BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84542_g1_i1 len=478 path=[1:0-477]

Length=478
                                                                      Score     E

ref|XP_007041813.1|  S phase kinase-associated protein 1                180   3e-54   
gb|KHG30151.1|  SKP1-like protein 1A                                    180   3e-54   
gb|KHN41877.1|  SKP1-like protein 1A                                    178   1e-53   
gb|ABB77426.1|  Skp1-like protein 1                                     178   2e-53   Petunia integrifolia subsp. inflata
ref|XP_003517160.1|  PREDICTED: SKP1-like protein 1A-like               177   3e-53   
ref|XP_009779583.1|  PREDICTED: SKP1-like protein 1A                    176   6e-53   
ref|XP_009420815.1|  PREDICTED: SKP1-like protein 1A                    176   1e-52   
ref|XP_007157884.1|  hypothetical protein PHAVU_002G106100g             176   1e-52   
ref|NP_001235929.1|  uncharacterized protein LOC100527683               176   1e-52   
ref|XP_010690359.1|  PREDICTED: SKP1-like protein 1B                    175   3e-52   
gb|AAO85510.1|  SKP1                                                    174   3e-52   Nicotiana benthamiana
gb|EYU17579.1|  hypothetical protein MIMGU_mgv1a015014mg                175   4e-52   
ref|XP_009591491.1|  PREDICTED: SKP1-like protein 1A                    174   4e-52   
ref|XP_009334694.1|  PREDICTED: SKP1-like protein 1B                    174   5e-52   
ref|XP_009620406.1|  PREDICTED: SKP1-like protein 1A                    174   7e-52   
gb|ACA61784.1|  SKP1-like protein 2                                     173   9e-52   Petunia x hybrida [garden petunia]
ref|XP_009624361.1|  PREDICTED: SKP1-like protein 1A isoform X1         172   2e-51   
gb|ABB77425.1|  Skp1-like protein 3                                     172   2e-51   Petunia integrifolia subsp. inflata
ref|XP_009624363.1|  PREDICTED: SKP1-like protein 1A isoform X2         172   2e-51   
gb|ACA61785.1|  SKP1-like protein 3                                     172   2e-51   Petunia x hybrida [garden petunia]
ref|XP_003612225.1|  SKP1-like protein                                  172   2e-51   
emb|CDP14555.1|  unnamed protein product                                172   3e-51   
gb|AFK44762.1|  unknown                                                 171   6e-51   
ref|XP_006362720.1|  PREDICTED: SKP1-like protein 1B-like               171   9e-51   
gb|EMT03937.1|  SKP1-like protein 1A                                    171   9e-51   
ref|XP_009783395.1|  PREDICTED: SKP1-like protein 1A                    171   1e-50   
gb|AAT99735.1|  SKP1                                                    171   1e-50   Nicotiana tabacum [American tobacco]
ref|XP_004512164.1|  PREDICTED: SKP1-like protein 1A-like               171   1e-50   
gb|ACJ86090.1|  unknown                                                 171   1e-50   Medicago truncatula
ref|XP_010536422.1|  PREDICTED: SKP1-like protein 1A                    171   1e-50   
gb|ABB77427.1|  Skp1-like protein 2                                     170   1e-50   Petunia integrifolia subsp. inflata
ref|XP_004250723.1|  PREDICTED: SKP1-like protein 1A                    170   1e-50   
ref|XP_007225985.1|  hypothetical protein PRUPE_ppa012755mg             170   2e-50   
gb|EPS66410.1|  hypothetical protein M569_08366                         170   2e-50   
ref|XP_006360903.1|  PREDICTED: SKP1-like protein 1B-like               170   2e-50   
gb|AAD34458.1|  Skp1                                                    169   3e-50   Medicago sativa [alfalfa]
gb|ACA61783.1|  SKP1-like protein 1                                     169   3e-50   Petunia x hybrida [garden petunia]
ref|XP_006422586.1|  hypothetical protein CICLE_v10029465mg             169   4e-50   
ref|XP_010550803.1|  PREDICTED: SKP1-like protein 1B                    169   4e-50   
ref|XP_002863814.1|  hypothetical protein ARALYDRAFT_917589             169   5e-50   
ref|XP_010683698.1|  PREDICTED: SKP1-like protein 1B isoform X1         169   5e-50   
gb|AAX83944.1|  Skp1                                                    169   6e-50   Capsicum annuum
gb|AFB18000.1|  SKP1 protein                                            169   7e-50   
ref|XP_010935123.1|  PREDICTED: SKP1-like protein 1B                    169   7e-50   
ref|XP_009379340.1|  PREDICTED: SKP1-like protein 1A                    169   8e-50   
ref|XP_004291337.1|  PREDICTED: SKP1-like protein 1B-like               168   1e-49   
ref|XP_008393845.1|  PREDICTED: SKP1-like protein 1A                    168   1e-49   
ref|XP_007046627.1|  S phase kinase-associated protein 1                168   1e-49   
gb|EPS61104.1|  hypothetical protein M569_13700                         168   1e-49   
gb|KHG24597.1|  SKP1-like protein 1B                                    168   1e-49   
ref|XP_003612227.1|  SKP1-like protein                                  167   2e-49   
ref|XP_010494151.1|  PREDICTED: SKP1-like protein 1B                    168   2e-49   
gb|ACP20181.1|  SKP1-like protein                                       167   2e-49   Citrus maxima [buntan]
ref|XP_006425391.1|  hypothetical protein CICLE_v10026642mg             168   2e-49   
gb|EMT05501.1|  SKP1-like protein 1B                                    168   2e-49   
ref|XP_010442189.1|  PREDICTED: SKP1-like protein 1B                    168   2e-49   
gb|AFM75900.1|  GSK1                                                    167   3e-49   
gb|AII79402.1|  S-phase kinase-associated protein 1-like protein 5      167   3e-49   
ref|XP_010669692.1|  PREDICTED: SKP1-like protein 1B                    167   3e-49   
gb|AII79401.1|  S-phase kinase-associated protein 1-like protein 4      167   3e-49   
gb|KDP29669.1|  hypothetical protein JCGZ_18831                         167   4e-49   
ref|XP_008337985.1|  PREDICTED: SKP1-like protein 1A                    167   4e-49   
ref|XP_002305525.2|  E3 ubiquitin ligase SCF complex subunit SKP1...    167   4e-49   Populus trichocarpa [western balsam poplar]
ref|NP_568603.1|  SKP1-like protein 1B                                  167   5e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281119.1|  hypothetical protein CARUB_v10027150mg             168   5e-49   
ref|XP_009363460.1|  PREDICTED: SKP1-like protein 1A                    166   6e-49   
ref|XP_008357122.1|  PREDICTED: SKP1-like protein 1B                    166   6e-49   
gb|AAC63110.1|  UIP2                                                    167   6e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KDO71310.1|  hypothetical protein CISIN_1g030962mg                   167   6e-49   
ref|XP_010683792.1|  PREDICTED: SKP1-like protein 1B                    167   6e-49   
ref|XP_003621661.1|  SKP1-like protein                                  166   6e-49   
ref|XP_010680409.1|  PREDICTED: SKP1-like protein 1B                    166   7e-49   
ref|XP_002270061.1|  PREDICTED: SKP1-like protein 1B                    166   7e-49   Vitis vinifera
ref|XP_010935122.1|  PREDICTED: SKP1-like protein 1A                    166   7e-49   
ref|XP_002510576.1|  skp1, putative                                     166   8e-49   Ricinus communis
ref|XP_011046673.1|  PREDICTED: SKP1-like protein 1A                    166   8e-49   
ref|XP_007202708.1|  hypothetical protein PRUPE_ppa012752mg             166   9e-49   
ref|NP_565123.1|  S-phase kinase-associated protein 1                   166   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002510577.1|  skp1, putative                                     166   1e-48   Ricinus communis
ref|XP_008445323.1|  PREDICTED: SKP1-like protein 1B                    166   1e-48   
ref|XP_002306950.1|  hypothetical protein POPTR_0005s26450g             165   1e-48   Populus trichocarpa [western balsam poplar]
gb|EMT15375.1|  SKP1-like protein 4                                     166   1e-48   
ref|XP_006435227.1|  hypothetical protein CICLE_v10002751mg             165   2e-48   
ref|XP_010683699.1|  PREDICTED: SKP1-like protein 1B isoform X2         165   2e-48   
ref|XP_006359705.1|  PREDICTED: SKP1-like protein 1B-like               165   2e-48   
emb|CDY13521.1|  BnaC02g23320D                                          165   2e-48   
ref|XP_011043147.1|  PREDICTED: SKP1-like protein 1B                    165   2e-48   
ref|XP_010683700.1|  PREDICTED: SKP1-like protein 1B isoform X3         164   2e-48   
gb|EMT23721.1|  SKP1-like protein 1A                                    165   3e-48   
ref|XP_011092967.1|  PREDICTED: SKP1-like protein 1A                    165   3e-48   
gb|KDP36889.1|  hypothetical protein JCGZ_08180                         164   3e-48   
ref|NP_001241052.1|  uncharacterized protein LOC100798104               164   3e-48   
ref|XP_006847969.1|  hypothetical protein AMTR_s00029p00153350          164   3e-48   
ref|XP_009414442.1|  PREDICTED: SKP1-like protein 1A                    164   3e-48   
ref|XP_003577587.1|  PREDICTED: SKP1-like protein 1A                    165   4e-48   
ref|XP_009128146.1|  PREDICTED: SKP1-like protein 1A                    164   4e-48   
gb|ACU13236.1|  unknown                                                 164   4e-48   Glycine max [soybeans]
dbj|BAB85607.1|  kinetochore protein                                    164   5e-48   Brassica juncea [brown mustard]
ref|XP_004287783.1|  PREDICTED: SKP1-like protein 1A-like               164   5e-48   
gb|ABK96569.1|  unknown                                                 164   5e-48   Populus trichocarpa x Populus deltoides
ref|XP_004231049.1|  PREDICTED: SKP1-like protein 1B                    164   6e-48   
ref|NP_001235349.1|  uncharacterized protein LOC100306458               164   7e-48   
ref|XP_004143010.1|  PREDICTED: SKP1-like protein 1B-like               164   7e-48   
emb|CAA75118.1|  fimbriata-associated protein                           164   8e-48   Antirrhinum majus [garden snapdragon]
gb|ABK92723.1|  unknown                                                 163   8e-48   Populus trichocarpa [western balsam poplar]
gb|EMT03939.1|  SKP1-like protein 1B                                    163   9e-48   
ref|XP_011003066.1|  PREDICTED: SKP1-like protein 1B                    163   1e-47   
gb|EMT33027.1|  SKP1-like protein 1B                                    164   1e-47   
ref|XP_011083455.1|  PREDICTED: SKP1-like protein 1A                    163   1e-47   
ref|XP_004248653.2|  PREDICTED: SKP1-like protein 1B                    163   1e-47   
ref|XP_004248654.1|  PREDICTED: SKP1-like protein 1B                    162   1e-47   
gb|ABS17589.1|  SKP1 component-like 1                                   163   1e-47   Humulus lupulus [common hop]
ref|XP_010095548.1|  SKP1-like protein 1B                               162   2e-47   
ref|XP_007156190.1|  hypothetical protein PHAVU_003G265900g             162   2e-47   
gb|KEH23694.1|  SCF ubiquitin ligase, SKP1 component                    162   2e-47   
ref|XP_010266012.1|  PREDICTED: SKP1-like protein 1B                    162   2e-47   
ref|XP_006302938.1|  hypothetical protein CARUB_v10021077mg             162   3e-47   
gb|AGU28415.1|  S phase kinase-associated protein 1                     162   3e-47   
ref|XP_002301954.1|  hypothetical protein POPTR_0002s02020g             162   4e-47   Populus trichocarpa [western balsam poplar]
gb|KFK42033.1|  hypothetical protein AALP_AA2G203200                    162   4e-47   
ref|XP_009104691.1|  PREDICTED: SKP1-like protein 1A                    162   4e-47   
ref|XP_002531150.1|  skp1, putative                                     161   7e-47   Ricinus communis
ref|XP_010416502.1|  PREDICTED: SKP1-like protein 1A                    161   7e-47   
gb|EMS35771.1|  SKP1-like protein 1B                                    161   7e-47   
ref|XP_011088616.1|  PREDICTED: SKP1-like protein 1A                    161   7e-47   
ref|XP_009418685.1|  PREDICTED: SKP1-like protein 1A                    161   7e-47   
ref|XP_009401439.1|  PREDICTED: SKP1-like protein 1B                    161   7e-47   
ref|XP_010029647.1|  PREDICTED: SKP1-like protein 1B isoform X1         161   7e-47   
ref|XP_004231048.1|  PREDICTED: SKP1-like protein 1A                    160   1e-46   
gb|KDP23982.1|  hypothetical protein JCGZ_25370                         160   1e-46   
ref|XP_002313704.1|  E3 ubiquitin ligase SCF complex subunit SKP1...    160   1e-46   Populus trichocarpa [western balsam poplar]
gb|EMT01771.1|  SKP1-like protein 1B                                    163   1e-46   
gb|KEH23696.1|  SCF ubiquitin ligase, SKP1 component                    160   1e-46   
ref|XP_004512165.1|  PREDICTED: SKP1-like protein 1A-like               160   1e-46   
ref|XP_002279232.1|  PREDICTED: SKP1-like protein 1A isoform X5         160   1e-46   Vitis vinifera
emb|CAA75117.1|  fimbriata-associated protein                           160   2e-46   Antirrhinum majus [garden snapdragon]
ref|XP_008447950.1|  PREDICTED: SKP1-like protein 1B                    160   2e-46   
ref|XP_004287067.1|  PREDICTED: SKP1-like protein 4-like                160   2e-46   
dbj|BAB85605.1|  kinetochore protein                                    160   2e-46   Brassica juncea [brown mustard]
ref|XP_006360901.1|  PREDICTED: SKP1-like protein 1B-like               159   3e-46   
ref|XP_009373027.1|  PREDICTED: SKP1-like protein 1A                    159   3e-46   
dbj|BAE72119.1|  SKP1-like protein                                      159   3e-46   Silene latifolia
gb|AAT12490.1|  Skp1/Ask1-like protein                                  159   4e-46   Zantedeschia hybrid cultivar
ref|XP_006390250.1|  hypothetical protein EUTSA_v10019260mg             159   4e-46   
dbj|BAE72121.1|  SKP1-like protein                                      159   4e-46   Silene latifolia
ref|XP_010471746.1|  PREDICTED: SKP1-like protein 1A                    159   4e-46   
ref|XP_009395355.1|  PREDICTED: SKP1-like protein 1B                    159   5e-46   
ref|XP_010033522.1|  PREDICTED: SKP1-like protein 1B                    159   5e-46   
dbj|BAB85604.1|  kinetochore protein                                    158   5e-46   Brassica juncea [brown mustard]
ref|XP_004144851.1|  PREDICTED: SKP1-like protein 1B-like               159   6e-46   
ref|XP_009372999.1|  PREDICTED: SKP1-like protein 1A                    159   7e-46   
ref|XP_004248652.1|  PREDICTED: SKP1-like protein 1B                    157   1e-45   
ref|XP_006436098.1|  hypothetical protein CICLE_v10033809mg             158   1e-45   
ref|NP_565604.1|  putative E3 ubiquitin ligase ASK3                     157   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006360900.1|  PREDICTED: SKP1-like protein 1B-like isoform X2    157   3e-45   
ref|XP_004301672.1|  PREDICTED: SKP1-like protein 4-like                157   3e-45   
gb|EMT01680.1|  SKP1-like protein 1B                                    157   3e-45   
ref|NP_564105.1|  SKP1-like protein 4                                   157   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008357536.1|  PREDICTED: SKP1-like protein 1A                    157   4e-45   
ref|XP_001753554.1|  predicted protein                                  156   4e-45   
ref|XP_008232104.1|  PREDICTED: SKP1-like protein 1B                    156   5e-45   
ref|XP_011046062.1|  PREDICTED: SKP1-like protein 1B                    156   5e-45   
ref|XP_002537506.1|  skp1, putative                                     156   5e-45   Ricinus communis
ref|XP_007219396.1|  hypothetical protein PRUPE_ppa020403mg             156   6e-45   
gb|KDO67761.1|  hypothetical protein CISIN_1g044292mg                   156   6e-45   
ref|XP_007221090.1|  hypothetical protein PRUPE_ppa017105mg             156   6e-45   
ref|XP_010941328.1|  PREDICTED: SKP1-like protein 1A                    156   7e-45   
ref|XP_006360899.1|  PREDICTED: SKP1-like protein 1B-like isoform X1    155   7e-45   
ref|XP_008806601.1|  PREDICTED: SKP1-like protein 1A                    156   7e-45   
ref|XP_010539092.1|  PREDICTED: SKP1-like protein 1B                    155   8e-45   
dbj|BAB85606.1|  kinetochore protein                                    156   8e-45   Brassica juncea [brown mustard]
ref|XP_010941330.1|  PREDICTED: SKP1-like protein 1B                    156   9e-45   
ref|XP_008811446.1|  PREDICTED: SKP1-like protein 1A                    155   9e-45   
ref|XP_008806600.1|  PREDICTED: SKP1-like protein 1A                    155   1e-44   
ref|XP_003621659.1|  SKP1-like protein                                  155   1e-44   
ref|XP_009372997.1|  PREDICTED: SKP1-like protein 1A isoform X1         155   1e-44   
gb|KEH23692.1|  SCF ubiquitin ligase, SKP1 component                    155   1e-44   
ref|XP_001753031.1|  predicted protein                                  155   1e-44   
ref|XP_003605511.1|  SKP1                                               155   2e-44   
ref|XP_002880415.1|  hypothetical protein ARALYDRAFT_481069             155   2e-44   
gb|AII79406.1|  S-phase kinase-associated protein 1-like protein 6      155   2e-44   
ref|XP_002976912.1|  hypothetical protein SELMODRAFT_271223             155   2e-44   
ref|XP_003605505.1|  SKP1-like protein                                  155   2e-44   
ref|XP_004957494.1|  PREDICTED: SKP1-like protein 1B-like               155   2e-44   
ref|XP_009395385.1|  PREDICTED: SKP1-like protein 1B                    154   3e-44   
ref|XP_003573486.1|  PREDICTED: SKP1-like protein 1A                    155   3e-44   
ref|XP_009372998.1|  PREDICTED: SKP1-like protein 1A isoform X2         154   3e-44   
ref|XP_010266846.1|  PREDICTED: SKP1-like protein 1B isoform X1         154   4e-44   
ref|XP_003628375.1|  SKP1-like protein                                  154   4e-44   
emb|CDX85931.1|  BnaC06g22030D                                          154   4e-44   
ref|XP_008382346.1|  PREDICTED: SKP1-like protein 1A                    154   4e-44   
emb|CDX93699.1|  BnaA06g03490D                                          154   5e-44   
ref|XP_006359704.1|  PREDICTED: SKP1-like protein 1B-like               154   5e-44   
ref|XP_009147939.1|  PREDICTED: SKP1-like protein 13                    154   5e-44   
ref|XP_009355656.1|  PREDICTED: SKP1-like protein 1A                    154   6e-44   
ref|XP_007201294.1|  hypothetical protein PRUPE_ppa012728mg             153   8e-44   
ref|XP_002887622.1|  hypothetical protein ARALYDRAFT_339769             163   8e-44   
ref|XP_010061081.1|  PREDICTED: SKP1-like protein 1B isoform X1         153   8e-44   
ref|XP_008382314.1|  PREDICTED: SKP1-like protein 1A isoform X1         153   8e-44   
ref|XP_008382316.1|  PREDICTED: SKP1-like protein 1A                    153   9e-44   
ref|XP_009372996.1|  PREDICTED: SKP1-like protein 1A                    153   9e-44   
ref|XP_002890373.1|  hypothetical protein ARALYDRAFT_889462             153   1e-43   
ref|XP_004299943.1|  PREDICTED: SKP1-like protein 4-like                153   1e-43   
gb|AGF33287.1|  SKP1 1A-like protein                                    151   1e-43   
ref|XP_006416426.1|  hypothetical protein EUTSA_v10008964mg             152   2e-43   
gb|AGT16907.1|  SKP1-like protein                                       153   2e-43   
ref|XP_009362142.1|  PREDICTED: SKP1-like protein 1A                    153   2e-43   
gb|EMS59755.1|  SKP1-like protein 4                                     152   2e-43   
ref|XP_009376944.1|  PREDICTED: SKP1-like protein 1B                    152   3e-43   
gb|ACR38888.1|  SKP1                                                    152   3e-43   Apopellia endiviifolia (species B)
ref|XP_008347749.1|  PREDICTED: SKP1-like protein 1A                    153   3e-43   
ref|XP_010428644.1|  PREDICTED: SKP1-like protein 1A                    152   4e-43   
ref|XP_008382315.1|  PREDICTED: SKP1-like protein 1A isoform X2         151   4e-43   
ref|XP_008811458.1|  PREDICTED: SKP1-like protein 1A                    151   5e-43   
ref|XP_008448523.1|  PREDICTED: SKP1-like protein 1B                    151   5e-43   
dbj|BAE72118.1|  SKP1-like protein                                      151   5e-43   Silene latifolia
ref|XP_006660908.1|  PREDICTED: SKP1-like protein 1B-like               151   6e-43   
ref|XP_007024458.1|  SKP1-like 4                                        150   8e-43   
ref|XP_003605516.1|  SKP1-like protein                                  150   1e-42   
ref|XP_008232108.1|  PREDICTED: SKP1-like protein 1A                    150   1e-42   
ref|XP_009363144.1|  PREDICTED: uncharacterized protein LOC103953139    154   1e-42   
ref|XP_010029650.1|  PREDICTED: SKP1-like protein 1B                    150   2e-42   
ref|XP_006304273.1|  hypothetical protein CARUB_v10010505mg             150   2e-42   
ref|XP_003574990.1|  PREDICTED: SKP1-like protein 1A                    149   2e-42   
dbj|BAD46569.1|  putative UIP2                                          150   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010425103.1|  PREDICTED: SKP1-like protein 16                    149   2e-42   
gb|KEH23706.1|  SCF ubiquitin ligase, SKP1 component                    149   2e-42   
ref|XP_010440828.1|  PREDICTED: SKP1-like protein 1A                    149   3e-42   
gb|EYU37960.1|  hypothetical protein MIMGU_mgv1a015408mg                149   3e-42   
ref|XP_010266848.1|  PREDICTED: SKP1-like protein 1B isoform X2         149   4e-42   
ref|XP_004159727.1|  PREDICTED: SKP1-like protein 1A-like               149   5e-42   
ref|XP_006661910.1|  PREDICTED: SKP1-like protein 1B-like               149   5e-42   
ref|XP_009149503.1|  PREDICTED: SKP1-like protein 4                     148   8e-42   
ref|XP_004146156.1|  PREDICTED: SKP1-like protein 1B-like               148   9e-42   
emb|CDP16773.1|  unnamed protein product                                147   1e-41   
ref|XP_008372868.1|  PREDICTED: SKP1-like protein 1B                    147   1e-41   
emb|CDY44209.1|  BnaC05g15660D                                          147   2e-41   
ref|NP_001176525.1|  Os11g0456300                                       147   2e-41   
emb|CAB87834.1|  putative kinetochore protein                           145   3e-41   Vicia faba var. minor [tick bean]
ref|XP_008236029.1|  PREDICTED: SKP1-like protein 1A                    146   3e-41   
emb|CDX73212.1|  BnaC06g36600D                                          146   3e-41   
emb|CCG34083.1|  SCF ubiquitin ligase                                   146   3e-41   
ref|XP_006646753.1|  PREDICTED: SKP1-like protein 1B-like               147   4e-41   
ref|XP_002947872.1|  hypothetical protein VOLCADRAFT_73445              146   4e-41   
gb|EMS53773.1|  SKP1-like protein 1B                                    147   4e-41   
ref|XP_010029649.1|  PREDICTED: SKP1-like protein 1B                    146   4e-41   
gb|ABK21374.1|  unknown                                                 146   5e-41   Picea sitchensis
ref|XP_010113308.1|  SKP1-like protein 1A                               146   6e-41   
gb|KFK36059.1|  hypothetical protein AALP_AA4G072500                    145   6e-41   
ref|XP_003605510.1|  SKP1-like protein                                  146   6e-41   
ref|XP_010432410.1|  PREDICTED: SKP1-like protein 11                    145   6e-41   
gb|AAX92710.1|  SCF ubiquitin ligase                                    147   7e-41   Picea abies
gb|ABK25195.1|  unknown                                                 145   8e-41   Picea sitchensis
ref|XP_006286731.1|  hypothetical protein CARUB_v10002974mg             145   8e-41   
ref|XP_004287435.1|  PREDICTED: SKP1-like protein 1A-like               145   9e-41   
ref|XP_010327537.1|  PREDICTED: SKP1-like protein 11                    146   9e-41   
ref|XP_003616859.1|  SKP1-like protein                                  145   1e-40   
emb|CDP16774.1|  unnamed protein product                                145   1e-40   
ref|XP_001690964.1|  E3 ubiquitin ligase                                145   1e-40   Chlamydomonas reinhardtii
emb|CDM86749.1|  unnamed protein product                                145   1e-40   
ref|XP_009382729.1|  PREDICTED: SKP1-like protein 1A                    145   1e-40   
emb|CAE53885.1|  putative SKP1 protein                                  145   1e-40   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008246274.1|  PREDICTED: SKP1-like protein 1A                    144   1e-40   
gb|EMT17500.1|  hypothetical protein F775_42820                         145   1e-40   
gb|KCW56600.1|  hypothetical protein EUGRSUZ_I02321                     147   1e-40   
gb|ABB69022.1|  SKP1                                                    145   1e-40   Brassica napus [oilseed rape]
ref|XP_010501125.1|  PREDICTED: SKP1-like protein 14                    145   2e-40   
ref|XP_007219120.1|  hypothetical protein PRUPE_ppa015805mg             144   2e-40   
emb|CDY40611.1|  BnaC06g02270D                                          144   2e-40   
ref|XP_010459699.1|  PREDICTED: SKP1-like protein 4                     144   3e-40   
dbj|BAB85603.1|  kinetochore protein                                    144   3e-40   Brassica juncea [brown mustard]
ref|XP_010646804.1|  PREDICTED: SKP1-like protein 1A isoform X3         148   3e-40   
ref|XP_008669236.1|  PREDICTED: SKP1-like protein 1A                    145   4e-40   
emb|CDY40610.1|  BnaC06g02260D                                          143   5e-40   
ref|XP_008671925.1|  PREDICTED: SKP1-like protein 1A                    144   6e-40   
ref|XP_009106248.1|  PREDICTED: SKP1-like protein 1A                    143   9e-40   
ref|XP_002462746.1|  hypothetical protein SORBIDRAFT_02g031280          143   1e-39   Sorghum bicolor [broomcorn]
ref|XP_002867118.1|  hypothetical protein ARALYDRAFT_912943             142   1e-39   
emb|CCG34082.1|  SCF ubiquitin ligase                                   142   1e-39   
ref|XP_004289997.1|  PREDICTED: SKP1-like protein 4-like                142   1e-39   
ref|XP_010437611.1|  PREDICTED: SKP1-like protein 11                    142   1e-39   
ref|XP_003636464.1|  SKP1-like protein                                  142   1e-39   
ref|XP_008245788.1|  PREDICTED: SKP1-like protein 11                    142   2e-39   
ref|XP_008670859.1|  PREDICTED: SKP1-like protein 1A                    143   2e-39   
emb|CAN73673.1|  hypothetical protein VITISV_031861                     141   2e-39   
emb|CAN81017.1|  hypothetical protein VITISV_028248                     141   3e-39   
ref|XP_010646801.1|  PREDICTED: SKP1-like protein 1A isoform X2         145   3e-39   
tpg|DAA42254.1|  TPA: SKP1-like protein 1A                              142   3e-39   
ref|XP_010477249.1|  PREDICTED: SKP1-like protein 4                     141   4e-39   
tpg|DAA56608.1|  TPA: hypothetical protein ZEAMMB73_397176              143   4e-39   
ref|XP_009147940.1|  PREDICTED: SKP1-like protein 1A                    141   4e-39   
ref|XP_010502325.1|  PREDICTED: SKP1-like protein 14                    142   4e-39   
ref|XP_010107659.1|  SKP1-like protein 4                                141   4e-39   
ref|XP_008232155.1|  PREDICTED: SKP1-like protein 11                    141   4e-39   
ref|XP_008670886.1|  PREDICTED: SKP1-like protein 1A                    142   5e-39   
gb|EMT23720.1|  SKP1-like protein 1A                                    139   7e-39   
ref|XP_009413024.1|  PREDICTED: SKP1-like protein 1A                    140   8e-39   
dbj|BAJ91150.1|  predicted protein                                      140   9e-39   
gb|EMT30556.1|  SKP1-like protein 4                                     140   9e-39   
ref|XP_010435879.1|  PREDICTED: SKP1-like protein 11                    140   1e-38   
ref|NP_001152391.1|  SKP1-like protein 1A                               141   1e-38   
ref|XP_010425101.1|  PREDICTED: SKP1-like protein 16                    140   1e-38   
ref|XP_010512295.1|  PREDICTED: SKP1-like protein 13                    139   1e-38   
ref|NP_001131741.1|  SKP1-like protein 1A                               140   2e-38   
gb|ADQ00179.1|  E3 ubiquitin ligase                                     139   2e-38   
ref|XP_003063597.1|  predicted protein                                  139   2e-38   
ref|XP_010441003.1|  PREDICTED: SKP1-like protein 11                    139   2e-38   
ref|XP_004979241.1|  PREDICTED: SKP1-like protein 1B-like               140   2e-38   
ref|XP_002277864.1|  PREDICTED: uncharacterized protein LOC100257...    146   2e-38   
ref|NP_567967.1|  SKP1-like protein 12                                  139   3e-38   
emb|CDP16772.1|  unnamed protein product                                139   3e-38   
ref|XP_010447075.1|  PREDICTED: SKP1-like protein 11 isoform X1         139   3e-38   
gb|EMT15207.1|  SKP1-like protein 1B                                    139   3e-38   
ref|XP_010510863.1|  PREDICTED: SKP1-like protein 14                    139   4e-38   
ref|XP_010514084.1|  PREDICTED: SKP1-like protein 14                    139   4e-38   
gb|AEQ39057.1|  putative SKP1-like protein 1                            139   4e-38   
gb|ACF85177.1|  unknown                                                 139   6e-38   
ref|XP_002450709.1|  hypothetical protein SORBIDRAFT_05g012740          139   6e-38   
gb|AFK43118.1|  unknown                                                 138   6e-38   
gb|EMS52877.1|  SKP1-like protein 1B                                    138   8e-38   
ref|NP_567959.1|  SKP1-like protein 11                                  137   8e-38   
gb|ABK28664.1|  unknown                                                 137   8e-38   
ref|XP_002453117.1|  hypothetical protein SORBIDRAFT_04g000330          138   1e-37   
ref|XP_010029648.1|  PREDICTED: SKP1-like protein 1B isoform X2         137   1e-37   
ref|XP_010506934.1|  PREDICTED: SKP1-like protein 16                    136   1e-37   
ref|XP_004306259.1|  PREDICTED: SKP1-like protein 4-like                137   2e-37   
gb|EMT17502.1|  hypothetical protein F775_42821                         140   2e-37   
emb|CAB85491.1|  putative kinetochore protein                           137   2e-37   
gb|AAF82795.1|AF274864_1  SKP1gamma1 protein                            137   2e-37   
emb|CDM80524.1|  unnamed protein product                                137   2e-37   
ref|XP_002885472.1|  hypothetical protein ARALYDRAFT_898638             136   2e-37   
emb|CDY03015.1|  BnaC07g22120D                                          136   2e-37   
ref|XP_010430688.1|  PREDICTED: SKP1-like protein 14                    137   3e-37   
ref|XP_006293215.1|  hypothetical protein CARUB_v10019539mg             136   3e-37   
ref|XP_010441072.1|  PREDICTED: SKP1-like protein 11                    136   3e-37   
ref|XP_011075000.1|  PREDICTED: SKP1-like protein 1A                    136   3e-37   
ref|XP_008677157.1|  PREDICTED: uncharacterized protein LOC100280...    138   4e-37   
ref|XP_010463461.1|  PREDICTED: uncharacterized protein LOC104744147    141   5e-37   
tpg|DAA58698.1|  TPA: SKP1-like protein 1A                              136   5e-37   
ref|XP_010448526.1|  PREDICTED: SKP1-like protein 4                     135   6e-37   
gb|ACG31014.1|  SKP1-like protein 1A                                    136   8e-37   
ref|NP_566695.1|  SKP1-like protein 10                                  135   8e-37   
gb|EMS57884.1|  SKP1-like protein 4                                     135   1e-36   
ref|XP_010450797.1|  PREDICTED: SKP1-like protein 11                    135   1e-36   
ref|NP_001152275.1|  SKP1-like protein 1A                               135   1e-36   
ref|XP_003605515.1|  SKP1-like protein                                  135   1e-36   
gb|KEH29323.1|  SCF ubiquitin ligase, SKP1 component                    137   1e-36   
emb|CAJ38400.1|  fimbriata-associated protein                           135   1e-36   
dbj|BAE72120.1|  SKP1-like protein                                      136   1e-36   
emb|CDY67544.1|  BnaCnng55410D                                          135   1e-36   
ref|XP_003578534.1|  PREDICTED: SKP1-like protein 1B                    135   1e-36   
ref|XP_010413610.1|  PREDICTED: SKP1-like protein 13                    134   2e-36   
gb|KFK35110.1|  hypothetical protein AALP_AA5G237300                    134   2e-36   
ref|XP_002444405.1|  hypothetical protein SORBIDRAFT_07g021450          134   2e-36   
ref|XP_002875195.1|  hypothetical protein ARALYDRAFT_484224             134   3e-36   
ref|XP_010028740.1|  PREDICTED: SKP1-like protein 1A                    134   3e-36   
gb|KFK33484.1|  hypothetical protein AALP_AA5G019200                    134   3e-36   
emb|CAB87813.1|  putative kinetochore protein                           132   3e-36   
ref|XP_010056210.1|  PREDICTED: SKP1-like protein 1B                    134   3e-36   
gb|EMT01637.1|  SKP1-like protein 1B                                    133   3e-36   
gb|KEH23709.1|  SCF ubiquitin ligase, SKP1 component                    133   3e-36   
ref|XP_006305612.1|  hypothetical protein CARUB_v10010290mg             135   4e-36   
ref|XP_007202707.1|  hypothetical protein PRUPE_ppa012732mg             133   4e-36   
ref|XP_010514081.1|  PREDICTED: SKP1-like protein 14                    134   4e-36   
gb|KEH19789.1|  SCF ubiquitin ligase, SKP1 component                    133   5e-36   
ref|XP_004951176.1|  PREDICTED: SKP1-like protein 1B-like               133   5e-36   
ref|XP_008242039.1|  PREDICTED: SKP1-like protein 1A                    133   5e-36   
gb|EMT28670.1|  SKP1-like protein 4                                     137   5e-36   
gb|KFK33482.1|  hypothetical protein AALP_AA5G019000                    133   6e-36   
ref|XP_010502326.1|  PREDICTED: SKP1-like protein 14                    133   6e-36   
ref|XP_002504623.1|  predicted protein                                  132   6e-36   
ref|XP_010514085.1|  PREDICTED: SKP1-like protein 14                    132   8e-36   
gb|ACS69067.1|  pollen specific SKP1-like protein LSK3                  132   8e-36   
ref|XP_008664388.1|  PREDICTED: SKP1-like protein 1B                    133   8e-36   
ref|XP_010438976.1|  PREDICTED: SKP1-like protein 4                     132   9e-36   
emb|CAJ38399.1|  fimbriata-associated protein                           132   1e-35   
ref|XP_004304041.1|  PREDICTED: SKP1-like protein 4-like                132   1e-35   
ref|XP_010447073.1|  PREDICTED: SKP1-like protein 11                    132   1e-35   
gb|AAP79890.1|  SKP1/ASK1-like protein                                  132   1e-35   
ref|XP_002488987.1|  hypothetical protein SORBIDRAFT_0702s002010        135   1e-35   
ref|XP_006393304.1|  hypothetical protein EUTSA_v10012168mg             132   2e-35   
gb|EAZ06798.1|  hypothetical protein OsI_29042                          132   2e-35   
gb|KCW55544.1|  hypothetical protein EUGRSUZ_I01426                     131   3e-35   
gb|EAZ06800.1|  hypothetical protein OsI_29044                          131   3e-35   
ref|XP_010028737.1|  PREDICTED: SKP1-like protein 1A                    131   3e-35   
ref|XP_009114174.1|  PREDICTED: SKP1-like protein 18                    131   3e-35   
ref|XP_010941329.1|  PREDICTED: SKP1-like protein 1A                    131   4e-35   
ref|NP_567090.1|  SKP1-like protein 13                                  130   4e-35   
ref|XP_001422389.1|  predicted protein                                  130   4e-35   
gb|EMS45381.1|  SKP1-like protein 1B                                    131   5e-35   
gb|AAT37114.1|  skp1-like protein                                       131   5e-35   
ref|XP_010507115.1|  PREDICTED: SKP1-like protein 14                    131   5e-35   
gb|KCW55541.1|  hypothetical protein EUGRSUZ_I01424                     130   7e-35   
ref|XP_010028736.1|  PREDICTED: SKP1-like protein 1A                    130   7e-35   
ref|XP_002878309.1|  hypothetical protein ARALYDRAFT_907521             130   7e-35   
ref|XP_006285109.1|  hypothetical protein CARUB_v10006442mg             130   8e-35   
ref|NP_565296.1|  SKP1-like protein 14                                  129   1e-34   
ref|NP_001061672.1|  Os08g0375700                                       130   1e-34   
gb|AAT09201.1|  skp1 protein                                            130   1e-34   
ref|XP_010241289.1|  PREDICTED: SKP1-like protein 11                    130   1e-34   
ref|XP_010430692.1|  PREDICTED: SKP1-like protein 14                    130   1e-34   
ref|XP_004289877.1|  PREDICTED: SKP1-like protein 4-like                129   2e-34   
ref|NP_566773.1|  SKP1-like protein 15                                  130   2e-34   
ref|XP_002875193.1|  hypothetical protein ARALYDRAFT_904587             130   2e-34   
ref|XP_009138886.1|  PREDICTED: SKP1-like protein 1A                    129   2e-34   
gb|KFK35210.1|  hypothetical protein AALP_AA5G254700                    129   2e-34   
ref|XP_010061082.1|  PREDICTED: SKP1-like protein 1B isoform X2         129   2e-34   
gb|KEH29322.1|  SCF ubiquitin ligase, SKP1 component                    129   2e-34   
gb|EMT17797.1|  SKP1-like protein 1B                                    129   2e-34   
ref|XP_006395735.1|  hypothetical protein EUTSA_v10005053mg             129   3e-34   
ref|XP_010028739.1|  PREDICTED: SKP1-like protein 1A                    129   3e-34   
gb|AAB38862.1|  homologue to SKP1                                       127   3e-34   
ref|XP_010433736.1|  PREDICTED: SKP1-like protein 4                     129   4e-34   
gb|KHG09322.1|  SKP1-like protein 11                                    130   4e-34   
ref|XP_006292236.1|  hypothetical protein CARUB_v10018443mg             128   4e-34   
gb|KCW55546.1|  hypothetical protein EUGRSUZ_I01426                     127   5e-34   
ref|NP_565295.1|  SKP1-like protein 19                                  129   5e-34   
emb|CBI37863.3|  unnamed protein product                                127   6e-34   
emb|CCG34078.1|  SCF ubiquitin ligase                                   128   6e-34   
ref|NP_001149673.1|  SKP1-like protein 1A                               128   7e-34   
ref|XP_002875194.1|  hypothetical protein ARALYDRAFT_904588             127   7e-34   
emb|CDX89042.1|  BnaA04g01440D                                          127   8e-34   
ref|XP_010413609.1|  PREDICTED: SKP1-like protein 5                     127   8e-34   
ref|XP_008670860.1|  PREDICTED: SKP1-like protein 1A                    128   9e-34   
ref|XP_002878310.1|  hypothetical protein ARALYDRAFT_907522             127   1e-33   
ref|XP_002887052.1|  hypothetical protein ARALYDRAFT_894320             127   1e-33   
emb|CAA75119.1|  fimbriata-associated protein                           125   1e-33   
ref|XP_002279171.1|  PREDICTED: SKP1-like protein 1A isoform X4         127   2e-33   
gb|ABK28567.1|  unknown                                                 126   2e-33   
ref|NP_566694.1|  SKP1-like protein 9                                   126   2e-33   
ref|XP_006291986.1|  hypothetical protein CARUB_v10018174mg             126   2e-33   
ref|XP_010028738.1|  PREDICTED: SKP1-like protein 4                     126   2e-33   
emb|CDX96963.1|  BnaC02g31010D                                          127   3e-33   
emb|CDY69121.1|  BnaCnng61970D                                          125   3e-33   
gb|KCW55543.1|  hypothetical protein EUGRSUZ_I01425                     125   3e-33   
dbj|BAB03085.1|  kinetechore (Skp1p-like) protein-like                  126   3e-33   
gb|KFK33483.1|  hypothetical protein AALP_AA5G019100                    126   3e-33   
gb|ACG46345.1|  SKP1-like protein 1A                                    126   4e-33   
ref|XP_010646873.1|  PREDICTED: SKP1-like protein 1A                    125   4e-33   
emb|CCA95090.1|  putative S phase kinase-associated protein 1           123   8e-33   
gb|EMT16783.1|  SKP1-like protein 1A                                    125   9e-33   
ref|XP_002777664.1|  glycoprotein FP21 precursor, putative              124   1e-32   
dbj|BAC19974.1|  putative Skp1                                          124   1e-32   
ref|NP_565297.1|  SKP1-like protein 16                                  124   2e-32   
gb|KFK36060.1|  hypothetical protein AALP_AA4G072600                    122   2e-32   
emb|CBI37865.3|  unnamed protein product                                122   3e-32   
emb|CEG00859.1|  E3 ubiquitin ligase, SCF complex, Skp subunit          123   4e-32   
ref|XP_005651580.1|  E3 ubiquitin ligase SCF complex, Skp subunit       123   4e-32   
emb|CDY16470.1|  BnaA08g02970D                                          123   5e-32   
emb|CDY14922.1|  BnaA02g22640D                                          123   5e-32   
ref|XP_006393339.1|  hypothetical protein EUTSA_v10012355mg             122   5e-32   
gb|EMT14444.1|  SKP1-like protein 1B                                    122   6e-32   
ref|XP_009623472.1|  PREDICTED: SKP1-like protein 1B                    122   6e-32   
ref|NP_001168727.1|  uncharacterized protein LOC100382519               129   6e-32   
tpg|DAA42753.1|  TPA: hypothetical protein ZEAMMB73_293473              128   6e-32   
ref|XP_010254888.1|  PREDICTED: SKP1-like protein 1A                    123   6e-32   
emb|CDX77280.1|  BnaC08g03250D                                          122   7e-32   
gb|EMT30811.1|  SKP1-like protein 10                                    123   8e-32   
ref|XP_009107332.1|  PREDICTED: SKP1-like protein 13                    122   8e-32   
ref|XP_006402659.1|  hypothetical protein EUTSA_v10006390mg             121   8e-32   
emb|CCG34079.1|  SCF ubiquitin ligase                                   122   9e-32   
gb|EMT27938.1|  SKP1-like protein 1B                                    121   9e-32   
ref|XP_006393342.1|  hypothetical protein EUTSA_v10012113mg             122   9e-32   
ref|XP_010469243.1|  PREDICTED: SKP1-like protein 5                     122   1e-31   
ref|XP_005846142.1|  hypothetical protein CHLNCDRAFT_59724              122   1e-31   
gb|KDD74923.1|  Skp1 family protein                                     126   1e-31   
ref|XP_002765750.1|  glycoprotein FP21 precursor, putative              122   2e-31   
ref|XP_008788796.1|  PREDICTED: SKP1-like protein 4                     122   2e-31   
ref|XP_009627980.1|  PREDICTED: SKP1-like protein 1B                    121   2e-31   
ref|XP_003604917.1|  SKP1-like protein                                  121   2e-31   
ref|XP_006292823.1|  hypothetical protein CARUB_v10019075mg             122   2e-31   
ref|XP_009786816.1|  PREDICTED: SKP1-like protein 1A                    121   2e-31   
ref|XP_006292249.1|  hypothetical protein CARUB_v10018457mg             122   3e-31   
emb|CDY63159.1|  BnaCnng41550D                                          120   7e-31   
ref|XP_010490823.1|  PREDICTED: SKP1-like protein 18                    121   7e-31   
ref|XP_005781634.1|  hypothetical protein EMIHUDRAFT_434598             119   9e-31   
emb|CAB87835.1|  putative kinetochore protein                           118   1e-30   
emb|CDY01389.1|  BnaA07g11620D                                          119   1e-30   
ref|XP_010539834.1|  PREDICTED: SKP1-like protein 1A                    119   1e-30   
gb|EYU37961.1|  hypothetical protein MIMGU_mgv1a019768mg                119   2e-30   
emb|CCG34080.1|  SCF ubiquitin ligase                                   119   2e-30   
dbj|BAD05286.1|  putative SKP1                                          119   2e-30   
ref|NP_566692.1|  SKP1-like protein 8                                   118   2e-30   
ref|XP_006292597.1|  hypothetical protein CARUB_v10018839mg             119   3e-30   
gb|KCW53209.1|  hypothetical protein EUGRSUZ_J02478                     117   3e-30   
gb|EMT19091.1|  SKP1-like protein 4                                     118   3e-30   
ref|XP_009123589.1|  PREDICTED: SKP1-like protein 14                    118   3e-30   
gb|KDO67759.1|  hypothetical protein CISIN_1g040816mg                   117   4e-30   
dbj|BAD26415.1|  putative SKP1                                          118   4e-30   
pdb|3L2O|A  Chain A, Structure-Based Mechanism Of Dimerization-De...    117   4e-30   
gb|KHN78538.1|  S-phase kinase-associated protein 1                     118   4e-30   
pdb|1FQV|B  Chain B, Insights Into Scf Ubiquitin Ligases From The...    117   5e-30   
ref|XP_002885471.1|  hypothetical protein ARALYDRAFT_898637             117   5e-30   
ref|XP_009794083.1|  PREDICTED: SKP1-like protein 11                    118   5e-30   
gb|KCW67979.1|  hypothetical protein EUGRSUZ_F01672                     117   6e-30   
ref|XP_010445546.1|  PREDICTED: SKP1-like protein 16                    117   7e-30   
ref|XP_007220743.1|  hypothetical protein PRUPE_ppa024856mg             117   7e-30   
emb|CCG34081.1|  SCF ubiquitin ligase                                   117   8e-30   
gb|AGT15908.1|  SKP1-like protein                                       117   9e-30   
ref|XP_006436096.1|  hypothetical protein CICLE_v10033955mg             116   9e-30   



>ref|XP_007041813.1| S phase kinase-associated protein 1 [Theobroma cacao]
 gb|EOX97644.1| S phase kinase-associated protein 1 [Theobroma cacao]
Length=156

 Score =   180 bits (456),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 108/136 (79%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + IMLRSSDGE FEVEE VA+E  TIK MI+D+C DN IP+ N+TSKILA V+EYCK
Sbjct  3    STSKKIMLRSSDGEAFEVEEAVAVESQTIKHMIEDDCADNEIPVPNVTSKILAKVLEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+AAA+ +  PED    D K +DA+F+KVD NTLFDLI+AAN+LNIKSLLDLT Q VA
Sbjct  63   KHVDAAADKEKIPED----DLKVWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            +MIK  +PEE+RK FN
Sbjct  119  EMIKGKTPEEIRKTFN  134



>gb|KHG30151.1| SKP1-like protein 1A [Gossypium arboreum]
Length=156

 Score =   180 bits (456),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 108/136 (79%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R IMLRSSDGE FEVEE VA+E  TIK MI+D+C DN IP+ N+TSKIL+ V+EYCK
Sbjct  3    STSRKIMLRSSDGETFEVEEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILSKVLEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+AAA+ +  P+D    + K +DA+F+KVD NTLFDLI+AAN+LNIKSLLDLT Q VA
Sbjct  63   KHVDAAADKEKTPDD----ELKVWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>gb|KHN41877.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   178 bits (452),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 106/137 (77%), Gaps = 6/137 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEVEE VALE  TIK MI+D+C D+ IP+ N+TSKILA VIEYCK
Sbjct  2    SSAKKITLKSSDGEAFEVEEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAK-DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HVEAA     NPED P++ D K +DA F+KVD  TLFDLI+AAN+LNIKSLLDLT Q V
Sbjct  62   KHVEAA-----NPEDKPSEDDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  116

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  117  ADMIKGKTPEEIRKTFN  133



>gb|ABB77426.1| Skp1-like protein 1 [Petunia integrifolia subsp. inflata]
 gb|ACA61786.1| SKP1-like protein 4 [Petunia x hybrida]
Length=156

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 109/136 (80%), Gaps = 3/136 (2%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  +MI+L+SSDGE FEVEE+VALE  TIK MI+D+C D++IP+ N+TSKILA VIEYCK
Sbjct  2    STSKMIVLKSSDGETFEVEESVALESQTIKHMIEDDCADSSIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVEAA  AKT+ +    +D K FDA F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VA
Sbjct  62   RHVEAA--AKTD-DKVSEEDLKNFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>ref|XP_003517160.1| PREDICTED: SKP1-like protein 1A-like [Glycine max]
 gb|KHN36011.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   177 bits (449),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 107/137 (78%), Gaps = 6/137 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEV+E VALE  TIK MI+D+C D+ IP+ N+TSKILA VIEYCK
Sbjct  2    SSAKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HVEAA     NPED P++D  K +DA+F+KVD  TLFDLI+AAN+LNIKSLLDLT Q V
Sbjct  62   KHVEAA-----NPEDKPSEDDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  116

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  117  ADMIKGKTPEEIRKTFN  133



>ref|XP_009779583.1| PREDICTED: SKP1-like protein 1A [Nicotiana sylvestris]
 gb|AAC63273.1| SKP1-like protein [Nicotiana clevelandii]
Length=153

 Score =   176 bits (447),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 109/134 (81%), Gaps = 3/134 (2%)
 Frame = -2

Query  402  VRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYH  223
            ++MI+LRSSDGE FEVEE+VALE  TIK MI+D+C D +IP+ N+TSKILA VIEYCK H
Sbjct  1    MKMIVLRSSDGETFEVEESVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRH  60

Query  222  VEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            V+AA++ +   + A   D K FDA+F+KVD +TLFDLI+AAN+LNIKSLLDLT Q VADM
Sbjct  61   VDAASKTE---DKAVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  117

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+RK FN
Sbjct  118  IKGKTPEEIRKTFN  131



>ref|XP_009420815.1| PREDICTED: SKP1-like protein 1A [Musa acuminata subsp. malaccensis]
Length=159

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 109/138 (79%), Gaps = 4/138 (3%)
 Frame = -2

Query  405  IVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKY  226
            + + I LRSSDGE+FEVEE VA+E  TIK MI+D+C DN IP+ N+TSKILA V+EYCK 
Sbjct  1    MAKTITLRSSDGEVFEVEEAVAMESQTIKHMIEDDCADNGIPLPNVTSKILAKVVEYCKK  60

Query  225  HVEAAAEAKTNPEDAPA---KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            HV+AAA + ++ +DAP+    D K +DA+F+KVD  TLFDLI+AAN+LNIK LLDLT Q 
Sbjct  61   HVDAAARSSSS-DDAPSVTEDDLKTWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQT  119

Query  54   VADMIKDMSPEEVRKIFN  1
            VADMIK  +PEE+RK FN
Sbjct  120  VADMIKGKTPEEIRKTFN  137



>ref|XP_007157884.1| hypothetical protein PHAVU_002G106100g [Phaseolus vulgaris]
 gb|AGV54260.1| SKP1-like protein [Phaseolus vulgaris]
 gb|ESW29878.1| hypothetical protein PHAVU_002G106100g [Phaseolus vulgaris]
Length=155

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 107/137 (78%), Gaps = 6/137 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I L+SSDGE FEV+E VALE  TIK MI+D+C D+ IP+ N+TSKILA VIEYCK
Sbjct  2    SSARKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPA-KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HV+AA     NP+D P+ +D K +DA+F+KVD  TLFDLI+AAN+LNIKSLLDLT Q V
Sbjct  62   KHVDAA-----NPDDKPSEEDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  116

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  117  ADMIKGKTPEEIRKTFN  133



>ref|NP_001235929.1| uncharacterized protein LOC100527683 [Glycine max]
 gb|ACU16825.1| unknown [Glycine max]
Length=155

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 6/137 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEVEE VALE  TIK MI+D+C D+ IP+ N+TSKILA VIEYCK
Sbjct  2    SSAKKITLKSSDGEAFEVEEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAK-DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HVEAA     NPED P++ D K + A F+KVD  TLFDLI+AAN+LNIKSLLDLT Q V
Sbjct  62   KHVEAA-----NPEDKPSEDDLKAWAAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  116

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  117  ADMIKGKTPEEIRKTFN  133



>ref|XP_010690359.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=166

 Score =   175 bits (443),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 109/142 (77%), Gaps = 7/142 (5%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            + V+ I L+SSDGE F+VEE+VALE  TIK MI+D+C DN IP+ N+T KIL+ VIEYCK
Sbjct  4    TTVKKITLKSSDGENFDVEESVALESQTIKHMIEDDCADNAIPLPNVTGKILSKVIEYCK  63

Query  228  YHVEAAAEAKTNPEDAPAKDT------KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDL  67
             HVE+AA AK++ ED  + +       K +DA F+KVD NTLFDLI+AAN+LNIKSLLDL
Sbjct  64   KHVESAA-AKSSTEDRSSSNATADEELKSWDAEFVKVDQNTLFDLILAANYLNIKSLLDL  122

Query  66   TTQAVADMIKDMSPEEVRKIFN  1
            T Q VADMIK  +PEE+RK FN
Sbjct  123  TCQTVADMIKGKTPEEIRKTFN  144



>gb|AAO85510.1| SKP1 [Nicotiana benthamiana]
Length=153

 Score =   174 bits (442),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 108/134 (81%), Gaps = 3/134 (2%)
 Frame = -2

Query  402  VRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYH  223
            ++MI+LRSSDGE FEVEE+VALE  TIK MI+D+C D +IP+ N+TSKILA VIEYCK H
Sbjct  1    MKMIVLRSSDGETFEVEESVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRH  60

Query  222  VEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            V+AA++ +   + A   D K FDA+F+KVD +TLFDLI+AAN+LNIK LLDLT Q VADM
Sbjct  61   VDAASKTE---DKAVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKRLLDLTCQTVADM  117

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+RK FN
Sbjct  118  IKGKTPEEIRKTFN  131



>gb|EYU17579.1| hypothetical protein MIMGU_mgv1a015014mg [Erythranthe guttata]
Length=170

 Score =   175 bits (443),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 112/149 (75%), Gaps = 7/149 (5%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            MSS  +++  + I LRSSDGE+FEVE+ VA+E  TIK MI+D+C DN IP+ N+T KIL+
Sbjct  1    MSSSTAENGGKKITLRSSDGEVFEVEDAVAVESQTIKHMIEDDCADNVIPLPNVTGKILS  60

Query  249  MVIEYCKYHVEAAAEAKTNPED------APAKDTKEFDANFIKVDHNTLFDLIMAANFLN  88
             VIEYCK HV+AAA A T  +D      A  +D K FDA+F+KVD  TLFDLI+AAN+LN
Sbjct  61   KVIEYCKRHVDAAASA-TKADDKLASAAASDEDLKVFDADFVKVDQATLFDLILAANYLN  119

Query  87   IKSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            IKSLLDLT Q VADMIK  +PEE+RK FN
Sbjct  120  IKSLLDLTCQTVADMIKGKTPEEIRKTFN  148



>ref|XP_009591491.1| PREDICTED: SKP1-like protein 1A [Nicotiana tomentosiformis]
 ref|XP_009782768.1| PREDICTED: SKP1-like protein 1A [Nicotiana sylvestris]
Length=156

 Score =   174 bits (442),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 107/136 (79%), Gaps = 3/136 (2%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  +MI+L+SSDGE FEVEE VALE  TIK MI+D+C D +IP+ N+TSKILA VIEYCK
Sbjct  2    STSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+A   AKT+ + A   D K FDA+F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VA
Sbjct  62   RHVDAV--AKTD-DKASEDDLKSFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>ref|XP_009334694.1| PREDICTED: SKP1-like protein 1B [Pyrus x bretschneideri]
Length=156

 Score =   174 bits (441),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 104/135 (77%), Gaps = 7/135 (5%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            R I L+SSDGE FEV+E VALE  TIK M++D+C DN IP+ N+TSKILA VIEYC+ HV
Sbjct  5    RKITLKSSDGETFEVDEAVALESQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYCRKHV  64

Query  219  EAAAEAKTNPEDAPA--KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            EAA      PE+ PA  +D K +DA F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VAD
Sbjct  65   EAA-----KPEERPAVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  119

Query  45   MIKDMSPEEVRKIFN  1
            MIK  +PEE+RK FN
Sbjct  120  MIKGKTPEEIRKTFN  134



>ref|XP_009620406.1| PREDICTED: SKP1-like protein 1A [Nicotiana tomentosiformis]
Length=153

 Score =   174 bits (440),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 109/134 (81%), Gaps = 3/134 (2%)
 Frame = -2

Query  402  VRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYH  223
            ++MI+L+SSDGE FEVEE+VA+E  TIK MI+D+C D +IP+ N+TSKILA VIEYCK H
Sbjct  1    MKMIVLKSSDGETFEVEESVAVESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRH  60

Query  222  VEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            V+AA++ +   + A   D K FDA+F+KVD +TLFDLI+AAN+LNIKSLLDLT Q VADM
Sbjct  61   VDAASKTE---DKAVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  117

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+RK FN
Sbjct  118  IKGKTPEEIRKTFN  131



>gb|ACA61784.1| SKP1-like protein 2 [Petunia x hybrida]
 gb|ACT35738.1| SKP1-like 1 [Petunia x hybrida]
Length=154

 Score =   173 bits (439),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 106/133 (80%), Gaps = 4/133 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI+L+SSDGE F+VEE+VA+E  TIK MI+D+C D++IP+ N+TS+ILA VIEYCK HV
Sbjct  4    KMIVLKSSDGETFQVEESVAVESQTIKHMIEDDCADSSIPLPNVTSQILAKVIEYCKRHV  63

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            EA+       ED    D K FDA+F+KVD +TLFDLI+AAN+LNIKSLLDLT Q VADMI
Sbjct  64   EASKSEDKATED----DLKSFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  119

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  120  KGKTPEEIRKTFN  132



>ref|XP_009624361.1| PREDICTED: SKP1-like protein 1A isoform X1 [Nicotiana tomentosiformis]
Length=153

 Score =   172 bits (437),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 109/134 (81%), Gaps = 3/134 (2%)
 Frame = -2

Query  402  VRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYH  223
            ++MI+L+SSDGE FEVEE+VA+E  TIK MI+D+C D +IP+ N+TSKILA VIEYCK H
Sbjct  1    MKMIVLKSSDGETFEVEESVAVESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRH  60

Query  222  VEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            V+AA++ +   + +   D K FDA+F+KVD +TLFDLI+AAN+LNIKSLLDLT Q VADM
Sbjct  61   VDAASKTE---DKSVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  117

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+RK FN
Sbjct  118  IKGKTPEEIRKTFN  131



>gb|ABB77425.1| Skp1-like protein 3 [Petunia integrifolia subsp. inflata]
 gb|ACT35736.1| SKP1-like 2 [Petunia x hybrida]
Length=155

 Score =   172 bits (437),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 104/136 (76%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  +MI+L+SSDGE F+VEE+VALE  TIK MI+D+C D +IP+ N+TSKILA VIEYCK
Sbjct  2    STSKMIVLKSSDGETFQVEESVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVEA        ED    + K FD++F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VA
Sbjct  62   RHVEANKSEDKASED----ELKSFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVA  117

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  118  DMIKGKTPEEIRKTFN  133



>ref|XP_009624363.1| PREDICTED: SKP1-like protein 1A isoform X2 [Nicotiana tomentosiformis]
Length=153

 Score =   172 bits (437),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 109/134 (81%), Gaps = 3/134 (2%)
 Frame = -2

Query  402  VRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYH  223
            ++MI+L+SSDGE FEVEE+VA+E  TIK MI+D+C D +IP+ N+TSKILA VIEYCK H
Sbjct  1    MKMIVLKSSDGETFEVEESVAVESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRH  60

Query  222  VEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            V+AA++ +   + +   D K FDA+F+KVD +TLFDLI+AAN+LNIKSLLDLT Q VADM
Sbjct  61   VDAASKTE---DKSVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  117

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+RK FN
Sbjct  118  IKGKTPEEIRKTFN  131



>gb|ACA61785.1| SKP1-like protein 3 [Petunia x hybrida]
Length=155

 Score =   172 bits (437),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 106/137 (77%), Gaps = 6/137 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  +MI+L+SSDGE F+VEE+VALE  TIK MI+D+C D +IP+ N+TSKILA VIEYCK
Sbjct  2    STSKMIVLKSSDGETFQVEESVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HVEA        ED  ++D  K FD++F+KVD  TLFDLI+AAN+LNIKSLLDLT Q V
Sbjct  62   RHVEA-----NKAEDKASEDELKSFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTV  116

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  117  ADMIKGKTPEEIRKTFN  133



>ref|XP_003612225.1| SKP1-like protein [Medicago truncatula]
 gb|ABG27019.1| SKP1-like a [Medicago truncatula]
 gb|ACJ83981.1| unknown [Medicago truncatula]
 gb|AES95183.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
 gb|AFK47584.1| unknown [Medicago truncatula]
Length=155

 Score =   172 bits (437),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 104/137 (76%), Gaps = 6/137 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I L+SSDGE FEV+E VALE  TIK MI+D+C D+ IP+ N+TSKILA VIEYCK
Sbjct  2    SSTRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HVEAAA      E+ P++D  K +D  F+KVD  TLFDLI+AAN+LNIKSLLDLT Q V
Sbjct  62   KHVEAAA-----AEEKPSEDEIKSWDGEFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  116

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  117  ADMIKGKTPEEIRKTFN  133



>emb|CDP14555.1| unnamed protein product [Coffea canephora]
Length=157

 Score =   172 bits (436),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 107/143 (75%), Gaps = 8/143 (6%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            MSSPK      +I+L+SSDGE FEVEE VALE  TIK MI+D C D  IP+ N+TSKILA
Sbjct  1    MSSPK------IIVLKSSDGETFEVEELVALESQTIKHMIEDNCADTCIPLPNVTSKILA  54

Query  249  MVIEYCKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLD  70
             VIEYCK HVEA     ++ + +  +D K FDA+F+KVD  TLFDLI+AAN+LNIKSLLD
Sbjct  55   KVIEYCKKHVEAPKS--SDGDKSSDEDLKSFDADFVKVDQGTLFDLILAANYLNIKSLLD  112

Query  69   LTTQAVADMIKDMSPEEVRKIFN  1
            LT Q VADMIK  +PEE+RK FN
Sbjct  113  LTCQTVADMIKGKTPEEIRKTFN  135



>gb|AFK44762.1| unknown [Lotus japonicus]
Length=155

 Score =   171 bits (434),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 105/137 (77%), Gaps = 6/137 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEV+E VALE  TIK M++D+C D+ IP+ N TSKILA VIEYCK
Sbjct  2    SSAKKITLKSSDGEAFEVDEAVALESRTIKHMVEDDCADSGIPLPNATSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HVEAA     NP++ P +D  K +DA+F+KVD  TLFDLI+AAN+LNIKSLLDLT Q V
Sbjct  62   KHVEAA-----NPDEKPTEDELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  116

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  117  ADMIKGKTPEEIRKTFN  133



>ref|XP_006362720.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=155

 Score =   171 bits (433),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 104/136 (76%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  +MI+L+SSDGE FEVEE VALE  TIK MI+D+C D +IP+ N+TSKILA VIEYCK
Sbjct  2    SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+A+       ED    + K FD++F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VA
Sbjct  62   RHVDASKTEDKASED----ELKTFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVA  117

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  118  DMIKGKTPEEIRKTFN  133



>gb|EMT03937.1| SKP1-like protein 1A [Aegilops tauschii]
Length=164

 Score =   171 bits (433),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE F+VEE VA+E  TI+ MI+D+C DN IP+ N+ SKIL+ VIEYCK HV
Sbjct  9    KMITLKSSDGEEFQVEEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVIEYCKKHV  68

Query  219  EAAAEAKTN-PEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            +A A + T+    APA+D K FDA+F+KVD  TLF LI+AAN+LNIK LLDLT Q VADM
Sbjct  69   QADASSSTSTAAPAPAEDLKSFDADFVKVDQATLFALILAANYLNIKGLLDLTCQTVADM  128

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+RK FN
Sbjct  129  IKGKTPEEIRKTFN  142



>ref|XP_009783395.1| PREDICTED: SKP1-like protein 1A [Nicotiana sylvestris]
Length=155

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 106/137 (77%), Gaps = 6/137 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  +MI+L+SSDGE FEVEE VALE  TIK MI+D+C D +IP+ N+TSKILA VIEYCK
Sbjct  2    SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HV+A     T  ED  ++D  K FD++F+KVD  TLFDLI+AAN+LNIKSLLDLT Q V
Sbjct  62   RHVDA-----TKTEDKASEDELKAFDSDFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  116

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  117  ADMIKGKTPEEIRKTFN  133



>gb|AAT99735.1| SKP1 [Nicotiana tabacum]
Length=155

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 106/137 (77%), Gaps = 6/137 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  +MI+L+SSDGE FEVEE VALE  TIK MI+D+C D +IP+ N+TSKILA VIEYCK
Sbjct  2    SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HV+A     T  ED  ++D  K FD++F+KVD  TLFDLI+AAN+LNIKSLLDLT Q V
Sbjct  62   RHVDA-----TKTEDKASEDELKGFDSDFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  116

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  117  ADMIKGKTPEEIRKTFN  133



>ref|XP_004512164.1| PREDICTED: SKP1-like protein 1A-like [Cicer arietinum]
Length=155

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 103/136 (76%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEV+E VALE  TIK MI+D+C D+ IP+ N+TSKILA VIEYCK
Sbjct  2    SSTKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVEAA+      ED    D K +DA+F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VA
Sbjct  62   KHVEAASSDDKPTED----DLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  117

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  118  DMIKGKTPEEIRKTFN  133



>gb|ACJ86090.1| unknown [Medicago truncatula]
Length=155

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 103/137 (75%), Gaps = 6/137 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I L+SSDGE FEV+E VALE  TIK MI+D+C D+ IP+ N+ SKILA VIEYCK
Sbjct  2    SSTRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLPNVASKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HVEAAA      E+ P++D  K +D  F+KVD  TLFDLI+AAN+LNIKSLLDLT Q V
Sbjct  62   KHVEAAA-----AEEKPSEDEIKSWDGEFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  116

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  117  ADMIKGKTPEEIRKTFN  133



>ref|XP_010536422.1| PREDICTED: SKP1-like protein 1A [Tarenaya hassleriana]
Length=166

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 105/145 (72%), Gaps = 9/145 (6%)
 Frame = -2

Query  414  SKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEY  235
            S ++ R I+L+SSDGE FEV+E VALE  TIK M++D+C DN IP+ N+TSK+LA VIEY
Sbjct  2    SSAVERKIILKSSDGEAFEVDEVVALESQTIKHMVEDDCADNGIPLPNVTSKVLAKVIEY  61

Query  234  CKYHVEAAAEAKTNPEDAPAK-------DTKEFDANFIKVDHNTLFDLIMAANFLNIKSL  76
            CK HV+AA  A  N ED           D K +DA F+KVD  TLFDLI+AAN+LNIK L
Sbjct  62   CKKHVDAA--AANNSEDCVGGSAGGDKDDLKAWDAEFVKVDQATLFDLILAANYLNIKGL  119

Query  75   LDLTTQAVADMIKDMSPEEVRKIFN  1
            LDLT Q VADMIK  +PEE+RK FN
Sbjct  120  LDLTCQTVADMIKGKTPEEIRKTFN  144



>gb|ABB77427.1| Skp1-like protein 2 [Petunia integrifolia subsp. inflata]
Length=154

 Score =   170 bits (431),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 105/133 (79%), Gaps = 4/133 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI+L+SSDGE F+VEE+VA+E  TIK MI+D+C D++IP+ N+TS+ILA VIEYCK HV
Sbjct  4    KMIVLKSSDGETFQVEESVAVESQTIKHMIEDDCADSSIPLPNVTSQILAKVIEYCKRHV  63

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            EA+       ED    D K FDA+F+KVD + LFDLI+AAN+LNIKSLLDLT Q VADMI
Sbjct  64   EASKTEDKATED----DLKSFDADFVKVDQSMLFDLILAANYLNIKSLLDLTCQTVADMI  119

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  120  KGKTPEEIRKTFN  132



>ref|XP_004250723.1| PREDICTED: SKP1-like protein 1A [Solanum lycopersicum]
Length=155

 Score =   170 bits (431),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 103/133 (77%), Gaps = 4/133 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI+L+SSDGE FEV+E VALE  TIK MI+D+C D +IP+ N+TSKILA VIEYCK HV
Sbjct  5    KMIVLKSSDGETFEVDEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRHV  64

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            +A+       ED    + K FDA+F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VADMI
Sbjct  65   DASKTEDKASED----ELKTFDADFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  121  KGKTPEEIRKTFN  133



>ref|XP_007225985.1| hypothetical protein PRUPE_ppa012755mg [Prunus persica]
 ref|XP_008221225.1| PREDICTED: SKP1-like protein 1B [Prunus mume]
 gb|AFJ21662.1| Skp1-like protein 1 [Prunus avium]
 gb|EMJ27184.1| hypothetical protein PRUPE_ppa012755mg [Prunus persica]
Length=156

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 104/135 (77%), Gaps = 7/135 (5%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            R I L+SSDGE FEV+E VALE  TIK M++D+C DN IP+ N+TSKILA VIEYCK HV
Sbjct  5    RKITLKSSDGETFEVDEAVALESQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYCKKHV  64

Query  219  EAAAEAKTNPEDAPA--KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            +AA      P+D P+  +D K +D +F+K+D  TLFDLI+AAN+LNIKSLLDLT Q VAD
Sbjct  65   DAA-----KPDDRPSNDEDLKAWDTDFVKIDQATLFDLILAANYLNIKSLLDLTCQTVAD  119

Query  45   MIKDMSPEEVRKIFN  1
            MIK  +PEE+RK FN
Sbjct  120  MIKGKTPEEIRKTFN  134



>gb|EPS66410.1| hypothetical protein M569_08366, partial [Genlisea aurea]
Length=168

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 102/138 (74%), Gaps = 5/138 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I LRSSDGE+FEVEE VA+E  TIK MI+D+C D+ IP+ N+  KIL+ VIEYC+ HV
Sbjct  9    KKITLRSSDGEIFEVEEAVAVESQTIKHMIEDDCADSVIPLPNVHGKILSKVIEYCRRHV  68

Query  219  EAAAEA-----KTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            E  A A     K +   +P +D K FDA F+KVD  TLFDLI+AAN+LNIKSLLDLT Q 
Sbjct  69   EVGASAAKSDDKVSSALSPDEDLKSFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQT  128

Query  54   VADMIKDMSPEEVRKIFN  1
            VADMIK  +PEE+RK FN
Sbjct  129  VADMIKGKTPEEIRKTFN  146



>ref|XP_006360903.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=150

 Score =   170 bits (430),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 102/133 (77%), Gaps = 6/133 (5%)
 Frame = -2

Query  396  MIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVE  217
            MI+LRSSDGE FEV+E VALE  TIK MI+D+C D +IP+ N+TSKILA VIEYCK HVE
Sbjct  1    MIVLRSSDGETFEVDEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRHVE  60

Query  216  AA-AEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
                E KT  ED      K FDA F+KVD +TLFDLI+AAN+LNIKSLLDLT Q VADMI
Sbjct  61   VPKTEDKTAEEDL-----KTFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  115

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  116  KGKTPEEIRKTFN  128



>gb|AAD34458.1| Skp1 [Medicago sativa]
Length=153

 Score =   169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 103/134 (77%), Gaps = 6/134 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            R I L+SSDGE FEV+E VALE  TIK MI+D+C D+ IP+ N+TSKILA VIEYCK HV
Sbjct  3    RKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCKKHV  62

Query  219  EAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            +AAA      ED P +D  K +D+ F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VADM
Sbjct  63   DAAA-----AEDKPNEDELKSWDSEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  117

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+RK FN
Sbjct  118  IKGKTPEEIRKTFN  131



>gb|ACA61783.1| SKP1-like protein 1 [Petunia x hybrida]
Length=155

 Score =   169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 103/136 (76%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  +MI+L+SSDGE F+VEE+VALE  T K MI+D+C D +IP+ N+TSKILA VIEYCK
Sbjct  2    STSKMIVLKSSDGETFQVEESVALESXTXKHMIEDDCADTSIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVEA        ED    + K FD++F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VA
Sbjct  62   RHVEANKSEDKASED----ELKSFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVA  117

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  118  DMIKGKTPEEIRKTFN  133



>ref|XP_006422586.1| hypothetical protein CICLE_v10029465mg [Citrus clementina]
 ref|XP_006486726.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis]
 gb|ESR35826.1| hypothetical protein CICLE_v10029465mg [Citrus clementina]
 gb|KDO68088.1| hypothetical protein CISIN_1g031498mg [Citrus sinensis]
Length=158

 Score =   169 bits (429),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE FEVEETVALE  TIK M++D+C D  IP+ N+TS IL+ VIEYCK HV
Sbjct  5    KKITLKSSDGETFEVEETVALESQTIKHMVEDDCADTVIPLPNVTSTILSKVIEYCKKHV  64

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            EA +  K + + +   D K +DA+F+KVD NTLFDLI+AAN+LNIK LLDLT Q VADMI
Sbjct  65   EAGSGDKKD-DKSTEDDLKTWDADFVKVDQNTLFDLILAANYLNIKGLLDLTCQTVADMI  123

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  124  KGKTPEEIRKTFN  136



>ref|XP_010550803.1| PREDICTED: SKP1-like protein 1B [Tarenaya hassleriana]
Length=158

 Score =   169 bits (429),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            R I L+SSDGE FEV+E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK HV
Sbjct  4    RKIALKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            +A+ + +T    +   D K +DA F+KVD  TLFDLI+AAN+LNIK LLDLT Q VADMI
Sbjct  64   DASVKTETATTYSTDDDLKNWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMI  123

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  124  KGKTPEEIRKTFN  136



>ref|XP_002863814.1| hypothetical protein ARALYDRAFT_917589 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40073.1| hypothetical protein ARALYDRAFT_917589 [Arabidopsis lyrata subsp. 
lyrata]
Length=169

 Score =   169 bits (429),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 106/146 (73%), Gaps = 10/146 (7%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S VR I L+SSDGE FE++E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK
Sbjct  2    STVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  61

Query  228  YHVEAAAEAKTN----------PEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKS  79
             HVEAAA+++T              +  +D K +D+ FIKVD  TLFDLI+AAN+LNIK 
Sbjct  62   KHVEAAAKSETTTEAAATTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKG  121

Query  78   LLDLTTQAVADMIKDMSPEEVRKIFN  1
            LLDLT Q VADMIK  +PEE+RK FN
Sbjct  122  LLDLTCQTVADMIKGKTPEEIRKTFN  147



>ref|XP_010683698.1| PREDICTED: SKP1-like protein 1B isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=171

 Score =   169 bits (429),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 112/145 (77%), Gaps = 9/145 (6%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            + VRMI L+SSDGE FEVEE+VALE  TIK MI+D+C D  IP+ N+T+KIL+ VIEYCK
Sbjct  4    TTVRMITLKSSDGEKFEVEESVALECETIKLMIEDDCADTAIPLPNVTAKILSKVIEYCK  63

Query  228  YHVEAAAEAKT-NPEDAPA--------KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSL  76
             HVE+AA AK+ + ED+ +        ++ K +D  F+KVD  TLF+LI+AAN+LNI+SL
Sbjct  64   KHVESAAAAKSCSTEDSCSSTANSSTNEELKIWDKEFVKVDQKTLFNLILAANYLNIRSL  123

Query  75   LDLTTQAVADMIKDMSPEEVRKIFN  1
            LDLT Q V+D+IKD +PEEVRK+FN
Sbjct  124  LDLTCQTVSDIIKDKTPEEVRKMFN  148



>gb|AAX83944.1| Skp1 [Capsicum annuum]
Length=156

 Score =   169 bits (428),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 107/143 (75%), Gaps = 9/143 (6%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            MS+PK       I+L+SSDGE FEV+E VALE  TIK MI+D+C + +IP+ N+TSKIL+
Sbjct  1    MSAPKK------ILLKSSDGETFEVDEAVALESQTIKHMIEDDCANTSIPLPNVTSKILS  54

Query  249  MVIEYCKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLD  70
             V+EYCK HV+A A+ +   + A   D K FD+ F+KVD  TLFDLI+AAN+LNIKSLLD
Sbjct  55   KVVEYCKKHVDAGAKTE---DKASEDDLKSFDSEFVKVDQGTLFDLILAANYLNIKSLLD  111

Query  69   LTTQAVADMIKDMSPEEVRKIFN  1
            LT Q VADMIK  +PEE+RK FN
Sbjct  112  LTCQTVADMIKGKTPEEIRKTFN  134



>gb|AFB18000.1| SKP1 protein [Nicotiana tabacum]
Length=155

 Score =   169 bits (427),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 105/137 (77%), Gaps = 6/137 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  +MI+L+SSDGE FEVEE VALE  TIK MI+D+C   +IP+ N+TSKILA VIEYCK
Sbjct  2    SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCAGTSIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HV+A     T  ED  ++D  K FD++F+KVD  TLFDLI+AAN+LNIKSLLDLT Q V
Sbjct  62   RHVDA-----TKTEDKASEDELKGFDSDFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  116

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  117  ADMIKGKTPEEIRKTFN  133



>ref|XP_010935123.1| PREDICTED: SKP1-like protein 1B [Elaeis guineensis]
Length=163

 Score =   169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 107/138 (78%), Gaps = 5/138 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE+FEVEETVA+E  TIK MI+D+C  N IP+ N+TSKIL+ VIEYCK HV
Sbjct  4    KKITLKSSDGEVFEVEETVAMESQTIKHMIEDDCAGNGIPLPNVTSKILSKVIEYCKKHV  63

Query  219  E-AAAEAKTNPEDAPAK----DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            + AAA +K+  +D  +K    + K +DA+F+KVD  TLFDLI+AAN+LNIK LLDLT Q 
Sbjct  64   DAAAASSKSTVDDTSSKIVDEELKTWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQT  123

Query  54   VADMIKDMSPEEVRKIFN  1
            VADMIK  +PEE+RK FN
Sbjct  124  VADMIKGKTPEEIRKTFN  141



>ref|XP_009379340.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=156

 Score =   169 bits (427),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 101/136 (74%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEVEE VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+AA   +   ED    D K +D  F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VA
Sbjct  63   RHVDAAKPDEKISED----DLKAWDQEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>ref|XP_004291337.1| PREDICTED: SKP1-like protein 1B-like [Fragaria vesca subsp. vesca]
Length=159

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I L+SSDGE FEV+E VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  2    SSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+AA ++      +  ++ K +DA+F+KVD  TLFDLI+AAN+LNIK+LLDLT Q VA
Sbjct  62   KHVDAAPKSDDRSSSSGDEELKNWDADFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA  121

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  122  DMIKGKTPEEIRKTFN  137



>ref|XP_008393845.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
 gb|ACB87913.1| SKP1-like protein 1 [Malus domestica]
Length=156

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 101/136 (74%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEVEE VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+AA   +   ED    D K +D  F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VA
Sbjct  63   RHVDAAKPDEKISED----DLKAWDQEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>ref|XP_007046627.1| S phase kinase-associated protein 1 [Theobroma cacao]
 gb|EOX90784.1| S phase kinase-associated protein 1 [Theobroma cacao]
Length=156

 Score =   168 bits (425),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 100/136 (74%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I L+SSDGE FEV+E VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  3    SSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVEA        ED    + K +DA+F+KVD  TLFDLI+AAN+LNIK LLDLT Q VA
Sbjct  63   KHVEAPKTEDRTAED----ELKNWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>gb|EPS61104.1| hypothetical protein M569_13700 [Genlisea aurea]
Length=167

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 109/146 (75%), Gaps = 4/146 (3%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            MSS  + S  + I+LRSSDGE+FEV+E+VALE  TIK +I+D+C D  IP+ N+T+KIL+
Sbjct  1    MSSGDATSESK-IVLRSSDGELFEVDESVALESQTIKHLIEDKCADTAIPLPNVTAKILS  59

Query  249  MVIEYCKYHVEAAA---EAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKS  79
             VIEYCK H+ AA+   +  T  E A   + K FDA F+KVD  TLFDLI+AAN+LNIKS
Sbjct  60   KVIEYCKQHISAASKVTDGLTLSEKAVEDELKAFDAEFVKVDQGTLFDLILAANYLNIKS  119

Query  78   LLDLTTQAVADMIKDMSPEEVRKIFN  1
            LLDLT Q VADMIK  +PEE+RK FN
Sbjct  120  LLDLTCQTVADMIKGKTPEEIRKTFN  145



>gb|KHG24597.1| SKP1-like protein 1B [Gossypium arboreum]
Length=158

 Score =   168 bits (425),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 104/139 (75%), Gaps = 8/139 (6%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I+L+SSDGE FEV+E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK
Sbjct  3    STGRKIILKSSDGENFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQ  58
             HVEA     +  ED  A    D K +DA+F+KVD  TLFDLI+AAN+LNIK+LLDLT Q
Sbjct  63   KHVEA-----SKSEDRSASLDDDLKGWDADFVKVDQATLFDLILAANYLNIKALLDLTCQ  117

Query  57   AVADMIKDMSPEEVRKIFN  1
             VADMIK  +PEE+RK FN
Sbjct  118  TVADMIKGKTPEEIRKTFN  136



>ref|XP_003612227.1| SKP1-like protein [Medicago truncatula]
 gb|ABG27020.1| SKP1-like b [Medicago truncatula]
 gb|ACJ84134.1| unknown [Medicago truncatula]
 gb|ACJ85945.1| unknown [Medicago truncatula]
 gb|AES95185.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
 gb|AFK39072.1| unknown [Medicago truncatula]
Length=155

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 104/137 (76%), Gaps = 6/137 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I L+SSDGE FEV+E VALE  TIK MI+D+C D+ IP+ N+TSKILA VIEYCK
Sbjct  2    SSTRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HV+AAA      E+ P +D  K +D+ F+KVD  TLFDLI+AAN+LNIK+LLDLT Q V
Sbjct  62   KHVDAAA-----AEEKPNEDELKSWDSEFVKVDQATLFDLILAANYLNIKNLLDLTCQTV  116

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  117  ADMIKGKTPEEIRKTFN  133



>ref|XP_010494151.1| PREDICTED: SKP1-like protein 1B [Camelina sativa]
Length=168

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 106/145 (73%), Gaps = 9/145 (6%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S VR I L+SSDGE FE++E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK
Sbjct  2    STVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  61

Query  228  YHVEAAAEAK---------TNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSL  76
             HVEAAA+++         T    +  +D K +D+ FIKVD  TLFDLI+AAN+LNIK L
Sbjct  62   KHVEAAAKSETAVSTAATTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGL  121

Query  75   LDLTTQAVADMIKDMSPEEVRKIFN  1
            LDLT Q VADMIK  +P+E+RK FN
Sbjct  122  LDLTCQTVADMIKGKTPDEIRKTFN  146



>gb|ACP20181.1| SKP1-like protein [Citrus maxima]
Length=158

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 101/133 (76%), Gaps = 1/133 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE FEVEETVALE  TIK  ++D+C D  IP+ N+TS IL+ VIEYCK HV
Sbjct  5    KKITLKSSDGETFEVEETVALESQTIKHTVEDDCADTVIPLPNVTSTILSKVIEYCKKHV  64

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            EA +  K + + +   D K +DA+F+KVD NTLFDLI+AAN+LNIK LLDLT Q VADMI
Sbjct  65   EAGSGDKKD-DKSTVDDLKTWDADFVKVDQNTLFDLILAANYLNIKGLLDLTCQTVADMI  123

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  124  KGKTPEEIRKTFN  136



>ref|XP_006425391.1| hypothetical protein CICLE_v10026642mg [Citrus clementina]
 ref|XP_006467001.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis]
 gb|ESR38631.1| hypothetical protein CICLE_v10026642mg [Citrus clementina]
Length=168

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 105/152 (69%), Gaps = 15/152 (10%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            MSSPK      MI+L+S DGE FEVEE VALE  TIK MI+D+C DN IP+ N+T KILA
Sbjct  1    MSSPK------MIVLKSCDGESFEVEEAVALESTTIKHMIEDDCADNGIPLPNVTGKILA  54

Query  249  MVIEYCKYHVEAAAEAKTNPEDAPA---------KDTKEFDANFIKVDHNTLFDLIMAAN  97
             V+EYCK HVE  A   +N   A +         +D K +D +F+KVD  TLFDLI+AAN
Sbjct  55   KVVEYCKKHVEVPATQDSNNSGANSNGTATNGGEEDLKSWDTDFVKVDQATLFDLILAAN  114

Query  96   FLNIKSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            +LNIK LLDLT Q VADMIK  +PEE+RK FN
Sbjct  115  YLNIKGLLDLTCQTVADMIKGKTPEEIRKTFN  146



>gb|EMT05501.1| SKP1-like protein 1B [Aegilops tauschii]
Length=175

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 104/145 (72%), Gaps = 12/145 (8%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE F+VEE +A+E  TI+ MI+D+C DN IP+ N+ SKIL+ VIEYCK HV
Sbjct  9    KMITLKSSDGEEFQVEEAIAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVIEYCKKHV  68

Query  219  EA------------AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSL  76
            +A            A+ + +    A A+D K FDA FIKVD NTLFDLI+AAN+LNIK L
Sbjct  69   QASPKPANSGAAVDASSSTSTAVAASAEDLKSFDAEFIKVDQNTLFDLILAANYLNIKGL  128

Query  75   LDLTTQAVADMIKDMSPEEVRKIFN  1
            LDLT Q VADMIK  +PEE+RK FN
Sbjct  129  LDLTCQTVADMIKGKTPEEIRKTFN  153



>ref|XP_010442189.1| PREDICTED: SKP1-like protein 1B [Camelina sativa]
Length=170

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 105/148 (71%), Gaps = 13/148 (9%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S VR I L+SSDGE FE+EE VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK
Sbjct  2    STVRKITLKSSDGENFEIEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  61

Query  228  YHVEAAAEAKTN------------PEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNI  85
             HVEAAA AK+                +  +D K +D+ FIKVD  TLFDLI+AAN+LNI
Sbjct  62   KHVEAAA-AKSETAVATAATTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNI  120

Query  84   KSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            K LLDLT Q VADMIK  +P+E+RK FN
Sbjct  121  KGLLDLTCQTVADMIKGKTPDEIRKTFN  148



>gb|AFM75900.1| GSK1 [Gossypium hirsutum]
 gb|AFP55363.1| SKP1-like protein [Gossypium hirsutum]
 gb|KHG25005.1| SKP1-like protein 1B [Gossypium arboreum]
Length=156

 Score =   167 bits (423),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 101/136 (74%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I L+SSDGE FEV+E VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  3    SSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVEA      + +D    + K +DA+F+KVD  TLFDLI+AAN+LNIK LLDLT Q VA
Sbjct  63   KHVEAPKTDDRSADD----ELKSWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>gb|AII79402.1| S-phase kinase-associated protein 1-like protein 5 [Malus hupehensis]
Length=156

 Score =   167 bits (423),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 100/136 (74%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEVEE VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+AA   +   ED    D K +D  F+KVD  TLFDLI+AAN+LNIK LLDLT Q VA
Sbjct  63   RHVDAAKPDEKISED----DLKAWDQEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGRTPEEIRKTFN  134



>ref|XP_010669692.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=171

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 108/145 (74%), Gaps = 9/145 (6%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            + V+ I L+SSDGE F+VEE+VALE  TIK +I+D+C DN IP+ N+T+KIL+ VIEYCK
Sbjct  4    TTVKKITLKSSDGENFDVEESVALECQTIKYIIEDDCADNVIPLPNVTAKILSKVIEYCK  63

Query  228  YHVEAAAEAK---------TNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSL  76
             HVE+ A AK         +NP  A  ++ K +DA F+KVD NTLFDLI+AAN+LNIKSL
Sbjct  64   KHVESVAAAKSSTEDGSSSSNPTTADEEELKTWDAEFVKVDQNTLFDLILAANYLNIKSL  123

Query  75   LDLTTQAVADMIKDMSPEEVRKIFN  1
            LDLT Q VA+M+   +PEE+RK FN
Sbjct  124  LDLTCQTVANMMTGKTPEEIRKTFN  148



>gb|AII79401.1| S-phase kinase-associated protein 1-like protein 4 [Malus hupehensis]
Length=156

 Score =   167 bits (422),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 101/136 (74%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEVEE VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+AA   +   ED    D K +D  F+KVD  TLFDLI+AAN+LNIK+LLDLT Q VA
Sbjct  63   KHVDAAKPDEKISED----DLKAWDQEFVKVDQATLFDLILAANYLNIKTLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>gb|KDP29669.1| hypothetical protein JCGZ_18831 [Jatropha curcas]
Length=159

 Score =   167 bits (422),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + + L+SSDGE FEVEE VA+E  TIK MI+D+C D  IP+ N+TSKILA VIEYCK
Sbjct  2    STSKKVTLKSSDGETFEVEEAVAVESQTIKHMIEDDCADTEIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVEAA   K   + +  +    +DA+F+KVD NTLFDLI+AAN+LNIKSLLDLT Q VA
Sbjct  62   KHVEAATADKDKDKSSSDEALTTWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVA  121

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  122  DMIKGKTPEEIRKTFN  137



>ref|XP_008337985.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
Length=156

 Score =   167 bits (422),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 101/136 (74%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEVEE VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+AA   +   ED    D K +D  F+KVD  TLFDLI+AAN+LNIK+LLDLT Q VA
Sbjct  63   KHVDAAKPDEKISED----DLKAWDQEFVKVDQATLFDLILAANYLNIKTLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>ref|XP_002305525.2| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
 gb|ABK92824.1| unknown [Populus trichocarpa]
 gb|EEE86036.2| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
Length=161

 Score =   167 bits (422),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE F V+E VA+E  TIK MI+D+C DN IP+ N+TSKILA VIEYCK HV
Sbjct  5    KKITLKSSDGETFVVDEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILAKVIEYCKKHV  64

Query  219  EAAAEAKTNPEDAPAKDT--KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            EA ++ + N      KD   K +D  F+KVD NTLFDLI+AAN+LNIK LLDLT Q VAD
Sbjct  65   EAGSDKEKNVTGVTEKDESLKSWDTEFVKVDQNTLFDLILAANYLNIKGLLDLTCQTVAD  124

Query  45   MIKDMSPEEVRKIFN  1
            MIK  +PEE+RK FN
Sbjct  125  MIKGKTPEEIRKTFN  139



>ref|NP_568603.1| SKP1-like protein 1B [Arabidopsis thaliana]
 sp|Q9FHW7.1|SKP1B_ARATH RecName: Full=SKP1-like protein 1B; AltName: Full=SKP1-like 2; 
AltName: Full=UFO-binding protein 2 [Arabidopsis thaliana]
 gb|AAC14445.1| Skp1 homolog [Arabidopsis thaliana]
 dbj|BAB08452.1| UIP2 [Arabidopsis thaliana]
 gb|AAO44064.1| At5g42190 [Arabidopsis thaliana]
 dbj|BAE99755.1| UIP2 [Arabidopsis thaliana]
 gb|AED94777.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana]
Length=171

 Score =   167 bits (423),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 105/148 (71%), Gaps = 12/148 (8%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S VR I L+SSDGE FE++E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK
Sbjct  2    STVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYCK  61

Query  228  YHVEAAAEAK------------TNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNI  85
             HVEAA +++            T    +  +D K +D+ FIKVD  TLFDLI+AAN+LNI
Sbjct  62   RHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNI  121

Query  84   KSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            K LLDLT Q VADMIK  +PEE+RK FN
Sbjct  122  KGLLDLTCQTVADMIKGKTPEEIRKTFN  149



>ref|XP_006281119.1| hypothetical protein CARUB_v10027150mg [Capsella rubella]
 gb|EOA14017.1| hypothetical protein CARUB_v10027150mg [Capsella rubella]
Length=204

 Score =   168 bits (425),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 107/150 (71%), Gaps = 11/150 (7%)
 Frame = -2

Query  417  KSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIE  238
            K  S VR I L+SSDGE FE++E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIE
Sbjct  33   KPMSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIE  92

Query  237  YCKYHVEAAAEAKTNPEDAPA-----------KDTKEFDANFIKVDHNTLFDLIMAANFL  91
            YCK HVEAAA+++T    A             +D K +D+ FIKVD  TLFDLI+AAN+L
Sbjct  93   YCKKHVEAAAKSETAVSAASTTTTAAASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYL  152

Query  90   NIKSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            NIK LLDLT Q VADMIK  +PEE+RK FN
Sbjct  153  NIKGLLDLTCQTVADMIKGKTPEEIRKTFN  182



>ref|XP_009363460.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=156

 Score =   166 bits (421),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 101/136 (74%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEVEE VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+AA   +   ED    D K +D  F+KVD  TLFDLI+AAN+LNIK+LLDLT Q VA
Sbjct  63   KHVDAAKPDEKISED----DLKAWDQEFVKVDQVTLFDLILAANYLNIKTLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>ref|XP_008357122.1| PREDICTED: SKP1-like protein 1B [Malus domestica]
 gb|AII79405.1| S-phase kinase-associated protein 1-like protein 2 [Malus hupehensis]
Length=156

 Score =   166 bits (421),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 102/135 (76%), Gaps = 7/135 (5%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            R I L+SSDGE FEV+E VAL   TIK M++D+C DN IP+ N+TSKILA VIEYC+ HV
Sbjct  5    RKITLKSSDGETFEVDEAVALMSQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYCRKHV  64

Query  219  EAAAEAKTNPEDAPA--KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            EAA      PE+  +  +D K +DA F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VAD
Sbjct  65   EAA-----KPEERASVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  119

Query  45   MIKDMSPEEVRKIFN  1
            MIK  +PEE+RK FN
Sbjct  120  MIKGKTPEEIRKTFN  134



>gb|AAC63110.1| UIP2 [Arabidopsis thaliana]
Length=172

 Score =   167 bits (422),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 105/148 (71%), Gaps = 12/148 (8%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S VR I L+SSDGE FE++E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK
Sbjct  3    STVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYCK  62

Query  228  YHVEAAAEAK------------TNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNI  85
             HVEAA +++            T    +  +D K +D+ FIKVD  TLFDLI+AAN+LNI
Sbjct  63   RHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNI  122

Query  84   KSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            K LLDLT Q VADMIK  +PEE+RK FN
Sbjct  123  KGLLDLTCQTVADMIKGKTPEEIRKTFN  150



>gb|KDO71310.1| hypothetical protein CISIN_1g030962mg [Citrus sinensis]
Length=168

 Score =   167 bits (422),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 104/152 (68%), Gaps = 15/152 (10%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            MSSPK      MI+L+S DGE FEVEE VALE  TIK MI+D+C DN IP+ N+T KILA
Sbjct  1    MSSPK------MIVLKSCDGESFEVEEAVALESTTIKHMIEDDCADNGIPLPNVTGKILA  54

Query  249  MVIEYCKYHVEAAAEAKTNPEDAPA---------KDTKEFDANFIKVDHNTLFDLIMAAN  97
             V+EYCK HVE      +N   A +         +D K +D +F+KVD  TLFDLI+AAN
Sbjct  55   KVVEYCKKHVEVPTTQDSNTSGANSNGAATNGGEEDLKSWDTDFVKVDQATLFDLILAAN  114

Query  96   FLNIKSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            +LNIK LLDLT Q VADMIK  +PEE+RK FN
Sbjct  115  YLNIKGLLDLTCQTVADMIKGKTPEEIRKTFN  146



>ref|XP_010683792.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=170

 Score =   167 bits (422),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 108/144 (75%), Gaps = 8/144 (6%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            + VR I L+SSDGE F+VEE+VALE  TIK MI+D+C DN IP+ N+T+KIL+ VI YCK
Sbjct  4    TTVRKITLKSSDGEKFDVEESVALECETIKLMIEDDCADNVIPLPNVTAKILSKVIVYCK  63

Query  228  YHVEAAAEAKTNPEDAPA--------KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLL  73
             HVE+AA    + ED+ +        ++ K +D  F+KVD +TL DLI+AAN+LNIKSLL
Sbjct  64   KHVESAAAKSCSTEDSCSSTANSTTNEELKIWDKEFVKVDQSTLLDLILAANYLNIKSLL  123

Query  72   DLTTQAVADMIKDMSPEEVRKIFN  1
            DLT Q V+DMIKD +PEEVRK+FN
Sbjct  124  DLTCQTVSDMIKDKTPEEVRKMFN  147



>ref|XP_003621661.1| SKP1-like protein [Medicago truncatula]
 gb|AES77879.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   166 bits (421),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + + L+SSD E FEV E VALE  TIK MI+D+C DN IP+ N+T +ILA VIEYCK
Sbjct  3    STTKKMTLKSSDNETFEVPEAVALESQTIKHMIEDDCTDNGIPVPNVTGQILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+AA+  +   ED    D K +DA F+KVD +TLFDLI+AAN+LNIKSLLDLT Q+VA
Sbjct  63   KHVDAASSDEKPSED----DLKNWDAEFVKVDQDTLFDLILAANYLNIKSLLDLTCQSVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>ref|XP_010680409.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=158

 Score =   166 bits (420),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 101/133 (76%), Gaps = 1/133 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            R I L+SSDGE FEVEE+VALE  TIK M++D+C DN IP+ N+TSKILA VIEYCK HV
Sbjct  5    RKITLKSSDGETFEVEESVALESQTIKHMVEDDCADNVIPLPNVTSKILAKVIEYCKKHV  64

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            +    ++ N       + K +DA+F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VADMI
Sbjct  65   DFPKSSENNDRQVD-DELKTWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  123

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  124  KGKTPEEIRKTFN  136



>ref|XP_002270061.1| PREDICTED: SKP1-like protein 1B [Vitis vinifera]
 ref|XP_010664854.1| PREDICTED: SKP1-like protein 1B [Vitis vinifera]
 emb|CAN76662.1| hypothetical protein VITISV_040452 [Vitis vinifera]
Length=156

 Score =   166 bits (420),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 102/138 (74%), Gaps = 7/138 (5%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I L+SSDGE F+V+E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK
Sbjct  2    SSSRKITLKSSDGEAFDVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDT--KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
             HVEA       PE+    D   K +DA+F+KVD  TLFDLI+AAN+LNIKSLLDLT Q 
Sbjct  62   KHVEAP-----KPEERSGVDEELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQT  116

Query  54   VADMIKDMSPEEVRKIFN  1
            VADMIK  +PEE+RK FN
Sbjct  117  VADMIKGKTPEEIRKTFN  134



>ref|XP_010935122.1| PREDICTED: SKP1-like protein 1A [Elaeis guineensis]
Length=163

 Score =   166 bits (421),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 105/138 (76%), Gaps = 5/138 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE+FEVEE VA+E  TIK MI+D+C  N IP+ N+TSKIL+ VIEYCK HV
Sbjct  4    KKITLKSSDGEVFEVEEAVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKRHV  63

Query  219  E-AAAEAKTNPEDAPAK----DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            + AAA +++  +D  +K    + K +DA F+KVD  TLFDLI+AAN+LNIK LLDLT Q 
Sbjct  64   DFAAASSRSTADDTSSKPADDELKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQT  123

Query  54   VADMIKDMSPEEVRKIFN  1
            VADMIK  +PEE+RK FN
Sbjct  124  VADMIKGKTPEEIRKTFN  141



>ref|XP_002510576.1| skp1, putative [Ricinus communis]
 gb|EEF52763.1| skp1, putative [Ricinus communis]
Length=157

 Score =   166 bits (420),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 102/139 (73%), Gaps = 8/139 (6%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I L+SSDGE FEV+E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK
Sbjct  2    STSRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQ  58
             HVE +       +D P+    + K +DA F+KVD  TLFDLI+AAN+LNIKSLLDLT Q
Sbjct  62   KHVETSKS-----DDRPSSVDDELKTWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQ  116

Query  57   AVADMIKDMSPEEVRKIFN  1
             VADMIK  +PEE+RK FN
Sbjct  117  TVADMIKGKTPEEIRKTFN  135



>ref|XP_011046673.1| PREDICTED: SKP1-like protein 1A [Populus euphratica]
Length=161

 Score =   166 bits (420),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE F V+E VA+E  TIK MI+D+C DN IP+ N+TSKILA VIEYCK HV
Sbjct  5    KKITLKSSDGETFVVDEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILAKVIEYCKKHV  64

Query  219  EAAAEAKTNPEDAPAKDT--KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            EA ++ + N      KD   K +D  F+KVD NTLFDLI+AAN+LNIK LLDLT Q VAD
Sbjct  65   EAGSDKEKNVTGVTEKDESLKSWDTEFVKVDQNTLFDLILAANYLNIKDLLDLTCQTVAD  124

Query  45   MIKDMSPEEVRKIFN  1
            MIK  +PEE+RK FN
Sbjct  125  MIKGKTPEEIRKTFN  139



>ref|XP_007202708.1| hypothetical protein PRUPE_ppa012752mg [Prunus persica]
 gb|EMJ03907.1| hypothetical protein PRUPE_ppa012752mg [Prunus persica]
Length=156

 Score =   166 bits (419),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 101/136 (74%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEVEE VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+AA   +   ED    D K +D +F+KVD  TLFDLI+AAN+LNIK LLDLT Q VA
Sbjct  63   KHVDAAKPDEKISED----DLKAWDQDFVKVDQATLFDLILAANYLNIKLLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>ref|NP_565123.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana]
 sp|Q39255.1|SKP1A_ARATH RecName: Full=SKP1-like protein 1A; Short=SKP1-like 1; AltName: 
Full=UFO-binding protein 1 [Arabidopsis thaliana]
 pdb|2P1M|A Chain A, Tir1-ask1 Complex Structure
 pdb|2P1N|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1N|D Chain D, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1O|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|2P1P|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|2P1Q|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|3C6N|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein- 
Substrate Interactions In Auxin Perception And Signaling
 pdb|3C6O|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein-Substrate 
Interactions In Auxin Perception And Signaling
 pdb|3C6P|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein- 
Substrate Interactions In Auxin Perception And Signaling
 pdb|3OGK|A Chain A, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|C Chain C, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|E Chain E, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|G Chain G, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|I Chain I, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|K Chain K, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|M Chain M, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|O Chain O, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGL|A Chain A, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|C Chain C, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|E Chain E, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|G Chain G, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|I Chain I, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|K Chain K, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|M Chain M, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|O Chain O, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGM|A Chain A, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|C Chain C, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|E Chain E, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|G Chain G, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|I Chain I, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|K Chain K, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|M Chain M, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|O Chain O, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 gb|AAF26761.1|AC007396_10 T4O12.17 [Arabidopsis thaliana]
 gb|AAB17535.1| homolog to Skp1p, an evolutionarily conserved kinetochore protein 
in budding yeast [Arabidopsis thaliana]
 gb|AAC14444.1| Skp1 homolog [Arabidopsis thaliana]
 gb|AAC63109.1| UIP1 [Arabidopsis thaliana]
 gb|AAL87354.1| putative SKP1/ASK1 protein At1 [Arabidopsis thaliana]
 gb|AAM45019.1| putative SKP1/ASK1 protein At1 [Arabidopsis thaliana]
 gb|AEE35780.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana]
Length=160

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEVEE VALE  TI  M++D+CVDN +P+ N+TSKILA VIEYCK HV
Sbjct  4    KKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHV  63

Query  219  EAAAEAKTNPEDAPAK--DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            EAAA      E A     D K +DA+F+K+D  TLF+LI+AAN+LNIK+LLDLT Q VAD
Sbjct  64   EAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVAD  123

Query  45   MIKDMSPEEVRKIFN  1
            MIK  +PEE+R  FN
Sbjct  124  MIKGKTPEEIRTTFN  138



>ref|XP_002510577.1| skp1, putative [Ricinus communis]
 gb|EEF52764.1| skp1, putative [Ricinus communis]
Length=157

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 101/139 (73%), Gaps = 8/139 (6%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEVEE VALE  TIK MI+D+C D+ IP+ N+TSKIL+ VIEYCK
Sbjct  2    SAGKKITLKSSDGETFEVEELVALESQTIKHMIEDDCADSGIPLPNVTSKILSKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQ  58
             HVE         ED P+    D K +DA F+KVD  TLFDLI+AAN+LNIKSLLDLT Q
Sbjct  62   KHVETPKS-----EDRPSSADDDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQ  116

Query  57   AVADMIKDMSPEEVRKIFN  1
             VADMIK  +PEE+RK FN
Sbjct  117  TVADMIKGKTPEEIRKTFN  135



>ref|XP_008445323.1| PREDICTED: SKP1-like protein 1B [Cucumis melo]
Length=157

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 102/139 (73%), Gaps = 8/139 (6%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I L+SSDGE+FEV+E VALE  TIK MI+D+C D+ IP+ N+TSKIL+ VIEYCK
Sbjct  2    SSGRKITLKSSDGEIFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILSKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQ  58
             HVE+       PED       D K +D+ F+KVD  TLFDLI+AAN+LNIKSLLDLT Q
Sbjct  62   KHVESP-----KPEDRTGSVDDDLKTWDSEFVKVDQATLFDLILAANYLNIKSLLDLTCQ  116

Query  57   AVADMIKDMSPEEVRKIFN  1
             VADMIK  +PEE+RK FN
Sbjct  117  TVADMIKGKTPEEIRKTFN  135



>ref|XP_002306950.1| hypothetical protein POPTR_0005s26450g [Populus trichocarpa]
 gb|ABK95554.1| unknown [Populus trichocarpa]
 gb|EEE93946.1| hypothetical protein POPTR_0005s26450g [Populus trichocarpa]
Length=157

 Score =   165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R  +L+SSDGE FEV+E VA+E  TIK MI+D+C DN IP+ N+TSK+LA VIEYCK
Sbjct  2    STGRKFILKSSDGESFEVDEAVAVESQTIKHMIEDDCADNGIPLPNVTSKVLAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVE + ++   P  A A D K +DA F+KVD  TLFDLI+AAN+LNIK+LLDLT Q VA
Sbjct  62   KHVE-SPKSDDRPSSA-ADDLKAWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQRVA  119

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  120  DMIKGKTPEEIRKTFN  135



>gb|EMT15375.1| SKP1-like protein 4 [Aegilops tauschii]
Length=172

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 104/149 (70%), Gaps = 17/149 (11%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
             + +MI+L+SS+GE F+VE  VA+E  TI+ MI+D+C DN IP+ N+ SKILA VIEYCK
Sbjct  6    GVKKMILLKSSNGEGFQVEAAVAIESQTIRHMIEDDCADNGIPLPNVDSKILAKVIEYCK  65

Query  228  YHVEAAAEAKTNPED-------------APAKDTKEFDANFIKVDHNTLFDLIMAANFLN  88
             HV+A+     NP D             A A+D K FDA F+KVD  TLFDLI+AAN+LN
Sbjct  66   KHVQAS----PNPADSSAADANSSTSTAAAAEDLKSFDAEFVKVDQATLFDLILAANYLN  121

Query  87   IKSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            IK LLDLT Q VADMIK  +PEE+RK FN
Sbjct  122  IKGLLDLTCQTVADMIKGKTPEEIRKTFN  150



>ref|XP_006435227.1| hypothetical protein CICLE_v10002751mg [Citrus clementina]
 ref|XP_006473700.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis]
 gb|ESR48467.1| hypothetical protein CICLE_v10002751mg [Citrus clementina]
Length=158

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEV+E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK
Sbjct  2    STSKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  61

Query  228  YHVEAAA---EAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQ  58
             HVEA+     A +  +D    D K +D +F+KVD  TLFDLI+AAN+LNIKSLLDLT Q
Sbjct  62   KHVEASKSDDRATSGVDD----DLKAWDTDFVKVDQATLFDLILAANYLNIKSLLDLTCQ  117

Query  57   AVADMIKDMSPEEVRKIFN  1
             VADMIK  +PEE+RK FN
Sbjct  118  TVADMIKGKTPEEIRKTFN  136



>ref|XP_010683699.1| PREDICTED: SKP1-like protein 1B isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=152

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 105/133 (79%), Gaps = 5/133 (4%)
 Frame = -2

Query  396  MIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVE  217
            MI L+SSDGE FEVEE+VALE  TIK MI+D+C D  IP+ N+T+KIL+ VIEYCK HVE
Sbjct  1    MITLKSSDGEKFEVEESVALECETIKLMIEDDCADTAIPLPNVTAKILSKVIEYCKKHVE  60

Query  216  AAAEAKT-NPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            +AA AK+ + ED      K +D  F+KVD  TLF+LI+AAN+LNI+SLLDLT Q V+D+I
Sbjct  61   SAAAAKSCSTEDK----LKIWDKEFVKVDQKTLFNLILAANYLNIRSLLDLTCQTVSDII  116

Query  39   KDMSPEEVRKIFN  1
            KD +PEEVRK+FN
Sbjct  117  KDKTPEEVRKMFN  129



>ref|XP_006359705.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=156

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 107/144 (74%), Gaps = 11/144 (8%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            MSSP        I+L+SSDGE+FEV+E VALE  TIK +I+D+C  + IP+ N+TSKILA
Sbjct  1    MSSPTK------ILLKSSDGEVFEVDEAVALESQTIKHLIEDDCAGSNIPLPNVTSKILA  54

Query  249  MVIEYCKYHVEAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLL  73
             VIEY K HVEA+++     ED  A+D  K FDA F+KVD  TLFDLI+AAN+LNIKSLL
Sbjct  55   KVIEYSKRHVEASSKT----EDKAAEDELKVFDAEFVKVDQGTLFDLILAANYLNIKSLL  110

Query  72   DLTTQAVADMIKDMSPEEVRKIFN  1
            DLT Q VADMIK  +PEE+RK FN
Sbjct  111  DLTCQTVADMIKGKTPEEIRKTFN  134



>emb|CDY13521.1| BnaC02g23320D [Brassica napus]
Length=160

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 105/136 (77%), Gaps = 4/136 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV+E VALE  TI  M++D+CVDN IP+ N+TSKILA VIEYCK HV
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGIPLPNVTSKILAKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
            +AAA +KT+  D  A    D K +DA F+K+D  TLF+LI+AAN+LNIK+LLDLT Q VA
Sbjct  64   DAAA-SKTDAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  122

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+R  FN
Sbjct  123  DMIKGKTPEEIRTTFN  138



>ref|XP_011043147.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
Length=158

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I LRSSDGE FEV+E VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  2    SSGRKISLRSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVE   +++    ++   + K +DA F++VD  TLFDLI+AAN+LNIK LLDLT Q VA
Sbjct  62   KHVE-TPKSEDRGTNSGGDELKNWDAEFVRVDQVTLFDLILAANYLNIKDLLDLTCQTVA  120

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  121  DMIKGKTPEEIRKTFN  136



>ref|XP_010683700.1| PREDICTED: SKP1-like protein 1B isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=150

 Score =   164 bits (416),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 103/132 (78%), Gaps = 5/132 (4%)
 Frame = -2

Query  396  MIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVE  217
            MI L+SSDGE FEVEE+VALE  TIK MI+D+C D  IP+ N+T+KIL+ VIEYCK HVE
Sbjct  1    MITLKSSDGEKFEVEESVALECETIKLMIEDDCADTAIPLPNVTAKILSKVIEYCKKHVE  60

Query  216  AAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMIK  37
            +AA A +  E     + K +D  F+KVD  TLF+LI+AAN+LNI+SLLDLT Q V+D+IK
Sbjct  61   SAAAANSTNE-----ELKIWDKEFVKVDQKTLFNLILAANYLNIRSLLDLTCQTVSDIIK  115

Query  36   DMSPEEVRKIFN  1
            D +PEEVRK+FN
Sbjct  116  DKTPEEVRKMFN  127



>gb|EMT23721.1| SKP1-like protein 1A [Aegilops tauschii]
Length=164

 Score =   165 bits (417),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE F+VEE VA+E  TI+ MI+D+C DN IP+ N+ SKIL+ +IEYCK HV
Sbjct  9    KMITLKSSDGEEFQVEEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKIIEYCKKHV  68

Query  219  EA-AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            +A A+ + +    APA+D K +DA+F+KVD  TLFDLI+AAN+LNIK LLDLT Q VADM
Sbjct  69   QADASSSTSTTAAAPAEDLKSYDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADM  128

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+RK FN
Sbjct  129  IKGKTPEEIRKTFN  142



>ref|XP_011092967.1| PREDICTED: SKP1-like protein 1A [Sesamum indicum]
Length=169

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 109/148 (74%), Gaps = 6/148 (4%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            MSS  + S  +MI+L+SSDGE FEVEE VA+E  TIK MI+D C D  IP+ N+TSKILA
Sbjct  1    MSSGDAAS-SKMIVLKSSDGETFEVEEAVAVESQTIKHMIEDNCADTCIPLPNVTSKILA  59

Query  249  MVIEYCKYHVEAAAEAKTNPEDAPA-----KDTKEFDANFIKVDHNTLFDLIMAANFLNI  85
             VIEYCK HV+AAA+A  +    PA     +D K FD  F+KVD  TLFDLI+AAN+LNI
Sbjct  60   KVIEYCKRHVDAAAKANADGALTPADKVVDEDLKAFDTEFVKVDQGTLFDLILAANYLNI  119

Query  84   KSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            KSLLDLT Q VADMIK  +PEE+RK FN
Sbjct  120  KSLLDLTCQTVADMIKGKTPEEIRKTFN  147



>gb|KDP36889.1| hypothetical protein JCGZ_08180 [Jatropha curcas]
Length=157

 Score =   164 bits (416),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 103/139 (74%), Gaps = 8/139 (6%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I L+S+DGE FEV+E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK
Sbjct  2    STGRKITLKSADGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPA---KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQ  58
             HVE         +D P+   ++ K +DA+F+KVD  TLFDLI+AAN+LNIKSLLDLT Q
Sbjct  62   KHVETPKS-----DDRPSSADEELKTWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQ  116

Query  57   AVADMIKDMSPEEVRKIFN  1
             VADMIK  +PEE+RK FN
Sbjct  117  TVADMIKGKTPEEIRKTFN  135



>ref|NP_001241052.1| uncharacterized protein LOC100798104 [Glycine max]
 gb|ACU21125.1| unknown [Glycine max]
 gb|KHN00453.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   164 bits (416),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 100/133 (75%), Gaps = 4/133 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE FEVEE VA+E  TIK MI+D C D+ IP+ N+TSKILA VIEYCK HV
Sbjct  5    KKITLKSSDGEAFEVEEAVAVESQTIKHMIEDNCADSGIPLPNVTSKILAKVIEYCKKHV  64

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            EA    +   ED    + K +DA+F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VADMI
Sbjct  65   EANCADEKPSED----ELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  121  KGKTPEEIRKTFN  133



>ref|XP_006847969.1| hypothetical protein AMTR_s00029p00153350 [Amborella trichopoda]
 gb|ERN09550.1| hypothetical protein AMTR_s00029p00153350 [Amborella trichopoda]
Length=157

 Score =   164 bits (416),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 7/135 (5%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + + L+SSDGE+FEVEE+VA+E  TIK MI+D+C  N IP+ N++SKILA VIEYCKYHV
Sbjct  6    KKVTLKSSDGEVFEVEESVAVESQTIKHMIEDDCAGNGIPLPNVSSKILAKVIEYCKYHV  65

Query  219  EA--AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            +A    E KT  E     + K +DA F++VD  TLFDLI+AAN+LNIK+LLDLT Q VAD
Sbjct  66   DAQKVTEDKTQEE-----EIKSWDAEFVRVDQATLFDLILAANYLNIKNLLDLTCQTVAD  120

Query  45   MIKDMSPEEVRKIFN  1
            MIK  +PEE+RK FN
Sbjct  121  MIKGKTPEEIRKTFN  135



>ref|XP_009414442.1| PREDICTED: SKP1-like protein 1A [Musa acuminata subsp. malaccensis]
Length=157

 Score =   164 bits (416),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV+  VA+E  TI+ MI+D+C +N +P+ N+TSKILA VIEYC+ HV
Sbjct  3    KKIILKSSDGEEFEVDVAVAMESQTIRHMIEDDCFENGVPLPNVTSKILAKVIEYCRKHV  62

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            +AA+ +  +    P ++ K +DA+F+KVD  TLFDLI+AAN+LNIK LLDLT Q VADMI
Sbjct  63   DAASNSSGDASKVPDEELKAWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMI  122

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  123  KGKTPEEIRKTFN  135



>ref|XP_003577587.1| PREDICTED: SKP1-like protein 1A [Brachypodium distachyon]
Length=181

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 103/149 (69%), Gaps = 16/149 (11%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE FEVEETVA+E  TI+ MI+D+C DN IP+ N+ SKIL+ VIEYC  HV
Sbjct  11   KMITLKSSDGEEFEVEETVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIEYCNKHV  70

Query  219  E-AAAEAKTNPED---------------APAKDTKEFDANFIKVDHNTLFDLIMAANFLN  88
               AA    NP D               AP +D K +DA+F+KVD  TLFDLI+AAN+LN
Sbjct  71   HATAAAKAANPSDGDANPAAANNSSTTAAPGEDLKNWDADFVKVDQATLFDLILAANYLN  130

Query  87   IKSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            IK LLDLT Q VADMIK  +PEE+RK FN
Sbjct  131  IKGLLDLTCQTVADMIKGKTPEEIRKTFN  159



>ref|XP_009128146.1| PREDICTED: SKP1-like protein 1A [Brassica rapa]
 emb|CDY39073.1| BnaA02g17620D [Brassica napus]
Length=160

 Score =   164 bits (416),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 104/136 (76%), Gaps = 4/136 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV+E VALE  TI  M++D+CVDN IP+ N+TSKILA VIEYCK HV
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGIPLPNVTSKILAKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
            +AAA +KT   D  A    D K +DA F+K+D  TLF+LI+AAN+LNIK+LLDLT Q VA
Sbjct  64   DAAA-SKTEAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  122

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+R  FN
Sbjct  123  DMIKGKTPEEIRTTFN  138



>gb|ACU13236.1| unknown [Glycine max]
Length=155

 Score =   164 bits (415),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 4/133 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE FEVEE VA+E  TIK M++D C D+ IP+ N+TSKILA VIEYCK HV
Sbjct  5    KKITLKSSDGEAFEVEEAVAVESQTIKHMVEDNCADSGIPLPNVTSKILAKVIEYCKKHV  64

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            EA    +   ED    + K +DA+F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VADMI
Sbjct  65   EANCADEKPSED----ELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  121  KGKTPEEIRKTFN  133



>dbj|BAB85607.1| kinetochore protein [Brassica juncea]
Length=160

 Score =   164 bits (415),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 104/136 (76%), Gaps = 4/136 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV+E VALE  TI  M++D+CVDN IP+ N+TSKILA VIEYCK HV
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGIPLPNVTSKILAKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
            +AAA +KT   D  A    D K +DA F+K+D  TLF+LI+AAN+LNIK+LLDLT Q VA
Sbjct  64   DAAA-SKTEAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  122

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+R  FN
Sbjct  123  DMIKGKTPEEIRTTFN  138



>ref|XP_004287783.1| PREDICTED: SKP1-like protein 1A-like [Fragaria vesca subsp. vesca]
Length=156

 Score =   164 bits (414),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 101/136 (74%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEVEE VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  3    SSAKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+AA       E    ++ K +D +F+KVD  TLFDLI+AAN+LNIK+LLDLT Q VA
Sbjct  63   KHVDAAKP----DEKVTEEELKVWDQDFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>gb|ABK96569.1| unknown [Populus trichocarpa x Populus deltoides]
Length=158

 Score =   164 bits (415),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 100/138 (72%), Gaps = 5/138 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I LRSSDGE FEV+E VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  2    SSGRKISLRSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEA--AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
             HVE   + +  TN  D    + K +D  F++VD  TLFDLI+AAN+LNIK LLDLT Q 
Sbjct  62   KHVETPKSEDRGTNSGD---DELKNWDTEFVRVDQATLFDLILAANYLNIKGLLDLTCQT  118

Query  54   VADMIKDMSPEEVRKIFN  1
            VADMIK  +PEE+RK FN
Sbjct  119  VADMIKGKTPEEIRKTFN  136



>ref|XP_004231049.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=156

 Score =   164 bits (414),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 107/144 (74%), Gaps = 11/144 (8%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            MS+P        I+L+SSDGE+FEV+E VALE  TIK +I+D+C  + IP+ N+TSKILA
Sbjct  1    MSTPTK------ILLKSSDGEVFEVDEAVALESQTIKHLIEDDCAGSNIPLPNVTSKILA  54

Query  249  MVIEYCKYHVEAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLL  73
             VIEY K HVEA+++     ED  A+D  K FDA F+KVD  TLFDLI+AAN+LNIKSLL
Sbjct  55   KVIEYSKRHVEASSKT----EDKAAEDELKVFDAEFVKVDQGTLFDLILAANYLNIKSLL  110

Query  72   DLTTQAVADMIKDMSPEEVRKIFN  1
            DLT Q VADMIK  +PEE+RK FN
Sbjct  111  DLTCQTVADMIKGKTPEEIRKTFN  134



>ref|NP_001235349.1| uncharacterized protein LOC100306458 [Glycine max]
 gb|ACU14645.1| unknown [Glycine max]
 gb|KHN35539.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   164 bits (414),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 102/134 (76%), Gaps = 6/134 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE FEVEE VALE  TIK MI+D+C D+ IP+ N+TSKILA VIEYCK HV
Sbjct  5    KKITLKSSDGEAFEVEEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCKKHV  64

Query  219  EAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            EA      + ++ P++D  K +D +F+ VD  TLFDLI+AAN+LNIKSLLDLT Q VADM
Sbjct  65   EA-----NSADEKPSEDVLKAWDVDFVNVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+RK FN
Sbjct  120  IKGKTPEEIRKTFN  133



>ref|XP_004143010.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 ref|XP_004161077.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 gb|KGN62264.1| hypothetical protein Csa_2G346050 [Cucumis sativus]
Length=157

 Score =   164 bits (414),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 101/139 (73%), Gaps = 8/139 (6%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I L+SSDGE+FEV+E VALE  TIK MI+D+C D+ IP+ N+ SKIL+ VIEYCK
Sbjct  2    SSGRKITLKSSDGEIFEVDEAVALESQTIKHMIEDDCADSGIPLPNVNSKILSKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQ  58
             HVE+       PED       D K +D+ F+KVD  TLFDLI+AAN+LNIKSLLDLT Q
Sbjct  62   KHVESP-----KPEDRTGSVDDDLKTWDSEFVKVDQATLFDLILAANYLNIKSLLDLTCQ  116

Query  57   AVADMIKDMSPEEVRKIFN  1
             VADMIK  +PEE+RK FN
Sbjct  117  TVADMIKGKTPEEIRKTFN  135



>emb|CAA75118.1| fimbriata-associated protein [Antirrhinum majus]
Length=165

 Score =   164 bits (414),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 103/141 (73%), Gaps = 3/141 (2%)
 Frame = -2

Query  414  SKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEY  235
            S +  + I LRSSDGE+FEV+E +AL   TIK MI+D+C DN IP+ N+T KIL+ VIEY
Sbjct  3    SDNASKKITLRSSDGEVFEVDEAIALLSQTIKHMIEDDCADNVIPLPNVTGKILSKVIEY  62

Query  234  CKYHVEAAA---EAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLT  64
            CK HV+A A   E K     A   D K FDA+F+KVD  TLFDLI+AAN+LNIK+LLDLT
Sbjct  63   CKRHVDADAAKSEEKVAAAAAGDDDLKAFDADFVKVDQATLFDLILAANYLNIKTLLDLT  122

Query  63   TQAVADMIKDMSPEEVRKIFN  1
             Q VADMIK  +PEE+RK FN
Sbjct  123  CQTVADMIKGKTPEEIRKTFN  143



>gb|ABK92723.1| unknown [Populus trichocarpa]
Length=158

 Score =   163 bits (413),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 98/140 (70%), Gaps = 9/140 (6%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I LRSSDGE FEV+E VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  2    SSGRKISLRSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAK----DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTT  61
             HVE        PED        + K +D  F++VD  TLFDLI+AAN+LNIK LLDLT 
Sbjct  62   KHVETP-----KPEDRGTNSGDDELKNWDTEFVRVDQATLFDLILAANYLNIKGLLDLTC  116

Query  60   QAVADMIKDMSPEEVRKIFN  1
            Q VADMIK  +PEE+RK FN
Sbjct  117  QTVADMIKGKTPEEIRKTFN  136



>gb|EMT03939.1| SKP1-like protein 1B [Aegilops tauschii]
Length=164

 Score =   163 bits (413),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE F+VE  VA+E  TI+ MI+D+C DN IP+ N+ SKIL+ VIEYCK H 
Sbjct  9    KMITLKSSDGEEFQVEVAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVIEYCKKHA  68

Query  219  EAAAEAKT-NPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
               A++       APA+D K FDA F+KVD  TLFDLI+AAN+LNIK LLDLT Q VADM
Sbjct  69   PKPADSSDFTAAAAPAEDLKSFDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADM  128

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+RK FN
Sbjct  129  IKGKTPEEIRKTFN  142



>ref|XP_011003066.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
Length=157

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 102/136 (75%), Gaps = 2/136 (1%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R  +L+SSDGE FEV+E VA+E  TIK MI+D+C DN IP+ N+TSK+LA VIEYCK
Sbjct  2    SAGRKFILKSSDGESFEVDEAVAVESQTIKHMIEDDCADNGIPLPNVTSKVLAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVE + ++   P  A A D K +DA F+KVD  TLFDLI+AAN+LNIK LLDLT Q VA
Sbjct  62   KHVE-SPKSDDRPSSA-ADDLKAWDAEFVKVDQATLFDLILAANYLNIKHLLDLTCQRVA  119

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PE++RK FN
Sbjct  120  DMIKGKTPEDIRKTFN  135



>gb|EMT33027.1| SKP1-like protein 1B [Aegilops tauschii]
Length=175

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 103/145 (71%), Gaps = 12/145 (8%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE F++EE VA+E  TI+ MI+D+C D+ IP+ N+ SKIL+ VIEYCK HV
Sbjct  9    KMITLKSSDGEEFQIEEAVAMESQTIRHMIEDDCADDGIPLPNVDSKILSKVIEYCKKHV  68

Query  219  EAAAEAK------------TNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSL  76
            +A+ +              +    APA+D K FDA F+KVD  TLFDLI+AAN+LNIK L
Sbjct  69   QASPKPADSGAAADASSFTSTAAAAPAEDLKSFDAEFVKVDQATLFDLILAANYLNIKGL  128

Query  75   LDLTTQAVADMIKDMSPEEVRKIFN  1
            LDLT Q VADMIK  +PEE+RK FN
Sbjct  129  LDLTCQTVADMIKGKTPEEIRKTFN  153



>ref|XP_011083455.1| PREDICTED: SKP1-like protein 1A [Sesamum indicum]
Length=170

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 109/148 (74%), Gaps = 5/148 (3%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            MS+  +++  R I LRSSDGE+FEV+E VA+E  TIK MI+D+C DN IP+ N+T KIL+
Sbjct  1    MSTSAAENSSRKITLRSSDGEVFEVDEAVAVESQTIKHMIEDDCADNVIPLPNVTGKILS  60

Query  249  MVIEYCKYHVEAAAEAKTNPED-----APAKDTKEFDANFIKVDHNTLFDLIMAANFLNI  85
             VIEYCK HV+AAA A    +      A   D K FDA+F+KVD  TLFDLI+AAN+LNI
Sbjct  61   KVIEYCKRHVDAAAAASKADDKLASTAATDDDLKAFDADFVKVDQATLFDLILAANYLNI  120

Query  84   KSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            K+LLDLT Q VADMIK  +PEE+RK FN
Sbjct  121  KTLLDLTCQTVADMIKGKTPEEIRKTFN  148



>ref|XP_004248653.2| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=160

 Score =   163 bits (412),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 105/140 (75%), Gaps = 7/140 (5%)
 Frame = -2

Query  414  SKSIVR-MIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIE  238
             K + R MI+LRSSDGE FEV++ VALE  TIK MI+D C D +IP+ NITSKILA+VIE
Sbjct  4    GKGVGRWMIVLRSSDGETFEVDKAVALESQTIKHMIEDNCADTSIPLPNITSKILALVIE  63

Query  237  YCKYHVEAAAEAKTNPEDAPA-KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTT  61
            YCK H+E A       ED  A +D K FDA F+KVD +TLF+LI+A N+LNIKSL+DLT 
Sbjct  64   YCKRHLEVA-----KVEDKIAEEDLKTFDAEFVKVDQSTLFNLILAVNYLNIKSLMDLTC  118

Query  60   QAVADMIKDMSPEEVRKIFN  1
            Q VA+MIK  +PEE+RK FN
Sbjct  119  QTVAEMIKGKTPEEIRKTFN  138



>ref|XP_004248654.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=150

 Score =   162 bits (411),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 6/133 (5%)
 Frame = -2

Query  396  MIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVE  217
            MI+LR SDGE FEV++ VALE  TIK MI+D+C D +IP+ NITSKILA+VIEYCK H+E
Sbjct  1    MIVLRCSDGETFEVDKAVALESQTIKHMIEDDCADTSIPLPNITSKILALVIEYCKRHLE  60

Query  216  AAAEAKTNPEDAPA-KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
             A       ED  A +D K FDA F+KVD +TLF+LI+AAN+LNIKSL+DLT Q VA+MI
Sbjct  61   VA-----KVEDQTAEEDLKTFDAEFVKVDQSTLFNLILAANYLNIKSLMDLTCQTVAEMI  115

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  116  KGKTPEEIRKTFN  128



>gb|ABS17589.1| SKP1 component-like 1 [Humulus lupulus]
Length=157

 Score =   163 bits (412),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 102/137 (74%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I L+SSDGE  EV+E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK
Sbjct  2    STGRKITLKSSDGETLEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  61

Query  228  YHVEAA-AEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HV A  AE + +  D    + K +DA+F+KVD  TLFDLI+AAN+LNIKSLLDLT Q V
Sbjct  62   KHVGAPKAEDRASSVD---DELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  118

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  119  ADMIKGKTPEEIRKTFN  135



>ref|XP_010095548.1| SKP1-like protein 1B [Morus notabilis]
 gb|EXB60668.1| SKP1-like protein 1B [Morus notabilis]
Length=157

 Score =   162 bits (411),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 100/136 (74%), Gaps = 2/136 (1%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I L+SSDGE FEV+E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK
Sbjct  2    SSGRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVEA          +   D K +DA+F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VA
Sbjct  62   KHVEAPKSDDR--ASSADDDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  119

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  120  DMIKGKTPEEIRKTFN  135



>ref|XP_007156190.1| hypothetical protein PHAVU_003G265900g [Phaseolus vulgaris]
 gb|ESW28184.1| hypothetical protein PHAVU_003G265900g [Phaseolus vulgaris]
Length=155

 Score =   162 bits (411),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 101/133 (76%), Gaps = 4/133 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE FEV+E VALE  TIK MI+D+C D+ IP+ N+TSKILA VIEYCK HV
Sbjct  5    KKITLKSSDGEAFEVDEIVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCKKHV  64

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            EA +  +   ED    + K +DA F+KVD  TLFDLI+AAN+LNIK+LLDLT Q VADMI
Sbjct  65   EANSADEKPTED----ELKAWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADMI  120

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  121  KGKTPEEIRKTFN  133



>gb|KEH23694.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   162 bits (410),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSD E FEV E VALE  TIK MI+D+C DN IP+ N+T +ILA VIEYCK
Sbjct  3    STSKKITLKSSDNETFEVPEAVALESQTIKHMIEDDCTDNGIPVPNVTGQILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+A +  +   ED    D K +DA F+KVD + LFDLI+AAN+LNIKSLLDLT Q VA
Sbjct  63   KHVDAESSDEKPSED----DLKNWDAEFVKVDQDKLFDLILAANYLNIKSLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>ref|XP_010266012.1| PREDICTED: SKP1-like protein 1B [Nelumbo nucifera]
Length=154

 Score =   162 bits (410),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 98/133 (74%), Gaps = 4/133 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + + L+SSDGE F+V+E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK HV
Sbjct  4    KKVTLKSSDGETFDVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            E         ED    + K +DA F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VADMI
Sbjct  64   ETPKTDDRGAED----ELKNWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  119

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  120  KGKTPEEIRKTFN  132



>ref|XP_006302938.1| hypothetical protein CARUB_v10021077mg [Capsella rubella]
 gb|EOA35836.1| hypothetical protein CARUB_v10021077mg [Capsella rubella]
Length=159

 Score =   162 bits (410),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV+E VALE  TI  M++D+CV+N +P+ N+TSKILA VIEYCK HV
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVENGVPLPNVTSKILAKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPA-KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            EAAA      E A    D K +DA+F+K+D  TLF+LI+AAN+LNIK+LLDLT Q VADM
Sbjct  64   EAAAAKSEAVEGASTDDDLKTWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADM  123

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+R  FN
Sbjct  124  IKGKTPEEIRTTFN  137



>gb|AGU28415.1| S phase kinase-associated protein 1 [Sinapis alba]
Length=158

 Score =   162 bits (409),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV+E VALE  TI  M++D+CVDN IP+ N+TSKILA VIEYCK HV
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGIPLPNVTSKILAKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
            +AAA +KT   D  A    D K +DA F+K+D  TLF LI+AAN+LNIK+LLDLT   VA
Sbjct  64   DAAA-SKTEAVDGGASSDDDLKAWDAEFMKIDQATLFALILAANYLNIKNLLDLTCGGVA  122

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+R  FN
Sbjct  123  DMIKGKTPEEIRTTFN  138



>ref|XP_002301954.1| hypothetical protein POPTR_0002s02020g [Populus trichocarpa]
 ref|XP_011034986.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
 gb|ABK94461.1| unknown [Populus trichocarpa]
 gb|EEE81227.1| hypothetical protein POPTR_0002s02020g [Populus trichocarpa]
Length=157

 Score =   162 bits (409),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 100/139 (72%), Gaps = 8/139 (6%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R   L+SSDGE FEV+E VALE  TIK MI+++C DN IP+ N+TSKIL+ VIEYCK
Sbjct  2    SSSRKFTLKSSDGEAFEVDEAVALESQTIKHMIEEDCADNAIPLPNVTSKILSKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQ  58
             HVE         +D P+    D K +DA F+KVD  TLFDLI+AAN+LNIK+LLDLT Q
Sbjct  62   KHVETPKS-----DDRPSSADDDLKSWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQ  116

Query  57   AVADMIKDMSPEEVRKIFN  1
             VADMIK  +PEE+RK FN
Sbjct  117  TVADMIKGKTPEEIRKTFN  135



>gb|KFK42033.1| hypothetical protein AALP_AA2G203200 [Arabis alpina]
Length=159

 Score =   162 bits (409),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV+E VALE  TI  M++D+CVDN +P+ N+TSKILA VIEYCK HV
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPA--KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            +AAA +K+   D  +  +D K +DA F+K+D  TLF+LI+AAN+LNIK+LLDLT Q VAD
Sbjct  64   DAAA-SKSEAVDGGSSDEDLKTWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVAD  122

Query  45   MIKDMSPEEVRKIFN  1
            MIK  +PEE+R  FN
Sbjct  123  MIKGKTPEEIRTTFN  137



>ref|XP_009104691.1| PREDICTED: SKP1-like protein 1A [Brassica rapa]
 dbj|BAB85608.1| kinetochore protein [Brassica juncea]
Length=160

 Score =   162 bits (409),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 4/136 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV+E VALE  TI  M++D+CVDN +P+ N+TSKILA VIEYCK HV
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
            +AAA +K+   D       D K +DA F+K+D  TLF+LI+AAN+LNIK+LLDLT Q VA
Sbjct  64   DAAA-SKSEAVDGGGSSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  122

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+R  FN
Sbjct  123  DMIKGKTPEEIRTTFN  138



>ref|XP_002531150.1| skp1, putative [Ricinus communis]
 gb|EEF31235.1| skp1, putative [Ricinus communis]
Length=161

 Score =   161 bits (408),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 102/136 (75%), Gaps = 3/136 (2%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE FEV+E VALE  TIK MI+D+C D+ IP+ N+TSKILA VIEYCK HV
Sbjct  4    KKITLKSSDGEPFEVDEVVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCKKHV  63

Query  219  E---AAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
            E   +++E +T        + K +DA F+KVD +TLFDLI+AAN+LNIK LLDLT Q VA
Sbjct  64   ETPKSSSEDRTINNSNTDDELKAWDAEFVKVDQSTLFDLILAANYLNIKGLLDLTCQTVA  123

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  124  DMIKGKTPEEIRKTFN  139



>ref|XP_010416502.1| PREDICTED: SKP1-like protein 1A [Camelina sativa]
Length=162

 Score =   161 bits (407),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 105/140 (75%), Gaps = 5/140 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I+L+SSDGE FEV+E VALE  TI  M++D+CVDN +P+ N+TSKILA VIEYCK
Sbjct  2    STTKKIVLKSSDGESFEVDELVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPA----KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTT  61
             HVE  A +KT+  D  A    ++ K +DA F+K+D  TLF+LI+AAN+LNIK+LLDLT 
Sbjct  62   KHVEVTA-SKTDAVDGAASSADEELKTWDAEFMKIDQATLFELILAANYLNIKNLLDLTC  120

Query  60   QAVADMIKDMSPEEVRKIFN  1
            Q VADMIK  +PEE+R  FN
Sbjct  121  QTVADMIKGKTPEEIRTTFN  140



>gb|EMS35771.1| SKP1-like protein 1B [Triticum urartu]
Length=167

 Score =   161 bits (408),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 102/137 (74%), Gaps = 4/137 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE F+VEE VA+E  TI+ MI+D+C DN IP+ N+ SKIL+ VIEYCK HV
Sbjct  9    KMITLKSSDGEEFQVEEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVIEYCKKHV  68

Query  219  EAAAEAKTNPEDA----PAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
            +A +   ++        PA+D K FDA F+KVD  TLFDLI+AAN+LNIK LLDLT Q V
Sbjct  69   QADSTDASSSTSTAAAAPAEDLKIFDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTV  128

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  129  ADMIKGKTPEEIRKTFN  145



>ref|XP_011088616.1| PREDICTED: SKP1-like protein 1A [Sesamum indicum]
Length=166

 Score =   161 bits (408),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI+L+SSDGE FEVEE VA E  TIK MI+D C D +IP+ N+TSKILA VIEYCK HV
Sbjct  9    KMIVLKSSDGETFEVEEAVAPESQTIKHMIEDNCADTSIPLPNVTSKILAKVIEYCKRHV  68

Query  219  ---EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
                 A+   T  +     D K FDA F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VA
Sbjct  69   DAAAKASADATASDKVAEDDLKAFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVA  128

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  129  DMIKGKTPEEIRKTFN  144



>ref|XP_009418685.1| PREDICTED: SKP1-like protein 1A [Musa acuminata subsp. malaccensis]
Length=161

 Score =   161 bits (407),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 105/139 (76%), Gaps = 4/139 (3%)
 Frame = -2

Query  405  IVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKY  226
            + + IML+SSDGE+FEV+E VA+E  TIK MI+D+C +N IP+ N+TS ILA VIEYC+ 
Sbjct  1    MAKTIMLKSSDGEVFEVDEAVAMESQTIKHMIEDDCAENGIPLPNVTSAILAKVIEYCRK  60

Query  225  HVEAAAEAKTNPEDAPAKDT----KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQ  58
            HVEA+A A +   D  +K T    K +DA F+KVD  TLFDLI+AAN+LNIK LLDLT Q
Sbjct  61   HVEASAAAASKSSDDGSKPTDDVIKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQ  120

Query  57   AVADMIKDMSPEEVRKIFN  1
             VADMIK  +PEE+RK FN
Sbjct  121  TVADMIKGKTPEEIRKTFN  139



>ref|XP_009401439.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
 ref|XP_009401447.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
Length=157

 Score =   161 bits (407),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I LRSSDGE+FEV+  VA+E  TIK MI+D+C +N IP+ N+ +KILA VIEYC+ HV
Sbjct  3    KKITLRSSDGEVFEVDVAVAMESQTIKHMIEDDCAENGIPLPNVNAKILAKVIEYCRKHV  62

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            +AAA   ++      ++ K +DA F+KVD  TLFDLI+AAN+LNIK LLDLT Q VADMI
Sbjct  63   DAAASKSSDDASKVDEELKPWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMI  122

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  123  KGKTPEEIRKTFN  135



>ref|XP_010029647.1| PREDICTED: SKP1-like protein 1B isoform X1 [Eucalyptus grandis]
Length=155

 Score =   161 bits (407),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 101/134 (75%), Gaps = 6/134 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            R I LRSSDGE F+VE++VA+E  TIK MI+D C DN IP+ N+ SKILA VIEYCK HV
Sbjct  5    RKITLRSSDGESFDVEQSVAVESQTIKHMIEDGCADNAIPLPNVNSKILAKVIEYCKMHV  64

Query  219  EAAAEAKTNPED-APAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            E+A      PED    ++ K +D +F+KVD  TLFDLI++AN+LNIKSLLDLT Q VADM
Sbjct  65   ESA-----KPEDRVNDEELKTWDVDFVKVDQATLFDLILSANYLNIKSLLDLTCQTVADM  119

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+RK F+
Sbjct  120  IKGKTPEEIRKTFS  133



>ref|XP_004231048.1| PREDICTED: SKP1-like protein 1A [Solanum lycopersicum]
Length=158

 Score =   160 bits (406),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 103/143 (72%), Gaps = 7/143 (5%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            MSSPK       I+L+S+DGE+FEVEE VALE  TIK +I+D+C  + IPI+N++  ILA
Sbjct  1    MSSPKK------ILLKSNDGEVFEVEEAVALESQTIKFLIEDDCAGSHIPISNVSGNILA  54

Query  249  MVIEYCKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLD  70
             V+EY K HVE  + +KT   DA A   K FDA F+KVD  TLFDLI+AAN+LNIKSLLD
Sbjct  55   KVLEYLKRHVEEESTSKTEGADADAA-LKVFDAEFVKVDQKTLFDLILAANYLNIKSLLD  113

Query  69   LTTQAVADMIKDMSPEEVRKIFN  1
            LT Q VADMIK  +PE +R  FN
Sbjct  114  LTCQTVADMIKGKTPEAIRNTFN  136



>gb|KDP23982.1| hypothetical protein JCGZ_25370 [Jatropha curcas]
Length=158

 Score =   160 bits (406),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 103/137 (75%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE FEV+E VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK
Sbjct  2    SSSKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAA-AEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HVE   ++ ++N   +   + K +DA F+KVD  TLFDLI+AAN+LNIK LLDLT Q V
Sbjct  62   KHVETPKSDDRSNG--SADDELKNWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTV  119

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +P+E+R+IFN
Sbjct  120  ADMIKGKTPDEIREIFN  136



>ref|XP_002313704.1| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
 gb|EEE87659.1| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
Length=158

 Score =   160 bits (406),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 100/135 (74%), Gaps = 5/135 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE F VEE VA+E  TIK MI+D+C +N IP+ N+TSKILA VIEYCK HV
Sbjct  5    KKITLKSSDGETFVVEEAVAVESQTIKHMIEDDCAENDIPLPNVTSKILAKVIEYCKKHV  64

Query  219  EAAAEAKTNPEDAPAKDT--KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            EA A+          KD   K +DA F+KVD NTLFDLI+AAN+LNIK LLDLT QA AD
Sbjct  65   EADADKDAT---ITGKDEFMKSWDAEFVKVDKNTLFDLILAANYLNIKDLLDLTCQAAAD  121

Query  45   MIKDMSPEEVRKIFN  1
            MIK  +P+E+RKIFN
Sbjct  122  MIKGKTPDEIRKIFN  136



>gb|EMT01771.1| SKP1-like protein 1B [Aegilops tauschii]
Length=252

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 105/149 (70%), Gaps = 20/149 (13%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDG+ F+VEE VA+E  TI+ MI+D+C DN IP+ N+ SKIL+ VIEYCK HV
Sbjct  9    KMITLKSSDGQEFDVEEAVAMESQTIRHMIEDDCADNDIPLPNVDSKILSKVIEYCKKHV  68

Query  219  EAAAEAKTNPEDAPA----------------KDTKEFDANFIKVDHNTLFDLIMAANFLN  88
            +A+ +    P D+ A                +D K FDA F+KVD  TLFDLI+AAN+LN
Sbjct  69   QASPK----PADSGAVTDANSSTSTAAAAPAEDLKSFDAEFVKVDRATLFDLILAANYLN  124

Query  87   IKSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            IK LLDLT Q VADMIKD +PEE+RKIFN
Sbjct  125  IKGLLDLTCQTVADMIKDNTPEEIRKIFN  153



>gb|KEH23696.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   160 bits (405),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 97/136 (71%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSD E FEV E VALE  TIK MI+D+C DN IP+ N+T +ILA VIEYCK
Sbjct  3    STTKKITLKSSDNETFEVPEAVALESQTIKYMIEDDCTDNGIPVPNVTGQILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+A +  +   ED    D K +DA F+KVD   LF LI+AAN+LNIKSLLDLT Q VA
Sbjct  63   KHVDAESSDEKPSED----DLKNWDAEFVKVDQAKLFGLILAANYLNIKSLLDLTCQTVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>ref|XP_004512165.1| PREDICTED: SKP1-like protein 1A-like [Cicer arietinum]
Length=155

 Score =   160 bits (405),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R   L+SSDGE FEV+E VA+E  TIK MI+D+C  N IP+ N+TSKILA VIEYCK
Sbjct  2    SSTRKFTLKSSDGEAFEVDEAVAVESQTIKHMIEDDCAGNGIPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVEAA       ED    D K +D++F+KVD  TLF+LI+AAN+LNIK+LLDLT   VA
Sbjct  62   KHVEAATSDDKPTED----DLKAWDSDFVKVDQATLFELILAANYLNIKNLLDLTCMTVA  117

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  118  DMIKGKTPEEIRKTFN  133



>ref|XP_002279232.1| PREDICTED: SKP1-like protein 1A isoform X5 [Vitis vinifera]
 emb|CAN73136.1| hypothetical protein VITISV_023042 [Vitis vinifera]
Length=155

 Score =   160 bits (405),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 99/135 (73%), Gaps = 8/135 (6%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I LRSSDGE F++EE VA+E  TIK MI+D C DN IP+ N+TSKILA VIEYCK HV
Sbjct  5    KTITLRSSDGEAFDLEEVVAVESQTIKHMIEDGCADNAIPLPNVTSKILAKVIEYCKKHV  64

Query  219  EA--AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            E   A E   N E       K +DA+F+KVD  TLFDLI+AAN+L+IKSLLDLT Q VAD
Sbjct  65   ETPKAEEHAVNDE------LKAWDADFVKVDQATLFDLILAANYLDIKSLLDLTCQTVAD  118

Query  45   MIKDMSPEEVRKIFN  1
            MIK  +PEE+RK FN
Sbjct  119  MIKGKTPEEIRKTFN  133



>emb|CAA75117.1| fimbriata-associated protein [Antirrhinum majus]
Length=161

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I LRSSDGE+FEVEE++ALE  TIK MI+D+C DN IP+ N+T KIL+ VIEYCK HV
Sbjct  4    KKITLRSSDGEVFEVEESLALESQTIKHMIEDDCADNVIPLPNVTGKILSKVIEYCKRHV  63

Query  219  EAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
            +AAA    +   +      + K FDA+F+KVD  TLFDLI+AAN+LNIK+LLDLT Q VA
Sbjct  64   DAAAAKADDKLASTGTSDDELKAFDADFVKVDQATLFDLILAANYLNIKTLLDLTCQTVA  123

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  124  DMIKGKTPEEIRKTFN  139



>ref|XP_008447950.1| PREDICTED: SKP1-like protein 1B [Cucumis melo]
Length=155

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 102/135 (76%), Gaps = 8/135 (6%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+LRSSDGE F+V+E VA+E  TIK MI+D+CVD  IP+ N+TS IL+ V+EYCK HV
Sbjct  5    KKIVLRSSDGETFDVDEIVAVESQTIKHMIEDDCVDTVIPLPNVTSAILSKVVEYCKMHV  64

Query  219  EAAAEAKTNPEDAPAKD--TKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            E      T+ +D+   D   K +DA F+KVD NTLFDLI+AAN+LNIKSLLDLT Q VAD
Sbjct  65   E------TDDKDSKVIDDTLKTWDAEFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVAD  118

Query  45   MIKDMSPEEVRKIFN  1
            MIK  +PEE+RK FN
Sbjct  119  MIKGKTPEEIRKTFN  133



>ref|XP_004287067.1| PREDICTED: SKP1-like protein 4-like [Fragaria vesca subsp. vesca]
Length=159

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 100/145 (69%), Gaps = 10/145 (7%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            MSS K     ++I L+SSD E FEV+E VALE  TIK M++D C DN IP+ N+T  ILA
Sbjct  1    MSSEK-----KLITLKSSDNETFEVDEAVALESQTIKHMVEDGCADNAIPLPNVTGAILA  55

Query  249  MVIEYCKYHVEAAAE--AKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSL  76
             VIEYCK HVE   +   K    ++P    K FDA F+KVD N LFDLI+AAN+LNIK L
Sbjct  56   RVIEYCKKHVEEGGKDAEKDKSGESP---LKTFDAEFVKVDQNVLFDLILAANYLNIKGL  112

Query  75   LDLTTQAVADMIKDMSPEEVRKIFN  1
            LDLT Q VADMIK  +PEE+RK FN
Sbjct  113  LDLTCQTVADMIKGKTPEEIRKTFN  137



>dbj|BAB85605.1| kinetochore protein [Brassica juncea]
Length=160

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV+E VALE  TI  M++D+CVDN +P+ N+TSKILA VIEYCK HV
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
            +A A +K+   D       D K +DA F+K+D  TLF+LI+AAN+LNIK+LLDLT Q VA
Sbjct  64   DAVA-SKSEAVDGGGSSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  122

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+R  FN
Sbjct  123  DMIKGKTPEEIRTTFN  138



>ref|XP_006360901.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=149

 Score =   159 bits (403),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 100/133 (75%), Gaps = 6/133 (5%)
 Frame = -2

Query  396  MIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVE  217
            MI LRS DGE FEV+E VALE  TIK +I+D+C + +IP+ N+T KILA VIEYCK HVE
Sbjct  1    MISLRSFDGETFEVDEAVALESETIKHLIEDDCANTSIPLHNVTGKILAKVIEYCKRHVE  60

Query  216  AA-AEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
               AE KT  ED      K FDA F+KVD +TLF+L++AAN+LNIKSLLDLT Q VADMI
Sbjct  61   VPKAEDKTAKEDL-----KTFDAEFVKVDQSTLFNLMLAANYLNIKSLLDLTCQTVADMI  115

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  116  KGKTPEEIRKTFN  128



>ref|XP_009373027.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=161

 Score =   159 bits (403),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 100/143 (70%), Gaps = 4/143 (3%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            M+S  S  + + I L+SSD EMFEVEE VA+E  TIK M++D C  N IP+ N+TS ILA
Sbjct  1    MASSSSADLKKKITLKSSDDEMFEVEEAVAIESQTIKHMVEDGCAGNAIPLPNVTSAILA  60

Query  249  MVIEYCKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLD  70
             VIEYC+ H E       + E    K+ KE+DA F+K+D NTL+DLIMAAN+L+IK LLD
Sbjct  61   KVIEYCRKHREDEGATAADGE----KNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLD  116

Query  69   LTTQAVADMIKDMSPEEVRKIFN  1
            LT Q VADMIK  +PE++R  FN
Sbjct  117  LTCQTVADMIKGKTPEQIRTTFN  139



>dbj|BAE72119.1| SKP1-like protein [Silene latifolia]
Length=160

 Score =   159 bits (403),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 101/146 (69%), Gaps = 16/146 (11%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV++ VALE  TIK MI+D+C DN IP+ N+T KIL+ VIEYCK HV
Sbjct  9    KKILLKSSDGEDFEVDQIVALESQTIKHMIEDDCADNAIPLPNVTGKILSKVIEYCKKHV  68

Query  219  EAAAEAKTN-------------PEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKS  79
            E A + K               P D    D K +D  F+KVD NTLFDLI+AAN+LNIKS
Sbjct  69   EFAEKNKGETTTTTSAAGTGTTPVD---DDLKNWDTEFVKVDQNTLFDLILAANYLNIKS  125

Query  78   LLDLTTQAVADMIKDMSPEEVRKIFN  1
            LLDLT Q VADMIK  +PEE+RK FN
Sbjct  126  LLDLTCQTVADMIKGKTPEEIRKTFN  151



>gb|AAT12490.1| Skp1/Ask1-like protein [Zantedeschia hybrid cultivar]
Length=167

 Score =   159 bits (403),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + + L+SSDGE+FEVEETVA+E  TI+ +I+D+C  + +P+ N+T +ILA VIE+CK HV
Sbjct  12   KKLTLKSSDGEVFEVEETVAMESQTIRNLIEDDCTADGVPLPNVTGRILAKVIEFCKKHV  71

Query  219  E-AAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            E AA +A    + A  ++ K +DA+F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VADM
Sbjct  72   EIAALKADEGVDRAADEELKVWDADFVKVDQTTLFDLILAANYLNIKSLLDLTCQTVADM  131

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+RK FN
Sbjct  132  IKGKTPEEIRKTFN  145



>ref|XP_006390250.1| hypothetical protein EUTSA_v10019260mg [Eutrema salsugineum]
 gb|ESQ27536.1| hypothetical protein EUTSA_v10019260mg [Eutrema salsugineum]
Length=159

 Score =   159 bits (402),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV+E VALE  TI  M++D+CVDN +P+ N+TSKILA VIEYCK HV
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPA-KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            ++AA      + A + +D K +D  F+K+D  TLF+LI+AAN+LNIK+LLDLT Q VADM
Sbjct  64   DSAASKSEAVDGASSDEDLKAWDTEFMKIDQATLFELILAANYLNIKNLLDLTCQTVADM  123

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+R  FN
Sbjct  124  IKGKTPEEIRTTFN  137



>dbj|BAE72121.1| SKP1-like protein [Silene latifolia]
Length=173

 Score =   159 bits (403),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 103/152 (68%), Gaps = 16/152 (11%)
 Frame = -2

Query  417  KSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIE  238
            +S    + I+L+SSDGE FEV++ VALE  TIK MI+D+C DN IP+ N+T KIL+ VIE
Sbjct  3    ESTESTKKILLKSSDGEDFEVDQIVALESQTIKHMIEDDCADNAIPLPNVTGKILSKVIE  62

Query  237  YCKYHVEAAAEAKTN-------------PEDAPAKDTKEFDANFIKVDHNTLFDLIMAAN  97
            YCK HVE A + K               P D    D K +D  F+KVD NTLFDLI+AAN
Sbjct  63   YCKKHVEFAEKNKGETTTTTSAAGTGTTPVD---DDLKNWDTEFVKVDQNTLFDLILAAN  119

Query  96   FLNIKSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            +LNIKSLLDLT Q VADMIK  +PEE+RK FN
Sbjct  120  YLNIKSLLDLTCQTVADMIKGKTPEEIRKTFN  151



>ref|XP_010471746.1| PREDICTED: SKP1-like protein 1A [Camelina sativa]
Length=162

 Score =   159 bits (402),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 105/140 (75%), Gaps = 5/140 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I+L+SSDGE FEV+E+VA E  TI  M++D+CVDN +P+ N+TSKILA VIEYCK
Sbjct  2    STTKKIVLKSSDGESFEVDESVARESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPA----KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTT  61
             HVE  A +KT+  +  A    ++ K +DA F+K+D  TLF+LI+AAN+LNIK+LLDLT 
Sbjct  62   KHVEVTA-SKTDAAEGAASSADEELKTWDAEFMKIDQATLFELILAANYLNIKNLLDLTC  120

Query  60   QAVADMIKDMSPEEVRKIFN  1
            Q VADMIK  +PEE+R  FN
Sbjct  121  QTVADMIKGKTPEEIRTTFN  140



>ref|XP_009395355.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
Length=160

 Score =   159 bits (401),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 105/138 (76%), Gaps = 4/138 (3%)
 Frame = -2

Query  402  VRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYH  223
            ++ I L+SSDGE+FEV+E VA+E  TIK MI+D+C +N IP+ N+TSKILA VIEYCK H
Sbjct  1    MKTITLKSSDGEVFEVDEAVAMESQTIKHMIEDDCAENGIPLPNVTSKILAKVIEYCKKH  60

Query  222  VEAAAEAKTNPEDAPAK----DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            V+A+A A +   D  +K    + K +DA F+KVD  TLFDLI+AAN+LNIK LLDLT Q 
Sbjct  61   VDASAAASSKSPDDASKLADDELKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQT  120

Query  54   VADMIKDMSPEEVRKIFN  1
            VADMIK  +PEE+RK FN
Sbjct  121  VADMIKGKTPEEIRKTFN  138



>ref|XP_010033522.1| PREDICTED: SKP1-like protein 1B [Eucalyptus grandis]
 gb|KCW53208.1| hypothetical protein EUGRSUZ_J02478 [Eucalyptus grandis]
Length=155

 Score =   159 bits (401),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I LRSSDGE FEV+E VA+E  TIK MI+D+C D+ IP+ N+TS+ILA VIEYCK
Sbjct  2    SSAKKITLRSSDGESFEVDEAVAVESQTIKHMIEDDCADSGIPLPNVTSRILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVE+A       ED    D K +DA F+KVD  TLFDLI+AAN+LNIK LLDLT   VA
Sbjct  62   KHVESAKPDDRTTED----DLKAWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCLTVA  117

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PE++RK F+
Sbjct  118  DMIKGKTPEDIRKSFS  133



>dbj|BAB85604.1| kinetochore protein [Brassica juncea]
Length=145

 Score =   158 bits (400),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 102/134 (76%), Gaps = 4/134 (3%)
 Frame = -2

Query  393  IMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVEA  214
            ++L+SSDGE FEV+E VALE  TI  M++D+ VDN IP+ N+TSKILA VIEYCK HV+A
Sbjct  1    MVLKSSDGESFEVDEAVALESQTIAHMVEDDGVDNGIPLPNVTSKILAKVIEYCKKHVDA  60

Query  213  AAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            AA +KT   D  A    D K +DA F+K+D  TLF+LI+AAN+LNIK+LLDLT Q VADM
Sbjct  61   AA-SKTEAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVADM  119

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+R  FN
Sbjct  120  IKGKTPEEIRTTFN  133



>ref|XP_004144851.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 ref|XP_004163420.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 gb|KGN43257.1| hypothetical protein Csa_7G012950 [Cucumis sativus]
Length=155

 Score =   159 bits (401),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 101/135 (75%), Gaps = 8/135 (6%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+LRSSDGE F+V+E VA+E  TIK MI+D+C D  IP+ N+TS IL+ VIEYCK HV
Sbjct  5    KKIVLRSSDGETFDVDEIVAVESQTIKHMIEDDCADTVIPLPNVTSAILSKVIEYCKMHV  64

Query  219  EAAAEAKTNPEDAPAKD--TKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            E      T+ +D+   D   K +DA F+KVD NTLFDLI+AAN+LNIKSLLDLT Q VAD
Sbjct  65   E------TDDKDSKVIDDTLKTWDAEFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVAD  118

Query  45   MIKDMSPEEVRKIFN  1
            MIK  +PEE+RK FN
Sbjct  119  MIKGKTPEEIRKTFN  133



>ref|XP_009372999.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=161

 Score =   159 bits (401),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 100/143 (70%), Gaps = 4/143 (3%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            M+S  S  + + I L+SSD EMFEVEE VA++  TIK M++D C  N IP+ N+TS ILA
Sbjct  1    MASSSSADLKKKITLKSSDDEMFEVEEAVAMQSQTIKHMVEDGCAGNAIPLPNVTSAILA  60

Query  249  MVIEYCKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLD  70
             VIEYC+ H E       + E    K+ KE+DA F+K+D NTL+DLIMAAN+L+IK LLD
Sbjct  61   KVIEYCRKHREDEGATAADGE----KNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLD  116

Query  69   LTTQAVADMIKDMSPEEVRKIFN  1
            LT Q VADMIK  +PE++R  FN
Sbjct  117  LTCQTVADMIKGKTPEQIRTTFN  139



>ref|XP_004248652.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
 ref|XP_010327406.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
 ref|XP_010327407.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
 ref|XP_010327408.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
 ref|XP_010327409.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=150

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 101/133 (76%), Gaps = 6/133 (5%)
 Frame = -2

Query  396  MIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVE  217
            MI+LRS +GE FEV+ETVALE  TIK MI+D+C +NTIP+ N+T KILA VI+YCK HVE
Sbjct  1    MIILRSFNGESFEVDETVALESETIKHMIEDDCANNTIPVPNVTGKILAKVIKYCKRHVE  60

Query  216  AAAEAKTNPEDAPAK-DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
                  +  ED  AK D K FDA F+KVD +TLF+LI+AAN+L IKSL+DLT Q +ADMI
Sbjct  61   V-----SKAEDNTAKEDLKTFDAEFVKVDQSTLFNLILAANYLKIKSLIDLTCQTLADMI  115

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+R + N
Sbjct  116  KGKTPEEIRNLLN  128



>ref|XP_006436098.1| hypothetical protein CICLE_v10033809mg [Citrus clementina]
 ref|XP_006486025.1| PREDICTED: SKP1-like protein 1A-like [Citrus sinensis]
 gb|ESR49338.1| hypothetical protein CICLE_v10033809mg [Citrus clementina]
Length=160

 Score =   158 bits (399),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 101/132 (77%), Gaps = 5/132 (4%)
 Frame = -2

Query  396  MIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVE  217
            MI+L+SSDGE FEVEETVAL+  TI+ M++D+C D+ IP+ N+T  IL+MV+EYCK HVE
Sbjct  12   MIILKSSDGETFEVEETVALQSQTIRHMVEDDCADSVIPLPNVTGTILSMVVEYCKKHVE  71

Query  216  AAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMIK  37
            AAA A          D K +D +F+KVD  TL DL++AAN+LNIK LL+LT QA ADMIK
Sbjct  72   AAAAAA-----GGDNDVKNWDRDFVKVDQETLLDLLLAANYLNIKDLLELTCQATADMIK  126

Query  36   DMSPEEVRKIFN  1
            D SPEEVR+IF+
Sbjct  127  DKSPEEVRRIFH  138



>ref|NP_565604.1| putative E3 ubiquitin ligase ASK3 [Arabidopsis thaliana]
 sp|Q9SL93.1|ASK3_ARATH RecName: Full=SKP1-like protein 3; Short=AtSK3 [Arabidopsis thaliana]
 gb|AAD31370.1| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 (At3), putative 
[Arabidopsis thaliana]
 gb|AAK96604.1| At2g25700/F3N11.15 [Arabidopsis thaliana]
 gb|AAM98112.1| At2g25700/F3N11.15 [Arabidopsis thaliana]
 gb|AEC07739.1| putative E3 ubiquitin ligase ASK3 [Arabidopsis thaliana]
Length=163

 Score =   157 bits (397),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 102/136 (75%), Gaps = 3/136 (2%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI+L+SSDGE FEVEE VA+E  TIK MI+D+CVDN IP+ N+T  ILA VIEYCK HV
Sbjct  6    KMIILKSSDGESFEVEEAVAVESQTIKHMIEDDCVDNGIPLPNVTGAILAKVIEYCKKHV  65

Query  219  EAAAEAKTNPEDAPAKDTKE---FDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
            EAAAEA  + +   + +  E   +D +F+KVDH TLFDL+ AAN+LNI  LLDLT +AVA
Sbjct  66   EAAAEAGGDKDFYGSTENHELKTWDNDFVKVDHPTLFDLLRAANYLNISGLLDLTCKAVA  125

Query  48   DMIKDMSPEEVRKIFN  1
            D ++  +P ++R+ FN
Sbjct  126  DQMRGKTPAQMREHFN  141



>ref|XP_006360900.1| PREDICTED: SKP1-like protein 1B-like isoform X2 [Solanum tuberosum]
Length=149

 Score =   157 bits (396),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 99/133 (74%), Gaps = 6/133 (5%)
 Frame = -2

Query  396  MIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVE  217
            MI+LRSSDGE FEV+E VALE  TIK MI+D+C D +I + N+TSKIL  VIEYCK HVE
Sbjct  1    MIVLRSSDGETFEVDEAVALESPTIKHMIEDDCTDTSISLPNVTSKILVKVIEYCKRHVE  60

Query  216  AAAEAKTNPEDAPAK-DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
                     ED  A+ D K FDA F+KVD +TL+DL++AAN+LNI SL+DLT Q VADMI
Sbjct  61   VP-----KAEDKTAEVDLKTFDAEFVKVDQSTLYDLMLAANYLNINSLIDLTCQTVADMI  115

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RKI N
Sbjct  116  KGKTPEEIRKILN  128



>ref|XP_004301672.1| PREDICTED: SKP1-like protein 4-like [Fragaria vesca subsp. vesca]
Length=163

 Score =   157 bits (397),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 99/144 (69%), Gaps = 13/144 (9%)
 Frame = -2

Query  432  TMSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKIL  253
            T SS  S+   +MI L+S+DGE FE+EE VALE  TIK M++D+C +N IP+ N+   IL
Sbjct  11   TTSSTSSEK--KMITLQSADGEPFEIEEVVALESQTIKHMVEDDCAENAIPLPNVKGAIL  68

Query  252  AMVIEYCKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLL  73
            A VIEYCK HVE A E           D K +DA ++ VD N LFDLI+AAN+LNIK LL
Sbjct  69   AKVIEYCKKHVEDAGE-----------DLKAWDAEYVNVDQNVLFDLILAANYLNIKGLL  117

Query  72   DLTTQAVADMIKDMSPEEVRKIFN  1
            DLT Q VADMIK  +PEE+R +FN
Sbjct  118  DLTCQKVADMIKGKTPEEIRTLFN  141



>gb|EMT01680.1| SKP1-like protein 1B [Aegilops tauschii]
Length=172

 Score =   157 bits (397),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 102/142 (72%), Gaps = 9/142 (6%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE F+VEE VA+E  TI+ MI+D+C DN IP+ N+ SKIL+ VIEYCK HV
Sbjct  9    KMITLKSSDGEEFQVEEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVIEYCKKHV  68

Query  219  EAAAEAKTNPEDAPA---------KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDL  67
            +A+ +   + + + +         +D K FDA F+KVD  TLFDLI+A N+LNIK LLDL
Sbjct  69   QASPKLADSTDASSSISTAAAAPAEDLKSFDAEFVKVDQATLFDLILATNYLNIKGLLDL  128

Query  66   TTQAVADMIKDMSPEEVRKIFN  1
            T Q VADMIK  +PEE+RK FN
Sbjct  129  TCQTVADMIKGKTPEEIRKTFN  150



>ref|NP_564105.1| SKP1-like protein 4 [Arabidopsis thaliana]
 sp|Q9LNT9.1|ASK4_ARATH RecName: Full=SKP1-like protein 4; Short=AtSK4 [Arabidopsis thaliana]
 gb|AAF79899.1|AC022472_8 Contains similarity to Skp1 mRNA from Medicago sativa gb|AF135596 
and is a member of Skp1 family PF|01466 [Arabidopsis thaliana]
 gb|AAL25617.1| At1g20140/T20H2_8 [Arabidopsis thaliana]
 gb|AAM19990.1| At1g20140/T20H2_8 [Arabidopsis thaliana]
 gb|AEE29943.1| SKP1-like protein 4 [Arabidopsis thaliana]
Length=163

 Score =   157 bits (396),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 101/136 (74%), Gaps = 3/136 (2%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI+L+SSDGE FE+EE VA++  TIK MI+D+C DN IP+ N+T  ILA VIEYCK HV
Sbjct  6    KMIILKSSDGESFEIEEAVAVKSQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKKHV  65

Query  219  EAAAEAKTNPE---DAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
            EAAAEA  + +    A   + K +D+ F+KVD  TLFDLI+AAN+LNI  LLDLT +AVA
Sbjct  66   EAAAEAGGDKDFYGSAENDELKNWDSEFVKVDQPTLFDLILAANYLNIGGLLDLTCKAVA  125

Query  48   DMIKDMSPEEVRKIFN  1
            D ++  +PE++R  FN
Sbjct  126  DQMRGKTPEQMRAHFN  141



>ref|XP_008357536.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
Length=191

 Score =   157 bits (398),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 102/150 (68%), Gaps = 4/150 (3%)
 Frame = -2

Query  450  AGQTRLTMSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITN  271
            AGQ   + ++P      + I L SS  EMFEVEE VA+E  TIK M++D C DNTIP+ N
Sbjct  29   AGQLGPSRAAPTDLKKKKKITLNSSGNEMFEVEEAVAMESQTIKHMVEDGCADNTIPLPN  88

Query  270  ITSKILAMVIEYCKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFL  91
            +TS ILA VIEYC  H E      T+ E+    + KE+DA FIK++ NTL+DLIMAAN+L
Sbjct  89   VTSAILAKVIEYCTKHREEDRAIATDNEN----NFKEWDAEFIKINQNTLYDLIMAANYL  144

Query  90   NIKSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            NIK LLDLT Q V D IK  +PEE+RK+FN
Sbjct  145  NIKGLLDLTCQIVVDXIKGKAPEEIRKMFN  174



>ref|XP_001753554.1| predicted protein [Physcomitrella patens]
 gb|EDQ81777.1| predicted protein [Physcomitrella patens]
Length=158

 Score =   156 bits (395),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + + LRSSD EMFEV+E VA E   +K MI+D   D  IP+ N++SKILA VIEYCKYHV
Sbjct  4    QRVKLRSSDDEMFEVDEAVAFESQAVKNMIEDTGKDAVIPLPNVSSKILAKVIEYCKYHV  63

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            +    A  +   A   D K +DA+F+KVD  TLFDLI+AAN+LNIK+LLDLT Q VADMI
Sbjct  64   DNQKGATDDKPAASEDDIKAWDADFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADMI  123

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  124  KGKTPEEIRKTFN  136



>ref|XP_008232104.1| PREDICTED: SKP1-like protein 1B [Prunus mume]
 ref|XP_008245448.1| PREDICTED: SKP1-like protein 1B [Prunus mume]
Length=156

 Score =   156 bits (395),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 100/134 (75%), Gaps = 5/134 (4%)
 Frame = -2

Query  402  VRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYH  223
            ++ I L+S DGE+FEVEE VA++  TI+ M++D+C D  IP+ N+TS I+A VIEYCK  
Sbjct  6    MKKITLKSDDGEIFEVEEAVAMQSQTIRHMVEDDCADGPIPLPNVTSNIVAKVIEYCKKK  65

Query  222  VEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
             E  A+ + N ED      K +DA F+KVD +TLFDLI+AAN+LNIKSLLDLT Q VADM
Sbjct  66   HEEDADGEKNKED-----IKNWDAAFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+R+IFN
Sbjct  121  IKGKTPEEIREIFN  134



>ref|XP_011046062.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
Length=158

 Score =   156 bits (395),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 102/137 (74%), Gaps = 9/137 (7%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE F VEE VA+E  TIK MI+D+C ++ IP+ N+T KILA VIEYCK HV
Sbjct  5    KKITLKSSDGETFVVEEAVAVESQTIKHMIEDDCAESDIPLPNVTGKILAKVIEYCKKHV  64

Query  219  EAAAEAKTNPEDA--PAKDT--KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
            EA A+     +DA    KD   K +D+ F+KVD NTLFDLI+AAN+LNIK LLDLT QA 
Sbjct  65   EADAD-----KDAIITGKDEFLKSWDSEFVKVDKNTLFDLILAANYLNIKDLLDLTCQAA  119

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +P+E+RKIFN
Sbjct  120  ADMIKGKTPDEIRKIFN  136



>ref|XP_002537506.1| skp1, putative [Ricinus communis]
 gb|EEF24877.1| skp1, putative [Ricinus communis]
Length=158

 Score =   156 bits (395),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDGE F+VEE VA+E  TIK +IDD+C D+ IPI N+T KIL+ VIEYCK
Sbjct  2    SASKKITLKSSDGETFDVEEAVAVESQTIKHIIDDDCADSVIPIPNVTGKILSKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV  AA    + +D+     K +DA+F++VD NTLFDLI+AAN+LN+K LLDLT Q VA
Sbjct  62   KHVADAAFKDNDNKDSDDA-LKSWDADFVRVDQNTLFDLILAANYLNVKGLLDLTCQTVA  120

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  121  DMIKGKTPEEIRKTFN  136



>ref|XP_007219396.1| hypothetical protein PRUPE_ppa020403mg [Prunus persica]
 gb|EMJ20595.1| hypothetical protein PRUPE_ppa020403mg [Prunus persica]
Length=156

 Score =   156 bits (394),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 100/134 (75%), Gaps = 5/134 (4%)
 Frame = -2

Query  402  VRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYH  223
            ++ I L+S DGE+FEVEE VA++  TIK M++D+C D  IP+ N+TS I+A VIEYCK H
Sbjct  6    MKKITLKSDDGEIFEVEEAVAMQSQTIKHMVEDDCADGPIPLPNVTSNIVAKVIEYCKKH  65

Query  222  VEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
             E  A+ + N E     D K++D  F+KVD +T+FDLI+AAN+LN+KSLLDLT Q VADM
Sbjct  66   HEEDADGEKNKE-----DIKKWDVEFVKVDQSTMFDLILAANYLNVKSLLDLTCQTVADM  120

Query  42   IKDMSPEEVRKIFN  1
            I   +PEE+R+IFN
Sbjct  121  INGKTPEEIREIFN  134



>gb|KDO67761.1| hypothetical protein CISIN_1g044292mg [Citrus sinensis]
Length=160

 Score =   156 bits (394),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 101/132 (77%), Gaps = 5/132 (4%)
 Frame = -2

Query  396  MIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVE  217
            MI+L+SSDGE FEVEETVAL+  TI+ M++D+C D+ IP+ N+T  IL+MV+EYCK HVE
Sbjct  12   MIILKSSDGETFEVEETVALQSQTIRHMVEDDCADSVIPLPNVTGTILSMVVEYCKKHVE  71

Query  216  AAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMIK  37
            AAA A          D K +D +F+KVD  TL DL++AAN+LNIK LL+LT QA AD+IK
Sbjct  72   AAAAAA-----GGDNDVKNWDRDFVKVDQETLLDLLLAANYLNIKDLLELTCQATADVIK  126

Query  36   DMSPEEVRKIFN  1
            D SPEEVR+IF+
Sbjct  127  DKSPEEVRRIFH  138



>ref|XP_007221090.1| hypothetical protein PRUPE_ppa017105mg [Prunus persica]
 gb|EMJ22289.1| hypothetical protein PRUPE_ppa017105mg [Prunus persica]
Length=156

 Score =   156 bits (394),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 100/134 (75%), Gaps = 5/134 (4%)
 Frame = -2

Query  402  VRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYH  223
            ++ I L+S DGE+FEVEE VA++  TI+ M++D+C D  IP+ N+TS I+A VIEYCK H
Sbjct  6    MKKITLKSEDGEIFEVEEAVAMQSQTIRHMVEDDCADGPIPLQNVTSNIVAKVIEYCKKH  65

Query  222  VEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
             E  A+ + N E     D K++D  F+KVD +T+FDLI+AAN+LN+KSLLDLT Q VADM
Sbjct  66   HEEDADGEKNKE-----DIKKWDVEFVKVDQSTMFDLILAANYLNVKSLLDLTCQTVADM  120

Query  42   IKDMSPEEVRKIFN  1
            I   +PEE+R+IFN
Sbjct  121  INGKTPEEIREIFN  134



>ref|XP_010941328.1| PREDICTED: SKP1-like protein 1A [Elaeis guineensis]
Length=163

 Score =   156 bits (394),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 102/137 (74%), Gaps = 6/137 (4%)
 Frame = -2

Query  393  IMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVEA  214
            I+L+SSDGE+FEVEE+VA+E  TIK MI+D+C  N IP+ N+TSKIL+ VIEYCK HVEA
Sbjct  5    IILKSSDGEVFEVEESVAMESQTIKHMIEDDCAGNGIPLPNVTSKILSKVIEYCKRHVEA  64

Query  213  AAEAK------TNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
            +A A       ++   A   + K +D  F++VD  TLFDLI+AAN+LNIK LLDLT Q V
Sbjct  65   SAAASKYAAEDSSSSKAADNELKAWDDEFVRVDQATLFDLILAANYLNIKGLLDLTCQTV  124

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  125  ADMIKGKTPEEIRKTFN  141



>ref|XP_006360899.1| PREDICTED: SKP1-like protein 1B-like isoform X1 [Solanum tuberosum]
Length=150

 Score =   155 bits (393),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 99/133 (74%), Gaps = 6/133 (5%)
 Frame = -2

Query  396  MIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVE  217
            MI+LRSSDGE FEV+E VALE  TIK MI+D+C D +I + N+TSKIL  VIEYCK HVE
Sbjct  1    MIVLRSSDGETFEVDEAVALESPTIKHMIEDDCTDTSISLPNVTSKILVKVIEYCKRHVE  60

Query  216  AAAEAKTNPEDAPAK-DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
                     ED  A+ D K FDA F+KVD +TL+DL++AAN+LNIKSLLDLT Q VADMI
Sbjct  61   VP-----KAEDKTAEVDLKTFDAEFVKVDQSTLYDLMLAANYLNIKSLLDLTCQTVADMI  115

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+ K F+
Sbjct  116  KGKTPEEISKTFD  128



>ref|XP_008806601.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=163

 Score =   156 bits (394),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 102/138 (74%), Gaps = 5/138 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE+FEVEE VA+E  TIK MI+D+C  N IP+ N+TSKIL+ VIEYCK HV
Sbjct  4    QKITLKSSDGEVFEVEEAVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKRHV  63

Query  219  EAAAEAKTNPEDAPAK-----DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            +AAA +  +  D  +      + K +DA F+KVD  TLFDLI+AAN+LNIK LLDLT Q 
Sbjct  64   DAAAASSKSTADDTSSKLADDELKAWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQT  123

Query  54   VADMIKDMSPEEVRKIFN  1
            VADMIK  +PEE+RK FN
Sbjct  124  VADMIKGKTPEEIRKTFN  141



>ref|XP_010539092.1| PREDICTED: SKP1-like protein 1B [Tarenaya hassleriana]
Length=157

 Score =   155 bits (393),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 101/133 (76%), Gaps = 1/133 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            R I L+SSDGE FEV+E VALE  TIK MI+D+C DN IP+ N+TSKIL+ VIEYCK HV
Sbjct  4    RKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            +AAA+++     A     K +DA F+KVD  TLFDLI+AAN+LNIK LLDLT Q VADMI
Sbjct  64   DAAAKSEAAAA-AEEDVMKNWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMI  122

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  123  KGKTPEEIRKTFN  135



>dbj|BAB85606.1| kinetochore protein [Brassica juncea]
Length=161

 Score =   156 bits (394),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV+E VA E  T+  M++D+C++N IP+ N+TSKILA VIEYCK HV
Sbjct  4    KKIVLKSSDGESFEVDEAVARESQTLAHMVEDDCIENGIPLPNVTSKILAKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
            +AAA       D  A    D K +D  F+K+D  TLF+LI+AAN+LNIK+LLDLT Q VA
Sbjct  64   DAAAAKTEGAVDGAASSDDDLKAWDTEFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  123

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+R  FN
Sbjct  124  DMIKGKTPEEIRTTFN  139



>ref|XP_010941330.1| PREDICTED: SKP1-like protein 1B [Elaeis guineensis]
Length=164

 Score =   156 bits (394),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 106/139 (76%), Gaps = 6/139 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE+FEV+E VA+E  TIK MI+D+C  N IP+ N+TSKIL+ VIEYCK HV
Sbjct  4    KKIILKSSDGEVFEVDEMVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKKHV  63

Query  219  E--AAAEAKTNPEDAPAK----DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQ  58
            +  AAA +K+  +D  +K    D K +DA F+KVD  TLFDLI+AAN+LNIK LLDLT Q
Sbjct  64   DAAAAAASKSATDDTSSKLGEEDLKTWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQ  123

Query  57   AVADMIKDMSPEEVRKIFN  1
             VADMIK  +PEE+RK FN
Sbjct  124  TVADMIKGKTPEEIRKTFN  142



>ref|XP_008811446.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=162

 Score =   155 bits (393),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 102/136 (75%), Gaps = 5/136 (4%)
 Frame = -2

Query  393  IMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVEA  214
            I+L+SSDGE+FEVEETVA+E  TIK MI+D+C  N IP+ N+TSKIL+ VIEYCK HVEA
Sbjct  5    IILKSSDGEVFEVEETVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKRHVEA  64

Query  213  AAEAKTNPEDAPAK-----DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
            +A A     +  +      + K +DA F++VD  TLFDLI+AAN+LNIK LLDLT Q VA
Sbjct  65   SAAASKAAAEDSSSKLADDELKAWDAEFVRVDQATLFDLILAANYLNIKGLLDLTCQTVA  124

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  125  DMIKGKTPEEIRKTFN  140



>ref|XP_008806600.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=164

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 105/137 (77%), Gaps = 6/137 (4%)
 Frame = -2

Query  393  IMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVE-  217
            I L+SSDGE+FEVEETVA+E  TIK +I+D+C  N IP+ N+TSKILA VIEYCK HV+ 
Sbjct  6    ITLKSSDGEVFEVEETVAMESQTIKHLIEDDCATNGIPLPNVTSKILAKVIEYCKKHVDA  65

Query  216  -AAAEAKTNPEDAPAK----DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             AAA +K+  +D  +K    + K +DA F+KVD  TLFDLI+AAN+LNIK LLDLT Q V
Sbjct  66   AAAASSKSTADDTSSKLADDELKAWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTV  125

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  126  ADMIKGKTPEEIRKTFN  142



>ref|XP_003621659.1| SKP1-like protein [Medicago truncatula]
 gb|AES77877.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   155 bits (392),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 97/136 (71%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSD E FEV E VALE+ TIK MI D+C DN I + N+T +ILA VIEYCK
Sbjct  3    STTKKITLKSSDNETFEVPEAVALELQTIKHMIKDDCTDNGILVPNVTGQILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             H++AA+  +   ED    D K +DA F+KV   TLFDLI+AAN LNIKSLLDLT Q VA
Sbjct  63   KHIDAASSDEKPSED----DLKNWDAEFVKVHQTTLFDLILAANDLNIKSLLDLTCQYVA  118

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  119  DMIKGKTPEEIRKTFN  134



>ref|XP_009372997.1| PREDICTED: SKP1-like protein 1A isoform X1 [Pyrus x bretschneideri]
Length=160

 Score =   155 bits (392),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 97/138 (70%), Gaps = 4/138 (3%)
 Frame = -2

Query  414  SKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEY  235
            S  + + I L+SSD EMFEVEE VA+E  TIK M++D C  N IP+ N+TS ILA VIEY
Sbjct  5    SADLKKKITLKSSDDEMFEVEEVVAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEY  64

Query  234  CKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            C+ H E       + E    K+ KE+DA F+K+D NTL+DLIMAAN+L+IK LLDLT Q 
Sbjct  65   CRKHREDEGATAADGE----KNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQT  120

Query  54   VADMIKDMSPEEVRKIFN  1
            VADMIK  +PE++R  FN
Sbjct  121  VADMIKGKTPEQIRTTFN  138



>gb|KEH23692.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=159

 Score =   155 bits (392),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 104/138 (75%), Gaps = 2/138 (1%)
 Frame = -2

Query  414  SKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEY  235
            S +  +MI L+S D E+FEV E VALE  TIK MI+D+C DN IP+ N+T KILA VIEY
Sbjct  2    SSTTTKMITLKSYDNEIFEVPEAVALESQTIKHMIEDDCADNAIPVQNVTGKILAKVIEY  61

Query  234  CKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            CK HV+ A+ A   P ++  +  K +DA+F+KVD  TLF+LI+AAN+L+IKSLLDLT Q+
Sbjct  62   CKKHVQVAS-ADEKPSES-EEYLKNWDADFVKVDKETLFELILAANYLDIKSLLDLTCQS  119

Query  54   VADMIKDMSPEEVRKIFN  1
             ADM+K  +PEE+R++FN
Sbjct  120  AADMMKGKTPEEMREMFN  137



>ref|XP_001753031.1| predicted protein [Physcomitrella patens]
 gb|EDQ82072.1| predicted protein [Physcomitrella patens]
Length=157

 Score =   155 bits (392),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 99/133 (74%), Gaps = 1/133 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + + L+SSD EMFEV+E VA E   +K MI+D  +D  IP+ N++SKILA VIEYCKYHV
Sbjct  4    KRVKLKSSDDEMFEVDEAVAFESQAVKNMIEDTGIDAPIPLPNVSSKILAKVIEYCKYHV  63

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            E   +   + +  P ++ K +DA+F+KVD  TLFDLI+AAN+LNIK+LLDLT Q VADMI
Sbjct  64   ENQ-KPSDDKQATPEEEIKAWDADFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADMI  122

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  123  KGKTPEEIRKTFN  135



>ref|XP_003605511.1| SKP1 [Medicago truncatula]
 gb|AES87708.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=150

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 18/143 (13%)
 Frame = -2

Query  426  SSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNT-IPITNITSKILA  250
            SSPK       I+L+SSDGE F++E+ VA++  TIK +ID+EC ++T IP+TN+T KILA
Sbjct  3    SSPK-------IILKSSDGETFKIEKAVAMQSQTIKHLIDEECANDTGIPLTNVTGKILA  55

Query  249  MVIEYCKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLD  70
            MVIEYCK HV+AA+          + + +++DA F+KVD NTLF+LIMAAN+LNIKSLLD
Sbjct  56   MVIEYCKKHVDAAS----------SDELEKWDAEFVKVDQNTLFNLIMAANYLNIKSLLD  105

Query  69   LTTQAVADMIKDMSPEEVRKIFN  1
            LT     D IKD +PEE+RKIFN
Sbjct  106  LTCMTTMDNIKDKTPEEIRKIFN  128



>ref|XP_002880415.1| hypothetical protein ARALYDRAFT_481069 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56674.1| hypothetical protein ARALYDRAFT_481069 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = -2

Query  402  VRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYH  223
             + I+L+SSDGE FEV+E VA+E  TIK MI+D+C DN IP+ N+T  ILA VIEYCK H
Sbjct  3    AKKIILKSSDGESFEVDEAVAVESQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKKH  62

Query  222  VEAAAEAKTNPEDAPAKDTKE---FDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
            VEAAAEA  + +   + +  E   +D +F+KVD  TLFDLI+AAN+LNI  LLDLT +AV
Sbjct  63   VEAAAEAGGDKDFCGSTENDELKAWDNDFVKVDQPTLFDLILAANYLNISGLLDLTCKAV  122

Query  51   ADMIKDMSPEEVRKIFN  1
            ADM++  +PE++R+ FN
Sbjct  123  ADMMRGKTPEQMREHFN  139



>gb|AII79406.1| S-phase kinase-associated protein 1-like protein 6 [Malus hupehensis]
Length=165

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 98/138 (71%), Gaps = 5/138 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE FEV+E VA+E  TIK M++D+C DN IP+ N+TS ILA VIEYC+ HV
Sbjct  6    KMITLKSSDGEAFEVDEAVAMESQTIKHMVEDDCADNAIPLPNVTSHILAKVIEYCRKHV  65

Query  219  EAAAEAKTNPEDAPAKDT--KEFDANF---IKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            E   +  +        +   K+FD +F   IK D N LFDLI+AAN+LNIKSLLDLT Q 
Sbjct  66   EGRTDGDSTDVGKIGDENTLKKFDDDFVNEIKADQNVLFDLILAANYLNIKSLLDLTCQT  125

Query  54   VADMIKDMSPEEVRKIFN  1
            VADMIK  +PEE+RK FN
Sbjct  126  VADMIKGKTPEEIRKTFN  143



>ref|XP_002976912.1| hypothetical protein SELMODRAFT_271223 [Selaginella moellendorffii]
 ref|XP_002980633.1| hypothetical protein SELMODRAFT_154042 [Selaginella moellendorffii]
 gb|EFJ18284.1| hypothetical protein SELMODRAFT_154042 [Selaginella moellendorffii]
 gb|EFJ22022.1| hypothetical protein SELMODRAFT_271223 [Selaginella moellendorffii]
Length=157

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  IMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVEA  214
            + LRSSDGEMFEV+E VALE  T+K MI+D   D  IP+ N+ SKILA VIEY KYHV+A
Sbjct  5    VKLRSSDGEMFEVDEAVALESQTVKNMIEDTGSDAPIPLPNVPSKILAKVIEYSKYHVDA  64

Query  213  AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMIKD  34
                  +      ++ K +DA F+KVD  TLFDLI+AAN+LNI++LLDLT Q VADMIK 
Sbjct  65   QKSGDDSKVVPTEEEIKAWDAEFVKVDQATLFDLILAANYLNIRNLLDLTCQTVADMIKG  124

Query  33   MSPEEVRKIFN  1
             +PEE+RK FN
Sbjct  125  KTPEEIRKTFN  135



>ref|XP_003605505.1| SKP1-like protein [Medicago truncatula]
 gb|AES87702.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=164

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 106/141 (75%), Gaps = 7/141 (5%)
 Frame = -2

Query  417  KSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNT-IPITNITSKILAMVI  241
            +S +  + I L+SSD E FE+E+ VALE  TIK +IDD C D++ IP+ N+T KILAMVI
Sbjct  6    ESSTATKKITLKSSDNETFEIEKAVALESQTIKHLIDDNCADDSGIPLPNVTGKILAMVI  65

Query  240  EYCKYHVEAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLT  64
            E+CK HV+A     T+ ++ P++D   ++D  F+KVD +TLFDLI+AAN+LNIKSLLDLT
Sbjct  66   EHCKKHVDA-----TSSDEKPSEDEINKWDTEFVKVDQDTLFDLILAANYLNIKSLLDLT  120

Query  63   TQAVADMIKDMSPEEVRKIFN  1
             + VADMIK  +PEE+RK FN
Sbjct  121  CKTVADMIKGRTPEEIRKTFN  141



>ref|XP_004957494.1| PREDICTED: SKP1-like protein 1B-like [Setaria italica]
Length=174

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 96/142 (68%), Gaps = 9/142 (6%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +M+ML S D E FEVEE+VA E  TI  MI+D C DN IPI N+  KILA VIEYCK HV
Sbjct  11   KMLMLVSCDKENFEVEESVARESRTILHMIEDGCTDNGIPIPNVNGKILAKVIEYCKKHV  70

Query  219  EA---------AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDL  67
            EA         AAE       A   + K FDA+F+KVD  TLFDLI+AAN+L+IK LLDL
Sbjct  71   EARRGADGDGDAAEPTAATNKASEDELKTFDADFVKVDQGTLFDLILAANYLDIKGLLDL  130

Query  66   TTQAVADMIKDMSPEEVRKIFN  1
            T Q VADMIK  +PEE+RK FN
Sbjct  131  TCQTVADMIKGKTPEEIRKTFN  152



>ref|XP_009395385.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
Length=161

 Score =   154 bits (390),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 106/139 (76%), Gaps = 4/139 (3%)
 Frame = -2

Query  405  IVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKY  226
            + +MI L+SSDGE+FEV+E VA+E  TIK MI+D+C +N IP+ N+TSKILA VIEYC+ 
Sbjct  1    MAKMITLKSSDGEVFEVDEAVAMESQTIKHMIEDDCAENGIPLPNVTSKILAKVIEYCRK  60

Query  225  HVEAAAEAKTNPEDAPAK----DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQ  58
            HV+A+A A +   D  +K    + K +DA F+KVD  TLFDLI+AAN+LNIK LLDLT Q
Sbjct  61   HVDASAAAASKSSDDSSKLADDELKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQ  120

Query  57   AVADMIKDMSPEEVRKIFN  1
             VADMIK  +PEE+RK FN
Sbjct  121  TVADMIKGKTPEEIRKTFN  139



>ref|XP_003573486.1| PREDICTED: SKP1-like protein 1A [Brachypodium distachyon]
Length=168

 Score =   155 bits (391),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 98/139 (71%), Gaps = 6/139 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE FEVEETVA+E  TI+ MI+D+C DN IP+ N+ SKIL+ VIEYC  HV
Sbjct  8    KMITLKSSDGEEFEVEETVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIEYCNKHV  67

Query  219  EAAAEAKTNPEDAP------AKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQ  58
             AA        +          D K +DA+F+KVD  TLFDLI+AAN+LNIK LLDLT Q
Sbjct  68   HAADATDAAAANTSAAPAAPTDDLKNWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQ  127

Query  57   AVADMIKDMSPEEVRKIFN  1
             VADMIK  +PEE+RK FN
Sbjct  128  TVADMIKGKTPEEIRKTFN  146



>ref|XP_009372998.1| PREDICTED: SKP1-like protein 1A isoform X2 [Pyrus x bretschneideri]
Length=154

 Score =   154 bits (389),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 95/133 (71%), Gaps = 4/133 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSD EMFEVEE VA+E  TIK M++D C  N IP+ N+TS ILA VIEYC+ H 
Sbjct  4    KKITLKSSDDEMFEVEEVVAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEYCRKHR  63

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            E       + E    K+ KE+DA F+K+D NTL+DLIMAAN+L+IK LLDLT Q VADMI
Sbjct  64   EDEGATAADGE----KNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVADMI  119

Query  39   KDMSPEEVRKIFN  1
            K  +PE++R  FN
Sbjct  120  KGKTPEQIRTTFN  132



>ref|XP_010266846.1| PREDICTED: SKP1-like protein 1B isoform X1 [Nelumbo nucifera]
 ref|XP_010266847.1| PREDICTED: SKP1-like protein 1B isoform X1 [Nelumbo nucifera]
Length=154

 Score =   154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 100/133 (75%), Gaps = 4/133 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + + L+ SDGE F+V+E VALE  TIK MI+++C+DN IP+ N+TSKIL  VIEYCK HV
Sbjct  4    KKVTLKGSDGETFDVDEAVALESQTIKHMIEEDCIDNGIPLPNVTSKILCKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            E     +T+   A  ++ K +DA F+KVD  TLFDLI+AAN+L+IKSLLDLT Q VADMI
Sbjct  64   ET---PRTDDRTAD-EELKNWDAEFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMI  119

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  120  KGKTPEEIRKTFN  132



>ref|XP_003628375.1| SKP1-like protein [Medicago truncatula]
 gb|AET02851.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=157

 Score =   154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R + L+SSD E FEVEE VAL+  TIK MI+D+C    IP+ N+TSKILA VIEYCK
Sbjct  3    SSARKVTLKSSDDETFEVEEAVALKSQTIKHMIEDDCAKTEIPLPNVTSKILAKVIEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVEA   ++  P +    D K +DA F+KVD NT F+LI+AAN+L+IKSLL+LT Q VA
Sbjct  63   KHVEATTSSEGKPSE---DDVKAWDAEFVKVDLNTRFELILAANYLDIKSLLELTCQDVA  119

Query  48   DMIKDMSPEEVRKIFN  1
            + IKD + EE+RKIFN
Sbjct  120  ETIKDKTVEEIRKIFN  135



>emb|CDX85931.1| BnaC06g22030D [Brassica napus]
 emb|CDX68112.1| BnaA07g21520D [Brassica napus]
Length=151

 Score =   154 bits (388),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 99/133 (74%), Gaps = 7/133 (5%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV+E VALE  TI  M++D+CVDN +P+ N+TSKILA VIEYCK H 
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKKH-  62

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
              A +   + +D    D K +DA F+K+D  TLF+LI+AAN+LNIK+LLDLT Q VADMI
Sbjct  63   --AVDGGGSSDD----DLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMI  116

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+R  FN
Sbjct  117  KGKTPEEIRTTFN  129



>ref|XP_008382346.1| PREDICTED: SKP1-like protein 1A, partial [Malus domestica]
Length=144

 Score =   154 bits (388),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 97/141 (69%), Gaps = 4/141 (3%)
 Frame = -2

Query  423  SPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMV  244
            +  S  + + I L+SSD EMFEVEE +A+E  TIK M++D C  N IP+ N+TS ILA V
Sbjct  2    ASSSADLKKKITLKSSDDEMFEVEEAIAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKV  61

Query  243  IEYCKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLT  64
            IEYC+ H E       + E    K+ KE+DA F+K+D NTL+DLIMAAN+L+IK LLDLT
Sbjct  62   IEYCRKHSEDEGATAADGE----KNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLT  117

Query  63   TQAVADMIKDMSPEEVRKIFN  1
             Q VADMIK  +PE++R   N
Sbjct  118  CQTVADMIKGXTPEQIRTTLN  138



>emb|CDX93699.1| BnaA06g03490D [Brassica napus]
Length=160

 Score =   154 bits (388),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I+L+SSDGE FEVEE VAL+  TI  M++D+C+D  IP+ NIT  ILA VIEYCK
Sbjct  2    STSRHIVLKSSDGETFEVEEAVALQSQTIAHMVEDDCIDGGIPLANITGVILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIK-VDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HV    +   N   +  ++ K +DA F+  +D +TLF LIMAANFLNIK LLDLT QAV
Sbjct  62   KHVTVVPDGDGNSSSSLEEELKNWDAEFLSNIDQSTLFHLIMAANFLNIKDLLDLTCQAV  121

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  SPEE+R   N
Sbjct  122  ADMIKGKSPEEIRAQLN  138



>ref|XP_006359704.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=158

 Score =   154 bits (388),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 100/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S ++ I LRSSDGE+FEVEE VALE  TIK +I+D+C  + IPI+N+TS ILA V+EY K
Sbjct  2    SSLKKISLRSSDGEVFEVEEAVALESQTIKFLIEDDCAGSDIPISNVTSNILAKVLEYLK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVEA  +A  +   A     K FDA F+KVD  TLFDLI+AAN+LNIK LLDLT Q VA
Sbjct  62   RHVEADDKAADDKAAADND-LKVFDAEFVKVDQKTLFDLILAANYLNIKGLLDLTCQTVA  120

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  121  DMIKGKTPEEIRKTFN  136



>ref|XP_009147939.1| PREDICTED: SKP1-like protein 13 [Brassica rapa]
Length=160

 Score =   154 bits (388),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I+L+SSDGE FEVEE VAL+  TI  M++D+C+D  IP+ NIT  ILA VIEYCK
Sbjct  2    SASRHIVLKSSDGETFEVEEAVALQSQTIAHMVEDDCIDGGIPLANITGVILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIK-VDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HV    +   N   +  ++ K +DA F+  +D +TLF LIMAANFLNIK LLDLT QAV
Sbjct  62   KHVTVVPDGDGNSSSSLEEELKNWDAEFLSNIDQSTLFHLIMAANFLNIKDLLDLTCQAV  121

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  SPEE+R   N
Sbjct  122  ADMIKGKSPEEIRAQLN  138



>ref|XP_009355656.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=165

 Score =   154 bits (388),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 98/138 (71%), Gaps = 5/138 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE FEV+E VA+E  TIK M++D+C DN IP+ N+TS ILA VIEYC+ HV
Sbjct  6    KMITLKSSDGEAFEVDEAVAMESQTIKHMVEDDCADNAIPLPNVTSHILAKVIEYCRKHV  65

Query  219  EAAAEAKTNPEDAPAKDT--KEFDANF---IKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            E   +  +        +   K+FD +F   IK D N LFDLI+AAN+LNIKSLLDLT Q 
Sbjct  66   EGRTDGDSTDVGKIGDENTLKKFDDDFVNEIKADQNVLFDLILAANYLNIKSLLDLTCQT  125

Query  54   VADMIKDMSPEEVRKIFN  1
            VADMIK  +PE++RK FN
Sbjct  126  VADMIKGKTPEDIRKTFN  143



>ref|XP_007201294.1| hypothetical protein PRUPE_ppa012728mg [Prunus persica]
 gb|EMJ02493.1| hypothetical protein PRUPE_ppa012728mg [Prunus persica]
Length=157

 Score =   153 bits (387),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 102/137 (74%), Gaps = 11/137 (8%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+S+DGE+FEVEE VALE  TIK M +D+CVDN IP+ N+ S +LA VIEYC+ HV
Sbjct  6    KMITLKSADGEIFEVEEAVALESQTIKHMAEDDCVDNAIPLPNVESHVLAKVIEYCRKHV  65

Query  219  EAAAEAKTNPEDAPAKDT-KEFDANF---IKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
            E AA    N E+   KDT KEF+ +F   IK D + LFD I+AAN+LNIKSLLDLT Q V
Sbjct  66   ELAA----NDEN---KDTVKEFNDDFVNEIKADQSVLFDTILAANYLNIKSLLDLTCQTV  118

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  119  ADMIKGKAPEEIRKTFN  135



>ref|XP_002887622.1| hypothetical protein ARALYDRAFT_339769 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63881.1| hypothetical protein ARALYDRAFT_339769 [Arabidopsis lyrata subsp. 
lyrata]
Length=703

 Score =   163 bits (412),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 82/135 (61%), Positives = 102/135 (76%), Gaps = 3/135 (2%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEVEE VALE  TI  M++D+CVDN +P+ N+TSKILA VIEYCK HV
Sbjct  4    KKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPA--KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            E AA AK+   D     +D K +D  F+K+D  TLF+LI+AAN+LNIK+LLDLT Q VAD
Sbjct  64   EVAA-AKSEAVDGATSDEDLKAWDTEFMKIDQATLFELILAANYLNIKNLLDLTCQTVAD  122

Query  45   MIKDMSPEEVRKIFN  1
            MIK  +PEE+R  FN
Sbjct  123  MIKGKTPEEIRTTFN  137



>ref|XP_010061081.1| PREDICTED: SKP1-like protein 1B isoform X1 [Eucalyptus grandis]
 gb|KCW67978.1| hypothetical protein EUGRSUZ_F01672 [Eucalyptus grandis]
Length=160

 Score =   153 bits (387),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 98/137 (72%), Gaps = 1/137 (1%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  R I+L SSD E FEVE  VALE  TIK MI+D+C  + IP+ N++SKIL+ +IE+C+
Sbjct  2    SSSRKIVLESSDKESFEVEVAVALECQTIKHMIEDDCAGDGIPLPNVSSKILSKIIEFCR  61

Query  228  YHVEAAAEAKTNPEDAPAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HV+A  E   +   A A D  K +DA FIKVD  TLFDLI+AAN+LNIK LLDLT Q V
Sbjct  62   KHVDADRERAGSASPAAADDELKAWDAEFIKVDQATLFDLILAANYLNIKGLLDLTCQNV  121

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  122  ADMIKGKTPEEIRKSFN  138



>ref|XP_008382314.1| PREDICTED: SKP1-like protein 1A isoform X1 [Malus domestica]
 gb|AII79404.1| S-phase kinase-associated protein 1-like protein 1 [Malus hupehensis]
Length=160

 Score =   153 bits (387),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 96/138 (70%), Gaps = 4/138 (3%)
 Frame = -2

Query  414  SKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEY  235
            S  + + I L+SSD EMFEVEE +A+E  TIK M++D C  N IP+ N+TS ILA VIEY
Sbjct  5    SADLKKKITLKSSDDEMFEVEEAIAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEY  64

Query  234  CKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            C+ H E       + E    K+ KE+DA F+K+D NTL+DLIMAAN+L+IK LLDLT Q 
Sbjct  65   CRKHSEDEGATAADGE----KNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQT  120

Query  54   VADMIKDMSPEEVRKIFN  1
            VADMIK  +PE++R   N
Sbjct  121  VADMIKGKTPEQIRTTLN  138



>ref|XP_008382316.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
 gb|AII79403.1| S-phase kinase-associated protein 1-like protein 3 [Malus hupehensis]
Length=161

 Score =   153 bits (387),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 99/143 (69%), Gaps = 4/143 (3%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            M+S  S  + + I L+SSD EMFEVEE VA++  TIK M++D C  N IP+ N+TS ILA
Sbjct  1    MASSSSADLKKKINLKSSDDEMFEVEEAVAMKSQTIKHMVEDGCAGNAIPLPNVTSAILA  60

Query  249  MVIEYCKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLD  70
             VIEYC+ H E       + E    K+ KE+DA F+K+D N L+DLIMAAN+L+IK LLD
Sbjct  61   KVIEYCRKHSEDEGATAADSE----KNVKEWDAEFMKIDQNILYDLIMAANYLDIKGLLD  116

Query  69   LTTQAVADMIKDMSPEEVRKIFN  1
            LT Q VA+MIK  +PE++R  FN
Sbjct  117  LTCQTVANMIKGKTPEQIRTTFN  139



>ref|XP_009372996.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=160

 Score =   153 bits (386),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 96/138 (70%), Gaps = 4/138 (3%)
 Frame = -2

Query  414  SKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEY  235
            S  + + I L+SSD EMFEVEE VA+E  TIK M++D C  N IP+ N+TS ILA VIEY
Sbjct  5    SADLKKKITLKSSDDEMFEVEEAVAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEY  64

Query  234  CKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            C+ H E       + E    K+  E+DA F+K+D NTL+DLIMAAN+L+IK LLDLT Q 
Sbjct  65   CRKHHEDEGATAADGE----KNVNEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQT  120

Query  54   VADMIKDMSPEEVRKIFN  1
            VADMIK  +PE++R  FN
Sbjct  121  VADMIKGKTPEQIRTTFN  138



>ref|XP_002890373.1| hypothetical protein ARALYDRAFT_889462 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66632.1| hypothetical protein ARALYDRAFT_889462 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   153 bits (386),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = -2

Query  402  VRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYH  223
             + I+L+SSDGE FE++E VA+E  TIK MI+D+C DN IP+ N+T  ILA VIEYCK H
Sbjct  3    AKKIILKSSDGESFEIDEAVAVESQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKKH  62

Query  222  VEAAAEAKTNPEDAPAKDTKE---FDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
            VEAAAE+  + +   + +  E   +D +F+KVD  TLFDLI+AAN+LNI  LLDLT +AV
Sbjct  63   VEAAAESGGDEDFCGSTENDELKAWDNDFVKVDQPTLFDLILAANYLNISGLLDLTCKAV  122

Query  51   ADMIKDMSPEEVRKIFN  1
            ADM++  +PE++R+ FN
Sbjct  123  ADMMRGKTPEQMREHFN  139



>ref|XP_004299943.1| PREDICTED: SKP1-like protein 4-like [Fragaria vesca subsp. vesca]
Length=159

 Score =   153 bits (386),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 97/134 (72%), Gaps = 4/134 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +M+ L+S DGE+FE+EE VA++  TIK M++D+C DN IP+ N+   ILA VIEY K HV
Sbjct  7    KMLTLKSEDGEVFEIEEAVAVQSQTIKHMVEDDCADNAIPLPNVKGPILARVIEYLKKHV  66

Query  219  EAAAEAK-TNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
              A E K +  ED      KEFD  F+KVD + LFDLI+AAN+LNIK LLDLT QAVADM
Sbjct  67   ADAEENKESKKEDV---GLKEFDEEFLKVDQSVLFDLILAANYLNIKELLDLTCQAVADM  123

Query  42   IKDMSPEEVRKIFN  1
            IK  +PE++RK FN
Sbjct  124  IKGKTPEQIRKTFN  137



>gb|AGF33287.1| SKP1 1A-like protein, partial [Quercus ilex]
Length=124

 Score =   151 bits (382),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 95/122 (78%), Gaps = 6/122 (5%)
 Frame = -2

Query  363  FEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVEA-AAEAKTNPE  187
            FEVEE VALE  TIK MI+D+C DN IP+ N+TSKILA VIEYCK HVE+ +A+ +T+ E
Sbjct  1    FEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCKKHVESTSADERTSDE  60

Query  186  DAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMIKDMSPEEVRKI  7
            D  A DT+     F++VD  TLFDLI+AAN+LNIKSLLDLT Q VADMIK  +PEE+RK 
Sbjct  61   DLKAWDTE-----FVRVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKT  115

Query  6    FN  1
            FN
Sbjct  116  FN  117



>ref|XP_006416426.1| hypothetical protein EUTSA_v10008964mg [Eutrema salsugineum]
 gb|ESQ34779.1| hypothetical protein EUTSA_v10008964mg [Eutrema salsugineum]
Length=162

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 101/138 (73%), Gaps = 5/138 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+LRSSDGE FEV+E VA+E  TIK MI+D+C  N IP+ N+ S IL+ VIEYCK HV
Sbjct  3    KKIVLRSSDGESFEVDEAVAVESQTIKHMIEDDCAGNGIPLPNVNSAILSKVIEYCKKHV  62

Query  219  EAAAEAKTNPED--APA---KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            +AAA A +  +D  AP     + K +DA F+ VD  TLFDLI+AAN+LNI  LLDLT + 
Sbjct  63   DAAAAASSGEKDICAPTDEDNELKTWDAAFVNVDQATLFDLILAANYLNITGLLDLTCKT  122

Query  54   VADMIKDMSPEEVRKIFN  1
            VADM++  +PE++R+IFN
Sbjct  123  VADMMRGKTPEQMREIFN  140



>gb|AGT16907.1| SKP1-like protein [Saccharum hybrid cultivar R570]
Length=176

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 101/147 (69%), Gaps = 14/147 (10%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE FEVE  VA+E  TI+ MI+D+C DN IP+ N+ SKIL+ VIEYC  HV
Sbjct  8    KMITLKSSDGEEFEVEVAVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIEYCNKHV  67

Query  219  EAAAE----AKTNPEDAP----------AKDTKEFDANFIKVDHNTLFDLIMAANFLNIK  82
             AAA     +K   +D             +D K +DA+F+KVD  TLFDLI+AAN+LNIK
Sbjct  68   HAAAAAAAASKAGSDDVGAAAANSTAASGEDLKNWDADFVKVDQATLFDLILAANYLNIK  127

Query  81   SLLDLTTQAVADMIKDMSPEEVRKIFN  1
             LLDLT Q VADMIK  +PEE+RK FN
Sbjct  128  GLLDLTCQTVADMIKGKTPEEIRKTFN  154



>ref|XP_009362142.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
 ref|XP_009373360.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=177

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 97/129 (75%), Gaps = 7/129 (5%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            R I L+SSDGE FEV+E VAL   TIK M++D+C DN IP+ N+TSKILA VIEYC+ HV
Sbjct  5    RKITLKSSDGETFEVDEAVALMSQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYCRKHV  64

Query  219  EAAAEAKTNPEDAPA--KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            EAA      PE+  +  +D K +DA F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VAD
Sbjct  65   EAA-----KPEERASVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  119

Query  45   MIKDMSPEE  19
            MIK+ + EE
Sbjct  120  MIKEKTLEE  128



>gb|EMS59755.1| SKP1-like protein 4 [Triticum urartu]
Length=164

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSD E F+V E VA+E  TI+ MI+D+C DN IP+ N+ SKIL+ VIEYCK HV
Sbjct  9    KMITLKSSDREEFQVAEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVIEYCKKHV  68

Query  219  EA-AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            +  A  + +    APA+D K FDA F+KVD  TLFDLI+AAN+LNIK LLDLT Q VADM
Sbjct  69   QVDAGSSTSTAAAAPAEDLKSFDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADM  128

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+RK FN
Sbjct  129  IKGKTPEEIRKTFN  142



>ref|XP_009376944.1| PREDICTED: SKP1-like protein 1B [Pyrus x bretschneideri]
Length=163

 Score =   152 bits (384),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 99/137 (72%), Gaps = 5/137 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE FEV+E VA+E  TIK +++D C DN IP+ N+TS ILA +IEYC+ HV
Sbjct  6    KMITLKSSDGEAFEVDEAVAMESQTIKHLVED-CTDNVIPLHNVTSHILAKIIEYCRKHV  64

Query  219  EAAAEAKTNPEDAPAKDT-KEFDANF---IKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
            E   +  +        +T K+FD +F   IK D N LFDLI+AAN+LNIKSLLDLT Q+V
Sbjct  65   EGRKDGDSTDLGQSGDETLKKFDEDFVNEIKADQNVLFDLILAANYLNIKSLLDLTCQSV  124

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PE+VRK FN
Sbjct  125  ADMIKGKTPEDVRKTFN  141



>gb|ACR38888.1| SKP1 [Pellia endiviifolia (species B)]
 gb|ACR38897.1| SKP1 [Pellia endiviifolia (species B)]
Length=158

 Score =   152 bits (383),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = -2

Query  393  IMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVEA  214
            + L+SSD EMFEVE+ VA E  T+K MI+D   +N IP+ N++SKIL+ VIEYCK+HVE 
Sbjct  7    VKLKSSDDEMFEVEDVVAFESQTVKNMIEDTGTENAIPLPNVSSKILSKVIEYCKFHVET  66

Query  213  AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMIKD  34
               A   P  A   + K +DA F+KVD  TLFDLI+AAN+LNIK+LLDLT Q VADMIK 
Sbjct  67   QKAADDKPV-ATEDEIKTWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADMIKG  125

Query  33   MSPEEVRKIF  4
             +PEE+RK F
Sbjct  126  KTPEEIRKTF  135



>ref|XP_008347749.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
Length=196

 Score =   153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 95/136 (70%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L SS  EMFEVEE VA+E  TIK M++D C  NTIP+ N+TS ILA VIEYC 
Sbjct  48   SAGQKITLNSSGSEMFEVEEAVAMESQTIKHMVEDGCAGNTIPLPNVTSAILAKVIEYCT  107

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             H E      T+ E+    + KE+DA FIK++ NTL+DLIMAAN+LNIK LLDLT Q V 
Sbjct  108  KHREEGXAIATDXEN----NFKEWDAEFIKINQNTLYDLIMAANYLNIKGLLDLTCQIVV  163

Query  48   DMIKDMSPEEVRKIFN  1
            D IK  +PEE+RK+FN
Sbjct  164  DXIKGKAPEEIRKMFN  179



>ref|XP_010428644.1| PREDICTED: SKP1-like protein 1A [Camelina sativa]
Length=170

 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 104/147 (71%), Gaps = 10/147 (7%)
 Frame = -2

Query  414  SKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEY  235
            + +  + I+L+SSDGE FEV+E VALE  TI  M++D+CVDN +P+ N+TSKILA VIEY
Sbjct  3    TTTTTKKIVLKSSDGESFEVDELVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEY  62

Query  234  CKYHVEAAAEAKT---------NPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIK  82
            CK HVE  A +KT             A  ++ K +DA F+K+D  TLF+LI+AAN+LNIK
Sbjct  63   CKKHVEVTA-SKTDAADGAAAGAASSAADEELKTWDAEFMKIDQATLFELILAANYLNIK  121

Query  81   SLLDLTTQAVADMIKDMSPEEVRKIFN  1
            +LLDLT Q VADMIK  +PEE+R  FN
Sbjct  122  NLLDLTCQTVADMIKGKTPEEIRTTFN  148



>ref|XP_008382315.1| PREDICTED: SKP1-like protein 1A isoform X2 [Malus domestica]
Length=154

 Score =   151 bits (382),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = -2

Query  393  IMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVEA  214
            I L+SSD EMFEVEE +A+E  TIK M++D C  N IP+ N+TS ILA VIEYC+ H E 
Sbjct  6    ITLKSSDDEMFEVEEAIAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEYCRKHSED  65

Query  213  AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMIKD  34
                  + E    K+ KE+DA F+K+D NTL+DLIMAAN+L+IK LLDLT Q VADMIK 
Sbjct  66   EGATAADGE----KNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVADMIKG  121

Query  33   MSPEEVRKIFN  1
             +PE++R   N
Sbjct  122  KTPEQIRTTLN  132



>ref|XP_008811458.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=164

 Score =   151 bits (382),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 100/139 (72%), Gaps = 6/139 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE+FEV+E VA+E  TIK MI+D+C  N IP+ N+TSKIL+ VIEYCK HV
Sbjct  4    KKITLKSSDGEVFEVDEMVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPAK------DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQ  58
            +AAA A +              D K +DA F+KVD  TLFDLI+AAN+LNIK LLDLT Q
Sbjct  64   DAAAAAASKSAADDTSFKLADDDLKTWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQ  123

Query  57   AVADMIKDMSPEEVRKIFN  1
             VADMIK  +PEE+RK FN
Sbjct  124  TVADMIKGKTPEEIRKTFN  142



>ref|XP_008448523.1| PREDICTED: SKP1-like protein 1B [Cucumis melo]
Length=155

 Score =   151 bits (381),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 100/137 (73%), Gaps = 6/137 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+SSDG+ FEV+  VAL+  TI+ MI+D C DN IP+ N+ SKILA VIEYC+
Sbjct  2    SSSKKITLKSSDGDYFEVDGAVALQSQTIRHMIEDSCADNGIPLPNVNSKILAKVIEYCR  61

Query  228  YHVEAAAEAKTNPEDAPA-KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
             HV A++    +P  AP+  D K +D +F+ VD  TLFDLI+AAN+L+IKSLLDLT Q V
Sbjct  62   KHVNASS---LDP--APSVDDLKTWDRDFVNVDQATLFDLILAANYLDIKSLLDLTCQTV  116

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  117  ADMIKGKTPEEIRKTFN  133



>dbj|BAE72118.1| SKP1-like protein [Silene latifolia]
Length=171

 Score =   151 bits (382),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 100/140 (71%), Gaps = 7/140 (5%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            R IML+SSDGE F V+E VALE  TIK MI+DEC DN IP+ N+T+K L+ VIEYCK HV
Sbjct  9    RKIMLKSSDGENFVVDEIVALESQTIKHMIEDECADNAIPLPNVTAKTLSKVIEYCKKHV  68

Query  219  EAAAEAKTNPED------APAKDT-KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTT  61
             AAA    +         A   D  K++D  F+KVD NTLFD+ +AAN+LNIK LLDLT 
Sbjct  69   NAAAAKTADTATTSTAGVAGGDDELKKWDEKFMKVDQNTLFDICLAANYLNIKDLLDLTC  128

Query  60   QAVADMIKDMSPEEVRKIFN  1
            Q VADMIK+M PEEVRK+FN
Sbjct  129  QTVADMIKNMMPEEVRKVFN  148



>ref|XP_006660908.1| PREDICTED: SKP1-like protein 1B-like [Oryza brachyantha]
Length=177

 Score =   151 bits (382),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 99/149 (66%), Gaps = 13/149 (9%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I LRS +GE+FEV E VA+E  TI+ MI+D+C DN IP+ N+++ IL  VIEYC 
Sbjct  7    SKAKSITLRSCEGEVFEVAEIVAMESQTIRHMIEDKCTDNGIPLPNVSANILCKVIEYCN  66

Query  228  YHVEA-------------AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLN  88
             HVEA             A EA T    A  ++ K FDA F+KVD  TLFDLI+AAN+LN
Sbjct  67   KHVEARRGVAADGRASGTAVEADTGLSKAIKEELKTFDAEFVKVDQTTLFDLILAANYLN  126

Query  87   IKSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            IK LLDL  QAV+DMIK  +PE++R+ FN
Sbjct  127  IKGLLDLICQAVSDMIKGKTPEQIRETFN  155



>ref|XP_007024458.1| SKP1-like 4 [Theobroma cacao]
 gb|EOY27080.1| SKP1-like 4 [Theobroma cacao]
Length=152

 Score =   150 bits (380),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 99/136 (73%), Gaps = 8/136 (6%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + IMLRSSDG+  EVEE VA+++ TIK MI+D+C DN IPI N+TS+ILA V+EYCK
Sbjct  3    STSKKIMLRSSDGKTVEVEEAVAVQLLTIKHMIEDDCADNEIPIPNVTSEILAKVLEYCK  62

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HV+         ED    + K +DA+F+KVD N L+ L++AAN+LNI+SLLDL  Q VA
Sbjct  63   KHVDKGKMG----ED----ELKAWDADFVKVDQNILYHLVLAANYLNIQSLLDLICQTVA  114

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +PEE+RK FN
Sbjct  115  DMIKGKTPEEIRKTFN  130



>ref|XP_003605516.1| SKP1-like protein [Medicago truncatula]
 gb|AES87713.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=153

 Score =   150 bits (379),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 104/144 (72%), Gaps = 15/144 (10%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNT-IPITNITSKIL  253
            M+S  SK I+    L+S +GE FE+EE VA++  TIK +IDD+C ++T IPI+N+TSKIL
Sbjct  1    MASLSSKKII----LKSYEGETFEIEEAVAMQSQTIKLLIDDDCANDTGIPISNVTSKIL  56

Query  252  AMVIEYCKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLL  73
            AMVIEYCK H +          D  + + +++DA F++VD +TLF+LI AAN+LNIKSLL
Sbjct  57   AMVIEYCKKHAD----------DVSSDELRKWDAEFVQVDQDTLFNLISAANYLNIKSLL  106

Query  72   DLTTQAVADMIKDMSPEEVRKIFN  1
            DLT    AD IKD +PEE+RKIFN
Sbjct  107  DLTCMTAADNIKDKTPEEIRKIFN  130



>ref|XP_008232108.1| PREDICTED: SKP1-like protein 1A [Prunus mume]
Length=156

 Score =   150 bits (378),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 99/134 (74%), Gaps = 5/134 (4%)
 Frame = -2

Query  402  VRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYH  223
            ++ I L+S DGE+FEVEE VA++  TI+ M++D+C D  IP+ N+TS ILA VIEYC+ H
Sbjct  6    MKKITLKSDDGEIFEVEEAVAMQSQTIRHMMEDDCADGAIPLPNVTSNILAKVIEYCRKH  65

Query  222  VEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
             E AA+ + N +D      KE+DA F+K+D  TLF LIM AN+LNIKSLLDLT Q VA+M
Sbjct  66   KEEAADGE-NKKDI----LKEWDAEFVKLDQVTLFHLIMTANYLNIKSLLDLTAQTVAEM  120

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+R+ FN
Sbjct  121  IKGKTPEEIRETFN  134



>ref|XP_009363144.1| PREDICTED: uncharacterized protein LOC103953139 [Pyrus x bretschneideri]
Length=275

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 97/129 (75%), Gaps = 7/129 (5%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            R I L+SSDGE FEV+E VAL   TIK M++D+C DN IP+ N+TSKILA VIEYC+ HV
Sbjct  5    RKITLKSSDGETFEVDEAVALMSQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYCRKHV  64

Query  219  EAAAEAKTNPEDAPA--KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVAD  46
            EAA      PE+  +  +D K +DA F+KVD  TLFDLI+AAN+LNIKSLLDLT Q VAD
Sbjct  65   EAA-----KPEERASVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  119

Query  45   MIKDMSPEE  19
            MIK+ + EE
Sbjct  120  MIKEKTLEE  128



>ref|XP_010029650.1| PREDICTED: SKP1-like protein 1B [Eucalyptus grandis]
 gb|KCW56601.1| hypothetical protein EUGRSUZ_I02322 [Eucalyptus grandis]
Length=155

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 99/134 (74%), Gaps = 6/134 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            R + L SSDGE FEVE++VA+E  TIK  I++    N IP+ N+ SKILA VIEYCK HV
Sbjct  5    RKVTLLSSDGESFEVEQSVAVESITIKDSIEEGGAGNAIPVPNVNSKILAKVIEYCKKHV  64

Query  219  EAA-AEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            E+A AE + + ED  A     +DA+F++VD  TLFDLI+AANFLNIKSLLDLT Q VADM
Sbjct  65   ESAKAEDRVDDEDLVA-----WDADFVEVDWATLFDLILAANFLNIKSLLDLTCQTVADM  119

Query  42   IKDMSPEEVRKIFN  1
            IK M+PEE RK F+
Sbjct  120  IKRMTPEEQRKTFS  133



>ref|XP_006304273.1| hypothetical protein CARUB_v10010505mg [Capsella rubella]
 gb|EOA37171.1| hypothetical protein CARUB_v10010505mg [Capsella rubella]
Length=162

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 98/139 (71%), Gaps = 3/139 (2%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            +  + I+L+SSDGE FEV+E VA+E  TIK MI+D+C  N IP+ N+T  ILA VIEYCK
Sbjct  2    AAAKKIILKSSDGESFEVDEVVAVESQTIKHMIEDDCTGNGIPLPNVTGTILAKVIEYCK  61

Query  228  YHVEAAAEAKTNPEDAPAKDTKE---FDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQ  58
             H EAAA+   + +   + +  E   +D  F+KVD NTLFDLI+AAN+LNI  LLDLT +
Sbjct  62   KHAEAAADDGGDKDFCGSTENDELKAWDTEFVKVDQNTLFDLILAANYLNISGLLDLTCK  121

Query  57   AVADMIKDMSPEEVRKIFN  1
            AVAD +K  +PEE+R  FN
Sbjct  122  AVADQMKGKTPEEMRAHFN  140



>ref|XP_003574990.1| PREDICTED: SKP1-like protein 1A [Brachypodium distachyon]
Length=162

 Score =   149 bits (377),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI+LRSSDG+ FEVEE VA E  TI  MI+D+C DN IP+ N+ +KIL  VIEYCK H 
Sbjct  8    KMILLRSSDGKEFEVEEAVAKESRTILHMIEDDCADNGIPLPNVDAKILTKVIEYCKKHA  67

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
             AA  +  +     A D KEFDA+F+KVD   LFDLI+AAN+L+IK LLDLT Q VADMI
Sbjct  68   AAADPSAADSNSTAAADLKEFDADFVKVDQAVLFDLILAANYLDIKGLLDLTCQTVADMI  127

Query  39   KDMSPEEVRKIFN  1
            K  + EE+R  FN
Sbjct  128  KGKTVEEIRTKFN  140



>dbj|BAD46569.1| putative UIP2 [Oryza sativa Japonica Group]
 dbj|BAH01115.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84966.1| hypothetical protein OsI_32208 [Oryza sativa Indica Group]
 gb|EEE70133.1| hypothetical protein OsJ_30167 [Oryza sativa Japonica Group]
Length=175

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 99/148 (67%), Gaps = 20/148 (14%)
 Frame = -2

Query  396  MIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVE  217
            MI LRS +G++FEV E VA+E  TI+ MI+D+C D  IP+ N+++KIL+ VIEYC  HVE
Sbjct  10   MITLRSCEGQVFEVAEAVAMESQTIRHMIEDKCADTGIPLPNVSAKILSKVIEYCSKHVE  69

Query  216  A----------------AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNI  85
            A                A EA    ED    + K FDA F+KVD +TLFDLI+AAN+LNI
Sbjct  70   ARGGAAAAADGDAPAPAAVEANKAVED----ELKTFDAEFVKVDQSTLFDLILAANYLNI  125

Query  84   KSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            K LLDLT Q VADMIK  +PEE+RK FN
Sbjct  126  KGLLDLTCQTVADMIKGKTPEEIRKTFN  153



>ref|XP_010425103.1| PREDICTED: SKP1-like protein 16 [Camelina sativa]
Length=163

 Score =   149 bits (377),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 99/132 (75%), Gaps = 2/132 (2%)
 Frame = -2

Query  393  IMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVEA  214
            ++L SSDGE FE+EE VA ++  I  MIDD+C D  IP+ N+T KILA+VIEYCK HV+ 
Sbjct  6    VVLTSSDGETFEIEEAVARKLQIIGHMIDDDCADKAIPLANVTGKILALVIEYCKKHVDD  65

Query  213  AAEAKTNPEDAPAKDTKEFDANFIK-VDHNTLFDLIMAANFLNIKSLLDLTTQAVADMIK  37
              ++ T  E+A AK+ K +DA F+K +D  T F +I+AAN+LN+K LLDLT Q+VAD IK
Sbjct  66   DKDS-TKEEEAKAKELKTWDAQFMKNIDLETNFSIILAANYLNVKDLLDLTCQSVADHIK  124

Query  36   DMSPEEVRKIFN  1
            DMSPEE+R IFN
Sbjct  125  DMSPEEIRTIFN  136



>gb|KEH23706.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=158

 Score =   149 bits (377),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 97/134 (72%), Gaps = 5/134 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+S DGE FEV E VAL+  TIK +I+D+C DN IP+ N+T KILA VIEYCK HV
Sbjct  7    KMITLKSDDGETFEVSEAVALKSQTIKHIIEDDCADNVIPVPNVTGKILAKVIEYCKKHV  66

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIK-VDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            EA +  +   ED    D K +DA+F K VD  TLF +++AAN+LNIK+LLDL  Q VAD 
Sbjct  67   EATSSDEKVSED----DLKNWDADFAKEVDQQTLFQILLAANYLNIKNLLDLCCQTVADD  122

Query  42   IKDMSPEEVRKIFN  1
            IKD  PEE+R+IF+
Sbjct  123  IKDKKPEEIREIFS  136



>ref|XP_010440828.1| PREDICTED: SKP1-like protein 1A [Camelina sativa]
Length=162

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 101/140 (72%), Gaps = 5/140 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I+L+SSDGE FE +E VA E  TI  M++D+CVDN +P+ N+TSKILA VIEYCK
Sbjct  2    STTKKIVLKSSDGESFEADELVARESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCK  61

Query  228  YHVEAAAEAKT----NPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTT  61
             HVE  A +KT        +  ++ K +DA F+K++  TLF+LI+AAN+LNIK+LLDLT 
Sbjct  62   KHVEVTA-SKTDAADAVASSADEELKTWDAEFMKINQATLFELILAANYLNIKTLLDLTC  120

Query  60   QAVADMIKDMSPEEVRKIFN  1
            Q VADMIK  +PEE+R  FN
Sbjct  121  QTVADMIKGKTPEEIRTTFN  140



>gb|EYU37960.1| hypothetical protein MIMGU_mgv1a015408mg [Erythranthe guttata]
Length=158

 Score =   149 bits (376),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 103/144 (72%), Gaps = 10/144 (7%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            M+S  +  I +MI+L+SSDG++FE+EE+VA    T++ MI+DEC DNTIP+ N+T+KILA
Sbjct  1    MASSSNTEIQKMIVLQSSDGQIFEIEESVASNSQTLRNMIEDECADNTIPLPNVTAKILA  60

Query  249  MVIEYCKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKV-DHNTLFDLIMAANFLNIKSLL  73
             VIEYCK H +AAA          A D K+FDA+F+   D  TLFD ++AAN+LNI SL+
Sbjct  61   RVIEYCKRHTDAAAN---------ADDLKKFDADFVDPDDQETLFDTLLAANYLNISSLM  111

Query  72   DLTTQAVADMIKDMSPEEVRKIFN  1
            D+  +A+A+M+KD  PE  RK FN
Sbjct  112  DMLCKAIAEMLKDKDPEVTRKKFN  135



>ref|XP_010266848.1| PREDICTED: SKP1-like protein 1B isoform X2 [Nelumbo nucifera]
Length=154

 Score =   149 bits (375),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 98/133 (74%), Gaps = 4/133 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + + L+SSDGE F V++ VALE  TI  MI+++C+DN IP+  +TSKIL+ VIEYCK HV
Sbjct  4    KKVTLKSSDGETFNVDKAVALESQTIMHMIEEDCIDNGIPLPTVTSKILSKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMI  40
            +     +T+   A  K  K +DA F+KVD  TLFDLI+AAN+L+IKSLLDLT Q VADMI
Sbjct  64   KTT---RTDDRTADEK-LKNWDAEFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMI  119

Query  39   KDMSPEEVRKIFN  1
            K  +PEE+RK FN
Sbjct  120  KGKTPEEIRKTFN  132



>ref|XP_004159727.1| PREDICTED: SKP1-like protein 1A-like [Cucumis sativus]
Length=155

 Score =   149 bits (375),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 96/131 (73%), Gaps = 4/131 (3%)
 Frame = -2

Query  393  IMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVEA  214
            I+L+SSDG+ F+V++ VAL+  TI+ MI+D C  N IP+ N+ SKILA VI+YC+ HV+A
Sbjct  7    IILKSSDGDYFQVDDAVALQSQTIRHMIEDNCAHNGIPLPNVNSKILAKVIQYCRKHVDA  66

Query  213  AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMIKD  34
            ++      ED    D K +D +F+ VD  TLFDLI+AAN+L++KSLLDLT Q VADMIK 
Sbjct  67   SSADPLPSED----DLKTWDRDFVNVDQATLFDLILAANYLDVKSLLDLTCQTVADMIKG  122

Query  33   MSPEEVRKIFN  1
              PEE+RK FN
Sbjct  123  KKPEEIRKTFN  133



>ref|XP_006661910.1| PREDICTED: SKP1-like protein 1B-like [Oryza brachyantha]
Length=169

 Score =   149 bits (376),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 103/141 (73%), Gaps = 9/141 (6%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE FEVEE VA+E  TI+ MI+D+C DN IP+ N+ SKIL+ VIEYC  HV
Sbjct  8    KMITLKSSDGEEFEVEEAVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIEYCNKHV  67

Query  219  EAAAEAKTNPEDAPAK--------DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLT  64
             A+    T+ +DAPA         D K +DA+F+KVD  TLFDLI+AAN+LNIK LLDLT
Sbjct  68   HASNSTSTS-DDAPAPAANSTSADDLKNWDADFVKVDQATLFDLILAANYLNIKGLLDLT  126

Query  63   TQAVADMIKDMSPEEVRKIFN  1
             Q VADMIK  +PEE+RK FN
Sbjct  127  CQTVADMIKGKTPEEIRKTFN  147



>ref|XP_009149503.1| PREDICTED: SKP1-like protein 4 [Brassica rapa]
 emb|CDY29370.1| BnaA06g14260D [Brassica napus]
Length=161

 Score =   148 bits (374),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 100/137 (73%), Gaps = 4/137 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV++ VALE  TIK M++D+CV + IP+ N+TS ILA VIEYCK HV
Sbjct  3    KKIILKSSDGESFEVDQAVALESQTIKHMVEDDCVADGIPLPNVTSAILAKVIEYCKKHV  62

Query  219  EAAAEAKTNPED--APAKDT--KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
            +AAAEA    +D     +DT  K +D  F KVD  TLFDLI+AAN+LNI  LLDLT + V
Sbjct  63   DAAAEANAGDKDIYGNTEDTELKNWDTEFAKVDQPTLFDLILAANYLNITGLLDLTCKTV  122

Query  51   ADMIKDMSPEEVRKIFN  1
            ADM+   +PE++R+ FN
Sbjct  123  ADMMVGKTPEQMREHFN  139



>ref|XP_004146156.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 gb|KGN55643.1| hypothetical protein Csa_3G002630 [Cucumis sativus]
Length=155

 Score =   148 bits (373),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 95/131 (73%), Gaps = 4/131 (3%)
 Frame = -2

Query  393  IMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVEA  214
            I L+SSDG+ F+V++ VAL+  TI+ MI+D C  N IP+ N+ SKILA VI+YC+ HV+A
Sbjct  7    ITLKSSDGDYFQVDDAVALQSQTIRHMIEDNCAHNGIPLPNVNSKILAKVIQYCRKHVDA  66

Query  213  AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMIKD  34
            ++      ED    D K +D +F+ VD  TLFDLI+AAN+L++KSLLDLT Q VADMIK 
Sbjct  67   SSADPLPSED----DLKTWDRDFVNVDQATLFDLILAANYLDVKSLLDLTCQTVADMIKG  122

Query  33   MSPEEVRKIFN  1
              PEE+RK FN
Sbjct  123  KKPEEIRKTFN  133



>emb|CDP16773.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   147 bits (372),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 99/138 (72%), Gaps = 9/138 (7%)
 Frame = -2

Query  414  SKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEY  235
            S S  +MI L+SSDGE FEVEE VA+E  TIK MI+D+C +++IPI N+TS  L  VIEY
Sbjct  2    SSSSPKMITLQSSDGETFEVEEVVAMESRTIKHMIEDDCANSSIPIPNVTSNTLTKVIEY  61

Query  234  CKYHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            CK HVEA      N E+      K FDA+F+K+D +TL+DL+MA+N+L+IKSLLDL  Q 
Sbjct  62   CKKHVEAK-----NDEEG----LKSFDADFMKIDKDTLYDLLMASNYLDIKSLLDLGCQT  112

Query  54   VADMIKDMSPEEVRKIFN  1
            VAD IK  +PE++RK F 
Sbjct  113  VADKIKGKNPEDIRKEFG  130



>ref|XP_008372868.1| PREDICTED: SKP1-like protein 1B [Malus domestica]
Length=165

 Score =   147 bits (372),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 95/138 (69%), Gaps = 5/138 (4%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE FEV+E VA+E  TIK M++D+C DN IP+ N+TS ILA VIEYC+ HV
Sbjct  6    KMITLKSSDGEAFEVDEAVAMESQTIKHMVEDDCADNAIPLPNVTSHILAKVIEYCRKHV  65

Query  219  EAAAEAKTNPEDAPAKDT--KEFDANF---IKVDHNTLFDLIMAANFLNIKSLLDLTTQA  55
            E   +  +        +   K+FD +F   IK D N LFDLI+AAN+LNIKSLLDLT   
Sbjct  66   EGRTDGDSTDXGKIGDEXTLKKFDDDFVNEIKADQNVLFDLILAANYLNIKSLLDLTCXT  125

Query  54   VADMIKDMSPEEVRKIFN  1
            VADMIK  +PE + K FN
Sbjct  126  VADMIKGXTPEXIXKTFN  143



>emb|CDY44209.1| BnaC05g15660D [Brassica napus]
Length=161

 Score =   147 bits (371),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 99/137 (72%), Gaps = 4/137 (3%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSDGE FEV+E VALE  TIK M++D+C+ + IP+ N+TS ILA VIEYCK HV
Sbjct  3    KKIILKSSDGESFEVDEAVALESQTIKHMVEDDCIADGIPLPNVTSAILAKVIEYCKKHV  62

Query  219  EAAAEAKTNPED--APAKDT--KEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
            +AAAEA    +D     +DT  K +D  F KVD  TLFDLI+AAN+LNI  LLDLT + V
Sbjct  63   DAAAEANAGDKDIYGNTEDTELKNWDTEFAKVDQPTLFDLILAANYLNITGLLDLTCKTV  122

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMI   +P ++R+ FN
Sbjct  123  ADMIVGKTPAQMREHFN  139



>ref|NP_001176525.1| Os11g0456300 [Oryza sativa Japonica Group]
 gb|ABA93508.1| SKP1-like protein 1B, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAH95253.1| Os11g0456300 [Oryza sativa Japonica Group]
Length=173

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 100/145 (69%), Gaps = 13/145 (9%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK---  229
            +MI L+SSDGE FEVEE VA+E  TI+ MI+D+C DN IP+ N+ SKIL+ VIEYC    
Sbjct  8    KMITLKSSDGEEFEVEEPVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIEYCNKHV  67

Query  228  ---------YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSL  76
                        +AA+ A   P  +  +D K +DA+F+KVD  TLFDLI+AAN+LNIK L
Sbjct  68   HAAAAAASKAADDAASAAAAVPPPS-GEDLKNWDADFVKVDQATLFDLILAANYLNIKGL  126

Query  75   LDLTTQAVADMIKDMSPEEVRKIFN  1
            LDLT Q VADMIK  +PEE+RK FN
Sbjct  127  LDLTCQTVADMIKGKTPEEIRKTFN  151



>emb|CAB87834.1| putative kinetochore protein [Vicia faba var. minor]
Length=124

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 93/122 (76%), Gaps = 6/122 (5%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I L+SSDGE FEV+E VALE   IK MI+D+C D+ IP+ N+TSKILA VIE+CK HV
Sbjct  5    KKITLKSSDGEAFEVDEAVALESQAIKHMIEDDCADSGIPLPNVTSKILAKVIEFCKKHV  64

Query  219  EAAAEAKTNPEDAPAKD-TKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
             AAA      +D P +D  K +DA+F+KVD  TLFDLI+AAN+LNIK+LLDLT Q VADM
Sbjct  65   XAAAS-----DDKPTEDELKAWDADFVKVDQVTLFDLILAANYLNIKNLLDLTCQTVADM  119

Query  42   IK  37
            IK
Sbjct  120  IK  121



>ref|XP_008236029.1| PREDICTED: SKP1-like protein 1A [Prunus mume]
 ref|XP_008236030.1| PREDICTED: SKP1-like protein 1A [Prunus mume]
Length=157

 Score =   146 bits (369),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 101/137 (74%), Gaps = 11/137 (8%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            ++I L+S+DGE+FEVEE VALE  TIK M +D+CVDN IP+  + S ILA VIEYC+ HV
Sbjct  6    KIITLKSADGEIFEVEEAVALESQTIKHMAEDDCVDNAIPLPIVESHILAKVIEYCRKHV  65

Query  219  EAAAEAKTNPEDAPAKDT-KEFDANF---IKVDHNTLFDLIMAANFLNIKSLLDLTTQAV  52
            E AA    N E+   KDT K+F+ +F   IK D + LFD I+AAN+LNIKSLLDLT Q V
Sbjct  66   EFAA----NDEN---KDTVKKFNDDFVNEIKTDQSVLFDTILAANYLNIKSLLDLTCQTV  118

Query  51   ADMIKDMSPEEVRKIFN  1
            ADMIK  +PEE+RK FN
Sbjct  119  ADMIKGKTPEEIRKTFN  135



>emb|CDX73212.1| BnaC06g36600D [Brassica napus]
Length=161

 Score =   146 bits (369),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 97/136 (71%), Gaps = 3/136 (2%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            + I+L+SSD E FEV+E VA E  T+  M++D+C DN IP+ N+T KILA VIEYCK HV
Sbjct  4    KKIVLKSSDNESFEVDEAVARESQTLAHMVEDDCTDNGIPLPNVTGKILAKVIEYCKKHV  63

Query  219  EAAAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
            +AAA       D  A    D K +DA F+K+D  TLF+LI+AAN+LNIK+LLDLT Q VA
Sbjct  64   DAAAAKTEAAADGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  123

Query  48   DMIKDMSPEEVRKIFN  1
            DMIK  +P+E+R  FN
Sbjct  124  DMIKGKTPDEIRTTFN  139



>emb|CCG34083.1| SCF ubiquitin ligase [uncultured eukaryote]
Length=158

 Score =   146 bits (369),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 3/132 (2%)
 Frame = -2

Query  393  IMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVEA  214
            + L+SSD E+F+V E VA E  TIK MI+D    N IP+ N++SKIL+ VIEYCK+HVEA
Sbjct  7    VSLKSSDDELFDVTEAVAFESQTIKNMIEDTGTANAIPLPNVSSKILSKVIEYCKFHVEA  66

Query  213  AAEAKTNPEDAPAKD-TKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMIK  37
               A  + + A ++D  K +D  F+KVD  TLFDLI+AAN+LNIK+LLDLT Q VADMIK
Sbjct  67   QKPA--DEKSAISEDEIKTWDQEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADMIK  124

Query  36   DMSPEEVRKIFN  1
              +PEE+RK FN
Sbjct  125  GKTPEEIRKTFN  136



>ref|XP_006646753.1| PREDICTED: SKP1-like protein 1B-like [Oryza brachyantha]
 ref|XP_006646755.1| PREDICTED: SKP1-like protein 1B-like [Oryza brachyantha]
Length=167

 Score =   147 bits (370),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 102/141 (72%), Gaps = 11/141 (8%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI L+SSDGE FEVEE VA+E  TI+ MI+D+C DN IP+ N+ SKIL+ VIEYC  HV
Sbjct  8    KMITLKSSDGEEFEVEEAVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIEYCNKHV  67

Query  219  EAAAEAKTNPEDAPAK--------DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLT  64
             A+    +  +DAPA         D K +DA+F+KVD  TLFDLI+AAN+LNIK LLDLT
Sbjct  68   HAS---NSTSDDAPAPATNSTSADDLKNWDADFVKVDQATLFDLILAANYLNIKGLLDLT  124

Query  63   TQAVADMIKDMSPEEVRKIFN  1
             Q VADMIK  +PEE+RK FN
Sbjct  125  CQTVADMIKGKTPEEIRKTFN  145



>ref|XP_002947872.1| hypothetical protein VOLCADRAFT_73445 [Volvox carteri f. nagariensis]
 gb|EFJ50860.1| hypothetical protein VOLCADRAFT_73445 [Volvox carteri f. nagariensis]
Length=158

 Score =   146 bits (369),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 93/134 (69%), Gaps = 6/134 (4%)
 Frame = -2

Query  393  IMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVEA  214
            + L SSD +MFEV+E  A +  T+K +++D   D+ IP+ N++ +ILA VIEYCKYHVEA
Sbjct  6    VKLMSSDTQMFEVDEEAAFQSQTVKNLVEDAGTDDAIPLPNVSGRILAKVIEYCKYHVEA  65

Query  213  AAEAKTNPEDAPAK---DTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
                K   +D P K   + K +D  F+KVD  TLFDLI+AAN+LNIK LLDLT Q VA M
Sbjct  66   ---EKKGADDKPMKTEDEVKRWDEEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVAQM  122

Query  42   IKDMSPEEVRKIFN  1
            IK  +PEE+RK FN
Sbjct  123  IKGKTPEEIRKTFN  136



>gb|EMS53773.1| SKP1-like protein 1B [Triticum urartu]
Length=175

 Score =   147 bits (370),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 105/156 (67%), Gaps = 16/156 (10%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            M++ + K I++   L+SSDG+ FEVE+ VA+E   I+ MI+D+  DN + + N+ SKIL+
Sbjct  1    MAAAEGKKIIK---LKSSDGKEFEVEQAVAMESQMIRHMIEDDYTDNGLSLRNVDSKILS  57

Query  249  MVIEYCKYHVEA-------------AAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLI  109
            MVIEYC  HV+A             A+ A +    APA+  K +DANF+KVD  T+FDL+
Sbjct  58   MVIEYCNKHVQAKAVNTSEFGGGARASNATSAVPAAPAEYLKNWDANFVKVDKATIFDLM  117

Query  108  MAANFLNIKSLLDLTTQAVADMIKDMSPEEVRKIFN  1
            +AAN LNIK LLDLT Q VADM+   +PEE+RKIFN
Sbjct  118  LAANHLNIKGLLDLTCQTVADMMTGKTPEEIRKIFN  153



>ref|XP_010029649.1| PREDICTED: SKP1-like protein 1B [Eucalyptus grandis]
Length=155

 Score =   146 bits (368),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 95/133 (71%), Gaps = 6/133 (5%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            R + L SSDGE FEVE++VA+E  TIK  I++    N IP+  + SKILA VIEYCK HV
Sbjct  5    RKVTLLSSDGESFEVEQSVAVESITIKDSIEEGSAGNPIPVPKVNSKILAKVIEYCKKHV  64

Query  219  EAA-AEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            E+A AE + + ED  A     +DA+F+KVD  TLFDLI AANFLNIKSLLDLT Q VADM
Sbjct  65   ESAKAEDRVDDEDLVA-----WDADFVKVDQATLFDLIRAANFLNIKSLLDLTCQTVADM  119

Query  42   IKDMSPEEVRKIF  4
            IK  +PEE RK F
Sbjct  120  IKGKTPEEKRKTF  132



>gb|ABK21374.1| unknown [Picea sitchensis]
 gb|ABK26105.1| unknown [Picea sitchensis]
 gb|ABK26432.1| unknown [Picea sitchensis]
Length=158

 Score =   146 bits (368),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 3/132 (2%)
 Frame = -2

Query  393  IMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHVEA  214
            + L+SSD E+F+V E VA E  TIK MI+D    + IP+ N++SKIL+ VIEYCKYHVEA
Sbjct  7    VSLKSSDDELFDVNEAVAFESQTIKNMIEDTGTASAIPLPNVSSKILSKVIEYCKYHVEA  66

Query  213  AAEAKTNPEDAPAKD-TKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVADMIK  37
               A  + + A ++D  K +D  F+KVD  TLFDLI+AAN+LNIK+LLDLT Q VADMIK
Sbjct  67   QKPA--DEKSAISEDEIKTWDQEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADMIK  124

Query  36   DMSPEEVRKIFN  1
              +PEE+RK FN
Sbjct  125  GKTPEEIRKTFN  136



>ref|XP_010113308.1| SKP1-like protein 1A [Morus notabilis]
 gb|EXC35315.1| SKP1-like protein 1A [Morus notabilis]
Length=163

 Score =   146 bits (368),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 102/145 (70%), Gaps = 6/145 (4%)
 Frame = -2

Query  429  MSSPKSKSIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILA  250
            MS+  SK IV    LRSSDGE FEVEE VAL+  TIK M++D   D+ IP+ N+TS+IL+
Sbjct  1    MSTSSSKKIV----LRSSDGESFEVEEAVALQSQTIKHMVEDVSDDSAIPLPNVTSRILS  56

Query  249  MVIEYCKYHVEAAAEAKTNPEDAPA--KDTKEFDANFIKVDHNTLFDLIMAANFLNIKSL  76
             VIEYC  H +A++ A  +     +   D K +DA F+KVD  TLFDLI+AAN+LNIK+L
Sbjct  57   KVIEYCNRHSDASSSASASASAGASDDNDLKSWDAEFVKVDQATLFDLILAANYLNIKNL  116

Query  75   LDLTTQAVADMIKDMSPEEVRKIFN  1
            LDLT Q VADMIK  +PEE+R  FN
Sbjct  117  LDLTCQTVADMIKGKTPEEIRSTFN  141



>gb|KFK36059.1| hypothetical protein AALP_AA4G072500 [Arabis alpina]
Length=151

 Score =   145 bits (367),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 98/134 (73%), Gaps = 10/134 (7%)
 Frame = -2

Query  399  RMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCKYHV  220
            +MI+L+S DGE+FE+EE VAL+  TI  M++D+CV+N IPI+N+T +ILA VIEYCK HV
Sbjct  5    KMIVLKSFDGEIFEIEEAVALQSQTIAHMVEDDCVENGIPISNVTGEILAKVIEYCKKHV  64

Query  219  EAAAEAKTNPEDAPAKDTKEFDANFIK-VDHNTLFDLIMAANFLNIKSLLDLTTQAVADM  43
            +              ++ K +D  F+K +D +TLF+LI+AAN+LNIK+LLD T Q VADM
Sbjct  65   DGG---------GSEEELKTWDEEFMKNIDQSTLFNLILAANYLNIKTLLDFTCQTVADM  115

Query  42   IKDMSPEEVRKIFN  1
            IK  +PE++R+ FN
Sbjct  116  IKGKTPEQIRETFN  129



>ref|XP_003605510.1| SKP1-like protein [Medicago truncatula]
 gb|AES87707.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=175

 Score =   146 bits (369),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 97/137 (71%), Gaps = 5/137 (4%)
 Frame = -2

Query  408  SIVRMIMLRSSDGEMFEVEETVALEMHTIKCMIDDECVDNTIPITNITSKILAMVIEYCK  229
            S  + I L+S DGE F++EE VALE  TIK +IDD   D  IPI N+T KILA VIEYCK
Sbjct  21   SSAKKITLKSYDGETFDIEEAVALESQTIKHLIDDVSDDTGIPIPNVTGKILAKVIEYCK  80

Query  228  YHVEAAAEAKTNPEDAPAKDTKEFDANFIKVDHNTLFDLIMAANFLNIKSLLDLTTQAVA  49
             HVE A   +  PED    + K++DA F++VD  TLFDLI+AAN+LNIKSLLDLT ++VA
Sbjct  81   KHVEYARSNEKPPED----ELKKWDAEFVQVDQETLFDLILAANYLNIKSLLDLTCKSVA  136

Query  48   D-MIKDMSPEEVRKIFN  1
            D M+   +PE +R+ FN
Sbjct  137  DMMLAAKTPEAIRETFN  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506240637208