BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84522_g1_i1 len=498 path=[1:0-497]

Length=498
                                                                      Score     E

ref|XP_008371252.1|  PREDICTED: putative ribonuclease H protein A...  64.7    6e-10   
ref|XP_008362461.1|  PREDICTED: putative ribonuclease H protein A...  63.9    7e-10   
ref|XP_008391104.1|  PREDICTED: putative ribonuclease H protein A...  62.4    2e-08   
ref|XP_003604713.1|  hypothetical protein MTR_4g016830                57.8    6e-08   
ref|XP_007224107.1|  hypothetical protein PRUPE_ppa015647mg           57.4    9e-08   
ref|XP_006492639.1|  PREDICTED: putative ribonuclease H protein A...  60.5    1e-07   
ref|XP_008224632.1|  PREDICTED: putative ribonuclease H protein A...  57.8    1e-07   
ref|XP_010681897.1|  PREDICTED: uncharacterized protein LOC104896802  57.0    2e-07   
ref|XP_004293144.1|  PREDICTED: putative ribonuclease H protein A...  58.2    3e-07   
ref|XP_008220870.1|  PREDICTED: putative ribonuclease H protein A...  57.4    4e-07   
ref|XP_010694338.1|  PREDICTED: uncharacterized protein LOC104907148  55.8    7e-07   
ref|XP_002304990.2|  hypothetical protein POPTR_0004s03265g           55.8    7e-07   Populus trichocarpa [western balsam poplar]
ref|XP_004306073.1|  PREDICTED: putative ribonuclease H protein A...  55.5    8e-07   
dbj|BAE79384.1|  unnamed protein product                              58.2    8e-07   Ipomoea batatas [batate]
ref|XP_007216426.1|  hypothetical protein PRUPE_ppa022108mg           55.1    8e-07   
dbj|BAE79382.1|  unnamed protein product                              57.8    9e-07   Ipomoea batatas [batate]
ref|XP_004301710.1|  PREDICTED: uncharacterized protein LOC101290873  55.1    9e-07   
ref|XP_008221992.1|  PREDICTED: uncharacterized protein LOC103321917  57.4    9e-07   
ref|XP_008354555.1|  PREDICTED: putative ribonuclease H protein A...  57.0    1e-06   
ref|WP_039743550.1|  hypothetical protein                             54.3    1e-06   
ref|XP_003543094.1|  PREDICTED: putative ribonuclease H protein A...  54.7    2e-06   
ref|XP_002514383.1|  nuclease, putative                               53.5    2e-06   Ricinus communis
dbj|BAE79385.1|  unnamed protein product                              55.8    4e-06   Ipomoea batatas [batate]
ref|XP_010241360.1|  PREDICTED: uncharacterized protein LOC104585986  54.7    4e-06   
ref|XP_004292485.1|  PREDICTED: putative ribonuclease H protein A...  53.1    7e-06   
ref|XP_010254588.1|  PREDICTED: uncharacterized protein LOC104595...  54.7    7e-06   
ref|XP_010254587.1|  PREDICTED: uncharacterized protein LOC104595...  54.3    7e-06   
ref|WP_029747740.1|  MULTISPECIES: hypothetical protein               51.6    8e-06   
ref|XP_010686169.1|  PREDICTED: uncharacterized protein LOC104900451  51.2    1e-05   
ref|XP_003627699.1|  hypothetical protein MTR_8g036680                50.8    2e-05   
gb|KHN47376.1|  Heat shock 70 kDa protein                             53.5    2e-05   
ref|YP_006666138.1|  RnaseH                                           51.2    2e-05   
ref|XP_008239854.1|  PREDICTED: putative ribonuclease H protein A...  52.8    3e-05   
ref|XP_002512143.1|  conserved hypothetical protein                   50.8    3e-05   Ricinus communis
ref|XP_007224782.1|  hypothetical protein PRUPE_ppa023938mg           50.8    3e-05   
ref|XP_007214110.1|  hypothetical protein PRUPE_ppa017108mg           51.2    4e-05   
ref|XP_003595180.1|  hypothetical protein MTR_2g039350                50.1    4e-05   
gb|ABN06159.1|  Polynucleotidyl transferase, Ribonuclease H fold      52.0    4e-05   Medicago truncatula
gb|KHN28455.1|  Putative ribonuclease H protein                       50.1    4e-05   
ref|XP_004305448.1|  PREDICTED: putative ribonuclease H protein A...  50.4    4e-05   
ref|XP_007050978.1|  Uncharacterized protein TCM_004691               51.2    5e-05   
ref|XP_008245516.1|  PREDICTED: putative ribonuclease H protein A...  50.8    5e-05   
gb|ABN09176.1|  Polynucleotidyl transferase, Ribonuclease H fold      51.6    5e-05   Medicago truncatula
ref|XP_009788843.1|  PREDICTED: uncharacterized protein LOC104236586  49.3    5e-05   
ref|XP_009805051.1|  PREDICTED: uncharacterized protein LOC104250178  51.2    5e-05   
ref|XP_010674097.1|  PREDICTED: uncharacterized protein LOC104890348  49.3    5e-05   
ref|XP_008222990.1|  PREDICTED: putative ribonuclease H protein A...  51.6    5e-05   
sp|P0C2F6.1|RNHX1_ARATH  RecName: Full=Putative ribonuclease H pr...  52.0    6e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAF23831.1|AC007234_3  F1E22.12                                    52.0    6e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB09192.1|  non-LTR retroelement reverse transcriptase-like ...  51.2    8e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003602374.1|  hypothetical protein MTR_3g092650                50.1    8e-05   
ref|XP_009121276.1|  PREDICTED: putative ribonuclease H protein A...  50.4    9e-05   
ref|XP_007210921.1|  hypothetical protein PRUPE_ppb019242mg           49.7    9e-05   
ref|XP_006605069.1|  PREDICTED: putative ribonuclease H protein A...  49.3    1e-04   
gb|KHN06921.1|  Heat shock 70 kDa protein                             51.2    1e-04   
ref|XP_007037560.1|  Uncharacterized protein TCM_014255               51.2    1e-04   
ref|XP_003604047.1|  hypothetical protein MTR_3g117930                48.1    1e-04   
emb|CAN72157.1|  hypothetical protein VITISV_019020                   50.8    1e-04   Vitis vinifera
ref|XP_006582491.1|  PREDICTED: uncharacterized protein LOC102662580  51.2    1e-04   
ref|WP_034407052.1|  hypothetical protein                             48.5    1e-04   
ref|XP_007226764.1|  hypothetical protein PRUPE_ppa018732mg           50.8    1e-04   
ref|XP_008229469.1|  PREDICTED: putative ribonuclease H protein A...  50.4    1e-04   
gb|KHN39964.1|  HVA22-like protein a                                  50.4    1e-04   
ref|XP_010667308.1|  PREDICTED: uncharacterized protein LOC104884364  50.8    1e-04   
ref|XP_004287420.1|  PREDICTED: uncharacterized protein LOC101302388  50.4    1e-04   
ref|XP_004293164.1|  PREDICTED: putative ribonuclease H protein A...  49.7    1e-04   
ref|XP_003544251.1|  PREDICTED: uncharacterized protein LOC100787629  50.4    2e-04   
ref|XP_006596723.1|  PREDICTED: uncharacterized protein LOC102662959  50.8    2e-04   
ref|XP_004294412.1|  PREDICTED: uncharacterized protein LOC101292780  50.1    2e-04   
ref|XP_007141283.1|  hypothetical protein PHAVU_008G183100g           50.1    2e-04   
gb|AAF97302.1|AC007843_5  Hypothetical protein                        49.7    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002527364.1|  conserved hypothetical protein                   50.1    2e-04   Ricinus communis
ref|XP_008219298.1|  PREDICTED: uncharacterized protein LOC103319525  50.1    2e-04   
gb|AAF79490.1|AC022492_34  F1L3.4                                     49.7    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009586778.1|  PREDICTED: putative ribonuclease H protein A...  48.9    2e-04   
ref|XP_006468253.1|  PREDICTED: uncharacterized protein LOC102614777  49.7    2e-04   
ref|XP_011016191.1|  PREDICTED: uncharacterized protein LOC105119...  50.1    2e-04   
ref|XP_011016192.1|  PREDICTED: uncharacterized protein LOC105119...  50.1    2e-04   
ref|XP_010278072.1|  PREDICTED: uncharacterized protein LOC104612377  48.9    2e-04   
ref|XP_010045599.1|  PREDICTED: uncharacterized protein LOC104434358  50.1    2e-04   
gb|KHE91828.1|  ribonuclease H                                        48.9    3e-04   
gb|AID60103.1|  hypothetical protein                                  50.1    3e-04   
ref|XP_008221720.1|  PREDICTED: putative ribonuclease H protein A...  49.3    3e-04   
ref|XP_009147282.1|  PREDICTED: putative ribonuclease H protein A...  49.3    3e-04   
gb|ABO80474.1|  Polynucleotidyl transferase, Ribonuclease H fold      47.4    3e-04   Medicago truncatula
ref|XP_003623945.1|  Trypsin/chymotrypsin inhibitor                   49.7    3e-04   
ref|XP_006475107.1|  PREDICTED: putative ribonuclease H protein A...  49.3    3e-04   
ref|XP_006605138.1|  PREDICTED: uncharacterized protein LOC100808063  50.1    3e-04   
gb|AAD22368.1|  putative non-LTR retroelement reverse transcriptase   49.3    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008233465.1|  PREDICTED: putative ribonuclease H protein A...  49.7    3e-04   
ref|XP_010666799.1|  PREDICTED: uncharacterized protein LOC104883921  47.8    3e-04   
ref|XP_006590228.1|  PREDICTED: uncharacterized protein LOC102661449  49.7    3e-04   
ref|WP_015676147.1|  ribonuclease HI                                  47.4    3e-04   
ref|XP_008349430.1|  PREDICTED: uncharacterized protein LOC103412666  47.8    3e-04   
ref|XP_010686862.1|  PREDICTED: uncharacterized protein LOC104901018  47.4    4e-04   
ref|XP_007147977.1|  hypothetical protein PHAVU_006G170300g           49.3    5e-04   
ref|XP_002524970.1|  conserved hypothetical protein                   47.0    5e-04   Ricinus communis
gb|EEC68711.1|  hypothetical protein OsI_37193                        49.3    5e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_008227007.1|  PREDICTED: uncharacterized protein LOC103326548  48.9    5e-04   
emb|CDY23510.1|  BnaC06g24790D                                        48.9    5e-04   
ref|XP_008219669.1|  PREDICTED: uncharacterized protein LOC103319850  48.9    5e-04   
gb|EEE52627.1|  hypothetical protein OsJ_34967                        49.3    5e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009138589.1|  PREDICTED: putative ribonuclease H protein A...  48.9    5e-04   
ref|XP_009775459.1|  PREDICTED: uncharacterized protein LOC104225380  48.9    6e-04   
ref|XP_004146631.1|  PREDICTED: putative ribonuclease H protein A...  48.1    6e-04   
ref|XP_003596206.1|  hypothetical protein MTR_2g071530                46.6    6e-04   
ref|XP_009607451.1|  PREDICTED: uncharacterized protein LOC104101668  48.5    7e-04   
ref|XP_004490492.1|  PREDICTED: uncharacterized protein LOC101492718  48.5    7e-04   
ref|XP_008383873.1|  PREDICTED: putative ribonuclease H protein A...  48.5    7e-04   
ref|XP_004305696.1|  PREDICTED: putative ribonuclease H protein A...  46.2    7e-04   
ref|XP_007216502.1|  hypothetical protein PRUPE_ppa024040mg           46.2    8e-04   
gb|KHF99723.1|  HVA22-like protein a                                  48.1    8e-04   
ref|WP_004784785.1|  ribonuclease HI                                  46.2    8e-04   
ref|XP_010681975.1|  PREDICTED: uncharacterized protein LOC104896887  45.8    8e-04   
ref|XP_004305757.1|  PREDICTED: putative ribonuclease H protein A...  48.1    8e-04   
ref|XP_003624960.1|  hypothetical protein MTR_7g089450                45.4    8e-04   
ref|XP_007219947.1|  hypothetical protein PRUPE_ppb019489mg           48.1    9e-04   
gb|KCW83711.1|  hypothetical protein EUGRSUZ_B00585                   48.1    0.001   
ref|XP_004306245.1|  PREDICTED: uncharacterized protein LOC101310543  47.0    0.001   



>ref|XP_008371252.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=212

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 70/131 (53%), Gaps = 3/131 (2%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDS-MSIVKALNQNGTVDNVARN  282
            GFT ++G  S+  AE W L  G+ LA  L ++KV  E DS M++   ++ N ++  +A +
Sbjct  83   GFTINIGVGSVLNAELWGLYHGLTLAWRLGYRKVLVELDSVMAVTLIMDFNSSMHPLA-H  141

Query  281  IIHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDR  105
            +I AC   L      +VS+  RE+NR  + +A L      GL ++   P ++ + I ED 
Sbjct  142  LITACRELLRKDWICSVSHVYREKNRVVDGMAALGHKFDIGLHVFYEPPPLVDRLIFEDA  201

Query  104  FGLPVWRQMDS  72
             G P  R ++S
Sbjct  202  VGFPHTRFVNS  212



>ref|XP_008362461.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=164

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 69/126 (55%), Gaps = 7/126 (6%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDS-MSIVKALNQNGTVDNVARN  282
            GFT ++G  S+   E W LL G+ LA+ L ++KV  E DS +++   ++ N ++D +A +
Sbjct  24   GFTINIGVGSVLNVELWGLLHGLSLALRLGYRKVFVEMDSVIAVTLVMDFNSSMDPLA-H  82

Query  281  IIHACNRELSNIANW--TVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEE  111
            +I AC REL    +W  +VS+  RE NR    +  L      GL ++   P ++ + I E
Sbjct  83   LITAC-RELLR-RDWICSVSHVYRENNRVTAGMTNLGHKFDIGLHVFYEPPPLVDRLIFE  140

Query  110  DRFGLP  93
            D  G P
Sbjct  141  DVVGFP  146



>ref|XP_008391104.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=359

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 65/124 (52%), Gaps = 3/124 (2%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDS-MSIVKALNQNGTVDNVARN  282
            GFT ++G  S+   E W LL G+ LA+ L ++KV  E DS +++   ++ N ++D +A +
Sbjct  227  GFTINIGVGSVLNVELWGLLHGLSLALRLGYRKVFVEMDSVIAVTLVMDFNSSMDPLA-H  285

Query  281  IIHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDR  105
            +I AC   L      +VS+  RE NR    +  L      GL ++   P ++ + I ED 
Sbjct  286  LITACRELLRRDWICSVSHVYRENNRVTAGMTNLGHKFDIGLHVFYEPPPLVDRLIFEDV  345

Query  104  FGLP  93
             G P
Sbjct  346  VGFP  349



>ref|XP_003604713.1| hypothetical protein MTR_4g016830 [Medicago truncatula]
Length=108

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = -2

Query  419  AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIAN  240
            AEA AL + I+LAISL ++ V FE+D M++  A++      N   +II  C   L    +
Sbjct  6    AEATALSEAIKLAISLGFQTVRFETDCMTLADAIHTTSAHLNEVGDIISQCRGLLFTNTD  65

Query  239  WTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQTIEE  111
            + VSY  R+ NR A+ +AR   +     ++ + P  L+  + E
Sbjct  66   FKVSYIRRQANRVAHSIARASLSHLSPHLFYSVPSTLLLFVFE  108



>ref|XP_007224107.1| hypothetical protein PRUPE_ppa015647mg, partial [Prunus persica]
 gb|EMJ25306.1| hypothetical protein PRUPE_ppa015647mg, partial [Prunus persica]
Length=140

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 58/118 (49%), Gaps = 1/118 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF   +G  SI  AE W + +G+ L  +   +++  E DS++ V  +N     ++   +I
Sbjct  11   GFVTKLGCGSILEAELWGVFRGLLLTWNEGIRRIQMECDSLTAVSLINGETGTNHPLSSI  70

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEED  108
            IH C   L      T+ +  REQN AA+ +A L  ++S G  + D  P  ++  +  D
Sbjct  71   IHCCKDLLLRDWECTIYHIYREQNSAADHMAHLGQNSSLGFHVIDLPPPSIVSLLAND  128



>ref|XP_006492639.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=569

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF   +G+CSI  AE W L +G+QLA +   +K+  E DS+ +++ + +     N    +
Sbjct  375  GFGMMIGSCSITVAELWGLYQGLQLAWNSGIRKLQVEIDSLCVLQLVTKPSLEINHYAPL  434

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDRF  102
            I A    L      ++S+  RE N AA+ +A L      GL IY T P  +   + +D +
Sbjct  435  IQAIKDYLKMDWQVSISHIYREANFAADYMANLAFSIPLGLAIYHTPPLGVKSFLFKDVY  494

Query  101  GL  96
            G+
Sbjct  495  GM  496



>ref|XP_008224632.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=204

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF+ ++G   +  AEAWAL  G+ LA  L  +++   SDS  +V  +N +    +    +
Sbjct  75   GFSANLGHGEVFVAEAWALYYGLNLAWQLGLRQIMVNSDSALVVDMINGDWVDSHPMAVL  134

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDRF  102
            +  C   L N  N  V +  RE N AA+ LA+L      G     + P++L   +++D+ 
Sbjct  135  LTKCKELLKNQWNCCVLHVYRETNFAADFLAKLGGHMDLGYHELSSPPDLLQPILDDDKN  194

Query  101  GL  96
            GL
Sbjct  195  GL  196



>ref|XP_010681897.1| PREDICTED: uncharacterized protein LOC104896802 [Beta vulgaris 
subsp. vulgaris]
Length=184

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 62/115 (54%), Gaps = 1/115 (1%)
 Frame = -2

Query  431  SIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELS  252
            SI  AEAW L +GI+ A+ L  KK+  E D++S+++A+ +   +     N+IH    +LS
Sbjct  65   SILVAEAWGLREGIRGALFLGIKKIHIEGDNLSVIQAIKRIWKIPWSIFNLIHDAIIDLS  124

Query  251  NIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQT-IEEDRFGLPV  90
               +  + +  RE N AA+ +A    ++  LK Y T  ++   + I +D  G PV
Sbjct  125  KFEDVVIHHVYREANCAADWMAHEGHSTPSLKYYFTNLDLSFSSIIRKDALGWPV  179



>ref|XP_004293144.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=321

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 66/123 (54%), Gaps = 3/123 (2%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVD-NVARN  282
            GF  ++GA  +  AEAW L  GIQLA S+K  K+  ESDS+ +V  L QN  +D +    
Sbjct  188  GFMVNIGAGEVLQAEAWGLFYGIQLAFSMKIPKLEIESDSVVLVNLL-QNSDMDVHPLGT  246

Query  281  IIHACNRELSNIANWTVSYAPREQNRAANCLARLLD-TSTGLKIYDTAPEVLMQTIEEDR  105
            I+  C   + +     + +  +E+N  A+ LA+     + G+ I++  P+++   + +D 
Sbjct  247  IVLNCRAMMQHFDFVQIKHIHKERNMVADLLAKNSPLNAKGICIFNEPPDLVTNALLDDI  306

Query  104  FGL  96
             G+
Sbjct  307  VGV  309



>ref|XP_008220870.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=264

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (50%), Gaps = 2/123 (2%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVD-NVARN  282
            GF  ++G   I  AE W L  G++LAI    KK+  E DS + ++ +    +++ +    
Sbjct  133  GFVVNLGQGQILEAELWGLFFGLKLAIGKGVKKLLVEMDSATTIRLIQCKESLEAHPLAG  192

Query  281  IIHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDR  105
            ++  C   LS +    V +  RE+N AA+CLA L  +   G+   D AP  L   + +D 
Sbjct  193  LLDCCREMLSQLDCVEVHHIFREKNFAADCLANLSYNMGLGVWFLDEAPSCLGSILIDDS  252

Query  104  FGL  96
             G+
Sbjct  253  LGV  255



>ref|XP_010694338.1| PREDICTED: uncharacterized protein LOC104907148 [Beta vulgaris 
subsp. vulgaris]
Length=200

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 67/131 (51%), Gaps = 11/131 (8%)
 Frame = -2

Query  452  TYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIH  273
            T+++G  S+  AEA AL +G++LA+SL  + +  E D++ ++K++           NII 
Sbjct  74   TFNLGQYSVIIAEATALHQGLRLAVSLGLQNIIIEGDNLLVIKSIQNVWPTPWKIANIIA  133

Query  272  ACNRELSNIANWTVSYAPREQNRAANCL---ARLLDTSTGLKIYDTAP---EVLMQTIEE  111
             C   L++ A + + +  RE NRAA+ +     L+D+      +D  P     L   I  
Sbjct  134  DCKILLTHFAKYEIRHVFREANRAADRITNVGHLVDSK-----FDVTPCNNSALNSIIVI  188

Query  110  DRFGLPVWRQM  78
            D  G+P  R++
Sbjct  189  DALGIPFERRV  199



>ref|XP_002304990.2| hypothetical protein POPTR_0004s03265g [Populus trichocarpa]
 gb|EEE85501.2| hypothetical protein POPTR_0004s03265g [Populus trichocarpa]
Length=202

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 64/129 (50%), Gaps = 4/129 (3%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTV--DNVAR  285
            G+   +G  +   AE  AL +G++L +   W  V  E DS S+V  + +   V      R
Sbjct  74   GYAEPIGGTTSTIAELAALRRGLELVLENGWSNVWLEGDSKSLVDIIVKRKQVRCKEAQR  133

Query  284  NIIHACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIY-DTAPEVLMQTIEED  108
             + H  N  +  + N  V++  RE NRAA+ LAR+       KI+ D  P+ +++ + ED
Sbjct  134  QVSH-INLIMPELQNCVVTHVFREGNRAADKLARIGHQLQKPKIWRDIPPDDILRIVHED  192

Query  107  RFGLPVWRQ  81
              G  V+R+
Sbjct  193  AKGKIVFRR  201



>ref|XP_004306073.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=187

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 58/108 (54%), Gaps = 1/108 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF  ++G C+I  AEAWAL  G++LA  L    +  ESDS  +V+ +N +    +   ++
Sbjct  38   GFQINLGVCAILDAEAWALFHGLKLASKLHISCLEIESDSAILVQLMNCSNLSSHPLGSL  97

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAP  138
            +  C+  ++ + +  + +  RE N  A+ LA+  +    GL I++  P
Sbjct  98   LGGCSSMMTEMDDVKLFHIFREANMTADSLAKCSISNELGLIIFEDPP  145



>dbj|BAE79384.1| unnamed protein product [Ipomoea batatas]
Length=1898

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 65/122 (53%), Gaps = 1/122 (1%)
 Frame = -2

Query  458   GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
             G+T ++G  +   AE W L +G+ LA +  + K+  E+DS ++V+ L ++G V   A  +
Sbjct  1771  GYTCNIGTANSFLAELWGLREGLLLAKNRGFTKLIAETDSEAVVQVLRKDGPVTPDASIL  1830

Query  278   IHACNRELSNIANWTVSYAPREQNRAANCLARLLDTST-GLKIYDTAPEVLMQTIEEDRF  102
             +  C   L +     V++  RE N+ A+ LA L  +S+ G  I +  P+ L   ++ D  
Sbjct  1831  VKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQRDAI  1890

Query  101   GL  96
             GL
Sbjct  1891  GL  1892



>ref|XP_007216426.1| hypothetical protein PRUPE_ppa022108mg [Prunus persica]
 gb|EMJ17625.1| hypothetical protein PRUPE_ppa022108mg [Prunus persica]
Length=154

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            G++ ++G  S+  AE W +  G+ LA +  ++ V  ESDS   V  L+      ++  NI
Sbjct  25   GYSVNLGIGSVLEAELWGIFWGLSLAWNFGFRTVEVESDSKVAVILLDSLTISTHLLFNI  84

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCL-ARLLDTSTGLKIYDTAPEVLMQTIEEDRF  102
            I+ C  ++ +  N +V +  R+QN A + L A   D ++GL I+D  P  +   +  +  
Sbjct  85   INCCKLKMGDDWNCSVRHIFRQQNCATDALAANSFDFNSGLHIFDEMPACITDILAANTR  144

Query  101  G  99
            G
Sbjct  145  G  145



>dbj|BAE79382.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 65/122 (53%), Gaps = 1/122 (1%)
 Frame = -2

Query  458   GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
             G+T ++G  +   AE W L +G+ LA +  + K+  E+DS ++V+ L ++G V   A  +
Sbjct  1239  GYTCNIGTANSFLAELWGLREGLLLAKNRGFTKLIAETDSEAVVQVLRKDGPVTPDASIL  1298

Query  278   IHACNRELSNIANWTVSYAPREQNRAANCLARLLDTST-GLKIYDTAPEVLMQTIEEDRF  102
             +  C   L +     V++  RE N+ A+ LA L  +S+ G  I +  P+ L   ++ D  
Sbjct  1299  VKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQRDAI  1358

Query  101   GL  96
             GL
Sbjct  1359  GL  1360



>ref|XP_004301710.1| PREDICTED: uncharacterized protein LOC101290873 [Fragaria vesca 
subsp. vesca]
Length=169

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 64/127 (50%), Gaps = 10/127 (8%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            G    V A S++A EA A+L G+ LA+ +  K V  +SDS S++  LN   T +N   N+
Sbjct  41   GLASLVRASSVEAVEALAILAGVNLAVDMNMKAVQVQSDSQSVISDLNSIATCNNWRTNL  100

Query  278  ----IHACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIY-DTAPEVLMQTIE  114
                I   +R    + +W   + PRE N AA+  A+L     GL I+ +T P  L   + 
Sbjct  101  IVEEIKWKSRYFDRV-HW--RWIPREANSAAHTAAQLGKQVLGLCIWSETPPPSLTMVLR  157

Query  113  EDRFGLP  93
             D  GLP
Sbjct  158  ND--GLP  162



>ref|XP_008221992.1| PREDICTED: uncharacterized protein LOC103321917 [Prunus mume]
Length=658

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 61/121 (50%), Gaps = 1/121 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF+ ++G  +I  AE W+L +G+ +A     + +  E DS+S+V  + +     +    +
Sbjct  529  GFSANIGIGNIYEAELWSLFRGLHMAWDKGIRSLDIECDSLSVVSLIAKACNHSHPLFCL  588

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDRF  102
            I  C   L       VS+  R+QNR A+ LA L  +   GL IY++AP  L   + +D  
Sbjct  589  IEDCKLLLKRNWRCNVSHIYRKQNRVADHLANLGYELPLGLHIYESAPISLSSFLLDDEL  648

Query  101  G  99
            G
Sbjct  649  G  649



>ref|XP_008354555.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=426

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 3/124 (2%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVK-ALNQNGTVDNVARN  282
            GFT ++G  S+   E W LL G+ LA+ L ++KV  E DS+  V   ++ N ++D +A +
Sbjct  294  GFTINIGVGSVLNXELWGLLHGLSLALRLGYRKVFVEMDSVXAVTLVMDFNSSMDPLA-H  352

Query  281  IIHACNRELSNIANWTVSYAPREQNRAANCLARLLDT-STGLKIYDTAPEVLMQTIEEDR  105
            +I AC   L      +VS+  RE NR    +  L      GL ++        + I ED 
Sbjct  353  LITACRELLXRDWICSVSHVYRENNRVTXGMXNLGHKFDIGLHVFYEXXXXXDRLIFEDV  412

Query  104  FGLP  93
             G P
Sbjct  413  VGFP  416



>ref|WP_039743550.1| hypothetical protein, partial [Marinimicrobia bacterium SCGC 
AAA076-M08]
Length=127

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 52/92 (57%), Gaps = 1/92 (1%)
 Frame = -2

Query  455  FTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNII  276
            F  +VG C+ + AE  AL++GI+L I  K   V    DS  IV+ +N +  V N     +
Sbjct  31   FAENVGDCTNNEAEYLALIRGIELCIEKKILDVNIFCDSELIVRQVNGDYKVKNERMIKL  90

Query  275  HACNRELSNI-ANWTVSYAPREQNRAANCLAR  183
            HA   +L +I  NWTVS+  RE+N  A+ L++
Sbjct  91   HARTIDLCSILENWTVSHVMREKNTEADLLSK  122



>ref|XP_003543094.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
 gb|KHN19096.1| Putative ribonuclease H protein [Glycine soja]
Length=201

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 64/128 (50%), Gaps = 3/128 (2%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTV--DNVAR  285
            G+  S+G  +   AE  AL KG++L +   W  +  E D+ ++V+ + +   V    V R
Sbjct  73   GYAESIGQANSTIAELTALRKGLELVLENGWNDIWLEGDAKTLVEIIVKRRKVRCTEVQR  132

Query  284  NIIHACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQTIEEDR  105
            +I H  N  L    N+ VS+  RE NRAA+  A++       +I+   P+ L+  + ED 
Sbjct  133  HINH-INTILPEFNNFFVSHIYREGNRAADKFAQMGHHLDQPRIWRHPPDELLAQLLEDA  191

Query  104  FGLPVWRQ  81
             G  V R+
Sbjct  192  QGKTVLRR  199



>ref|XP_002514383.1| nuclease, putative [Ricinus communis]
 gb|EEF47979.1| nuclease, putative [Ricinus communis]
Length=145

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 47/94 (50%), Gaps = 0/94 (0%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF   +GAC    AE WA L+GI LA S     +  E DS  +   +N+     ++  N+
Sbjct  35   GFVIHIGACDPVGAELWAFLQGISLAWSKGIHNLIVEVDSSLVADWMNKKSVCKSIHANL  94

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARLL  177
            + AC   L N  +  + +  RE N+ A+ LA ++
Sbjct  95   VSACLDLLQNWWDVKIKHVFREMNQVADSLANIV  128



>dbj|BAE79385.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 64/122 (52%), Gaps = 1/122 (1%)
 Frame = -2

Query  458   GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
             G+  ++G  +   AE W L +G+ LA +  + K+  E+DS ++V+ L ++G V   A  +
Sbjct  1239  GYICNIGTANSFLAELWGLREGLLLAKNRGFTKLIAETDSEAVVQVLRKDGPVTPDASIL  1298

Query  278   IHACNRELSNIANWTVSYAPREQNRAANCLARLLDTST-GLKIYDTAPEVLMQTIEEDRF  102
             +  C   L +     V++  RE N+ A+ LA L  +S+ G  I +  P+ L   ++ D  
Sbjct  1299  VKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQRDAI  1358

Query  101   GL  96
             GL
Sbjct  1359  GL  1360



>ref|XP_010241360.1| PREDICTED: uncharacterized protein LOC104585986 [Nelumbo nucifera]
Length=265

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 57/113 (50%), Gaps = 1/113 (1%)
 Frame = -2

Query  443  VGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQ-NGTVDNVARNIIHAC  267
            V A S    EA+AL +GI+LA+ L    + FE D+  ++ +L + N       R ++ +C
Sbjct  147  VEANSASTTEAFALFEGIKLALQLDLNLIIFEGDAKILIDSLLEINPNPPWSLRVLLSSC  206

Query  266  NRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQTIEED  108
               L  + +++V++ PR  N+ A+ LAR   + +  K + + P  L      D
Sbjct  207  KNLLDRLPDYSVTFTPRSGNKVAHKLARFALSCSSPKTWSSCPNFLKDIFSSD  259



>ref|XP_004292485.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=207

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 57/108 (53%), Gaps = 2/108 (2%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF  ++G  +IDA EAW L  G++LA +L   K+  ESDS  +V  +       +   ++
Sbjct  75   GFQINLGVGAIDA-EAWGLFHGLKLASNLHISKLEIESDSAILVHLMKSANLSLHPLGSL  133

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAP  138
            ++ C   +S + +  +S+  RE N  A+ LA+  +    GL +++  P
Sbjct  134  LNGCKSMMSQMDDVKLSHVFRESNMTADVLAKCSISNDLGLILFEEPP  181



>ref|XP_010254588.1| PREDICTED: uncharacterized protein LOC104595530 isoform X2 [Nelumbo 
nucifera]
Length=414

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (52%), Gaps = 1/112 (1%)
 Frame = -2

Query  431  SIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELS  252
             I + E WA+ +G+ LA+    K +  ESDSMS+VK +N+       A + +      L 
Sbjct  296  GIFSLELWAVWRGLVLALGQGIKDIWVESDSMSVVKVINKEWPHPQKAGSCLKHIWEMLR  355

Query  251  NIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDT-APEVLMQTIEEDRFG  99
                + VS++ RE NRAA+ LAR+   S  + ++    P  L+  I+ED  G
Sbjct  356  KFDKYRVSHSWREANRAADHLARMDLPSNDVVLWPVDFPVSLVDIIKEDALG  407



>ref|XP_010254587.1| PREDICTED: uncharacterized protein LOC104595530 isoform X1 [Nelumbo 
nucifera]
Length=435

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (52%), Gaps = 1/112 (1%)
 Frame = -2

Query  431  SIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELS  252
             I + E WA+ +G+ LA+    K +  ESDSMS+VK +N+       A + +      L 
Sbjct  317  GIFSLELWAVWRGLVLALGQGIKDIWVESDSMSVVKVINKEWPHPQKAGSCLKHIWEMLR  376

Query  251  NIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDT-APEVLMQTIEEDRFG  99
                + VS++ RE NRAA+ LAR+   S  + ++    P  L+  I+ED  G
Sbjct  377  KFDKYRVSHSWREANRAADHLARMDLPSNDVVLWPVDFPVSLVDIIKEDALG  428



>ref|WP_029747740.1| MULTISPECIES: hypothetical protein, partial [Marinimicrobia]
Length=127

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = -2

Query  455  FTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNII  276
            F  + G C+ + AE  AL++GI+L I  K   V    DS  IV+ +N +  V N     +
Sbjct  31   FAENXGDCTNNEAEYLALIRGIELCIEKKILDVNIFCDSELIVRQVNGDYKVKNERMIKL  90

Query  275  HACNRELSNI-ANWTVSYAPREQNRAANCLAR  183
            HA   +L +I  NWTVS+  RE+N  A+ L++
Sbjct  91   HARXIDLCSILENWTVSHVMREKNTEADLLSK  122



>ref|XP_010686169.1| PREDICTED: uncharacterized protein LOC104900451 [Beta vulgaris 
subsp. vulgaris]
Length=146

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 58/115 (50%), Gaps = 1/115 (1%)
 Frame = -2

Query  431  SIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELS  252
            SI  AEAWAL +G+  A  L   K+  E D++S+++A+ +   +     ++I     EL 
Sbjct  27   SILVAEAWALREGLVGARMLGINKLVVEGDNLSVIQAIKRVWKIPWSIHSLIMDAGEELK  86

Query  251  NIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEV-LMQTIEEDRFGLPV  90
            N A  ++++  RE N AA+ +A      + L  +  +P+      I +D  G P+
Sbjct  87   NFAEVSINHGVREGNAAADWMAHRGHVCSNLTYWFESPDFNFSVIIRKDALGWPI  141



>ref|XP_003627699.1| hypothetical protein MTR_8g036680 [Medicago truncatula]
Length=116

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -2

Query  419  AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIAN  240
            AEA  LL+ ++LAI+   + V FESD   +V A+N +    N   +II  C + LS  AN
Sbjct  21   AEATGLLEAVKLAIARGMQPVIFESDCKIVVDAVNSSVNPHNELGDIIFYCKQLLSLHAN  80

Query  239  WTVSYAPREQNRAANCLAR  183
            ++V +  R+ N+  + +A+
Sbjct  81   FSVRFVRRQANKVTHNIAK  99



>gb|KHN47376.1| Heat shock 70 kDa protein [Glycine soja]
Length=793

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 66/133 (50%), Gaps = 7/133 (5%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GFT ++G  S+  AE W ++ G++LA  L  KKV  + DS + +  +      ++ A  +
Sbjct  663  GFTVNLGNTSVTLAELWGVVHGLKLAWDLGCKKVKVDIDSGNALGLVRHGPVANDPAFAL  722

Query  278  IHACNRELSNIANWTVSYAP--REQNRAANCLARLLDT---STGLKIYDTAPEVLMQTIE  114
            +   N  +     W V ++   RE NRAA+ LA L  +    +G K +   P  L+  ++
Sbjct  723  VSEINELVRK--EWLVEFSHVFRESNRAADKLAHLGHSHSLESGAKRFSDPPSALVAILQ  780

Query  113  EDRFGLPVWRQMD  75
            +D  GL   R ++
Sbjct  781  DDLAGLAKQRGVN  793



>ref|YP_006666138.1| RnaseH (mitochondrion) [Malus domestica]
 emb|CBX33402.1| rnaseH (mitochondrion) [Malus domestica]
Length=153

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 57/121 (47%), Gaps = 1/121 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GFT ++G   I AAE W L  G++LA    ++ V  E DS ++V  +NQ     +    +
Sbjct  24   GFTANLGKGKIIAAELWGLFFGLRLAWMRGFRSVEVEVDSATVVTLVNQQDNSLHPLHTL  83

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDRF  102
            I  C   L    +  +S+  RE+N +A+ LA + L    G     + P   +  + ED  
Sbjct  84   IRGCQAYLKMDWHCKLSHIYREKNFSADYLASIGLTYDLGYFESQSPPPGCIPFLFEDSL  143

Query  101  G  99
            G
Sbjct  144  G  144



>ref|XP_008239854.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=467

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 58/121 (48%), Gaps = 1/121 (1%)
 Frame = -2

Query  455  FTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNII  276
            F+ ++G   +  AEAWAL  G+ LA  L  +++   SDS  +V  +N +    +    ++
Sbjct  339  FSANLGHGEVFVAEAWALYYGLNLAWQLGLRQIMVNSDSALVVDMINGDWVDFHPMSMLL  398

Query  275  HACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDRFG  99
              C   L N  N  V    RE N AAN LA++      G     + P+ L   +++D+ G
Sbjct  399  TKCRELLKNQWNCCVLRVYRETNFAANFLAKMDHHKDLGYPKLSSPPDQLQPILDDDKNG  458

Query  98   L  96
            L
Sbjct  459  L  459



>ref|XP_002512143.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50177.1| conserved hypothetical protein [Ricinus communis]
Length=169

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 58/133 (44%), Gaps = 23/133 (17%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQN----GTVDNV  291
            G+++ + +CS   AE W +L G++LA  L +K V  E DS  ++ A++ N    G   ++
Sbjct  56   GYSHMISSCSALEAECWGVLNGLKLAWELGYKHVELECDSTEVIAAISGNSSLVGNFQSL  115

Query  290  ARNIIHACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQTIEE  111
            A  I     RE +  ANW    AP +                G+ +YD  P  +   +  
Sbjct  116  AVQI-----REANFCANWLAHSAPNQ--------------VLGVTVYDYPPVGIFSLLLA  156

Query  110  DRFGLPVWRQMDS  72
               G   +R + S
Sbjct  157  YYLGFGYFRDIVS  169



>ref|XP_007224782.1| hypothetical protein PRUPE_ppa023938mg, partial [Prunus persica]
 gb|EMJ25981.1| hypothetical protein PRUPE_ppa023938mg, partial [Prunus persica]
Length=189

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 1/121 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            G++ ++G  S+  AE W +   + LA    ++ V  ESDS   V  LN      +   +I
Sbjct  60   GYSVNLGIGSVLEAELWGIFWRLSLAWDFGFRTVEVESDSKVAVTLLNSLTISTHPLFSI  119

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDRF  102
            I+ C  ++S   N +V +   EQN AA+ LA +  D + GL I++  P  +   +  D  
Sbjct  120  INCCKVKMSVDWNCSVRHILLEQNCAADALAAISFDFNPGLHIFEEMPACIFDILVADSR  179

Query  101  G  99
            G
Sbjct  180  G  180



>ref|XP_007214110.1| hypothetical protein PRUPE_ppa017108mg, partial [Prunus persica]
 gb|EMJ15309.1| hypothetical protein PRUPE_ppa017108mg, partial [Prunus persica]
Length=197

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 61/120 (51%), Gaps = 3/120 (3%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVD--NVAR  285
            GF  ++G   +  AE WAL +G++LA       +  E+DS +++K ++    V+  +   
Sbjct  55   GFAANLGTGKVIEAELWALYRGLELAWKSGLAPIEVETDSTTVLKLMHNPVEVNWKHPQF  114

Query  284  NIIHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEED  108
            N+I +C   L+   + ++++A  +QN  A+CLA   L    G   +D  P +    + +D
Sbjct  115  NLIKSCQNLLNQSWSCSLNHAYWQQNSVADCLANFGLTMELGCHYFDVPPPLCEPFLVQD  174



>ref|XP_003595180.1| hypothetical protein MTR_2g039350 [Medicago truncatula]
 gb|ABN05766.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
 gb|ABN08743.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=141

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 52/108 (48%), Gaps = 1/108 (1%)
 Frame = -2

Query  458  GFT-YSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARN  282
            GF+ +S    +    EA  L + I +AI+     V FES+   +V  +N N T +N   +
Sbjct  20   GFSKHSYFHSTPPEPEALGLFEAINIAINCHMSSVIFESNCRLLVDTINSNSTSNNEFGD  79

Query  281  IIHACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAP  138
            II  C   LS+  N+ V+Y  R+ N+  + + +   +   L I+   P
Sbjct  80   IISRCKDLLSSRNNFIVNYVRRQTNKVVHNIVKASLSHLSLHIFHEVP  127



>gb|ABN06159.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=266

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = -2

Query  419  AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIAN  240
             EA ALL+ I  A + +W +V FESDS ++V+AL+  G  D+    I+ +   +LS  +N
Sbjct  161  GEAVALLEAIHSADANRWNRVVFESDSSTLVQALSSPGHGDSEFSAIVSSIIYQLSLHSN  220

Query  239  WTVSYAPREQNRAANCLARLLDTSTGLKIYDTAP  138
            + V +  R+ N  A+ LAR   +    +I+ + P
Sbjct  221  FEVKFVRRQANMVAHTLARADCSWASHRIFYSYP  254



>gb|KHN28455.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=152

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/117 (26%), Positives = 55/117 (47%), Gaps = 1/117 (1%)
 Frame = -2

Query  455  FTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNII  276
            F + +G CS+  AE WA++ GIQ+A S  + +   ESDS   +  +    +  +V   ++
Sbjct  36   FVFKIGRCSVTQAELWAIVLGIQVAKSRGFSESLVESDSKLAISLIQHRCSPSHVCFQLV  95

Query  275  HACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEED  108
                +  S+   +T   A  E N+ A  L++  L + T  +I+   P  +   +  D
Sbjct  96   EMIRKFESDGGRFTWIPAYPEANQVAEILSKFGLSSDTHSRIFPLCPSFVFSAVMAD  152



>ref|XP_004305448.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=171

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 48/92 (52%), Gaps = 0/92 (0%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF  ++G   I  AEAW L  G++L + L+   +  ESDS  +V  +  +    +   ++
Sbjct  38   GFQINLGVGEILTAEAWGLFYGLKLVVKLQISNLEVESDSAILVNLMQSSNLALHPLGSL  97

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLAR  183
            +  C + +S + N  +S+  RE N  A+ LA+
Sbjct  98   LDGCCKLMSRMENAKLSHIFRESNMTADALAK  129



>ref|XP_007050978.1| Uncharacterized protein TCM_004691 [Theobroma cacao]
 gb|EOX95135.1| Uncharacterized protein TCM_004691 [Theobroma cacao]
Length=240

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 61/125 (49%), Gaps = 1/125 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF+   GA +   AE  AL +G+ L       +V  E D+M +++ L +     + +R +
Sbjct  113  GFSEKFGAKNSILAELLALHRGLILCRDYGISRVWIEMDAMVVIQMLKKGHHGSHDSRYV  172

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQTIEEDRFG  99
            + + N+ L+  + + +S+ PRE N+A + LA L      L ++  A   L   +  D+ G
Sbjct  173  LASINKLLTQFS-YRISHIPREGNQATDLLANLGHDRQNLHVFVEAFGTLRGILRLDKLG  231

Query  98   LPVWR  84
             P  R
Sbjct  232  SPYVR  236



>ref|XP_008245516.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=203

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 63/123 (51%), Gaps = 2/123 (2%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQN-GTVDNVARN  282
            GF  ++G      AE W L  G++LA++    ++  E DSM+ V+ + Q+  +  +    
Sbjct  72   GFAVNLGIGQTLDAELWGLFFGLKLAVAKGVARLSIEMDSMTAVQLIKQHVPSCHHPCAG  131

Query  281  IIHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDR  105
            +I +C   +    +  +++  RE+N AA+CLA   L+   G+  ++ AP  +   + +D 
Sbjct  132  VIASCVALMRKFESVELTHVYRERNVAADCLANWSLNMDMGVCYFEDAPIWISSILIDDM  191

Query  104  FGL  96
             G+
Sbjct  192  LGV  194



>gb|ABN09176.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=260

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = -2

Query  419  AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIAN  240
            AEA  LL+ ++LAI+   + V F+SD   +V A+N +    N   +II  C + LS  AN
Sbjct  155  AEATGLLEAVKLAIARGMQSVIFKSDCKIVVDAVNSSVNPHNELGDIIFYCKQLLSLHAN  214

Query  239  WTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVL  129
            ++V +  R+ N+ A+ +AR   +     I+   P  L
Sbjct  215  FSVRFVRRQANKVAHNIARASLSHPSPHIFFDVPSSL  251



>ref|XP_009788843.1| PREDICTED: uncharacterized protein LOC104236586, partial [Nicotiana 
sylvestris]
Length=124

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 60/121 (50%), Gaps = 8/121 (7%)
 Frame = -2

Query  455  FTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNII  276
            F  ++   S  +AE  AL++G+QLA+      +  E +S  I++ L  N    N   N+I
Sbjct  1    FAAAITTDSPSSAELRALIQGLQLALKHNLVPLEVEVNSKDIIRLLTSNNVATN---NLI  57

Query  275  HACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLK----IYDTAPEVLMQTIEED  108
              C   L  +    V YA REQN  A+ LA+  D + G++    I+D +P+      E++
Sbjct  58   SDCRYLLDRLGKPIVLYAYREQNSVADKLAK-EDYNFGIQSVVHIFDGSPDFAWAVFEQE  116

Query  107  R  105
            +
Sbjct  117  K  117



>ref|XP_009805051.1| PREDICTED: uncharacterized protein LOC104250178 [Nicotiana sylvestris]
Length=222

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 58/121 (48%), Gaps = 6/121 (5%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF  S+ A S   AE +AL++G+QLA+      +  E DS   ++ L     + N   N+
Sbjct  85   GFATSITAESPTTAETYALMQGLQLALDRNLLPLEVEVDSRDSLRLLTSTKDIPN---NL  141

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL---LDTSTGLKIYDTAPEVLMQTIEED  108
            I  C   L  +    V +A REQN  A+ LA+     +  + + I+D +P +     E +
Sbjct  142  ISDCRYLLDRLGKPIVMHAYREQNGVADKLAKEGCNFELQSMVHIFDDSPVLARSLFERE  201

Query  107  R  105
            +
Sbjct  202  K  202



>ref|XP_010674097.1| PREDICTED: uncharacterized protein LOC104890348 [Beta vulgaris 
subsp. vulgaris]
Length=122

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 57/115 (50%), Gaps = 15/115 (13%)
 Frame = -2

Query  431  SIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELS  252
            SI  AEAW L +G++ A+ L  K +  E D++SI      N  +++ A         +L 
Sbjct  17   SILVAEAWGLREGVRGALFLGVKNITIEGDNLSI------NALINDTA--------EDLR  62

Query  251  NIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEV-LMQTIEEDRFGLPV  90
             I N+ V +  RE N AA+ +A    + T L  +  +P++   + I +D  G PV
Sbjct  63   KIDNYNVQHVFRESNFAADWMAHHGHSITNLCYWFESPDIAFFKNIRKDALGWPV  117



>ref|XP_008222990.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=346

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/123 (24%), Positives = 67/123 (54%), Gaps = 2/123 (2%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVD-NVARN  282
            GF  ++G   I  AE W L  G+++A++  +  + FE DS+  ++ + Q+ ++  +   +
Sbjct  215  GFAVNLGKGQILEAELWGLFFGLRMAVAKGFNNLIFEMDSVVAIQLVQQHDSLTLHPLAS  274

Query  281  IIHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDR  105
            ++ +C + +  + N ++ +  RE+N  A+ LA    +   G+ ++D AP  +  ++ +D 
Sbjct  275  LVSSCWQLMQQLENCSLHHIFREKNSVADRLAAWSYNLDLGICVFDEAPSWIGTSLVDDL  334

Query  104  FGL  96
             G+
Sbjct  335  LGV  337



>sp|P0C2F6.1|RNHX1_ARATH RecName: Full=Putative ribonuclease H protein At1g65750 [Arabidopsis 
thaliana]
Length=620

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 54/123 (44%), Gaps = 5/123 (4%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF+ ++G CS   AE W +  G+  A   K  +V  E DS  IV  L    +  +    +
Sbjct  491  GFSLNIGRCSAPQAELWGVYYGLYFAWEKKVPRVELEVDSEVIVGFLKTGISDSHPLSFL  550

Query  278  IHACNRELSNIANWTVS--YAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEED  108
            +  C+  L    +W V   +  RE NR A+ LA      S G   +D  P+ +   + ED
Sbjct  551  VRLCHGFLQK--DWLVRIVHVYREANRLADGLANYAFSLSLGFHSFDLVPDAMSSLLRED  608

Query  107  RFG  99
              G
Sbjct  609  TLG  611



>gb|AAF23831.1|AC007234_3 F1E22.12 [Arabidopsis thaliana]
Length=1055

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 54/123 (44%), Gaps = 5/123 (4%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF+ ++G CS   AE W +  G+  A   K  +V  E DS  IV  L    +  +    +
Sbjct  600  GFSLNIGRCSAPQAELWGVYYGLYFAWEKKVPRVELEVDSEVIVGFLKTGISDSHPLSFL  659

Query  278  IHACNRELSNIANWTVS--YAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEED  108
            +  C+  L    +W V   +  RE NR A+ LA      S G   +D  P+ +   + ED
Sbjct  660  VRLCHGFLQK--DWLVRIVHVYREANRLADGLANYAFSLSLGFHSFDLVPDAMSSLLRED  717

Query  107  RFG  99
              G
Sbjct  718  TLG  720



>dbj|BAB09192.1| non-LTR retroelement reverse transcriptase-like protein [Arabidopsis 
thaliana]
Length=308

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 56/123 (46%), Gaps = 5/123 (4%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF+ ++G CS   AE W +  G+  A   K  +V  E DS +IV  L    +  +    +
Sbjct  179  GFSLNIGRCSAQHAELWGVYYGLYFAWEKKVPRVELEVDSEAIVGFLKTGISDSHPLSFL  238

Query  278  IHACNRELSNIANWTVS--YAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEED  108
            +  C+  L    +W V   Y  RE N  A+ LA   +  S G   +D  P+ +   ++ED
Sbjct  239  VRLCHNFLQK--DWLVRIVYVYREANCLADGLANYTILLSLGFHSFDFVPDAMSSLLKED  296

Query  107  RFG  99
              G
Sbjct  297  TLG  299



>ref|XP_003602374.1| hypothetical protein MTR_3g092650 [Medicago truncatula]
Length=187

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 50/97 (52%), Gaps = 0/97 (0%)
 Frame = -2

Query  419  AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIAN  240
             EA ALL  I  A   +W +V FESDS ++V+AL+  G  D+    I+     +LS  +N
Sbjct  82   GEAIALLDVIHFADVNRWDRVVFESDSATLVQALSSPGHGDSEFYAIVSNIIYQLSLHSN  141

Query  239  WTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVL  129
            + V +  R+ N  A+ L R   +    +I++  P  +
Sbjct  142  FEVKFVRRQANMVAHTLDRAACSLASHRIFNFYPSCI  178



>ref|XP_009121276.1| PREDICTED: putative ribonuclease H protein At1g65750, partial 
[Brassica rapa]
Length=216

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 54/118 (46%), Gaps = 1/118 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF  ++G CS   AE W +  G+ +A     +K+  E DS S+V  L       +    +
Sbjct  87   GFALNIGICSAPLAELWGVYYGMCIAWDKGIRKLEVEVDSKSVVGFLKTGIHDSHPLSFL  146

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLAR-LLDTSTGLKIYDTAPEVLMQTIEED  108
            +  C   +S      +S+  RE NR A+ LA  +     GL  +D+ PE +   + ED
Sbjct  147  VRLCYGFVSRDWIVNISHVYREANRLADGLANYVFSLQFGLHFFDSVPEHVAPILLED  204



>ref|XP_007210921.1| hypothetical protein PRUPE_ppb019242mg, partial [Prunus persica]
 gb|EMJ12120.1| hypothetical protein PRUPE_ppb019242mg, partial [Prunus persica]
Length=174

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF+ ++G   I  AE  AL  G++LA  ++  K+  E+DS  +++ LN N    +    +
Sbjct  49   GFSANLGYGDILKAELSALCHGLELAQRMQVTKLIVETDSKPVLRLLNANLEDHHPLLIL  108

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDRF  102
             + C     +  +  +++  R+ N AA+ LA++      G   +D  P+ ++  +E+DR 
Sbjct  109  RNKCRSYWKSSWDCKINHEYRQVNSAADSLAKMGHRMEMGTHFFDKPPDGIIGVLEDDRA  168

Query  101  G  99
            G
Sbjct  169  G  169



>ref|XP_006605069.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=148

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/117 (26%), Positives = 54/117 (46%), Gaps = 1/117 (1%)
 Frame = -2

Query  455  FTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNII  276
            F + +G CS+  AE WA++ GIQ+A S  + +   ESDS   +  +    +   V   ++
Sbjct  22   FVFKIGRCSVTQAELWAIVLGIQVAKSRGFSESLVESDSKLAISLIQHRCSPSYVCFQLV  81

Query  275  HACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEED  108
                +  S+   +T   A  E N+ A  L++  L + T  +I+   P  +   +  D
Sbjct  82   EMIRKFESDGGRFTWIPAYPEANQVAEILSKFGLSSDTHSRIFPLCPSFVFSAVMAD  138



>gb|KHN06921.1| Heat shock 70 kDa protein [Glycine soja]
Length=778

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 62/130 (48%), Gaps = 7/130 (5%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GFT ++G  ++  AE W ++ G++LA  L  KKV  + DS   +  +       + A  +
Sbjct  648  GFTVNIGITAVTLAELWGVVHGLKLAWDLGCKKVKVDIDSGHALGLIRHGPVAKDPAFAL  707

Query  278  IHACNRELSNIANWTVSYAP--REQNRAANCLARL---LDTSTGLKIYDTAPEVLMQTIE  114
            +   N  +     W V ++   RE NRAA+ LA L     + +G K +   P  L+  ++
Sbjct  708  VSEINELVRK--EWLVEFSHVFRESNRAADKLAHLGHSHSSESGAKRFSDPPFALLAILQ  765

Query  113  EDRFGLPVWR  84
            +D  G+   R
Sbjct  766  DDLAGVAKQR  775



>ref|XP_007037560.1| Uncharacterized protein TCM_014255 [Theobroma cacao]
 gb|EOY22061.1| Uncharacterized protein TCM_014255 [Theobroma cacao]
Length=956

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 61/120 (51%), Gaps = 5/120 (4%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            G+  ++G CS  + + WAL +GI+      ++KV  ESD ++ V+ L +  ++ N    +
Sbjct  817  GYNLNLGRCSSLSTDLWALFQGIKFTWDRGYRKVLVESDCVAAVECLRKAPSLLNSNIAL  876

Query  278  IHACNRELSNIANWTVSYAP--REQNRAANCLARLLD-TSTGLKIYDTAPEVLMQTIEED  108
            I +C R+L N   W     P  RE+N  AN LA  ++  S GL I    P  L   +E D
Sbjct  877  IKSC-RDLLN-RKWDCKVHPIRREENLCANWLATHVEGCSPGLSIIKEPPLELNPLLEND  934



>ref|XP_003604047.1| hypothetical protein MTR_3g117930 [Medicago truncatula]
Length=104

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  EAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIANW  237
            EA ALL  I   +  +W +V F+SDS ++V+AL+  G  D+    I+ +   + S  +N+
Sbjct  7    EAVALLDAIHFVVGNRWDRVVFKSDSATLVQALSSTGHGDSEFYAIVSSIIFQSSLHSNF  66

Query  236  TVSYAPREQNRAANCLARLLDTSTGLKIYDTAP  138
             V +  R+ N  A+ LA    +     I+ + P
Sbjct  67   EVKFVRRQANMVAHSLATAACSCASDHIFYSYP  99



>emb|CAN72157.1| hypothetical protein VITISV_019020 [Vitis vinifera]
Length=318

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 57/108 (53%), Gaps = 3/108 (3%)
 Frame = -2

Query  416  EAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIANW  237
            E WA+ +G+ LA  L  K +  ESDSMS+VK +N+     + A + ++     L     +
Sbjct  206  ELWAIWRGLVLASGLGIKAIWVESDSMSVVKTINRKQPYSSRAGSCLNHIWVLLGKFEKY  265

Query  236  TVSYAPREQNRAANCLARLLDTSTGLKIYDTA--PEVLMQTIEEDRFG  99
             VS+  RE N+AA+ L+R +D S    +  TA  P  L   I++D  G
Sbjct  266  RVSHTWRETNKAADFLSR-MDLSGSDVVLGTADFPNGLNSIIKDDAEG  312



>ref|XP_006582491.1| PREDICTED: uncharacterized protein LOC102662580 [Glycine max]
Length=1007

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 69/125 (55%), Gaps = 11/125 (9%)
 Frame = -2

Query  455  FTYSV-GACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTV--DNVAR  285
            F Y + G CS + AE  AL+ G+++ ISL  + V    DS  ++K L Q      +++A+
Sbjct  610  FKYKIKGLCSNNEAEYEALITGLEILISLGARNVNIRGDSELVLKQLTQEYKCVNEHLAK  669

Query  284  NIIHACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQTIE-ED  108
              + A +  L++  +  + + PR++N+ AN LA++   ++G   Y  + E L Q IE +D
Sbjct  670  YFVMASSL-LNHFDHINIEHIPRQENQEANDLAQI---ASG---YKMSKEKLTQLIEIKD  722

Query  107  RFGLP  93
            +  LP
Sbjct  723  KLVLP  727



>ref|WP_034407052.1| hypothetical protein, partial [Candidatus Scalindua brodae]
Length=125

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (53%), Gaps = 1/87 (1%)
 Frame = -2

Query  443  VGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHA-C  267
            +G  + + AE  AL+ G++LA     KK+ F+SDS  +VK +     V N    +++   
Sbjct  37   LGVATNNIAEYKALILGVKLATKHNAKKILFKSDSELMVKQIKGEYKVKNAHLKLLYTEV  96

Query  266  NRELSNIANWTVSYAPREQNRAANCLA  186
               L  + NW + + PR +N+ A+ LA
Sbjct  97   QSLLKKLPNWEIMHVPRGENKEADLLA  123



>ref|XP_007226764.1| hypothetical protein PRUPE_ppa018732mg [Prunus persica]
 gb|EMJ27963.1| hypothetical protein PRUPE_ppa018732mg [Prunus persica]
Length=430

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 59/111 (53%), Gaps = 1/111 (1%)
 Frame = -2

Query  428  IDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSN  249
            I   E WA+ +G+ LA+SL  K +  ESDS S+V+ +N++      A + +      L+ 
Sbjct  314  IFLVELWAIWRGLVLALSLGIKVIWVESDSESVVQTINRDRPYSQKASSCLKHIWELLNK  373

Query  248  IANWTVSYAPREQNRAANCLARLLDTSTGLKIYDT-APEVLMQTIEEDRFG  99
                 VS++ RE NRAA+ L++++   + +  +    P+ L   I+ED  G
Sbjct  374  FDKHQVSHSWRETNRAADHLSKMVLLGSDVVFWPVDFPDSLHNIIKEDAEG  424



>ref|XP_008229469.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=333

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 60/123 (49%), Gaps = 2/123 (2%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTV-DNVARN  282
            GF  ++G   I  AE W L  G++LA++  + K+  E DS   V    Q  ++  +    
Sbjct  202  GFAVNLGKWRILDAEIWGLFFGLRLAVAKGFTKILIEMDSQIAVNLFQQRDSLCFHPLTA  261

Query  281  IIHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDR  105
            ++  C + L +  +W + +  RE+N  A+CLA+   +    ++ + +AP      + +D 
Sbjct  262  LLSNCGKILRHFESWDIQHIFREKNGLADCLAKWSHNLDLDIQFFASAPIWASSALADDL  321

Query  104  FGL  96
             G+
Sbjct  322  LGV  324



>gb|KHN39964.1| HVA22-like protein a [Glycine soja]
Length=470

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 58/109 (53%), Gaps = 4/109 (4%)
 Frame = -2

Query  419  AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIAN  240
            AE WA+ +G+ L++ L  K +  ESDSMS+V+ +N+       A   ++   + L     
Sbjct  358  AELWAIWRGLVLSLGLGIKAIWVESDSMSVVRTVNRKQLCPK-AVGYLNQIWKLLKKFDK  416

Query  239  WTVSYAPREQNRAANCLAR--LLDTSTGLKIYDTAPEVLMQTIEEDRFG  99
            + +S++ RE NRAA+ LA+  LL     L   D  P  L + IE+D  G
Sbjct  417  YQISHSWRETNRAADHLAKMDLLANDVVLSPVDFPPS-LSRIIEDDAKG  464



>ref|XP_010667308.1| PREDICTED: uncharacterized protein LOC104884364 [Beta vulgaris 
subsp. vulgaris]
Length=1286

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 60/115 (52%), Gaps = 1/115 (1%)
 Frame = -2

Query  431   SIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELS  252
             SI  AEAWAL +GI+ A +L  +K+  E D++S+++A+ +   +     +II     +L 
Sbjct  1167  SILVAEAWALREGIRGACNLGIEKLIIEGDNLSVIQAIKRIWKIPWTIHSIILDAGEDLK  1226

Query  251   NIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQT-IEEDRFGLPV  90
               +   +++  RE N AA+ LA    + + L  +  +P+      I +D  G PV
Sbjct  1227  QFSEVHINHEVREGNAAADWLAHRGHSCSNLTYWFDSPDSSFSVIIRKDALGWPV  1281



>ref|XP_004287420.1| PREDICTED: uncharacterized protein LOC101302388 [Fragaria vesca 
subsp. vesca]
Length=425

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 58/108 (54%), Gaps = 1/108 (1%)
 Frame = -2

Query  419  AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIAN  240
             E WA+ +G+ LA SL  K +  ESDS+S+VK +N++      A + +      L     
Sbjct  312  VELWAIWRGLILASSLGIKVLWVESDSLSVVKTINRDQPYSLKASSCLKHIWELLKKFDE  371

Query  239  WTVSYAPREQNRAANCLARLLDTSTGLKIYD-TAPEVLMQTIEEDRFG  99
              VS++ RE NRAA+ LA+++ + + +  +    P+ L   I+ED  G
Sbjct  372  HRVSHSWRETNRAADHLAKMVLSESDVVFWPGDFPDSLNTIIKEDAEG  419



>ref|XP_004293164.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=212

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 54/105 (51%), Gaps = 1/105 (1%)
 Frame = -2

Query  419  AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIAN  240
            AE  ALL+G++LA +L   K+ FE+D + + +A++Q  T  +    II      L   A+
Sbjct  105  AELIALLEGLKLAETLHISKIVFETDCLLLQQAVSQPDTDLSTLGTIIAEVKEFLHRYAD  164

Query  239  WTVSYAPREQNRAANCLA-RLLDTSTGLKIYDTAPEVLMQTIEED  108
            + V + P E NR A+ LA   L+ S     +  APE +   I  D
Sbjct  165  FRVLHVPCEANRVAHILANHALNYSESQSWFVVAPEFVRDVILSD  209



>ref|XP_003544251.1| PREDICTED: uncharacterized protein LOC100787629 [Glycine max]
Length=470

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 58/109 (53%), Gaps = 4/109 (4%)
 Frame = -2

Query  419  AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIAN  240
            AE WA+ +G+ L++ L  K +  ESDSMS+V+ +N+       A   ++   + L     
Sbjct  358  AELWAIWRGLVLSLGLGIKAIWVESDSMSVVRTVNRKQLCPK-AVGYLNQIWKLLKKFDK  416

Query  239  WTVSYAPREQNRAANCLAR--LLDTSTGLKIYDTAPEVLMQTIEEDRFG  99
            + +S++ RE NRAA+ LA+  LL     L   D  P  L + IE+D  G
Sbjct  417  YQISHSWRETNRAADHLAKMDLLANDVVLSPVDFPPS-LSRIIEDDAKG  464



>ref|XP_006596723.1| PREDICTED: uncharacterized protein LOC102662959 [Glycine max]
Length=805

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 68/125 (54%), Gaps = 11/125 (9%)
 Frame = -2

Query  455  FTYSV-GACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTV--DNVAR  285
            F Y + G CS + AE  AL+ G+++ ISL  + V    DS  +++ L Q      +++A+
Sbjct  526  FKYKIKGLCSNNEAEYEALITGLEILISLGARNVNIRGDSELVLRQLTQEYKCVNEHLAK  585

Query  284  NIIHACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQTIE-ED  108
              + A +  L++     + + PR++NR AN LA++   ++G   Y  + E L Q IE +D
Sbjct  586  YFVIASSL-LNHFDYINIEHVPRQENREANDLAQI---ASG---YKMSKEKLTQLIEIKD  638

Query  107  RFGLP  93
            +  LP
Sbjct  639  KLVLP  643



>ref|XP_004294412.1| PREDICTED: uncharacterized protein LOC101292780 [Fragaria vesca 
subsp. vesca]
Length=430

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 62/122 (51%), Gaps = 4/122 (3%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTV--DNVAR  285
            GF  + G      AE  AL  G++LA+  + + +  E+DS   V  L+  GT+  ++   
Sbjct  58   GFVANFGTGKAIEAELKALHTGLELALKSRVECLEVETDSQLAVNLLSNVGTLYQEHHLI  117

Query  284  NIIHACNRELSNIANWTVSYAPREQNRAANCLARLLDT-STGLKI-YDTAPEVLMQTIEE  111
             +I +CN  L+  + WT+S   R+QN  A+CLA L  T   G+   YD+ P      + E
Sbjct  118  ELIKSCNALLNQNSRWTISGVYRQQNCVADCLAGLGHTLEEGVTTYYDSPPTACEPILLE  177

Query  110  DR  105
            D+
Sbjct  178  DQ  179



>ref|XP_007141283.1| hypothetical protein PHAVU_008G183100g [Phaseolus vulgaris]
 gb|ESW13277.1| hypothetical protein PHAVU_008G183100g [Phaseolus vulgaris]
Length=439

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 61/127 (48%), Gaps = 2/127 (2%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF   V    +   E WA+ +G+ L   L  K +  ESDSMS+VK +N+       A   
Sbjct  314  GFVSKVPQGDVFLVELWAIWRGLVLCGGLGIKAIWVESDSMSVVKTVNRKQHCPK-AYGY  372

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDT-APEVLMQTIEEDRF  102
            +    + L     + +S++ RE NRAA+ L++++     + ++    P  L   I++D  
Sbjct  373  LKQIWKLLKKFDKYQISHSWRETNRAADHLSKMVVWGNDVVLWPVDFPPTLCSIIKDDAR  432

Query  101  GLPVWRQ  81
            G+   R+
Sbjct  433  GMKYLRR  439



>gb|AAF97302.1|AC007843_5 Hypothetical protein [Arabidopsis thaliana]
 gb|AAV68820.1| hypothetical protein AT1G17390 [Arabidopsis thaliana]
Length=272

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 55/118 (47%), Gaps = 1/118 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF+ ++G CS   AE W    G+ +A      ++  E DS  +V  L       +    +
Sbjct  143  GFSLNIGICSAPLAELWGAYYGLNIAWERGVTQLEMEIDSEMVVGFLRTGIDDSHPLSFL  202

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEED  108
            +  C+  LS   +  +S+  RE NR A+ LA        G  ++++ P+++M  + +D
Sbjct  203  VRLCHGLLSKDWSVRISHVYREANRLADGLANYAFFLPLGFHLFNSTPDIVMSIVHDD  260



>ref|XP_002527364.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35036.1| conserved hypothetical protein [Ricinus communis]
Length=437

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 57/111 (51%), Gaps = 1/111 (1%)
 Frame = -2

Query  428  IDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSN  249
            I   E WA+ +G+ LA+ L  K +  ESDSMS VK +N+  +    A   ++     L  
Sbjct  321  IFLVELWAIWRGLVLALGLGIKVIWVESDSMSAVKTINRVQSHSGKANRCLNHIWALLKK  380

Query  248  IANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTA-PEVLMQTIEEDRFG  99
               + VS+A RE N+AA+ L++++     + ++    P  L   I++D  G
Sbjct  381  FEEYKVSHAWRETNKAADYLSKMVLERNDVVLWPVHFPTTLQNIIKDDAQG  431



>ref|XP_008219298.1| PREDICTED: uncharacterized protein LOC103319525 [Prunus mume]
Length=393

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 58/111 (52%), Gaps = 1/111 (1%)
 Frame = -2

Query  428  IDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSN  249
            I   E WA+ +G+ LA+SL  K +  ESDS S+V+ +N++      A + +      L  
Sbjct  277  IFLVELWAIWRGLVLALSLGIKVIWVESDSESVVQTINRDRPYGQKASSCLKHIWELLKK  336

Query  248  IANWTVSYAPREQNRAANCLARLLDTSTGLKIYDT-APEVLMQTIEEDRFG  99
                 VS++ RE NRAA+ L++++   + +  +    P+ L   I+ED  G
Sbjct  337  FDKHQVSHSWRETNRAADLLSKMVLLGSDVVFWPVDFPDSLCNIIKEDAEG  387



>gb|AAF79490.1|AC022492_34 F1L3.4 [Arabidopsis thaliana]
Length=253

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/121 (26%), Positives = 56/121 (46%), Gaps = 1/121 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF+ ++G CS   AE W    G+ +A      ++  E DS  +V  L       +    +
Sbjct  124  GFSLNIGICSAPLAELWGAYYGLNIAWERGVTQLEMEIDSEMVVGFLRTGIDDSHPLSFL  183

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDRF  102
            +  C+  LS   +  +S+  RE NR A+ LA        G  ++++ P+++M  + +D  
Sbjct  184  VRLCHGLLSKDWSVRISHVYREANRLADGLANYAFFLPLGFHLFNSTPDIVMSIVHDDVA  243

Query  101  G  99
            G
Sbjct  244  G  244



>ref|XP_009586778.1| PREDICTED: putative ribonuclease H protein At1g65750 [Nicotiana 
tomentosiformis]
Length=200

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 60/122 (49%), Gaps = 8/122 (7%)
 Frame = -2

Query  458  GFT-YSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARN  282
            GF+ + +   S++  E  AL  G+QLA +  +K +    D+  ++  L    T   +  N
Sbjct  40   GFSGHHISHGSVET-ELRALYHGLQLAYNHGYKPLKVNLDAQIVINILQ---TSHPLYAN  95

Query  281  IIHACNRELSNIANWTVSYAPREQNRAANCLARL---LDTSTGLKIYDTAPEVLMQTIEE  111
            +IH C   L  + +  + Y   EQN+ A+ LA+    +D + G+ ++   P  +   +E+
Sbjct  96   LIHDCRFLLKQLDDPVILYTYMEQNQVADLLAKYVFHMDNNAGVTVFAQPPSFVKTALED  155

Query  110  DR  105
            DR
Sbjct  156  DR  157



>ref|XP_006468253.1| PREDICTED: uncharacterized protein LOC102614777 [Citrus sinensis]
Length=320

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/126 (25%), Positives = 56/126 (44%), Gaps = 1/126 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            G++ ++G CS+ + E W L  G+ +A    +++V  E DSM +++ ++      N    +
Sbjct  191  GYSANLGVCSVTSTELWGLFHGLSIAWQYGFRRVYVEVDSMCVMRLISNPNPPINEHFTL  250

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDRF  102
            I      L       V +  RE N  A+ LA      S GL  +   P  ++  +  D  
Sbjct  251  IQEIQALLRRDWLTKVEHIYREANEVADFLASYNFSFSLGLHCFQFNPPNMLSILTNDVH  310

Query  101  GLPVWR  84
            G+  +R
Sbjct  311  GVAHFR  316



>ref|XP_011016191.1| PREDICTED: uncharacterized protein LOC105119721 isoform X1 [Populus 
euphratica]
Length=424

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 9/125 (7%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQ----NGTVDNV  291
            GF        I   E WA+ +G+ LA+ L  + V  ESDS+S+V  +N+    +G  D  
Sbjct  298  GFVSKASGHDIFLVELWAIWRGLVLALDLHIQVVWVESDSLSVVNTINRQQPYSGKADAC  357

Query  290  ARNIIHACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDT-APEVLMQTIE  114
             + I H     L       VS++ RE NRAA+ LA+++     + ++    P  L   I+
Sbjct  358  LKRIWHL----LKMFKKHKVSHSWRETNRAADYLAKMVVERDDVVLWPADFPTSLNNIIK  413

Query  113  EDRFG  99
            +D  G
Sbjct  414  DDAQG  418



>ref|XP_011016192.1| PREDICTED: uncharacterized protein LOC105119721 isoform X2 [Populus 
euphratica]
Length=423

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 50/98 (51%), Gaps = 8/98 (8%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQ----NGTVDNV  291
            GF        I   E WA+ +G+ LA+ L  + V  ESDS+S+V  +N+    +G  D  
Sbjct  297  GFVSKASGHDIFLVELWAIWRGLVLALDLHIQVVWVESDSLSVVNTINRQQPYSGKADAC  356

Query  290  ARNIIHACNRELSNIANWTVSYAPREQNRAANCLARLL  177
             + I H     L       VS++ RE NRAA+ LA+++
Sbjct  357  LKRIWHL----LKMFKKHKVSHSWRETNRAADYLAKMV  390



>ref|XP_010278072.1| PREDICTED: uncharacterized protein LOC104612377 [Nelumbo nucifera]
Length=210

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 48/88 (55%), Gaps = 1/88 (1%)
 Frame = -2

Query  446  SVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDN-VARNIIHA  270
            ++  CS   AE+ AL + +Q AIS    K  FE D ++++K L ++          +IH 
Sbjct  77   ALSKCSALEAESLALFESLQFAISYGITKATFEGDCVALIKFLLEDSCNPPWSVTTLIHN  136

Query  269  CNRELSNIANWTVSYAPREQNRAANCLA  186
            C   L    +++V+++PR  N+AA+ LA
Sbjct  137  CKIILRRHCDFSVAFSPRSTNKAAHALA  164



>ref|XP_010045599.1| PREDICTED: uncharacterized protein LOC104434358 [Eucalyptus grandis]
Length=854

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 39/127 (31%), Positives = 62/127 (49%), Gaps = 11/127 (9%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            G+++ +G  S  AA+ WA+ +G+ L     ++KV   SDS   + +L       +  +++
Sbjct  729  GYSFQLGKWSSLAADLWAIFQGLNLVWDRNYRKVLVLSDSYPALNSLKTAPQASDPNKDL  788

Query  278  IHACNRELSNIANW--TVSYAPREQNRAANCLARLLDTS----TGLKIYDTAPEVLMQTI  117
            I  C REL  + NW   VS+  RE+N AA  LA   D S     GL   D  P+ L   +
Sbjct  789  IQCC-RELI-LRNWECNVSHISREKNAAAAWLA---DHSQLYPMGLTELDEPPQELAHIL  843

Query  116  EEDRFGL  96
            +    G+
Sbjct  844  KNQDNGI  850



>gb|KHE91828.1| ribonuclease H [Candidatus Scalindua brodae]
Length=198

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (53%), Gaps = 1/87 (1%)
 Frame = -2

Query  443  VGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHA-C  267
            +G  + + AE  AL+ G++LA     KK+ F+SDS  +VK +     V N    +++   
Sbjct  109  LGVATNNIAEYKALILGVKLATKHNAKKILFKSDSELMVKQIKGEYKVKNAHLKLLYTEV  168

Query  266  NRELSNIANWTVSYAPREQNRAANCLA  186
               L  + NW + + PR +N+ A+ LA
Sbjct  169  QSLLKKLPNWEIMHVPRGENKEADLLA  195



>gb|AID60103.1| hypothetical protein [Brassica napus]
Length=620

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 56/120 (47%), Gaps = 5/120 (4%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF+ ++G CS   AE W +  G+ +A     +K+  E DS S+V  L       +    +
Sbjct  491  GFSLNIGICSAPLAELWGVYYGLCIAWDKGIRKLEVEVDSKSVVGFLKTGIHDSHPLSFL  550

Query  278  IHACNRELSNIANWTV--SYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEED  108
            +  C   +S   +W V  S+  RE NR A+ LA        GL  +D+ PE +   + ED
Sbjct  551  VRLCYGFVSR--DWIVNFSHVYRETNRLADGLANYAFSLQFGLHFFDSVPEHVAPIMLED  608



>ref|XP_008221720.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=228

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 58/121 (48%), Gaps = 1/121 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF+ ++G  SI  AE W +  G+ +A    ++ V  E D+ S V  L       +   +I
Sbjct  99   GFSVNLGYGSIIEAELWGIFWGLNMAWDAGFRTVEIECDANSAVALLKSPIVSTHPLFSI  158

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCL-ARLLDTSTGLKIYDTAPEVLMQTIEEDRF  102
            I+ C  ++    + +V +  REQN A + L A+  D + GL ++  AP  L   +  D  
Sbjct  159  INCCKMKIHEDWSCSVKHIFREQNCAVDALAAKSCDFAPGLHVFLEAPAFLSDLLAADVR  218

Query  101  G  99
            G
Sbjct  219  G  219



>ref|XP_009147282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=308

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 58/124 (47%), Gaps = 5/124 (4%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF  ++G CS   AE W +  G+ +A     +++  E DS S+V  L       +    +
Sbjct  179  GFAVNIGICSASLAELWGVYYGLCIAWDRGIRRLEVEVDSASVVDFLRTGIHDSHPLSFL  238

Query  278  IHACNRELSNIANWTV--SYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEED  108
            +  C   +S   +W V  S+  RE N  A+ LA        GL  ++T PEV++  + ED
Sbjct  239  VRLCYGFISR--DWLVKFSHVYREANHLADGLATYAFSLPFGLHYFETIPEVVVPILLED  296

Query  107  RFGL  96
              G+
Sbjct  297  LSGV  300



>gb|ABO80474.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=118

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = -2

Query  416  EAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIANW  237
            EA ALL+ +    + +W +V FESDS ++V+AL+     D+    I+ +   +L+  +N+
Sbjct  14   EAVALLEALHFVDANRWDRVVFESDSSTLVQALSSQDHGDSEFYAIVSSIIYQLALHSNF  73

Query  236  TVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQTIEED  108
             V +  R+ N  A+ LAR   +    +I+ + P  +   +  D
Sbjct  74   NVKFIWRQANMVAHTLARAACSWASHRIFYSYPSCIEHWLIND  116



>ref|XP_003623945.1| Trypsin/chymotrypsin inhibitor [Medicago truncatula]
Length=331

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 50/95 (53%), Gaps = 8/95 (8%)
 Frame = -2

Query  434  CSIDA--------AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            C++DA         E   LL  I  A   +WK+V FESDS ++V+AL+  G  D+    I
Sbjct  129  CNVDARTNMTVLEGEVACLLDVIHFADVNRWKRVVFESDSATLVQALSSLGHGDSEFYAI  188

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARLLD  174
            + +   +LS  +N+ V +  R+ N  A+ LAR  D
Sbjct  189  VSSIIYQLSLHSNFEVKFVRRQTNMVAHTLARAKD  223



>ref|XP_006475107.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=246

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 59/122 (48%), Gaps = 1/122 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            G+  ++G CS+ +AE W L  G+ +A    +++V  E DS  I++ ++ +    N   ++
Sbjct  117  GYCANLGFCSVTSAELWGLFHGLSIAWLYGYRRVIVEVDSKCILQLVSSSNPTINEHLSL  176

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDRF  102
            I A    +       +++  RE N AA+ LA   L    GL  + + P  ++  +  D  
Sbjct  177  IKAIQELIGRKWLIQMNHIYREANAAADFLATYSLSFPVGLHYFQSPPLNMLNILNNDVS  236

Query  101  GL  96
            G+
Sbjct  237  GV  238



>ref|XP_006605138.1| PREDICTED: uncharacterized protein LOC100808063 [Glycine max]
Length=898

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 68/125 (54%), Gaps = 11/125 (9%)
 Frame = -2

Query  455  FTYSV-GACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTV--DNVAR  285
            F Y + G CS + AE  AL+ G+++ ISL  + V    DS  +++ L Q      +++A+
Sbjct  526  FKYKIKGLCSNNEAEYEALITGLEILISLGARNVNIRGDSELVLRQLTQEYKCVNEHLAK  585

Query  284  NIIHACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQTIE-ED  108
              + A +  L++     + + PR++NR AN LA++   ++G   Y  + E L Q IE +D
Sbjct  586  YFVIASSL-LNHFDYINIEHIPRQENREANDLAQI---ASG---YKMSKEKLTQLIEIKD  638

Query  107  RFGLP  93
            +  LP
Sbjct  639  KLVLP  643



>gb|AAD22368.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=321

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 58/128 (45%), Gaps = 1/128 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF  ++G CS   AE W +  G+ +A     ++V  E DS  +V  L       +    +
Sbjct  192  GFAVNIGVCSAPLAELWGVYYGLFIAWGRGARRVELEVDSKMVVGFLTTGIADSHPLSFL  251

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDRF  102
            +  C   LS      +S+  RE NR A+ LA      S GL + ++ P+V+   + +D  
Sbjct  252  LRLCYDFLSKGWIVRISHVYREANRLADGLANYAFSLSLGLHLLESRPDVVSSILLDDVA  311

Query  101  GLPVWRQM  78
            G+   R +
Sbjct  312  GVSYPRHV  319



>ref|XP_008233465.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=547

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 60/123 (49%), Gaps = 2/123 (2%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVD-NVARN  282
            GF  ++G   I  AE W L  G++LA+  +   +  E DS  +V+ + + G  D +    
Sbjct  413  GFAVNLGRGQILEAEIWGLFFGLKLAVDKEINNLVVEMDSALVVQLIQKQGLTDVHPFAA  472

Query  281  IIHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEEDR  105
            ++ +C   +  I   +V +   E+N  ANCLA    +   GL I+  AP  +  ++ +D 
Sbjct  473  LVASCWELMHKINCCSVCHVYIERNSIANCLATWSYNLDLGLYIFVDAPAWVGPSLIDDL  532

Query  104  FGL  96
             G+
Sbjct  533  LGI  535



>ref|XP_010666799.1| PREDICTED: uncharacterized protein LOC104883921 [Beta vulgaris 
subsp. vulgaris]
Length=159

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 56/123 (46%), Gaps = 8/123 (7%)
 Frame = -2

Query  446  SVGAC-SIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHA  270
            S+G C SI  AEAW LL+ ++ A SL    V  E D  +++  +N+   +     NII  
Sbjct  38   SLGCCTSILQAEAWGLLEAVRGAYSLNLSNVMIEGDKFAVINTVNKIWHIPWKIDNIICN  97

Query  269  CNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKI----YDTAPEVLMQTIEEDRF  102
               EL    +  V +  RE NRAAN +A      + L      YD    +L   I +D  
Sbjct  98   VGMELLKFNSVYVKHCFREANRAANFMAHRGHAVSSLCFSFPPYDMDFSLL---IRKDVL  154

Query  101  GLP  93
            G P
Sbjct  155  GWP  157



>ref|XP_006590228.1| PREDICTED: uncharacterized protein LOC102661449 [Glycine max]
Length=1056

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 68/125 (54%), Gaps = 11/125 (9%)
 Frame = -2

Query  455  FTYSV-GACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTV--DNVAR  285
            F Y + G CS + AE  AL+ G+++ ISL  + V    DS  ++K L Q      +++A+
Sbjct  610  FKYKIKGLCSNNEAEYEALITGLEILISLGARNVNIRGDSELVLKQLTQEYKCVNEHLAK  669

Query  284  NIIHACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQTIE-ED  108
              + A +  L++     + + PR++N+ AN LA++   ++G   Y  + E L Q IE +D
Sbjct  670  YFVMASSL-LNHFDYINIEHIPRQENQEANDLAQI---ASG---YKMSKEKLTQLIEIKD  722

Query  107  RFGLP  93
            +  LP
Sbjct  723  KLVLP  727



>ref|WP_015676147.1| ribonuclease HI [Leptospira yanagawae]
 gb|EOQ90123.1| ribonuclease HI [Leptospira yanagawae serovar Saopaulo str. Sao 
Paulo = ATCC 700523]
Length=137

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 1/93 (1%)
 Frame = -2

Query  443  VGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACN  264
            +G  + + AE  ALL+G++ AI    KK  F  DS  +VK +     V N    +  +  
Sbjct  43   IGNATNNIAEWHALLRGMEEAIKQNIKKTKFRLDSELVVKQMKGEYKVKNKDLMVFKSKC  102

Query  263  REL-SNIANWTVSYAPREQNRAANCLARLLDTS  168
             EL S+  N+ + Y PREQN  A+ LA     S
Sbjct  103  EELKSSFENFEIQYIPREQNARADQLANFAQDS  135



>ref|XP_008349430.1| PREDICTED: uncharacterized protein LOC103412666 [Malus domestica]
Length=155

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 1/109 (1%)
 Frame = -2

Query  431  SIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELS  252
            S  AAEA A+   +   I   +  V  +SD++ I++ L +  T D     I+      + 
Sbjct  40   STAAAEACAIRSALLACIDNGFDNVVIKSDALVIIQMLKKESTHDYSIECILGDIELLVQ  99

Query  251  NIANWTVSYAPREQNRAANCLARLLDTSTGLKIYD-TAPEVLMQTIEED  108
             + + T S+ PRE NRAA+ +A+      G  ++D   PE L   +  D
Sbjct  100  RLTSVTFSFVPRESNRAAHSVAKFAFQKGGDFVWDCIGPEFLFNVLAHD  148



>ref|XP_010686862.1| PREDICTED: uncharacterized protein LOC104901018 [Beta vulgaris 
subsp. vulgaris]
Length=149

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 58/114 (51%), Gaps = 1/114 (1%)
 Frame = -2

Query  431  SIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELS  252
            SI  AEAWAL +GI  A  L   K+  E D++SI++A+ +   +     ++I     +L 
Sbjct  30   SILVAEAWALREGIIGARMLGIDKLIIEGDNLSIIQAIKRIWKISWAIHSLILDTGEDLK  89

Query  251  NIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQT-IEEDRFGLP  93
            + A   +++  RE N AA+ +A+   + + L  +  +P+      I +D  G P
Sbjct  90   SFAEVHINHGVREGNVAADWMAQRGHSCSNLTYWFDSPDHRFSVIIRKDALGWP  143



>ref|XP_007147977.1| hypothetical protein PHAVU_006G170300g [Phaseolus vulgaris]
 gb|ESW19971.1| hypothetical protein PHAVU_006G170300g [Phaseolus vulgaris]
Length=793

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 62/130 (48%), Gaps = 7/130 (5%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF  ++G+ S+  AE W ++ G++LA  L  KKV  + DS   +  +       + A  +
Sbjct  663  GFGVNLGSTSVTLAELWGVVHGLRLAWDLGCKKVKVDIDSGHALGLVRHCPVGSDPAFAV  722

Query  278  IHACNRELSNIANWTVSYAP--REQNRAANCLARLLDT---STGLKIYDTAPEVLMQTIE  114
            +   N  +    +W V ++   RE NRAA+ LA L  +    +G K +   P  ++  + 
Sbjct  723  VREINELVRK--DWLVEFSHVFRESNRAADRLAHLGHSHSLDSGAKRFSEPPSPILHILR  780

Query  113  EDRFGLPVWR  84
            +D  GL   R
Sbjct  781  DDLAGLAKQR  790



>ref|XP_002524970.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37467.1| conserved hypothetical protein [Ricinus communis]
Length=132

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 45/97 (46%), Gaps = 4/97 (4%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF  ++G CSI  A  W L  G+ LA  L  +K+  + DSM  V  +     + +    +
Sbjct  9    GFVVNIGRCSITGAGLWGLYHGLTLAWKLGIRKLLVKVDSMCAVPLVTGEKDISSSYAPL  68

Query  278  IHACNRELSNIANW--TVSYAPREQNRAANCLARLLD  174
            +      L    NW  +VS+  RE N AA+ LA   D
Sbjct  69   VSGIRSMLGQ--NWQVSVSHVYREANFAADGLASFAD  103



>gb|EEC68711.1| hypothetical protein OsI_37193 [Oryza sativa Indica Group]
Length=1546

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -2

Query  419  AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIAN  240
            AEA+AL +G+ LA  +   ++  +SD M +V+ +   G   N A  I   CN   S  A+
Sbjct  901  AEAFALKEGLMLAQQIGCNRLIIQSDCMEVVQIMTDGGFTANSAAAIYEDCNILWSGFAD  960

Query  239  WTVSYAPREQNRAANCLAR  183
             T+ +  RE N+ A+ LAR
Sbjct  961  ITIEHCSREANQVAHNLAR  979



>ref|XP_008227007.1| PREDICTED: uncharacterized protein LOC103326548 [Prunus mume]
Length=370

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 60/120 (50%), Gaps = 3/120 (3%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVD--NVAR  285
            GF  ++G   +  AE WAL +G++LA       +  E+DS +++K ++    V+  +   
Sbjct  58   GFAANLGTGKVIEAEVWALYRGLELAWKSGLAPLEVETDSTTVLKLMHNPVEVNWKHPHF  117

Query  284  NIIHACNRELSNIANWTVSYAPREQNRAANCLARL-LDTSTGLKIYDTAPEVLMQTIEED  108
            N+I +C   L+     ++++A  +QN  A+CLA   L    G   +D  P +    + +D
Sbjct  118  NLIKSCQNLLNQSWICSLNHAYWQQNSVADCLANFGLTMERGCHYFDVPPPLCEPFLVQD  177



>emb|CDY23510.1| BnaC06g24790D [Brassica napus]
Length=324

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 2/106 (2%)
 Frame = -2

Query  416  EAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIANW  237
            EA A+   IQ  +   + +V FE+DS+ + K LN       V   I+   +  LS+   +
Sbjct  216  EAEAIRWTIQTLVGFGYSRVSFETDSLVLAKMLNGEEEFWPVLEPILQDISTSLSSNGGF  275

Query  236  TVSYAPREQNRAANCLARLLDTSTGL--KIYDTAPEVLMQTIEEDR  105
             V Y PR  N++A+ +A+   T T    K+Y   P  L   +E D+
Sbjct  276  EVVYYPRSGNKSADRIAKETTTFTSFVPKLYSMVPLWLKLCLETDK  321



>ref|XP_008219669.1| PREDICTED: uncharacterized protein LOC103319850 [Prunus mume]
Length=294

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 61/113 (54%), Gaps = 8/113 (7%)
 Frame = -2

Query  419  AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACN--RELSN-  249
            AEA A L+G +LA  + +++V FESD   I+  L   G + +    I H  +  R++ N 
Sbjct  180  AEAQACLEGCKLAAEMGYRQVTFESDCKEIISPL--KGPLSDGRWEIYHILSNVRDVLNC  237

Query  248  IANWTVSYAPREQNRAANCLARLLDTSTGLKIY-DTAPEVLMQTIEEDRFGLP  93
               +  ++ PR  N+AA+ LA L ++    K++ +  P  LMQ + +D  GLP
Sbjct  238  FQTYVWTWIPRTANQAADHLAMLANSRMSPKVWVNRPPSSLMQILNKD--GLP  288



>gb|EEE52627.1| hypothetical protein OsJ_34967 [Oryza sativa Japonica Group]
Length=1395

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -2

Query  419  AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIAN  240
            AEA+AL +G+ LA  +   ++  +SD M +V+ +   G   N A  I   CN   S  A+
Sbjct  750  AEAFALKEGLMLAQQIGCNRLIIQSDCMEVVQIMTDGGFTANSAAAIYEDCNILWSGFAD  809

Query  239  WTVSYAPREQNRAANCLAR  183
             T+ +  RE N+ A+ LAR
Sbjct  810  ITIEHCSREANQVAHNLAR  828



>ref|XP_009138589.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=739

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 2/106 (2%)
 Frame = -2

Query  416  EAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIANW  237
            EA AL  G +      +K V FE+DS+S+VK +N N  V  V +  +      L  I ++
Sbjct  626  EAEALRWGAETLAGFGYKNVIFETDSLSLVKMINGNEEVWPVLQPTVEMIRHALLRIQSY  685

Query  236  TVSYAPREQNRAANCLARLLDT--STGLKIYDTAPEVLMQTIEEDR  105
             V + PR  N+AA+ +A+   T  S   K+Y   P  L   +  D+
Sbjct  686  EVRFYPRGGNKAADRIAKETITFVSNVPKLYSVVPLWLNYHVRSDK  731



>ref|XP_009775459.1| PREDICTED: uncharacterized protein LOC104225380 [Nicotiana sylvestris]
Length=426

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 58/111 (52%), Gaps = 1/111 (1%)
 Frame = -2

Query  428  IDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSN  249
            I   E  A+ +G+ LA S+  K +  ESDSMS VKA+N+       A + +    + L  
Sbjct  310  IFLVELLAIWRGLTLAASIGIKMIWVESDSMSAVKAINKEQPFSQKASSCLIHIWKILKK  369

Query  248  IANWTVSYAPREQNRAANCLARLLDTSTGLKIYDT-APEVLMQTIEEDRFG  99
               + V+++ RE NRAA+ L+++  + + + I+    P  L + I ED  G
Sbjct  370  FQKYQVTHSWRETNRAADYLSKMDISGSDIVIWPADFPSSLCKFIAEDAQG  420



>ref|XP_004146631.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Cucumis 
sativus]
 ref|XP_004158057.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Cucumis 
sativus]
 gb|KGN64619.1| hypothetical protein Csa_1G071820 [Cucumis sativus]
Length=205

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 1/110 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNV-ARN  282
            G+  S+G      AE  AL KG++L +   WK V  E D+  +V+ L +N  V  + AR+
Sbjct  77   GYAESIGRAYSSMAELKALTKGLELVLENGWKDVWVEGDAKGLVEILAENREVKCMEARS  136

Query  281  IIHACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEV  132
             +      L +  N  VS+  RE N+ A+  A +      L+I+   P +
Sbjct  137  YLRHIKSLLLDFDNCKVSHIYREGNKVADRFASIGHRCKKLEIWRELPPL  186



>ref|XP_003596206.1| hypothetical protein MTR_2g071530 [Medicago truncatula]
Length=126

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 49/112 (44%), Gaps = 3/112 (3%)
 Frame = -2

Query  434  CSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNREL  255
            C +D  EA  L   +Q    L +  V F  D  S+V+  N N    +    II AC R+L
Sbjct  15   CDVDVGEAVGLHTTLQWMADLHYDNVDFVLDCKSVVEHFNSNLGDSSELDCIIQAC-RQL  73

Query  254  --SNIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQTIEEDR  105
               N  N  V +  R+ N  A+ LAR+  +     +YD  P  +   I  ++
Sbjct  74   FDCNFQNSHVEFNRRQANGVAHELARVAPSHASSHVYDDVPSCIRDLIANEK  125



>ref|XP_009607451.1| PREDICTED: uncharacterized protein LOC104101668 [Nicotiana tomentosiformis]
Length=427

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 58/111 (52%), Gaps = 1/111 (1%)
 Frame = -2

Query  428  IDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSN  249
            I   E  A+ +G+ LA S+  K +  ESDSMS VKA+N+       A + +    + L  
Sbjct  311  IFLVELLAIWRGLTLAASIGIKMIWVESDSMSAVKAINKEQPYSQKASSCLIHIWKILKK  370

Query  248  IANWTVSYAPREQNRAANCLARLLDTSTGLKIYDT-APEVLMQTIEEDRFG  99
               + V+++ RE NRAA+ L+++  + + + I+    P  L + I ED  G
Sbjct  371  FQKYQVTHSWRETNRAADYLSKMDISGSDIVIWPRDFPSSLCKFIAEDAQG  421



>ref|XP_004490492.1| PREDICTED: uncharacterized protein LOC101492718 [Cicer arietinum]
Length=375

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 46/91 (51%), Gaps = 1/91 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF        I   E WA+ +G+ L+  L  K +  ESDSMS+VK +N+       A + 
Sbjct  284  GFVSKAPQGDIFLVELWAIWRGLVLSFGLGIKSIWVESDSMSVVKTINKMQPCPK-AESC  342

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLA  186
            +    + LS    + +S++ RE NRAA+ L 
Sbjct  343  LEKIWKLLSKFEKYRISHSWRETNRAADHLV  373



>ref|XP_008383873.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=389

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 62/130 (48%), Gaps = 2/130 (2%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVA-RN  282
            GF+ S+G  +   AE  A++  I+LA +  WK +  ESDS S++            + + 
Sbjct  260  GFSLSLGHRTSFYAELHAVILAIELAHARGWKNLWLESDSSSVISCFASGSFSPPWSLQT  319

Query  281  IIHACNRELSNIANWTVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQTIEEDRF  102
              + C   L N+  +  S+  RE N  A+ LA L   S+ L  + T P  ++  +  D  
Sbjct  320  RWNNCTLHLQNMV-FRCSHIFREGNVVADKLANLGLLSSSLVWHSTPPIEILPPLHSDFL  378

Query  101  GLPVWRQMDS  72
            G+P +R + S
Sbjct  379  GMPTYRFVSS  388



>ref|XP_004305696.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=128

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 50/91 (55%), Gaps = 3/91 (3%)
 Frame = -2

Query  455  FTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNII  276
            F + +G   ++ AEAW L  G+QLA++L  +K+  ESDS  +V+ +  N    +   ++I
Sbjct  10   FKFKLG---VEDAEAWGLFFGLQLAVNLNVQKLEVESDSPILVQLVQMNDCGLHPLGSLI  66

Query  275  HACNRELSNIANWTVSYAPREQNRAANCLAR  183
              C   +++  +  +S+  RE    A+ LA+
Sbjct  67   SGCINFMASFNSTKISHIFREGYMTADVLAK  97



>ref|XP_007216502.1| hypothetical protein PRUPE_ppa024040mg, partial [Prunus persica]
 gb|EMJ17701.1| hypothetical protein PRUPE_ppa024040mg, partial [Prunus persica]
Length=132

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = -2

Query  437  ACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRE  258
             CS D  EA ALL G++LA SL      FESDS+    A+ + G   ++   I   C   
Sbjct  39   GCS-DQIEALALLDGLRLAASLDHDLFHFESDSLKTTTAVLKGGANLSLLGRIYEDCMGL  97

Query  257  LSNIANWTVSYAPREQNRAANCLA  186
            LSN  + ++++ PR  N  A+ LA
Sbjct  98   LSNFHSVSLNHVPRTCNSVADRLA  121



>gb|KHF99723.1| HVA22-like protein a [Gossypium arboreum]
Length=418

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 56/108 (52%), Gaps = 1/108 (1%)
 Frame = -2

Query  419  AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIAN  240
             E W + +G+ LA  L  K +  ESDS S+VK +N+       +   +    + L+   N
Sbjct  305  VELWPIWRGLVLASGLGVKVIWVESDSKSVVKTINREQPYGPKSSQCLRQIWKLLTKFEN  364

Query  239  WTVSYAPREQNRAANCLARLLDTSTGLKIYDT-APEVLMQTIEEDRFG  99
            + V+++ RE N+AA+ L+R++     + ++    P+ L   I++D  G
Sbjct  365  YRVTHSWRETNKAADHLSRMVLRENDVVLWPADFPDTLNSIIKDDAQG  412



>ref|WP_004784785.1| ribonuclease HI [Leptospira meyeri]
 gb|EKJ86544.1| ribonuclease HI [Leptospira meyeri serovar Hardjo str. Went 5]
 gb|EMJ89186.1| ribonuclease HI [Leptospira meyeri serovar Semaranga str. Veldrot 
Semarang 173]
Length=137

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 46/89 (52%), Gaps = 1/89 (1%)
 Frame = -2

Query  443  VGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHA-C  267
            +G  + + AE  AL +G++ AI+   +K+ F  DS  +VK +     V N    +    C
Sbjct  43   IGNATNNVAEWQALYRGMEEAINQNLQKIRFRLDSELVVKQMKGEYKVKNKDLLVFKTKC  102

Query  266  NRELSNIANWTVSYAPREQNRAANCLARL  180
            +   S+  N+ + Y PREQN  A+ LA L
Sbjct  103  DTLKSSFQNFEIQYIPREQNSRADQLANL  131



>ref|XP_010681975.1| PREDICTED: uncharacterized protein LOC104896887 [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 53/107 (50%), Gaps = 1/107 (1%)
 Frame = -2

Query  419  AEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIAN  240
            AEA A+  G+Q+AI   +  +  E D+ ++   L +     +   +I+H  +R  +   N
Sbjct  6    AEALAVRHGLQIAIEAGFSSLVLEMDNFTVYSKLQRRKQEASTLGSILHDIHRLANQCFN  65

Query  239  WTVSYAPREQNRAANCLARLLDTSTGLKIY-DTAPEVLMQTIEEDRF  102
             + S+  RE N  A+ LA+L     GL+++ +  P  ++  +  D F
Sbjct  66   VSFSFVKREGNGVAHALAKLSCKFEGLRVWLEEYPSEVLAAVMADLF  112



>ref|XP_004305757.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=395

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF  ++G   I  AEAW L +G++LA+SL    +  ESDS  +V+ +N +   ++   ++
Sbjct  279  GFQINLGVGEILDAEAWGLFQGLKLAVSLNINNLIIESDSAILVQLMNNSEFGNHPLGSL  338

Query  278  IHACNRELSN--IANWTVSYAPREQNRAANCLAR  183
            +  C+  ++   + + T+S+  RE N   + LA+
Sbjct  339  LQGCSSLMNKMEMKSATLSHIFRECNSTTDALAK  372



>ref|XP_003624960.1| hypothetical protein MTR_7g089450 [Medicago truncatula]
Length=95

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 51/103 (50%), Gaps = 16/103 (16%)
 Frame = -2

Query  416  EAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNIIHACNRELSNIANW  237
            EA ALL+ I  A    W+KV F+SDS ++V AL+ +       R ++H         +N+
Sbjct  7    EAMALLEIIWFAEQNGWEKVVFKSDSATVVNALSSH-------RRVLH---------SNF  50

Query  236  TVSYAPREQNRAANCLARLLDTSTGLKIYDTAPEVLMQTIEED  108
             + +  R+ N  A  LAR   +S   ++++  P  + Q +  D
Sbjct  51   KLKFIRRQANMVARTLARATYSSASRRVFEFYPPCIEQYVIND  93



>ref|XP_007219947.1| hypothetical protein PRUPE_ppb019489mg [Prunus persica]
 gb|EMJ21146.1| hypothetical protein PRUPE_ppb019489mg [Prunus persica]
Length=516

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 58/122 (48%), Gaps = 1/122 (1%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            GF  ++G  S+  AE W++  G+ LA    ++ V  ESD    V  L+ +    +   ++
Sbjct  387  GFFVNLGVGSVLEAELWSIFGGLHLAWESSFRVVEVESDFSVAVALLSSSTISTHPLFSL  446

Query  278  IHACNRELSNIANWTVSYAPREQNRAANCLA-RLLDTSTGLKIYDTAPEVLMQTIEEDRF  102
            I  C  ++      +V +  REQN AA+ LA +  +   G++ +   P  L   + ED  
Sbjct  447  IRCCKLKVQAGWRCSVKHIFREQNVAADVLASKSSEFGIGVQYFTEVPTFLATCLAEDAI  506

Query  101  GL  96
            G+
Sbjct  507  GV  508



>gb|KCW83711.1| hypothetical protein EUGRSUZ_B00585 [Eucalyptus grandis]
Length=322

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 62/127 (49%), Gaps = 11/127 (9%)
 Frame = -2

Query  458  GFTYSVGACSIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDNVARNI  279
            G+++ +G  S  AA+ WA+ +G+ L     ++KV   SDS   + +L       +  +++
Sbjct  197  GYSFQLGKWSSLAADLWAIFQGLNLVWDRNYRKVLVLSDSYPALNSLKTAPQASDPNKDL  256

Query  278  IHACNRELSNIANW--TVSYAPREQNRAANCLARLLDTST----GLKIYDTAPEVLMQTI  117
            I  C REL  + NW   VS+  RE+N AA   A L D S     GL   D  P+ L   +
Sbjct  257  IQCC-RELI-LRNWECNVSHISREKNAAA---AWLADHSQLYPMGLTELDEPPQELAHIL  311

Query  116  EEDRFGL  96
            +    G+
Sbjct  312  KNQDNGI  318



>ref|XP_004306245.1| PREDICTED: uncharacterized protein LOC101310543 [Fragaria vesca 
subsp. vesca]
Length=191

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 4/115 (3%)
 Frame = -2

Query  431  SIDAAEAWALLKGIQLAISLKWKKVCFESDSMSIVKALNQNGTVDN-VARNIIHACNREL  255
            S++AAEA A+L G+ +A+ +  K V  +SDS+SI+  LN + +  N     II     + 
Sbjct  72   SVEAAEATAILLGVNVALDMGLKDVIVQSDSLSIITELNSSSSCKNWKITQIIDDIKWKK  131

Query  254  SNIANWTVSYAPREQNRAANCLARLLDTSTGLKIY-DTAPEVLMQTIEEDRFGLP  93
                + T  + PRE N+ A+  A L     GL  + +  P  L+  +  D  GLP
Sbjct  132  VFFNSITWDWIPREANQVADAAALLGKRMMGLNRWVNRPPSSLLSVLRND--GLP  184



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506732777192