+IF +YL+
Sbjct  90   VSIAVLLKKLREMWRPKGAMYVVDLPRQFFMVRFELEDEYLEALTGGPWRIFGSYLM  146



>ref|XP_010692742.1| PREDICTED: uncharacterized protein LOC104905804 [Beta vulgaris 
subsp. vulgaris]
Length=138

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -3

Query  112  LIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            + DIGY  ++ARF N+ DY +VL  GPW I DNYL 
Sbjct  1    MTDIGYKFYIARFTNQDDYHYVLTQGPWMIEDNYLT  36



>ref|XP_006282338.1| hypothetical protein CARUB_v10028633mg, partial [Capsella rubella]
 gb|EOA15236.1| hypothetical protein CARUB_v10028633mg, partial [Capsella rubella]
Length=463

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = -3

Query  163  VLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            VL  KL  LW  QG + + D+    F+ RF+ + +YL  L  GPWK F +YL+
Sbjct  92   VLTRKLKELWKPQGAMYVTDLPRQFFMVRFEVEDEYLTALTGGPWKAFGSYLM  144



>ref|XP_009151454.1| PREDICTED: uncharacterized protein LOC103874766 [Brassica rapa]
Length=510

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -3

Query  160  LNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            L  KL  LW  +G + ++D+    F+ RF+ + +Y+  L DGPW+ F +YL+
Sbjct  95   LTRKLKELWKPKGSMYVMDLPRQFFMVRFEKEEEYMTALADGPWRAFGSYLM  146



>gb|KDO44000.1| hypothetical protein CISIN_1g046515mg, partial [Citrus sinensis]
Length=495

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/56 (36%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + + VL+++L  +W+     E+ID+G   F+ RF+NK D  + L +GPW +  +YL
Sbjct  58   LGYRVLSSRLNRIWSSTIGFEIIDLGNDYFLIRFNNKKDVEYALTEGPWTLMGHYL  113



>ref|XP_009141433.1| PREDICTED: uncharacterized protein LOC103865384 [Brassica rapa]
Length=414

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -3

Query  160  LNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            LN KL  LW  +G + ++D+    F+ RFD + +Y+  L  GPW+ F +YL+
Sbjct  97   LNRKLRELWKPRGSMFVMDLPRNFFIVRFDLEEEYMAALSGGPWRAFGSYLM  148



>ref|XP_003592894.1| hypothetical protein MTR_2g005460 [Medicago truncatula]
 gb|ABE91952.1| Zinc finger, CCHC-type [Medicago truncatula]
Length=504

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + +N + ++L  +W +QG  +++D   G F+ +FD   D   V+  GPW IFD+ L
Sbjct  100  LGYNTMKDRLQKIWKLQGGFDIMDNDNGFFMVKFDQAADKEKVITGGPWLIFDHCL  155



>ref|XP_006295613.1| hypothetical protein CARUB_v10024726mg, partial [Capsella rubella]
 gb|EOA28511.1| hypothetical protein CARUB_v10024726mg, partial [Capsella rubella]
Length=489

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/53 (38%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  163  VLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V++ KL  +W  QG + + D+    FV RF+ + +Y+  L  GPWK+F +YL+
Sbjct  91   VMSRKLKEMWRPQGAMVVTDLPRQFFVVRFELEEEYMAALTGGPWKMFGSYLM  143



>ref|NP_178215.1| zinc ion binding / nucleic acid binding protein [Arabidopsis 
thaliana]
 gb|AAF18653.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC05391.1| zinc ion binding / nucleic acid binding protein [Arabidopsis 
thaliana]
Length=515

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            +  +VLN KL  LW   G + ++D+    F+ RF+ + +Y+  L  GPW++  NYL+
Sbjct  90   IPISVLNRKLRELWKPSGVMTVMDLPRQFFMIRFELEEEYMAALTGGPWRVLGNYLL  146



>ref|XP_010659263.1| PREDICTED: uncharacterized protein LOC104881299 [Vitis vinifera]
 ref|XP_010659264.1| PREDICTED: uncharacterized protein LOC104881299 [Vitis vinifera]
Length=833

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  148  LPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            L  LW+++G V++ID+GYG F+ +F   TDY+ V    PW I   Y+
Sbjct  122  LHRLWSLEGTVDIIDLGYGFFLLKFSLPTDYIKVFKGVPWLIHGYYI  168



>emb|CAN60544.1| hypothetical protein VITISV_006250 [Vitis vinifera]
Length=833

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  148  LPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            L  LW+++G V++ID+GYG F+ +F   TDY+ V    PW I   Y+
Sbjct  122  LHRLWSLEGTVDIIDLGYGFFLLKFSLPTDYIKVFKGVPWLIHGYYI  168



>emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=744

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            ++ N L  ++  +W    +VE+ID+G+  F+ +F+N  D    L  GPW I ++YL+
Sbjct  135  ISRNFLVERVNRIWKTNDKVEVIDLGHDVFLFKFNNGNDMEKALFGGPWFILNHYLM  191



>ref|XP_009101806.1| PREDICTED: uncharacterized protein LOC103827989 [Brassica rapa]
Length=512

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V    L+ KL  LW+ +G + ++D+    F+ RF+ + +YL  L  GPW+IF +YL+
Sbjct  90   VAIAALSKKLRELWSPKGAMYVMDLPRQFFMVRFEREEEYLAALSGGPWRIFGSYLM  146



>ref|XP_006285413.1| hypothetical protein CARUB_v10006824mg [Capsella rubella]
 gb|EOA18311.1| hypothetical protein CARUB_v10006824mg [Capsella rubella]
Length=446

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = -3

Query  148  LPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            L  LW   G + ++D+   CF+ RF+ + +YL  L  GPWK+F +YL+
Sbjct  76   LVKLWKPTGGMYVLDLPRQCFMIRFEREEEYLAALTGGPWKVFGSYLL  123



>ref|XP_003630108.1| hypothetical protein MTR_8g091870 [Medicago truncatula]
Length=423

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            + +N +  +L  +W  QG  E++D   G ++ +FD  +D   V+  GPW IFD+ +V
Sbjct  48   LGYNTMKERLHKVWKTQGGFEIMDNDNGFYMVKFDQTSDKEKVITGGPWMIFDHCMV  104



>ref|XP_006285607.1| hypothetical protein CARUB_v10007057mg, partial [Capsella rubella]
 gb|EOA18505.1| hypothetical protein CARUB_v10007057mg, partial [Capsella rubella]
Length=394

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            +   VL+ +L ++WN    + ++D+    F+ RF+++ +Y+  L  GPWKIF +YL+
Sbjct  90   ITIAVLSRRLRDMWNPSRDMFVLDLPRQFFMVRFESEEEYMAALTGGPWKIFGSYLM  146



>ref|XP_009139888.1| PREDICTED: uncharacterized protein LOC103863877 [Brassica rapa]
Length=516

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V  + L+ KL  LW+ +G + ++D+    F+ RF+ + +YL  L  GPW+ F +YL+
Sbjct  114  VPISALSRKLRELWSPKGSMYVMDLPRQFFMVRFEKEDEYLEALTGGPWRAFGSYLM  170



>ref|XP_006299881.1| hypothetical protein CARUB_v10016088mg, partial [Capsella rubella]
 gb|EOA32779.1| hypothetical protein CARUB_v10016088mg, partial [Capsella rubella]
Length=340

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/58 (33%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLVT  2
            V+ +VL+ +L +LW   G + ++D+    F+ RF+ + +Y+  L  GPW++F + L+T
Sbjct  90   VSVSVLSRRLRDLWKPAGAMHVMDLPRQFFMIRFEKEEEYMAALTGGPWRVFGSCLLT  147



>ref|XP_010520311.1| PREDICTED: uncharacterized protein LOC104799464 [Tarenaya hassleriana]
Length=548

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/56 (34%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            +++  ++++L  LW   GR+ +ID+    F+ RF  + DY   L +GPW I   YL
Sbjct  109  LSYKTMSSRLETLWKPMGRLTVIDLENEFFLVRFQKEEDYQRALCEGPWVILGAYL  164



>ref|XP_006282222.1| hypothetical protein CARUB_v10028495mg, partial [Capsella rubella]
 gb|EOA15120.1| hypothetical protein CARUB_v10028495mg, partial [Capsella rubella]
Length=409

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/57 (32%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            +  + LN KL  +W  +G + ++D+    F+ RFD + DY+  +  GPW++F + L+
Sbjct  105  ITIDALNRKLKEMWKPRGGMAVLDLPRQFFMIRFDLEEDYMAAVTGGPWRVFGSILM  161



>ref|XP_009782149.1| PREDICTED: uncharacterized protein LOC104230937 [Nicotiana sylvestris]
 ref|XP_009782150.1| PREDICTED: uncharacterized protein LOC104230937 [Nicotiana sylvestris]
Length=330

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/56 (38%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            +   +L  KL +LW     + LID+G   F+ +F  K + LH L DGPW I  ++L
Sbjct  103  IGHQLLKAKLQSLWKPTELLHLIDLGSAFFLIKFTQKNNMLHALHDGPWFILGHFL  158



>gb|AAD37019.2| putative non-LTR retrolelement reverse transcriptase [Arabidopsis 
thaliana]
Length=855

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -3

Query  160  LNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            LN +L  +W  QG + ++D+    F+ RF+ + +YL  L  GPW+ F +YL+
Sbjct  70   LNRRLREMWKPQGAMFVVDLPCQFFMIRFEREDEYLSALTGGPWRAFGSYLL  121



>ref|XP_010682918.1| PREDICTED: uncharacterized protein LOC104897680 [Beta vulgaris 
subsp. vulgaris]
Length=452

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/52 (33%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -3

Query  160  LNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            +  ++ ++W  +G +E+ID+G   ++ RF  + DY   L  GPW + D+YL+
Sbjct  113  ITQRVRSMWKPRGTLEVIDLGKDTYLFRFSLQDDYERALFGGPWYVLDHYLM  164



>ref|XP_003604996.1| hypothetical protein MTR_4g022640 [Medicago truncatula]
Length=513

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + +N + ++L  +W +Q   E++D   G ++ +FD + D   V+  GPW IFD+ L
Sbjct  97   LGYNTMKDRLQRIWKLQSGFEIMDNDNGFYMVKFDQEADKEKVVTGGPWMIFDHCL  152



>ref|XP_010467351.1| PREDICTED: uncharacterized protein LOC104747425 isoform X1 [Camelina 
sativa]
 ref|XP_010467352.1| PREDICTED: uncharacterized protein LOC104747425 isoform X1 [Camelina 
sativa]
Length=377

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V   VL+ K   LW ++G + ++D+    F+ RF+ + +Y+  ++ GPWK F +YL+
Sbjct  135  VPLPVLSRKFWELWKLRGGMTVLDLPRQFFIIRFEVEEEYMAAVIGGPWKAFGSYLM  191



>ref|XP_006279197.1| hypothetical protein CARUB_v10016517mg, partial [Capsella rubella]
 gb|EOA12095.1| hypothetical protein CARUB_v10016517mg, partial [Capsella rubella]
Length=457

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/55 (33%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = -3

Query  169  FNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
             + L+ KL  LW   G + ++D+    F+ RF+ + +YL  L  GPW++F ++L+
Sbjct  88   LSALSRKLKELWKPTGEMSVVDLPRQFFMIRFEREEEYLAALTGGPWRVFGSHLM  142



>gb|KDO70278.1| hypothetical protein CISIN_1g046866mg, partial [Citrus sinensis]
Length=583

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/56 (34%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + + VL+++L  +W+     E+ID+    F+ RF+NK D  + L +GPW +  +YL
Sbjct  107  LGYRVLSSRLNMIWSSTTGFEIIDLANDYFLIRFNNKKDVEYALTEGPWTVMGHYL  162



>ref|XP_010467353.1| PREDICTED: uncharacterized protein LOC104747425 isoform X2 [Camelina 
sativa]
Length=351

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V   VL+ K   LW ++G + ++D+    F+ RF+ + +Y+  ++ GPWK F +YL+
Sbjct  109  VPLPVLSRKFWELWKLRGGMTVLDLPRQFFIIRFEVEEEYMAAVIGGPWKAFGSYLM  165



>ref|XP_010481113.1| PREDICTED: uncharacterized protein LOC104759949 [Camelina sativa]
Length=285

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLVT  2
            ++   L  KL  +W  +G + ++D+    F+ RFD + +YL VL  GPW  F +YL+T
Sbjct  105  ISIAALTRKLREMWKPKGGMYVMDLPRQFFMIRFDLEEEYLSVLTGGPWIAFGSYLLT  162



>ref|XP_006380429.1| hypothetical protein POPTR_0007s05790g [Populus trichocarpa]
 gb|ERP58226.1| hypothetical protein POPTR_0007s05790g [Populus trichocarpa]
Length=378

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/56 (38%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            V +  L+ +L     +QG   L+D+G   F+++F N  D  HVL +GPW   D+YL
Sbjct  116  VGYMYLHKRLKTPRKLQGDPSLVDLGNEFFLSKFSNNEDKEHVLFEGPWMDADHYL  171



>ref|XP_007206580.1| hypothetical protein PRUPE_ppa020297mg, partial [Prunus persica]
 gb|EMJ07779.1| hypothetical protein PRUPE_ppa020297mg, partial [Prunus persica]
Length=346

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLVT  2
            + +N L+ +L   W ++G + LID+    F+ +F  + D  +VL  GPW+I   YLVT
Sbjct  35   LTYNFLHARLLQRWALKGPMSLIDLENNYFIVKFLLEEDMQYVLTGGPWQIAGQYLVT  92



>ref|XP_006295690.1| hypothetical protein CARUB_v10024806mg [Capsella rubella]
 gb|EOA28588.1| hypothetical protein CARUB_v10024806mg [Capsella rubella]
Length=185

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -3

Query  160  LNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            L  KL  +W  +G + ++D+    F+ RFD + DYL V+  GPW++F + L+
Sbjct  91   LVRKLREIWVPKGGMHVVDLPRHFFIVRFDLEEDYLSVVTGGPWRLFGSLLM  142



>ref|XP_006601654.1| PREDICTED: uncharacterized protein LOC100791212 [Glycine max]
Length=484

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
            + F  + + L  +W +    +++DIG   ++ +FD   D   V+  GPW IFD+YL
Sbjct  103  IGFQAMKDHLTRIWKLVAGFDILDIGNHFYMVKFDTTEDRQKVIEGGPWMIFDHYL  158



>gb|KHN33899.1| hypothetical protein glysoja_031761, partial [Glycine soja]
Length=212

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 31/57 (54%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            + F  + + L  +W +    +++DIG   ++ +FD   D   V+  GPW IFD+YL 
Sbjct  34   IGFQAMKDHLTRIWKLVAGFDILDIGNHFYMVKFDTTEDRQKVIEGGPWMIFDHYLT  90



>ref|XP_006294233.1| hypothetical protein CARUB_v10023230mg, partial [Capsella rubella]
 gb|EOA27131.1| hypothetical protein CARUB_v10023230mg, partial [Capsella rubella]
Length=440

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            ++ +VL+ +L  +W  +G + ++D+    F+ RF+   +YL VL  GPW+ F +YL+
Sbjct  90   MSISVLSKRLREMWKPRGVMHVVDLPRQFFMIRFELVEEYLAVLTGGPWRAFGSYLM  146



>emb|CDX88033.1| BnaA06g26240D [Brassica napus]
Length=508

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/52 (35%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -3

Query  160  LNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            L  KL  LW   G + ++D+    F+ RF+++ +Y++ L  GPW+ F +YL+
Sbjct  95   LTRKLKELWKPNGSMFVMDLPRNFFMVRFESEEEYMNALSGGPWRAFGSYLM  146



>dbj|BAB09815.1| non-LTR retroelement reverse transcriptase-like [Arabidopsis 
thaliana]
Length=676

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -3

Query  175  VNFNVLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            V+   L+ KL  LW  +G + ++D+    FV RFD + DYL  +  GPW++F + L+
Sbjct  104  VSIAALSRKLRELWKPRGGMYVLDLPRQFFVVRFDVEEDYLAAVTGGPWRLFGSVLM  160



>ref|XP_006286839.1| hypothetical protein CARUB_v10003838mg, partial [Capsella rubella]
 gb|EOA19737.1| hypothetical protein CARUB_v10003838mg, partial [Capsella rubella]
Length=391

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/53 (36%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -3

Query  163  VLNNKLPNLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYLV  5
            VL+ +L  LW     + ++D+    F+ RF++  +YL  L  GPWK+F +YL+
Sbjct  94   VLSRRLKELWRPSRDMVVVDLPRQFFMVRFESDDEYLAALTGGPWKVFGSYLM  146



>ref|XP_002529397.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32993.1| conserved hypothetical protein [Ricinus communis]
Length=78

 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -3

Query  142  NLWNIQGRVELIDIGYGCFVARFDNKTDYLHVLLDGPWKIFDNYL  8
             +W ++G  ++ID+  G F+ +   K D  H++LDGPW I  +YL
Sbjct  2    TIWKLRGHYKVIDLDNGFFLIKLALKEDLEHIILDGPWTILGHYL  46



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509996894868