BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84451_g1_i1 len=653 path=[1:0-652]

Length=653
                                                                      Score     E

ref|XP_002509490.1|  DNA binding protein, putative                      103   3e-24   Ricinus communis
ref|XP_003631666.1|  PREDICTED: protein RADIALIS-like 3                 102   3e-24   
emb|CDP02010.1|  unnamed protein product                                102   4e-24   
ref|XP_011099630.1|  PREDICTED: protein RADIALIS-like 3                 101   8e-24   
ref|XP_007042177.1|  DnaJ subfamily C member 2                          102   1e-23   
ref|XP_002305430.1|  myb family transcription factor family protein     100   4e-23   Populus trichocarpa [western balsam poplar]
ref|XP_007131828.1|  hypothetical protein PHAVU_011G044900g           99.4    7e-23   
gb|KDP46257.1|  hypothetical protein JCGZ_10097                       97.8    2e-22   
ref|XP_009603278.1|  PREDICTED: protein RADIALIS-like 1               97.8    2e-22   
ref|XP_011048444.1|  PREDICTED: protein RADIALIS-like 1               97.8    2e-22   
ref|XP_010028595.1|  PREDICTED: protein RADIALIS-like 1               97.8    2e-22   
ref|XP_004289671.1|  PREDICTED: transcription factor RADIALIS-like    97.8    3e-22   
ref|XP_009786616.1|  PREDICTED: protein RADIALIS-like 1               97.1    3e-22   
ref|XP_003540679.1|  PREDICTED: protein RADIALIS-like 1-like          97.8    3e-22   
gb|KHN25378.1|  hypothetical protein glysoja_010295                   97.4    3e-22   
ref|XP_011037522.1|  PREDICTED: protein RADIALIS-like 2               97.1    4e-22   
ref|XP_009390189.1|  PREDICTED: protein RADIALIS-like 3               97.1    5e-22   
ref|XP_007017563.1|  RAD-like 6                                       96.3    6e-22   
ref|XP_010254802.1|  PREDICTED: protein RADIALIS-like 3               96.7    7e-22   
ref|XP_007141400.1|  hypothetical protein PHAVU_008G192200g           96.7    7e-22   
ref|XP_010254825.1|  PREDICTED: protein RADIALIS-like 3 isoform X2    96.7    8e-22   
ref|XP_002313794.1|  myb family transcription factor family protein   96.3    9e-22   Populus trichocarpa [western balsam poplar]
ref|XP_003603930.1|  DnaJ homolog subfamily C member                  95.5    1e-21   
sp|Q58FS3.1|RAD_ANTMA  RecName: Full=Transcription factor RADIALIS    95.9    1e-21   Antirrhinum majus [garden snapdragon]
ref|XP_003537885.2|  PREDICTED: protein RADIALIS-like 1-like          95.9    1e-21   
ref|XP_004292033.1|  PREDICTED: protein RADIALIS-like 6-like          95.9    1e-21   
ref|XP_010649137.1|  PREDICTED: protein RADIALIS-like 3               95.5    1e-21   
ref|XP_011028852.1|  PREDICTED: protein RADIALIS-like 5               95.9    1e-21   
ref|XP_011083673.1|  PREDICTED: protein RADIALIS-like 3               95.9    1e-21   
ref|XP_010254824.1|  PREDICTED: protein RADIALIS-like 1 isoform X1    96.7    1e-21   
ref|XP_003631667.1|  PREDICTED: protein RADIALIS-like 3               95.1    2e-21   
ref|XP_010664694.1|  PREDICTED: protein RADIALIS-like 3 isoform X1    95.5    2e-21   
ref|XP_002282461.1|  PREDICTED: protein RADIALIS-like 3 isoform X2    95.5    2e-21   Vitis vinifera
emb|CBI17505.3|  unnamed protein product                              94.7    2e-21   
ref|XP_004232415.1|  PREDICTED: protein RADIALIS-like 5               94.7    2e-21   
ref|XP_002300766.1|  myb family transcription factor family protein   95.5    2e-21   Populus trichocarpa [western balsam poplar]
gb|EPS58348.1|  hypothetical protein M569_16468                       95.1    2e-21   
gb|EYU37803.1|  hypothetical protein MIMGU_mgv1a024317mg              94.7    2e-21   
ref|XP_004500809.1|  PREDICTED: protein RADIALIS-like 6-like          94.7    3e-21   
ref|XP_009342796.1|  PREDICTED: transcription factor RADIALIS iso...  94.7    3e-21   
ref|XP_008347407.1|  PREDICTED: transcription factor RADIALIS-like    94.4    4e-21   
ref|XP_010029788.1|  PREDICTED: protein RADIALIS-like 4               94.0    4e-21   
ref|XP_003518389.1|  PREDICTED: protein RADIALIS-like 6-like          94.4    5e-21   
gb|KHN41108.1|  hypothetical protein glysoja_013450                   94.7    5e-21   
ref|XP_004238608.1|  PREDICTED: protein RADIALIS-like 6               94.0    5e-21   
ref|XP_008795931.1|  PREDICTED: protein RADIALIS-like 3               94.4    6e-21   
ref|XP_011048394.1|  PREDICTED: protein RADIALIS-like 4               94.4    6e-21   
ref|XP_010088931.1|  hypothetical protein L484_018558                 94.7    6e-21   
ref|XP_002510401.1|  DNA binding protein, putative                    94.0    6e-21   Ricinus communis
ref|XP_008378460.1|  PREDICTED: transcription factor RADIALIS-like    94.4    6e-21   
gb|ADZ73427.1|  MYB transcription factor                              93.2    8e-21   
ref|XP_010028603.1|  PREDICTED: protein RADIALIS-like 3               93.6    8e-21   
gb|KDP38516.1|  hypothetical protein JCGZ_04441                       93.6    8e-21   
ref|XP_011037519.1|  PREDICTED: protein RADIALIS-like 4 isoform X2    93.6    8e-21   
emb|CDP07503.1|  unnamed protein product                              94.0    9e-21   
ref|XP_011037518.1|  PREDICTED: protein RADIALIS-like 4 isoform X1    93.6    9e-21   
ref|XP_006595898.1|  PREDICTED: protein RADIALIS-like 3-like          93.6    9e-21   
ref|XP_010263653.1|  PREDICTED: protein RADIALIS-like 3               93.6    1e-20   
ref|XP_009390408.1|  PREDICTED: protein RADIALIS-like 3               93.2    1e-20   
ref|XP_008782489.1|  PREDICTED: protein RADIALIS-like 3 isoform X1    93.2    1e-20   
ref|XP_009364936.1|  PREDICTED: protein RADIALIS-like 6               93.2    1e-20   
ref|XP_002310812.1|  hypothetical protein POPTR_0007s13000g           92.8    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_007201464.1|  hypothetical protein PRUPE_ppa014060mg           92.8    1e-20   
ref|XP_010088924.1|  DnaJ homolog subfamily C member 2                93.2    1e-20   
emb|CAN68999.1|  hypothetical protein VITISV_033596                   92.8    2e-20   Vitis vinifera
ref|XP_009378510.1|  PREDICTED: protein RADIALIS-like 1               92.4    2e-20   
ref|XP_011092801.1|  PREDICTED: protein RADIALIS-like 1               92.4    2e-20   
ref|XP_002306110.2|  hypothetical protein POPTR_0004s16320g           92.8    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_002313044.2|  hypothetical protein POPTR_0009s11990g           93.2    2e-20   Populus trichocarpa [western balsam poplar]
gb|EYU40174.1|  hypothetical protein MIMGU_mgv1a019621mg              91.7    3e-20   
ref|XP_006341953.1|  PREDICTED: protein RADIALIS-like 6-like          92.0    3e-20   
ref|XP_010263639.1|  PREDICTED: protein RADIALIS-like 3               92.4    3e-20   
ref|XP_006577922.1|  PREDICTED: protein RADIALIS-like 6-like isof...  92.4    3e-20   
ref|XP_009365547.1|  PREDICTED: protein RADIALIS-like 3               92.4    3e-20   
gb|KDP46261.1|  hypothetical protein JCGZ_10101                       91.7    3e-20   
ref|XP_009371617.1|  PREDICTED: protein RADIALIS-like 4               91.7    3e-20   
ref|XP_003631660.1|  PREDICTED: protein RADIALIS-like 1               92.0    4e-20   
gb|EYU42614.1|  hypothetical protein MIMGU_mgv1a021827mg              91.7    4e-20   
ref|XP_006577923.1|  PREDICTED: protein RADIALIS-like 6-like isof...  92.0    4e-20   
ref|XP_008220818.1|  PREDICTED: protein RADIALIS-like 6               92.0    4e-20   
ref|XP_007224604.1|  hypothetical protein PRUPE_ppa026982mg           91.7    4e-20   
emb|CBI32595.3|  unnamed protein product                              92.4    4e-20   
ref|XP_010095252.1|  hypothetical protein L484_014592                 91.3    5e-20   
ref|XP_011088399.1|  PREDICTED: transcription factor RADIALIS-like    91.3    5e-20   
ref|XP_010940077.1|  PREDICTED: protein RADIALIS-like 3               91.7    5e-20   
ref|XP_009594360.1|  PREDICTED: protein RADIALIS-like 1               91.3    6e-20   
ref|XP_009336185.1|  PREDICTED: protein RADIALIS-like 3               91.7    6e-20   
gb|KHN33753.1|  DnaJ like subfamily C member 2                        92.0    6e-20   
ref|XP_006340632.1|  PREDICTED: protein RADIALIS-like 6-like          90.9    6e-20   
ref|XP_008352458.1|  PREDICTED: protein RADIALIS-like 4               90.9    6e-20   
ref|XP_007042186.1|  Homeodomain-like superfamily protein             92.8    7e-20   
ref|XP_011092800.1|  PREDICTED: transcription factor RADIALIS-like    91.3    7e-20   
ref|XP_009340740.1|  PREDICTED: protein RADIALIS-like 3               90.9    7e-20   
ref|XP_004287888.1|  PREDICTED: protein RADIALIS-like 6-like          90.5    8e-20   
ref|XP_006595936.1|  PREDICTED: protein RADIALIS-like 1-like isof...  90.5    1e-19   
gb|ABH02884.1|  MYB transcription factor MYB164                       90.9    1e-19   Glycine max [soybeans]
ref|XP_002509493.1|  transcription factor, putative                   90.1    1e-19   Ricinus communis
ref|XP_003545280.1|  PREDICTED: protein RADIALIS-like 1-like isof...  90.9    1e-19   
ref|XP_011004014.1|  PREDICTED: protein RADIALIS-like 3               90.9    1e-19   
ref|XP_009779120.1|  PREDICTED: protein RADIALIS-like 4               90.5    1e-19   
ref|XP_006423271.1|  hypothetical protein CICLE_v10029663mg           90.5    1e-19   
ref|XP_006423270.1|  hypothetical protein CICLE_v10029663mg           90.1    1e-19   
ref|XP_008338377.1|  PREDICTED: protein RADIALIS-like 4               90.1    1e-19   
ref|XP_003569420.1|  PREDICTED: protein RADIALIS-like 4               90.5    1e-19   
ref|NP_001151113.1|  LOC100284746                                     90.5    1e-19   Zea mays [maize]
ref|XP_008388050.1|  PREDICTED: protein RADIALIS-like 6               90.5    2e-19   
emb|CDY59758.1|  BnaC08g49320D                                        90.5    2e-19   
ref|XP_010446463.1|  PREDICTED: protein RADIALIS-like 1               90.5    2e-19   
ref|XP_010690864.1|  PREDICTED: protein RADIALIS-like 3               90.5    2e-19   
ref|XP_008810721.1|  PREDICTED: protein RADIALIS-like 1               89.7    2e-19   
ref|XP_009117377.1|  PREDICTED: protein RADIALIS-like 2               90.1    2e-19   
emb|CDY13797.1|  BnaA09g42990D                                        90.5    2e-19   
ref|XP_008447023.1|  PREDICTED: protein RADIALIS-like 3               90.1    2e-19   
ref|XP_011088407.1|  PREDICTED: protein RADIALIS-like 4               89.7    2e-19   
ref|XP_009602671.1|  PREDICTED: protein RADIALIS-like 4               89.7    2e-19   
ref|XP_004231423.1|  PREDICTED: transcription factor RADIALIS         89.7    2e-19   
ref|XP_006383186.1|  hypothetical protein POPTR_0005s12390g           89.4    2e-19   
ref|XP_002868895.1|  DNA binding protein                              90.1    2e-19   
ref|XP_008800710.1|  PREDICTED: protein RADIALIS-like 1               89.4    2e-19   
ref|XP_009364794.1|  PREDICTED: protein RADIALIS-like 3               89.7    2e-19   
ref|XP_010437040.1|  PREDICTED: protein RADIALIS-like 1               89.7    3e-19   
ref|XP_011083676.1|  PREDICTED: protein RADIALIS-like 4               89.7    3e-19   
ref|XP_004499158.1|  PREDICTED: protein RADIALIS-like 5-like          89.7    3e-19   
emb|CDP07510.1|  unnamed protein product                              89.7    3e-19   
gb|EYU42615.1|  hypothetical protein MIMGU_mgv1a017293mg              89.4    3e-19   
ref|NP_001043662.1|  Os01g0635200                                     89.4    3e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EAY75088.1|  hypothetical protein OsI_02982                        89.4    3e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_002307660.2|  myb family transcription factor family protein   89.0    3e-19   Populus trichocarpa [western balsam poplar]
gb|KHN36107.1|  hypothetical protein glysoja_003230                   89.0    3e-19   
ref|XP_004151090.1|  PREDICTED: protein RADIALIS-like 6-like          89.4    3e-19   
ref|XP_007160753.1|  hypothetical protein PHAVU_001G014300g           89.4    3e-19   
ref|XP_007156953.1|  hypothetical protein PHAVU_002G031300g           88.6    3e-19   
ref|XP_008812249.1|  PREDICTED: protein RADIALIS-like 4               89.4    4e-19   
ref|XP_008241690.1|  PREDICTED: protein RADIALIS-like 4               89.0    4e-19   
emb|CAB43640.1|  putative protein                                     89.4    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195636.2|  protein RAD-like 1                                  89.4    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404620.1|  hypothetical protein EUTSA_v10000389mg           89.4    4e-19   
ref|XP_004961116.1|  PREDICTED: protein RADIALIS-like 3-like          89.4    4e-19   
ref|XP_009761204.1|  PREDICTED: protein RADIALIS-like 1               89.0    4e-19   
ref|XP_002456020.1|  hypothetical protein SORBIDRAFT_03g028960        89.4    4e-19   Sorghum bicolor [broomcorn]
ref|XP_007150886.1|  hypothetical protein PHAVU_004G002400g           88.6    4e-19   
ref|XP_009611761.1|  PREDICTED: protein RADIALIS-like 5               89.0    4e-19   
ref|XP_004291870.1|  PREDICTED: protein RADIALIS-like 6-like          89.4    4e-19   
gb|ABI14756.1|  AtRL1                                                 89.4    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006473515.1|  PREDICTED: protein RADIALIS-like 6-like          89.4    5e-19   
ref|XP_009771192.1|  PREDICTED: protein RADIALIS-like 3               89.0    5e-19   
gb|KDP38508.1|  hypothetical protein JCGZ_04433                       89.0    5e-19   
ref|XP_004252792.1|  PREDICTED: protein RADIALIS-like 3               88.6    6e-19   
ref|XP_010690880.1|  PREDICTED: protein RADIALIS-like 2               88.6    6e-19   
ref|XP_009396486.1|  PREDICTED: protein RADIALIS-like 3               88.2    6e-19   
ref|XP_011003722.1|  PREDICTED: protein RADIALIS-like 3               88.6    6e-19   
ref|XP_008388061.1|  PREDICTED: protein RADIALIS-like 3               88.6    6e-19   
ref|XP_009106182.1|  PREDICTED: protein RADIALIS-like 6               88.6    6e-19   
ref|XP_009380360.1|  PREDICTED: protein RADIALIS-like 3               88.6    7e-19   
ref|XP_008220806.1|  PREDICTED: protein RADIALIS-like 3               88.6    7e-19   
ref|XP_004304977.1|  PREDICTED: protein RADIALIS-like 1-like          89.0    7e-19   
ref|XP_009618694.1|  PREDICTED: protein RADIALIS-like 2               88.2    7e-19   
dbj|BAJ85631.1|  predicted protein                                    88.6    8e-19   
emb|CDY45420.1|  BnaA07g32000D                                        88.2    8e-19   
ref|XP_009406294.1|  PREDICTED: protein RADIALIS-like 3               87.8    8e-19   
ref|XP_006435008.1|  hypothetical protein CICLE_v10003620mg           88.2    8e-19   
ref|XP_006295299.1|  hypothetical protein CARUB_v10024389mg           88.6    8e-19   
gb|KDP26264.1|  hypothetical protein JCGZ_22436                       87.8    9e-19   
ref|XP_009134001.1|  PREDICTED: protein RADIALIS-like 2 isoform X3    88.6    9e-19   
ref|XP_009134000.1|  PREDICTED: protein RADIALIS-like 2 isoform X2    88.6    9e-19   
gb|KHN08900.1|  hypothetical protein glysoja_029477                   88.2    1e-18   
ref|XP_008364991.1|  PREDICTED: protein RADIALIS-like 3               88.2    1e-18   
ref|XP_010102066.1|  DnaJ homolog subfamily C member 2                87.8    1e-18   
ref|XP_004152694.1|  PREDICTED: protein RADIALIS-like 6-like          88.2    1e-18   
ref|NP_001236080.1|  MYB transcription factor MYB142                  87.8    1e-18   
ref|XP_008236902.1|  PREDICTED: protein RADIALIS-like 1               87.0    1e-18   
ref|XP_007203252.1|  hypothetical protein PRUPE_ppa019533mg           87.4    1e-18   
gb|KHN14528.1|  hypothetical protein glysoja_027137                   87.4    1e-18   
ref|XP_006423283.1|  hypothetical protein CICLE_v10029669mg           87.8    1e-18   
gb|KHN41969.1|  hypothetical protein glysoja_003709                   87.0    1e-18   
ref|XP_011025809.1|  PREDICTED: protein RADIALIS-like 3               87.4    1e-18   
ref|NP_177661.1|  protein RADIALIS-like 6                             88.6    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008800712.1|  PREDICTED: protein RADIALIS-like 3               87.8    1e-18   
ref|XP_010539897.1|  PREDICTED: protein RADIALIS-like 5               87.4    1e-18   
gb|EMT00143.1|  DnaJ homolog subfamily C member 2                     87.8    2e-18   
gb|KFK41962.1|  hypothetical protein AALP_AA2G194600                  87.8    2e-18   
emb|CDX83196.1|  BnaA03g23100D                                        88.2    2e-18   
gb|KEH40146.1|  MYB family transcription factor                       87.4    2e-18   
ref|XP_009134002.1|  PREDICTED: protein RADIALIS-like 2 isoform X4    87.8    2e-18   
ref|XP_010060956.1|  PREDICTED: protein RADIALIS-like 3               87.8    2e-18   
gb|KFK32873.1|  hypothetical protein AALP_AA6G298600                  87.4    2e-18   
gb|EMS56253.1|  DnaJ homolog subfamily C member 2                     87.4    2e-18   
ref|XP_002889017.1|  myb family transcription factor                  87.4    2e-18   
ref|XP_007225405.1|  hypothetical protein PRUPE_ppa024375mg           87.4    2e-18   
ref|XP_006342582.1|  PREDICTED: protein RADIALIS-like 6-like          87.0    2e-18   
ref|NP_001077825.1|  protein RADIALIS-like 6                          87.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|ABM97744.1|  RAD                                                   87.0    2e-18   Oreocharis leiophylla
ref|XP_010548326.1|  PREDICTED: protein RADIALIS-like 3               86.7    2e-18   
ref|XP_010061304.1|  PREDICTED: protein RADIALIS-like 3 isoform X1    86.7    2e-18   
ref|XP_006654838.1|  PREDICTED: protein RADIALIS-like 1-like          87.0    3e-18   
gb|EYU32775.1|  hypothetical protein MIMGU_mgv1a016932mg              87.0    3e-18   
ref|XP_009133999.1|  PREDICTED: protein RADIALIS-like 2 isoform X1    88.2    3e-18   
ref|XP_002878564.1|  hypothetical protein ARALYDRAFT_481032           87.0    3e-18   
ref|XP_004151116.1|  PREDICTED: transcription factor RADIALIS-like    86.7    3e-18   
ref|XP_006390328.1|  hypothetical protein EUTSA_v10019367mg           87.0    3e-18   
ref|XP_004230980.1|  PREDICTED: protein RADIALIS-like 4               86.7    3e-18   
gb|KFK30501.1|  hypothetical protein AALP_AA7G270400                  87.0    3e-18   
ref|XP_009340748.1|  PREDICTED: protein RADIALIS-like 4               86.7    3e-18   
ref|XP_010428536.1|  PREDICTED: protein RADIALIS-like 6               87.0    3e-18   
ref|XP_010927372.1|  PREDICTED: protein RADIALIS-like 1               88.6    3e-18   
ref|XP_010416923.1|  PREDICTED: protein RADIALIS-like 2               87.0    3e-18   
gb|AHB59612.1|  putative MYB-related protein 26                       86.3    3e-18   
ref|XP_010102082.1|  DnaJ homolog subfamily C member 1                86.7    3e-18   
ref|XP_009371599.1|  PREDICTED: protein RADIALIS-like 4               86.7    3e-18   
ref|XP_010431894.1|  PREDICTED: protein RADIALIS-like 1               86.7    4e-18   
ref|XP_006409166.1|  hypothetical protein EUTSA_v10023187mg           86.7    4e-18   
ref|XP_010416394.1|  PREDICTED: protein RADIALIS-like 6               86.7    4e-18   
ref|XP_009378514.1|  PREDICTED: protein RADIALIS-like 3               86.7    4e-18   
ref|XP_009128087.1|  PREDICTED: protein RADIALIS-like 6               86.7    4e-18   
ref|XP_010061305.1|  PREDICTED: protein RADIALIS-like 3 isoform X2    86.3    4e-18   
ref|XP_009347537.1|  PREDICTED: protein RADIALIS-like 4               86.7    4e-18   
ref|XP_008236907.1|  PREDICTED: protein RADIALIS-like 3               86.7    4e-18   
gb|EEE55045.1|  hypothetical protein OsJ_02736                        86.3    4e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AEV91165.1|  MYB-related protein                                   86.3    4e-18   
ref|XP_010555296.1|  PREDICTED: protein RADIALIS-like 2               86.7    4e-18   
ref|XP_009785808.1|  PREDICTED: protein RADIALIS-like 1               86.3    5e-18   
ref|XP_006365108.1|  PREDICTED: transcription factor RADIALIS-like    86.3    5e-18   
ref|XP_010471632.1|  PREDICTED: protein RADIALIS-like 6               86.3    5e-18   
ref|XP_010936699.1|  PREDICTED: protein RADIALIS-like 3               86.3    5e-18   
emb|CDY62533.1|  BnaA02g35960D                                        86.3    5e-18   
ref|XP_009616920.1|  PREDICTED: protein RADIALIS-like 6 isoform X2    85.9    6e-18   
ref|XP_006284830.1|  hypothetical protein CARUB_v10006110mg           86.3    6e-18   
ref|XP_009616919.1|  PREDICTED: protein RADIALIS-like 6 isoform X1    85.9    6e-18   
ref|XP_003547982.1|  PREDICTED: protein RADIALIS-like 1-like          85.1    7e-18   
ref|XP_007200670.1|  hypothetical protein PRUPE_ppa015823mg           85.9    7e-18   
gb|EMS68204.1|  DnaJ homolog subfamily C member 2                     85.9    7e-18   
ref|XP_007204842.1|  hypothetical protein PRUPE_ppa026779mg           85.5    8e-18   
emb|CDO97041.1|  unnamed protein product                              85.9    8e-18   
ref|NP_179759.1|  MYB transcription factor RSM1                       85.5    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102249.1|  PREDICTED: protein RADIALIS-like 4               85.1    1e-17   
ref|XP_007156943.1|  hypothetical protein PHAVU_002G030400g           85.5    1e-17   
ref|XP_008444724.1|  PREDICTED: protein RADIALIS-like 4               85.5    1e-17   
ref|XP_004969265.1|  PREDICTED: protein RADIALIS-like 3-like          85.1    1e-17   
ref|XP_006298896.1|  hypothetical protein CARUB_v10015016mg           84.7    1e-17   
emb|CDY46299.1|  BnaA07g02020D                                        84.7    1e-17   
gb|ADE77540.1|  unknown                                               85.5    1e-17   
ref|XP_002441574.1|  hypothetical protein SORBIDRAFT_09g029560        84.7    1e-17   Sorghum bicolor [broomcorn]
ref|XP_002510392.1|  DNA binding protein, putative                    85.1    1e-17   Ricinus communis
emb|CDY42615.1|  BnaC01g00270D                                        85.1    1e-17   
ref|XP_010523611.1|  PREDICTED: protein RADIALIS-like 6               84.7    2e-17   
ref|XP_008465612.1|  PREDICTED: protein RADIALIS-like 3               84.7    2e-17   
ref|XP_010679739.1|  PREDICTED: protein RADIALIS-like 1               84.3    2e-17   
gb|KDO84586.1|  hypothetical protein CISIN_1g034673mg                 84.3    2e-17   
ref|XP_004150820.1|  PREDICTED: transcription factor RADIALIS-like    84.3    2e-17   
ref|XP_008782490.1|  PREDICTED: protein RADIALIS-like 5 isoform X2    84.0    2e-17   
ref|XP_008241676.1|  PREDICTED: protein RADIALIS-like 3               84.3    2e-17   
ref|XP_008447025.1|  PREDICTED: protein RADIALIS-like 1               84.0    3e-17   
ref|XP_002303127.1|  myb family transcription factor family protein   84.3    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010429089.1|  PREDICTED: protein RADIALIS-like 2               84.3    3e-17   
ref|XP_009760253.1|  PREDICTED: protein RADIALIS-like 3               84.3    3e-17   
ref|XP_006365112.1|  PREDICTED: protein RADIALIS-like 5-like          84.0    3e-17   
ref|XP_010497645.1|  PREDICTED: protein RADIALIS-like 2               84.3    3e-17   
ref|XP_009396625.1|  PREDICTED: protein RADIALIS-like 3               85.5    3e-17   
ref|XP_007162062.1|  hypothetical protein PHAVU_001G120400g           85.1    3e-17   
gb|KFK44084.1|  hypothetical protein AALP_AA1G213900                  84.0    3e-17   
ref|XP_007148839.1|  hypothetical protein PHAVU_005G018500g           84.0    3e-17   
ref|XP_004147867.1|  PREDICTED: protein RADIALIS-like 1-like          84.0    4e-17   
ref|XP_002310232.1|  hypothetical protein POPTR_0007s12860g           83.6    4e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010523610.1|  PREDICTED: protein RADIALIS-like 6               83.6    4e-17   
ref|XP_003521116.1|  PREDICTED: protein RADIALIS-like 1-like          83.6    4e-17   
ref|XP_010060952.1|  PREDICTED: protein RADIALIS-like 3               83.6    5e-17   
ref|XP_008338442.1|  PREDICTED: protein RADIALIS-like 1               83.6    5e-17   
gb|KHN12708.1|  hypothetical protein glysoja_008671                   83.6    5e-17   
emb|CDY01398.1|  BnaA07g11710D                                        83.6    5e-17   
ref|XP_006434998.1|  hypothetical protein CICLE_v10003726mg           83.2    5e-17   
ref|XP_006473504.1|  PREDICTED: protein RADIALIS-like 6-like          83.6    5e-17   
gb|KHN00534.1|  hypothetical protein glysoja_000202                   82.8    5e-17   
ref|XP_007136596.1|  hypothetical protein PHAVU_009G058100g           83.2    6e-17   
gb|KHG24713.1|  DnaJ subfamily C member 1                             82.8    6e-17   
ref|XP_006425660.1|  hypothetical protein CICLE_v10026862mg           82.8    6e-17   
ref|XP_002521210.1|  DNA binding protein, putative                    82.8    7e-17   Ricinus communis
ref|XP_006575120.1|  PREDICTED: protein RADIALIS-like 1-like          83.2    7e-17   
gb|AGT17349.1|  hypothetical protein SHCRBa_078_K12_R_140             82.8    7e-17   
gb|ABK96643.1|  unknown                                               83.2    7e-17   Populus trichocarpa x Populus deltoides
ref|XP_009107919.1|  PREDICTED: protein RADIALIS-like 1               82.8    8e-17   
gb|ABN08550.1|  Homeodomain-related                                   82.8    8e-17   
gb|EYU45174.1|  hypothetical protein MIMGU_mgv1a024515mg              82.8    9e-17   
gb|KDO84575.1|  hypothetical protein CISIN_1g041475mg                 84.3    9e-17   
ref|XP_004151125.1|  PREDICTED: transcription factor RADIALIS-like    82.4    9e-17   
gb|KGN44080.1|  hypothetical protein Csa_7G170600                     82.4    9e-17   
ref|XP_003624937.1|  hypothetical protein MTR_7g089210                82.4    9e-17   
ref|XP_002884127.1|  DNA binding protein                              82.4    1e-16   
ref|XP_009774057.1|  PREDICTED: protein RADIALIS-like 5               82.4    1e-16   
ref|XP_008447024.1|  PREDICTED: protein RADIALIS-like 1               82.0    1e-16   
ref|XP_002282280.1|  PREDICTED: protein RADIALIS-like 3               82.4    1e-16   
ref|XP_008810736.1|  PREDICTED: protein RADIALIS-like 3               82.4    1e-16   
ref|XP_006411728.1|  hypothetical protein EUTSA_v10027169mg           82.4    1e-16   
ref|XP_004148844.1|  PREDICTED: transcription factor RADIALIS-like    82.4    1e-16   
ref|XP_010414205.1|  PREDICTED: protein RADIALIS-like 4               82.0    1e-16   
ref|XP_007156055.1|  hypothetical protein PHAVU_003G254500g           81.6    2e-16   
ref|XP_007156054.1|  hypothetical protein PHAVU_003G254400g           81.3    2e-16   
ref|XP_006411987.1|  hypothetical protein EUTSA_v10026710mg           81.6    2e-16   
ref|XP_011024437.1|  PREDICTED: protein RADIALIS-like 3               82.0    2e-16   
ref|XP_002869031.1|  At4g36570                                        81.6    2e-16   
emb|CDY41968.1|  BnaA01g05400D                                        82.0    2e-16   
gb|EPS74147.1|  hypothetical protein M569_00611                       81.3    2e-16   
ref|XP_003554832.1|  PREDICTED: transcription factor RADIALIS-like    81.6    2e-16   
gb|KHN19694.1|  DnaJ like subfamily C member 2                        81.3    2e-16   
ref|NP_001056421.1|  Os05g0579600                                     81.6    2e-16   
emb|CAN75513.1|  hypothetical protein VITISV_020771                   83.6    2e-16   
ref|XP_009605567.1|  PREDICTED: protein RADIALIS-like 1               81.6    2e-16   
ref|XP_003523829.1|  PREDICTED: protein RADIALIS-like 2-like          81.6    2e-16   
ref|XP_007017546.1|  DnaJ subfamily C member 2                        81.6    2e-16   
gb|EMS66288.1|  DnaJ homolog subfamily C member 2                     81.6    3e-16   
gb|KFK40224.1|  hypothetical protein AALP_AA3G346800                  81.3    3e-16   
ref|XP_006581206.1|  PREDICTED: protein RADIALIS-like 2-like          81.3    3e-16   
ref|XP_009419867.1|  PREDICTED: protein RADIALIS-like 3               81.3    3e-16   
ref|XP_008460938.1|  PREDICTED: protein RADIALIS-like 2               82.0    3e-16   
gb|KHN00535.1|  hypothetical protein glysoja_000203                   80.9    3e-16   
ref|XP_008447294.1|  PREDICTED: protein RADIALIS-like 2               81.3    3e-16   
ref|XP_011025785.1|  PREDICTED: protein RADIALIS-like 4               81.3    3e-16   
ref|XP_006840264.1|  hypothetical protein AMTR_s00045p00040070        81.6    4e-16   
ref|XP_007145477.1|  hypothetical protein PHAVU_007G242300g           80.9    4e-16   
ref|XP_006878579.1|  hypothetical protein AMTR_s00011p00247840        81.3    4e-16   
gb|EPS66061.1|  hypothetical protein M569_08717                       81.3    4e-16   
ref|XP_003598418.1|  RADIALIS                                         80.9    4e-16   
gb|ABI14753.1|  myb-like protein RL4                                  80.5    5e-16   
ref|XP_006303004.1|  hypothetical protein CARUB_v10021157mg           81.3    5e-16   
ref|XP_011074553.1|  PREDICTED: protein RADIALIS-like 3               80.9    6e-16   
ref|XP_010477169.1|  PREDICTED: protein RADIALIS-like 5               80.9    6e-16   
ref|XP_003629427.1|  RAD                                              80.1    6e-16   
ref|XP_003629426.1|  MYB transcription factor MYB164                  80.1    6e-16   
emb|CDY29227.1|  BnaA06g25300D                                        80.1    6e-16   
ref|XP_004509270.1|  PREDICTED: protein RADIALIS-like 1-like          79.7    7e-16   
ref|XP_009140298.1|  PREDICTED: protein RADIALIS-like 2               80.5    7e-16   
gb|ABI14752.1|  myb-like protein RL3                                  80.1    7e-16   
ref|XP_010446777.1|  PREDICTED: protein RADIALIS-like 3               79.7    8e-16   
ref|XP_009400078.1|  PREDICTED: protein RADIALIS-like 4 isoform X3    79.7    8e-16   
gb|AES94986.2|  MYB family transcription factor                       79.3    8e-16   
ref|XP_006416498.1|  hypothetical protein EUTSA_v10009748mg           80.1    9e-16   
ref|XP_006573585.1|  PREDICTED: protein RADIALIS-like 1-like          80.5    9e-16   
gb|KGN44073.1|  hypothetical protein Csa_7G168060                     79.7    9e-16   
emb|CDX69233.1|  BnaC01g02200D                                        79.3    1e-15   
emb|CDX99575.1|  BnaC04g33320D                                        80.1    1e-15   
ref|XP_009389415.1|  PREDICTED: protein RADIALIS-like 3               79.3    1e-15   
gb|KDP24350.1|  hypothetical protein JCGZ_25646                       80.5    1e-15   
ref|XP_009400076.1|  PREDICTED: protein RADIALIS-like 4 isoform X1    79.7    1e-15   
ref|XP_009400077.1|  PREDICTED: protein RADIALIS-like 4 isoform X2    79.7    1e-15   
gb|KHN17912.1|  hypothetical protein glysoja_017963                   79.7    1e-15   
ref|XP_009588768.1|  PREDICTED: protein RADIALIS-like 3               79.7    1e-15   
gb|KHN36130.1|  DnaJ like subfamily C member 2                        79.7    1e-15   
ref|XP_009109324.1|  PREDICTED: protein RADIALIS-like 3               79.0    1e-15   
ref|XP_007046916.1|  RAD-like 6                                       80.9    1e-15   
emb|CDY15877.1|  BnaA04g12340D                                        80.5    1e-15   
ref|XP_010467643.1|  PREDICTED: protein RADIALIS-like 4               79.0    1e-15   
ref|XP_009607881.1|  PREDICTED: protein RADIALIS-like 5               79.3    1e-15   
ref|XP_006282757.1|  hypothetical protein CARUB_v10006084mg           79.7    1e-15   
ref|XP_004163210.1|  PREDICTED: uncharacterized LOC101221093          81.6    2e-15   
ref|XP_009143738.1|  PREDICTED: protein RADIALIS-like 3               79.0    2e-15   
ref|XP_003537461.1|  PREDICTED: protein RADIALIS-like 6-like          80.5    2e-15   
ref|XP_010498374.1|  PREDICTED: protein RADIALIS-like 5               79.3    2e-15   
ref|NP_564087.2|  protein RADIALIS-like 5                             79.3    2e-15   
ref|XP_010230972.1|  PREDICTED: protein RADIALIS-like 3               79.3    2e-15   
ref|XP_004287896.1|  PREDICTED: protein RADIALIS-like 1-like          79.0    2e-15   
gb|ACN32306.1|  RADIALIS                                              79.0    2e-15   
ref|XP_004149425.1|  PREDICTED: uncharacterized protein LOC101221093  81.6    2e-15   
ref|NP_001233849.1|  SANT/MYB domain protein                          79.0    2e-15   
gb|AAD39593.1|AC007858_7  10A19I.8                                    82.0    2e-15   
ref|XP_009150735.1|  PREDICTED: protein RADIALIS-like 4               78.6    2e-15   
ref|XP_006304325.1|  hypothetical protein CARUB_v10010724mg           79.3    2e-15   
ref|XP_009796752.1|  PREDICTED: protein RADIALIS-like 1               79.0    2e-15   
gb|KHN07576.1|  hypothetical protein glysoja_019683                   79.0    3e-15   
gb|KHN41976.1|  DnaJ like subfamily C member 2                        79.0    3e-15   
ref|NP_001147409.1|  RADIALIS                                         79.0    3e-15   
ref|XP_009149439.1|  PREDICTED: protein RADIALIS-like 5               79.0    3e-15   
emb|CDY59631.1|  BnaC07g48440D                                        78.6    3e-15   
ref|XP_004147863.1|  PREDICTED: protein RADIALIS-like 3-like          78.6    3e-15   
ref|XP_010531038.1|  PREDICTED: protein RADIALIS-like 3               78.2    4e-15   
ref|XP_006655628.1|  PREDICTED: protein RADIALIS-like 3-like          78.6    4e-15   
emb|CDY36474.1|  BnaC03g48330D                                        77.8    4e-15   
ref|XP_010432165.1|  PREDICTED: protein RADIALIS-like 3               77.8    4e-15   
gb|EYU45166.1|  hypothetical protein MIMGU_mgv1a021320mg              77.8    4e-15   
ref|XP_004249320.1|  PREDICTED: protein RADIALIS-like 1               78.2    4e-15   
ref|XP_007163428.1|  hypothetical protein PHAVU_001G233900g           77.8    4e-15   
emb|CDY39383.1|  BnaC05g15040D                                        78.2    5e-15   
gb|KHN11104.1|  hypothetical protein glysoja_033658                   77.0    6e-15   
gb|EYU32780.1|  hypothetical protein MIMGU_mgv1a024989mg              77.8    7e-15   
ref|XP_004509271.1|  PREDICTED: protein RADIALIS-like 1-like          77.0    7e-15   
gb|KHG28372.1|  DnaJ subfamily C member 2                             77.4    7e-15   
ref|XP_009791349.1|  PREDICTED: protein RADIALIS-like 5               77.4    8e-15   
ref|XP_008800711.1|  PREDICTED: protein RADIALIS-like 3               77.0    8e-15   
gb|KDO36093.1|  hypothetical protein CISIN_1g041937mg                 77.0    8e-15   
ref|XP_009103382.1|  PREDICTED: protein RADIALIS-like 5               77.4    9e-15   
ref|XP_003612028.1|  MYB transcription factor MYB164                  77.0    9e-15   
ref|XP_003527513.1|  PREDICTED: protein RADIALIS-like 1-like isof...  77.0    1e-14   
gb|ABR16097.1|  unknown                                               80.1    1e-14   
gb|KHN41254.1|  hypothetical protein glysoja_017298                   77.0    1e-14   
ref|XP_006467147.1|  PREDICTED: protein RADIALIS-like 5-like          77.0    1e-14   
ref|XP_006425671.1|  hypothetical protein CICLE_v10026848mg           77.0    1e-14   
emb|CDP02018.1|  unnamed protein product                              76.6    1e-14   
ref|XP_009586717.1|  PREDICTED: protein RADIALIS-like 5               76.6    1e-14   
gb|KHG17860.1|  DnaJ subfamily C member 2                             76.6    2e-14   
gb|KEH36157.1|  MYB family transcription factor                       76.6    2e-14   
ref|XP_006582375.1|  PREDICTED: protein RADIALIS-like 1-like isof...  77.8    2e-14   
gb|ABR28346.1|  MYB transcription factor MYB114                       76.3    2e-14   
ref|XP_006341944.1|  PREDICTED: protein RADIALIS-like 1-like          76.3    2e-14   
ref|XP_004501011.1|  PREDICTED: protein RADIALIS-like 1-like          76.3    2e-14   
gb|EEE64814.1|  hypothetical protein OsJ_19670                        76.6    2e-14   
ref|XP_008650058.1|  PREDICTED: protein RADIALIS-like 3               76.6    2e-14   
ref|XP_006590687.1|  PREDICTED: protein RADIALIS-like 1-like          77.0    2e-14   
ref|XP_003522889.2|  PREDICTED: protein RADIALIS-like 1-like          76.6    2e-14   
gb|EAY99167.1|  hypothetical protein OsI_21126                        76.6    2e-14   
gb|AAD39594.1|AC007858_8  10A19I.9                                    77.0    2e-14   
ref|XP_002441575.1|  hypothetical protein SORBIDRAFT_09g029575        75.5    3e-14   
gb|KHN12318.1|  hypothetical protein glysoja_034410                   75.9    3e-14   
ref|XP_003611998.1|  MYB transcription factor MYB164                  75.9    3e-14   
ref|XP_002310233.1|  hypothetical protein POPTR_0007s12870g           75.5    3e-14   
gb|AGT17350.1|  hypothetical protein SHCRBa_078_K12_R_170             76.3    4e-14   
gb|ABK28092.1|  unknown                                               75.1    4e-14   
gb|AFX97759.1|  DNA binding protein                                   75.1    4e-14   
ref|XP_008447026.1|  PREDICTED: protein RADIALIS-like 1               75.1    4e-14   
ref|NP_001077912.1|  protein RADIALIS-like 4                          75.1    4e-14   
ref|XP_009411227.1|  PREDICTED: protein RADIALIS-like 4               75.1    5e-14   
gb|EPS58871.1|  hypothetical protein M569_15942                       74.3    5e-14   
ref|XP_003629431.1|  SANT/MYB protein                                 74.3    5e-14   
ref|XP_007046939.1|  RAD-like 1                                       75.5    5e-14   
ref|XP_004238300.1|  PREDICTED: protein RADIALIS-like 3               74.7    8e-14   
gb|KEH24745.1|  transcription factor radialis-like protein            73.9    1e-13   
ref|XP_006339257.1|  PREDICTED: protein RADIALIS-like 1-like          73.9    1e-13   
gb|KGN44078.1|  hypothetical protein Csa_7G169590                     73.6    1e-13   
ref|XP_011025788.1|  PREDICTED: protein RADIALIS-like 3               74.3    1e-13   
gb|KHG23691.1|  DnaJ subfamily C member 2                             73.9    1e-13   
gb|ABH02889.1|  MYB transcription factor MYB97                        73.9    1e-13   
ref|XP_004499797.1|  PREDICTED: protein RADIALIS-like 1-like          73.6    2e-13   
gb|EMT31622.1|  hypothetical protein F775_10816                       73.6    2e-13   
ref|XP_010089027.1|  hypothetical protein L484_020313                 73.6    2e-13   
ref|XP_004173942.1|  PREDICTED: protein RADIALIS-like 6-like          73.6    2e-13   
ref|XP_004489311.1|  PREDICTED: transcription factor RADIALIS-like    72.8    2e-13   
ref|XP_008444713.1|  PREDICTED: protein RADIALIS-like 4               73.6    2e-13   
ref|XP_004152778.1|  PREDICTED: protein RADIALIS-like 6-like          73.6    2e-13   
gb|KGN62599.1|  hypothetical protein Csa_2G361640                     73.2    3e-13   
ref|XP_004961115.1|  PREDICTED: protein RADIALIS-like 3-like          72.8    4e-13   
ref|XP_006647765.1|  PREDICTED: protein RADIALIS-like 3-like isof...  72.0    6e-13   
ref|XP_006656973.1|  PREDICTED: polygalacturonase At1g48100-like      76.3    8e-13   
ref|XP_006342713.1|  PREDICTED: protein RADIALIS-like 5-like          71.6    9e-13   
ref|XP_006847792.1|  hypothetical protein AMTR_s00029p00021500        72.8    1e-12   
gb|ABA99223.1|  Myb-related protein, putative                         71.6    1e-12   
ref|XP_002458271.1|  hypothetical protein SORBIDRAFT_03g030330        70.5    2e-12   
gb|KHN43075.1|  DnaJ like subfamily C member 2                        71.6    2e-12   
ref|XP_010314640.1|  PREDICTED: protein RADIALIS-like 5               70.1    2e-12   
ref|XP_010029804.1|  PREDICTED: protein RADIALIS-like 6               70.5    3e-12   
gb|AFM92051.1|  RADIALIS                                              68.9    3e-12   
ref|XP_007153178.1|  hypothetical protein PHAVU_003G013600g           72.8    4e-12   
ref|XP_008810723.1|  PREDICTED: protein RADIALIS-like 4               68.9    5e-12   
emb|CDM83643.1|  unnamed protein product                              69.3    5e-12   
gb|ADX59503.1|  RADIALIS                                              68.2    6e-12   
gb|AFM92012.1|  RADIALIS                                              68.2    7e-12   
gb|ADX59507.1|  RADIALIS                                              68.2    8e-12   
ref|XP_009402284.1|  PREDICTED: transcription factor DIVARICATA-like  73.2    8e-12   
ref|XP_008810724.1|  PREDICTED: protein RADIALIS-like 4               68.2    8e-12   
ref|XP_006646177.1|  PREDICTED: protein RADIALIS-like 3-like          68.9    9e-12   
ref|XP_011077580.1|  PREDICTED: transcription factor DIVARICATA-like  72.0    9e-12   
ref|XP_006855645.1|  hypothetical protein AMTR_s00044p00109210        69.7    9e-12   
ref|XP_003555779.1|  PREDICTED: transcription factor DIVARICATA-l...  72.0    9e-12   
ref|XP_009405682.1|  PREDICTED: protein RADIALIS-like 3               68.6    9e-12   
ref|XP_010249061.1|  PREDICTED: transcription factor DIVARICATA-l...  72.0    1e-11   
gb|KHN46169.1|  Transcription factor MYB1R1                           71.6    1e-11   
tpg|DAA58242.1|  TPA: putative homeodomain-like transcription fac...  68.6    1e-11   
gb|AFM92054.1|  RADIALIS                                              67.4    1e-11   
ref|XP_008785421.1|  PREDICTED: transcription factor DIVARICATA i...  71.2    1e-11   
ref|XP_003569501.1|  PREDICTED: protein RADIALIS-like 3               68.6    1e-11   
ref|XP_003519244.1|  PREDICTED: transcription factor DIVARICATA       71.6    1e-11   
ref|XP_009407033.1|  PREDICTED: protein RADIALIS-like 4               69.3    1e-11   
ref|XP_009389416.1|  PREDICTED: protein RADIALIS-like 4               68.6    1e-11   
ref|XP_010249027.1|  PREDICTED: transcription factor DIVARICATA-l...  72.0    1e-11   
ref|XP_010256655.1|  PREDICTED: transcription factor DIVARICATA-like  71.6    1e-11   
ref|XP_006848111.1|  hypothetical protein AMTR_s00029p00215750        71.2    2e-11   
ref|XP_008785419.1|  PREDICTED: transcription factor DIVARICATA i...  71.2    2e-11   
ref|XP_010262772.1|  PREDICTED: transcription factor DIVARICATA-like  70.9    2e-11   
ref|XP_003529238.1|  PREDICTED: transcription factor DIVARICATA-l...  70.9    2e-11   
dbj|BAB90737.1|  hypothetical protein                                 67.4    3e-11   
ref|NP_001148292.1|  SANT/MYB protein                                 67.4    3e-11   
gb|EPS60201.1|  hypothetical protein M569_14602                       70.1    3e-11   
ref|XP_006437648.1|  hypothetical protein CICLE_v10032259mg           70.5    3e-11   
gb|KDO69927.1|  hypothetical protein CISIN_1g022439mg                 70.5    3e-11   
gb|ACN32305.1|  RADIALIS                                              67.0    3e-11   
ref|XP_004953619.1|  PREDICTED: protein RADIALIS-like 5-like          67.4    3e-11   
ref|XP_003532025.1|  PREDICTED: transcription factor DIVARICATA-l...  70.5    4e-11   
gb|KHN10618.1|  Transcription factor MYB1R1                           70.5    4e-11   
ref|NP_001147389.1|  SANT/MYB protein                                 66.6    4e-11   
ref|XP_009589244.1|  PREDICTED: transcription factor DIVARICATA-like  69.7    4e-11   
ref|NP_001235675.1|  MYB transcription factor MYB57                   70.1    5e-11   
gb|EMT32489.1|  hypothetical protein F775_12961                       66.6    5e-11   
gb|KHN20067.1|  hypothetical protein glysoja_014645                   66.6    5e-11   
gb|ADW84277.1|  RADIALIS                                              65.9    5e-11   
ref|XP_009786719.1|  PREDICTED: transcription factor DIVARICATA-like  69.7    5e-11   
gb|KHN14065.1|  hypothetical protein glysoja_048339                   67.4    5e-11   
ref|XP_001754431.1|  predicted protein                                68.2    5e-11   
gb|KHN40253.1|  hypothetical protein glysoja_038936                   67.8    5e-11   
ref|XP_009770756.1|  PREDICTED: transcription factor DIVARICATA       69.7    5e-11   
emb|CDP18453.1|  unnamed protein product                              69.7    5e-11   
ref|NP_001240091.1|  uncharacterized protein LOC100819797             69.7    5e-11   
gb|KDP40478.1|  hypothetical protein JCGZ_24477                       69.7    6e-11   
ref|XP_010279472.1|  PREDICTED: transcription factor DIVARICATA       69.7    6e-11   
ref|XP_011024174.1|  PREDICTED: transcription factor DIVARICATA-like  68.9    6e-11   



>ref|XP_002509490.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF50877.1| DNA binding protein, putative [Ricinus communis]
Length=107

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +D+DTPDRW N+AR VG K+P EVK+ YD+LV D+K+IESG VP 
Sbjct  14   WTAQQNKAFERALAVYDKDTPDRWANVARAVGGKTPEEVKRHYDLLVEDVKYIESGQVPF  73

Query  389  PNYRSTGTR  363
            PNYR+TGTR
Sbjct  74   PNYRTTGTR  82



>ref|XP_003631666.1| PREDICTED: protein RADIALIS-like 3 [Vitis vinifera]
 emb|CBI32600.3| unnamed protein product [Vitis vinifera]
Length=96

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 58/68 (85%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT+ QNK FE+ALA +D+DTPDRWQN+A+ VG KS  EVK+ Y+IL+ DLKHIESG VP+
Sbjct  12   WTSKQNKLFEKALALYDKDTPDRWQNVAKAVGGKSAEEVKRHYEILIEDLKHIESGHVPI  71

Query  389  PNYRSTGT  366
            PNY+STG+
Sbjct  72   PNYKSTGS  79



>emb|CDP02010.1| unnamed protein product [Coffea canephora]
Length=80

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVGKSPAEVKQLYDILVHDLKHIESGDVPVP  387
            WTA +NK FE+ALA++D+DT DRWQN+AR VGK+  EVK+ Y ILV DLKHIESG+VP P
Sbjct  12   WTAKENKLFEKALAKYDKDTADRWQNVARAVGKTEEEVKRHYQILVEDLKHIESGNVPFP  71

Query  386  NYRSTGTRR  360
            NYRS   +R
Sbjct  72   NYRSGRNKR  80



>ref|XP_011099630.1| PREDICTED: protein RADIALIS-like 3 [Sesamum indicum]
 ref|XP_011099631.1| PREDICTED: protein RADIALIS-like 3 [Sesamum indicum]
Length=86

 Score =   101 bits (251),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNKQFE+ALA +D+DTPDRWQNIAR V GKS  EVK+ Y+ILV DLKHIESG+ P 
Sbjct  17   WTPKQNKQFEKALAVYDKDTPDRWQNIARAVGGKSAEEVKRHYEILVEDLKHIESGNYPF  76

Query  389  PNYRSTGTRR  360
            PNYR+ G  R
Sbjct  77   PNYRTNGNSR  86



>ref|XP_007042177.1| DnaJ subfamily C member 2 [Theobroma cacao]
 gb|EOX98008.1| DnaJ subfamily C member 2 [Theobroma cacao]
Length=139

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS SL SR S SWTA QNK FE+ALA++D+DTPDRW N+A+ V GK+  EVK+ Y+ILV
Sbjct  1    MASSSLQSRDSVSWTAKQNKLFEKALAKYDKDTPDRWHNVAKAVGGKTAEEVKRHYEILV  60

Query  428  HDLKHIESGDVPVPNYRSTG  369
             DLKHIESG VP+PNYRSTG
Sbjct  61   EDLKHIESGRVPIPNYRSTG  80



>ref|XP_002305430.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE85941.1| myb family transcription factor family protein [Populus trichocarpa]
Length=99

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +DRDTPDRW N+AR V GK+  EVK+ Y+ILV D+KHIESG VP 
Sbjct  14   WTAQQNKAFERALAVYDRDTPDRWHNVARAVGGKTAEEVKRHYEILVEDVKHIESGRVPF  73

Query  389  PNYRSTG  369
            PNYR+TG
Sbjct  74   PNYRTTG  80



>ref|XP_007131828.1| hypothetical protein PHAVU_011G044900g [Phaseolus vulgaris]
 gb|ESW03822.1| hypothetical protein PHAVU_011G044900g [Phaseolus vulgaris]
Length=100

 Score = 99.4 bits (246),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA++D+DTPDRWQN+A  VG KSP EVK+ Y+IL+ DL+HIESG VP+
Sbjct  16   WTPKQNKLFEKALAKYDKDTPDRWQNVATAVGDKSPDEVKRHYEILLEDLRHIESGHVPL  75

Query  389  PNYRSTGT  366
            P YRSTG+
Sbjct  76   PKYRSTGS  83



>gb|KDP46257.1| hypothetical protein JCGZ_10097 [Jatropha curcas]
Length=84

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +D+DTPDRW N+AR V GK+  EVK+ Y++LV D+K+IESG VP 
Sbjct  14   WTAQQNKAFERALAVYDKDTPDRWANVARAVGGKTADEVKRHYELLVRDVKYIESGQVPF  73

Query  389  PNYRSTGTR  363
            PNYR+TGTR
Sbjct  74   PNYRTTGTR  82



>ref|XP_009603278.1| PREDICTED: protein RADIALIS-like 1 [Nicotiana tomentosiformis]
 ref|XP_009603279.1| PREDICTED: protein RADIALIS-like 1 [Nicotiana tomentosiformis]
Length=79

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  +NK+FE+ALA +D+DTPDRWQNIA+ VG  KS  +VKQ Y IL+ DLKHIESGDVP
Sbjct  9    WTPKENKKFEQALAVYDKDTPDRWQNIAKYVGGGKSVEDVKQHYAILIEDLKHIESGDVP  68

Query  392  VPNYRSTGTRR  360
             P YRS G  R
Sbjct  69   FPKYRSGGNSR  79



>ref|XP_011048444.1| PREDICTED: protein RADIALIS-like 1 [Populus euphratica]
Length=87

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +DRDTPDRW N+AR V GK+  EVK+ Y++LV D+KHIESG VP 
Sbjct  14   WTAQQNKAFERALAVYDRDTPDRWYNVARAVGGKTAEEVKRHYELLVEDVKHIESGHVPF  73

Query  389  PNYRSTG  369
            PNYR+TG
Sbjct  74   PNYRTTG  80



>ref|XP_010028595.1| PREDICTED: protein RADIALIS-like 1 [Eucalyptus grandis]
 gb|KCW55358.1| hypothetical protein EUGRSUZ_I01273 [Eucalyptus grandis]
Length=85

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FEEALA +D+DTPDRW N+A+ V GK+  EVK+ Y++LV D+KHIESG VP 
Sbjct  13   WTAKQNKAFEEALAVYDKDTPDRWHNVAKAVGGKTAEEVKRHYELLVEDVKHIESGRVPF  72

Query  389  PNYRSTG  369
            PNYR+TG
Sbjct  73   PNYRTTG  79



>ref|XP_004289671.1| PREDICTED: transcription factor RADIALIS-like [Fragaria vesca 
subsp. vesca]
Length=100

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTPDRW N+AR VG K+P EVK+ YD+LV D+KHIESG VP 
Sbjct  15   WTAKQNKAFEKALALYDKDTPDRWYNVARAVGNKTPEEVKRHYDLLVEDVKHIESGQVPF  74

Query  389  PNYRSTG  369
            P+YR++G
Sbjct  75   PDYRTSG  81



>ref|XP_009786616.1| PREDICTED: protein RADIALIS-like 1 [Nicotiana sylvestris]
Length=79

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  +NK+FE+ALA +D+DTPDRWQNIA+ V  GKS  +VKQ Y IL+ DLKHIESGDVP
Sbjct  9    WTPKENKKFEQALAVYDKDTPDRWQNIAKYVGGGKSVDDVKQHYAILIEDLKHIESGDVP  68

Query  392  VPNYRSTGTRR  360
             P YRS G  R
Sbjct  69   FPKYRSGGNSR  79



>ref|XP_003540679.1| PREDICTED: protein RADIALIS-like 1-like [Glycine max]
Length=100

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA++D+DTPDRWQN+A+ V GKS  EVK+ Y+IL+ DL+HIESG VP+
Sbjct  16   WTPKQNKLFEKALAKYDKDTPDRWQNVAKAVGGKSADEVKRHYEILLEDLRHIESGHVPL  75

Query  389  PNYRSTGT  366
            P Y+STG+
Sbjct  76   PKYKSTGS  83



>gb|KHN25378.1| hypothetical protein glysoja_010295 [Glycine soja]
Length=92

 Score = 97.4 bits (241),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA++D+DTPDRWQN+A+ V GKS  EVK+ Y+IL+ DL+HIESG VP+
Sbjct  16   WTPKQNKLFEKALAKYDKDTPDRWQNVAKAVGGKSADEVKRHYEILLEDLRHIESGHVPL  75

Query  389  PNYRSTGT  366
            P Y+STG+
Sbjct  76   PKYKSTGS  83



>ref|XP_011037522.1| PREDICTED: protein RADIALIS-like 2 [Populus euphratica]
Length=88

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +D+DTPDRW N+AR V GK+  EVK+ Y++LV D+KHIESG VP 
Sbjct  14   WTAQQNKAFERALAVYDKDTPDRWHNVARAVGGKTAEEVKRHYELLVEDVKHIESGRVPF  73

Query  389  PNYRSTG  369
            PNYR+TG
Sbjct  74   PNYRTTG  80



>ref|XP_009390189.1| PREDICTED: protein RADIALIS-like 3 [Musa acuminata subsp. malaccensis]
Length=92

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 66/83 (80%), Gaps = 2/83 (2%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDIL  432
            MAS SLS  ++SSWT  QNK FE ALA +D+DTPDRWQN+AR V  GK+  EVK+ Y++L
Sbjct  1    MASGSLSRGSTSSWTPQQNKLFERALAVYDKDTPDRWQNVARAVGGGKTAEEVKKHYELL  60

Query  431  VHDLKHIESGDVPVPNYRSTGTR  363
            + DL+HIESG VP PNY+S+G+R
Sbjct  61   LEDLEHIESGRVPYPNYKSSGSR  83



>ref|XP_007017563.1| RAD-like 6 [Theobroma cacao]
 gb|EOY14788.1| RAD-like 6 [Theobroma cacao]
Length=86

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DTPDRWQ +A  VG KS  EV++ Y+ILV DL +IESG VP+
Sbjct  16   WTPKQNKLFEKALAVYDKDTPDRWQKVAAAVGEKSAEEVRRHYEILVADLMYIESGQVPI  75

Query  389  PNYRSTGTRRR  357
            PNYRSTG+ RR
Sbjct  76   PNYRSTGSNRR  86



>ref|XP_010254802.1| PREDICTED: protein RADIALIS-like 3 [Nelumbo nucifera]
Length=99

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DTPDRW N+AR V GKS  EVK+ Y+IL+ DLK+IESG VP 
Sbjct  13   WTPKQNKLFEKALALYDKDTPDRWHNVARAVGGKSAEEVKRHYEILIEDLKYIESGQVPF  72

Query  389  PNYRSTGTRRR  357
            PNYRS+G+  +
Sbjct  73   PNYRSSGSHSK  83



>ref|XP_007141400.1| hypothetical protein PHAVU_008G192200g [Phaseolus vulgaris]
 gb|ESW13394.1| hypothetical protein PHAVU_008G192200g [Phaseolus vulgaris]
Length=96

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNKQFE ALA +D+DTPDRWQNIAR VG KS  EVK+ Y+IL+ DL+HIESG VP+
Sbjct  15   WTRMQNKQFESALALYDQDTPDRWQNIARIVGDKSAEEVKKHYEILLEDLRHIESGRVPI  74

Query  389  PNYRSTGTR  363
            P Y+ST  R
Sbjct  75   PTYKSTHDR  83



>ref|XP_010254825.1| PREDICTED: protein RADIALIS-like 3 isoform X2 [Nelumbo nucifera]
Length=101

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTPDRWQNIA+ V GK+  EVK+ Y+IL+ DL HIESG VP 
Sbjct  14   WTAKQNKLFEKALAIYDKDTPDRWQNIAKAVGGKTVEEVKRHYEILIEDLNHIESGKVPF  73

Query  389  PNYRSTG  369
            PNY+ TG
Sbjct  74   PNYKMTG  80



>ref|XP_002313794.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE87749.1| myb family transcription factor family protein [Populus trichocarpa]
Length=87

 Score = 96.3 bits (238),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +DRDTPDRW N+AR V GK+  EVK+ Y++LV D+KHIESG VP 
Sbjct  14   WTVQQNKAFERALAVYDRDTPDRWYNVARAVGGKTAEEVKRHYELLVEDVKHIESGHVPF  73

Query  389  PNYRSTG  369
            PNYR+TG
Sbjct  74   PNYRTTG  80



>ref|XP_003603930.1| DnaJ homolog subfamily C member [Medicago truncatula]
 gb|AES74181.1| MYB family transcription factor [Medicago truncatula]
Length=81

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA+ D+DTPDRWQN+A+ V GKS  EVK+ Y++L+ DLKHIESG VP+
Sbjct  16   WTPKQNKLFEKALAKFDKDTPDRWQNVAKAVGGKSVEEVKRHYELLLEDLKHIESGHVPI  75

Query  389  PNYRST  372
            PNY+ST
Sbjct  76   PNYKST  81



>sp|Q58FS3.1|RAD_ANTMA RecName: Full=Transcription factor RADIALIS [Antirrhinum majus]
 pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription 
Factor From Antirrhinum Majus
 gb|AAX48042.1| RADIALIS [Antirrhinum majus]
Length=93

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            W+A +NK FE ALA +D+DTPDRW N+AR V G++P EVK+ Y+ILV D+K+IESG VP 
Sbjct  11   WSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF  70

Query  389  PNYRSTG  369
            PNYR+TG
Sbjct  71   PNYRTTG  77



>ref|XP_003537885.2| PREDICTED: protein RADIALIS-like 1-like [Glycine max]
 gb|KHN39786.1| DnaJ like subfamily C member 2 [Glycine soja]
Length=100

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA++D+DTP+RWQN+A+ V GKS  EVK+ Y+IL+ DL+HIESG VP+
Sbjct  16   WTPKQNKLFEKALAKYDKDTPERWQNVAKAVGGKSADEVKRHYEILLEDLRHIESGRVPL  75

Query  389  PNYRSTGT  366
            P Y+STG+
Sbjct  76   PKYKSTGS  83



>ref|XP_004292033.1| PREDICTED: protein RADIALIS-like 6-like [Fragaria vesca subsp. 
vesca]
Length=101

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 2/68 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE ALA +D+DTPDRWQN+A+ VG  K+P EVK+ YDIL+ DL+ IESG VP
Sbjct  15   WTPKQNKVFERALALYDKDTPDRWQNVAKAVGGNKTPEEVKRHYDILLEDLRQIESGQVP  74

Query  392  VPNYRSTG  369
            +PNY+S G
Sbjct  75   IPNYKSLG  82



>ref|XP_010649137.1| PREDICTED: protein RADIALIS-like 3 [Vitis vinifera]
Length=79

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA++D+DTPDRWQNIA+ V GKS  EVK+ Y+IL+ D+KHIESG VP 
Sbjct  16   WTPKQNKLFEKALAKYDKDTPDRWQNIAKAVGGKSAEEVKRHYEILIEDVKHIESGKVPF  75

Query  389  PNYR  378
            PNYR
Sbjct  76   PNYR  79



>ref|XP_011028852.1| PREDICTED: protein RADIALIS-like 5 [Populus euphratica]
Length=99

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTPDRWQN+A+ VG KS  EVK+ YD LV DL +IESG VP+
Sbjct  14   WTAKQNKLFEKALAVYDKDTPDRWQNVAKAVGSKSAEEVKRHYDRLVEDLVYIESGQVPL  73

Query  389  PNYRSTGTRRR  357
            PNY+ TG+  R
Sbjct  74   PNYKPTGSSGR  84



>ref|XP_011083673.1| PREDICTED: protein RADIALIS-like 3 [Sesamum indicum]
Length=101

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT+ QNKQFEEALA +D+DTPDRW NIAR V GKS  EV++ Y+ILV D+  IE+  VP+
Sbjct  16   WTSKQNKQFEEALAMYDKDTPDRWHNIARAVGGKSAEEVRRHYEILVKDIMQIETDQVPI  75

Query  389  PNYRSTGTRRR  357
            PNYR+ G+  R
Sbjct  76   PNYRAMGSNSR  86



>ref|XP_010254824.1| PREDICTED: protein RADIALIS-like 1 isoform X1 [Nelumbo nucifera]
Length=122

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTPDRWQNIA+ V GK+  EVK+ Y+IL+ DL HIESG VP 
Sbjct  14   WTAKQNKLFEKALAIYDKDTPDRWQNIAKAVGGKTVEEVKRHYEILIEDLNHIESGKVPF  73

Query  389  PNYRSTG  369
            PNY+ TG
Sbjct  74   PNYKMTG  80



>ref|XP_003631667.1| PREDICTED: protein RADIALIS-like 3 [Vitis vinifera]
 emb|CAN74946.1| hypothetical protein VITISV_007698 [Vitis vinifera]
Length=75

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +DRDTPDRWQN+A  V GKS  EVKQ Y+IL+ DLKHIESG VP+
Sbjct  12   WTPKQNKLFEKALALYDRDTPDRWQNVANAVGGKSAEEVKQHYEILIRDLKHIESGRVPI  71

Query  389  PNYR  378
            PNY+
Sbjct  72   PNYK  75



>ref|XP_010664694.1| PREDICTED: protein RADIALIS-like 3 isoform X1 [Vitis vinifera]
Length=94

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE AL  +D+DTPDRWQN+AR V GK+  EVK+ Y++LV D+KHIESG VP+
Sbjct  8    WTTKQNKLFENALVMYDKDTPDRWQNMARAVGGKTVEEVKRHYEMLVEDVKHIESGQVPL  67

Query  389  PNYRSTGTRRR*FS  348
            PNYR  G   + +S
Sbjct  68   PNYRKAGASNKGYS  81



>ref|XP_002282461.1| PREDICTED: protein RADIALIS-like 3 isoform X2 [Vitis vinifera]
 emb|CBI19701.3| unnamed protein product [Vitis vinifera]
Length=91

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE AL  +D+DTPDRWQN+AR V GK+  EVK+ Y++LV D+KHIESG VP+
Sbjct  8    WTTKQNKLFENALVMYDKDTPDRWQNMARAVGGKTVEEVKRHYEMLVEDVKHIESGQVPL  67

Query  389  PNYRSTGTRRR*FS  348
            PNYR  G   + +S
Sbjct  68   PNYRKAGASNKGYS  81



>emb|CBI17505.3| unnamed protein product [Vitis vinifera]
Length=74

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA++D+DTPDRWQNIA+ V GKS  EVK+ Y+IL+ D+KHIESG VP 
Sbjct  11   WTPKQNKLFEKALAKYDKDTPDRWQNIAKAVGGKSAEEVKRHYEILIEDVKHIESGKVPF  70

Query  389  PNYR  378
            PNYR
Sbjct  71   PNYR  74



>ref|XP_004232415.1| PREDICTED: protein RADIALIS-like 5 [Solanum lycopersicum]
Length=78

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  +NK+FE+ALA +D+DT DRWQNIAR V GKS  EVK  Y ILV DLKHIESGDVP 
Sbjct  9    WTPRENKKFEQALAVYDKDTSDRWQNIARYVGGKSVEEVKHHYAILVEDLKHIESGDVPF  68

Query  389  PNYRSTGTRR  360
            P Y+S G  R
Sbjct  69   PKYKSGGKSR  78



>ref|XP_002300766.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE80039.1| myb family transcription factor family protein [Populus trichocarpa]
Length=99

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTPDRWQN+A+ V GKSP EVK+ YD LV DL +IESG  P+
Sbjct  14   WTAKQNKLFEKALAVYDKDTPDRWQNVAKAVGGKSPEEVKRHYDRLVEDLVYIESGQAPL  73

Query  389  PNYRSTGTRRR  357
            PNY+ +G+  R
Sbjct  74   PNYKPSGSNGR  84



>gb|EPS58348.1| hypothetical protein M569_16468 [Genlisea aurea]
Length=93

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +DRDTPDRWQN+AR V GKS  +VK+ Y  LV D+ HIESG VPV
Sbjct  7    WTAKQNKAFEDALATYDRDTPDRWQNLARAVGGKSVEDVKRHYQKLVQDINHIESGKVPV  66

Query  389  PNYRST  372
            PNYR T
Sbjct  67   PNYRDT  72



>gb|EYU37803.1| hypothetical protein MIMGU_mgv1a024317mg, partial [Erythranthe 
guttata]
Length=82

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WTA +NK FE+ALAR DRDTPDRWQN+AR V  GKS  EVK  Y IL+ DL+ IE+G VP
Sbjct  15   WTAQENKLFEKALARFDRDTPDRWQNVARAVGGGKSAEEVKTHYQILIEDLRRIETGHVP  74

Query  392  VPNYR  378
            +PNYR
Sbjct  75   IPNYR  79



>ref|XP_004500809.1| PREDICTED: protein RADIALIS-like 6-like [Cicer arietinum]
Length=81

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA++D+DTPDRW N+A+ VG KS  EVK+ Y+IL+ DLKHIESG VP+
Sbjct  16   WTPKQNKLFEKALAKYDKDTPDRWINVAKAVGEKSVEEVKRHYEILLEDLKHIESGRVPI  75

Query  389  PNYRST  372
            PNY+ST
Sbjct  76   PNYKST  81



>ref|XP_009342796.1| PREDICTED: transcription factor RADIALIS isoform X2 [Pyrus x 
bretschneideri]
Length=81

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DT DRW N+A+ VG K+P EVK+ Y++LV D+KHIESG VP 
Sbjct  15   WTAKQNKAFEKALAVYDKDTADRWYNVAKAVGGKTPEEVKRHYEVLVEDVKHIESGQVPF  74

Query  389  PNYRSTG  369
            P+YR+TG
Sbjct  75   PDYRTTG  81



>ref|XP_008347407.1| PREDICTED: transcription factor RADIALIS-like [Malus domestica]
Length=81

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DT DRW N+A+ VG K+P EVK+ Y++LV D+KHIESG VP 
Sbjct  15   WTAKQNKAFEKALAVYDKDTADRWYNVAKAVGGKTPEEVKRHYELLVEDVKHIESGQVPF  74

Query  389  PNYRSTG  369
            P+YR+TG
Sbjct  75   PDYRTTG  81



>ref|XP_010029788.1| PREDICTED: protein RADIALIS-like 4 [Eucalyptus grandis]
Length=80

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA++D+DTPDRWQ IA+ V GKS  EVK+ Y+IL+ D+KHIESG VP 
Sbjct  11   WTPKQNKMFEKALAQYDKDTPDRWQKIAKAVGGKSADEVKRHYEILIEDVKHIESGRVPF  70

Query  389  PNYRST  372
            PNYRS+
Sbjct  71   PNYRSS  76



>ref|XP_003518389.1| PREDICTED: protein RADIALIS-like 6-like [Glycine max]
Length=95

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNKQFE ALA +D+DTPDRWQNIA+ VG KS  EVK+ Y+IL+ DL+HIESG VP+
Sbjct  16   WTRMQNKQFESALALYDQDTPDRWQNIAKVVGDKSAEEVKRHYEILLEDLRHIESGRVPI  75

Query  389  PNYRST  372
            P+Y+ST
Sbjct  76   PSYKST  81



>gb|KHN41108.1| hypothetical protein glysoja_013450 [Glycine soja]
Length=111

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNKQFE ALA +D+DTPDRWQNIA+ VG KS  EVK+ Y+IL+ DL+HIESG VP+
Sbjct  16   WTRMQNKQFESALALYDQDTPDRWQNIAKVVGDKSAEEVKRHYEILLEDLRHIESGRVPI  75

Query  389  PNYRST  372
            P+Y+ST
Sbjct  76   PSYKST  81



>ref|XP_004238608.1| PREDICTED: protein RADIALIS-like 6 [Solanum lycopersicum]
Length=91

 Score = 94.0 bits (232),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK+FEEALA +DRDTPDRW NIAR V GKS AEVK+ Y++LV D+  IE+G VP+
Sbjct  4    WTARQNKKFEEALALYDRDTPDRWHNIARCVGGKSAAEVKRHYEVLVKDIMQIENGQVPL  63

Query  389  PNYRSTG  369
            PNY++  
Sbjct  64   PNYKAAA  70



>ref|XP_008795931.1| PREDICTED: protein RADIALIS-like 3 [Phoenix dactylifera]
Length=95

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS S S    SSWT  QNK FE ALA +D+DTPDRWQN+AR V GKS  EVK+ Y++LV
Sbjct  1    MASGSFSRSTGSSWTPKQNKLFERALAVYDKDTPDRWQNVARAVGGKSAEEVKRHYELLV  60

Query  428  HDLKHIESGDVPVPNYRSTGT  366
             DLKHIESG VP PNY +  +
Sbjct  61   EDLKHIESGQVPFPNYNNNSS  81



>ref|XP_011048394.1| PREDICTED: protein RADIALIS-like 4 [Populus euphratica]
Length=100

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  +NK FE+ALA  D+DTPDRWQNIA+ VG  KS  EVK+ Y+IL+ DL HIESG +P
Sbjct  15   WTPRENKLFEKALALFDKDTPDRWQNIAKAVGGVKSAEEVKKHYEILIEDLHHIESGRIP  74

Query  392  VPNYRSTGTR  363
            +P Y+S+G+R
Sbjct  75   IPKYKSSGSR  84



>ref|XP_010088931.1| hypothetical protein L484_018558 [Morus notabilis]
 gb|EXB37135.1| hypothetical protein L484_018558 [Morus notabilis]
Length=112

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DTPDRWQN+A+ V GK+P EVK+ Y++L+ DL+ IESG +P+
Sbjct  17   WTPKQNKSFEKALALYDKDTPDRWQNVAKAVGGKTPEEVKRHYEVLLEDLRQIESGRIPI  76

Query  389  PNYRSTG  369
            PNY+S+G
Sbjct  77   PNYKSSG  83



>ref|XP_002510401.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF52588.1| DNA binding protein, putative [Ricinus communis]
Length=94

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA++D+DTPDRWQN+A+ V GKSP EVK+ YD LV DL +IESG  P+
Sbjct  17   WTPKQNKLFEKALAKYDKDTPDRWQNVAKAVGGKSPDEVKRHYDRLVEDLIYIESGQAPL  76

Query  389  PNYRSTGTRRR  357
            PNY+ TG   R
Sbjct  77   PNYKVTGVNGR  87



>ref|XP_008378460.1| PREDICTED: transcription factor RADIALIS-like [Malus domestica]
 ref|XP_009342795.1| PREDICTED: transcription factor RADIALIS isoform X1 [Pyrus x 
bretschneideri]
Length=102

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DT DRW N+A+ VG K+P EVK+ Y++LV D+KHIESG VP 
Sbjct  15   WTAKQNKAFEKALAVYDKDTADRWYNVAKAVGGKTPEEVKRHYEVLVEDVKHIESGQVPF  74

Query  389  PNYRSTG  369
            P+YR+TG
Sbjct  75   PDYRTTG  81



>gb|ADZ73427.1| MYB transcription factor [Vitis pseudoreticulata]
Length=75

 Score = 93.2 bits (230),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +DRDTPDRWQN+A  V GKS  EVKQ Y+IL+ DLK+IESG VP+
Sbjct  12   WTPKQNKLFEKALALYDRDTPDRWQNVANAVGGKSAEEVKQHYEILIRDLKYIESGRVPI  71

Query  389  PNYR  378
            PNY+
Sbjct  72   PNYK  75



>ref|XP_010028603.1| PREDICTED: protein RADIALIS-like 3 [Eucalyptus grandis]
 gb|KCW55363.1| hypothetical protein EUGRSUZ_I01278 [Eucalyptus grandis]
Length=85

 Score = 93.6 bits (231),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS SLS    SSWT  QNKQFE ALA +D+DTPDRWQN+AR V GKS  EVK+ Y+ LV
Sbjct  1    MASSSLSRNHGSSWTPIQNKQFERALALYDKDTPDRWQNVARAVEGKSADEVKRHYEALV  60

Query  428  HDLKHIESGDVPVPNYRSTG  369
             DL  IESG +PVPNY+S G
Sbjct  61   EDLDQIESGRIPVPNYKSGG  80



>gb|KDP38516.1| hypothetical protein JCGZ_04441 [Jatropha curcas]
Length=94

 Score = 93.6 bits (231),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DTPDRW N+A+ VG KSP EVK+ YD LV DL +IESG  P+
Sbjct  17   WTPKQNKLFEKALAVYDKDTPDRWHNVAKAVGGKSPEEVKRHYDRLVEDLMYIESGQAPL  76

Query  389  PNYRSTGTRRR  357
            PNYR+TG+  R
Sbjct  77   PNYRATGSNGR  87



>ref|XP_011037519.1| PREDICTED: protein RADIALIS-like 4 isoform X2 [Populus euphratica]
Length=92

 Score = 93.6 bits (231),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 2/69 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  +NK FE+ALA  D+DTPDRWQNIA+ VG  KS  EVK+ Y+IL+ DLK+IESG VP
Sbjct  15   WTPRENKLFEKALALFDKDTPDRWQNIAKAVGGVKSAEEVKRHYEILIEDLKYIESGRVP  74

Query  392  VPNYRSTGT  366
            +PNYRS  +
Sbjct  75   IPNYRSCSS  83



>emb|CDP07503.1| unnamed protein product [Coffea canephora]
Length=101

 Score = 94.0 bits (232),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNKQFEEALA +D+DTPDRW NIAR V GKS  EV++ Y++LV D+  IES  VP+
Sbjct  16   WTAKQNKQFEEALATYDKDTPDRWYNIARAVGGKSEEEVRRHYEVLVKDIMQIESDQVPL  75

Query  389  PNYRSTGTRRR*FS  348
            PNYRS  +  R ++
Sbjct  76   PNYRSMASNGRGYA  89



>ref|XP_011037518.1| PREDICTED: protein RADIALIS-like 4 isoform X1 [Populus euphratica]
Length=97

 Score = 93.6 bits (231),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 2/69 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  +NK FE+ALA  D+DTPDRWQNIA+ VG  KS  EVK+ Y+IL+ DLK+IESG VP
Sbjct  15   WTPRENKLFEKALALFDKDTPDRWQNIAKAVGGVKSAEEVKRHYEILIEDLKYIESGRVP  74

Query  392  VPNYRSTGT  366
            +PNYRS  +
Sbjct  75   IPNYRSCSS  83



>ref|XP_006595898.1| PREDICTED: protein RADIALIS-like 3-like [Glycine max]
 gb|KHN20916.1| hypothetical protein glysoja_009224 [Glycine soja]
Length=95

 Score = 93.6 bits (231),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNKQFE ALA +D+DTPDRWQNIA+ VG KS  EVK+ Y+IL+ DL HIESG VP+
Sbjct  16   WTRMQNKQFESALALYDQDTPDRWQNIAKVVGDKSAEEVKRHYEILLEDLSHIESGRVPI  75

Query  389  PNYRST  372
            P+Y+ST
Sbjct  76   PSYKST  81



>ref|XP_010263653.1| PREDICTED: protein RADIALIS-like 3 [Nelumbo nucifera]
Length=92

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTPDRWQNIAR V GK+  EVK+ Y+IL+ DL HIESG VP 
Sbjct  16   WTATQNKLFEKALATYDKDTPDRWQNIARAVGGKTVEEVKRHYEILIEDLNHIESGRVPF  75

Query  389  PNYRS  375
            PNY++
Sbjct  76   PNYKT  80



>ref|XP_009390408.1| PREDICTED: protein RADIALIS-like 3 [Musa acuminata subsp. malaccensis]
Length=84

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDIL  432
            MAS SL   ++SSWT  QNK FE ALA +D+DTPDRW N+AR V  GK+  EVK+ Y++L
Sbjct  1    MASGSLPRSSTSSWTPQQNKLFERALAVYDKDTPDRWLNVARAVGGGKTAEEVKKHYELL  60

Query  431  VHDLKHIESGDVPVPNYRSTGTRR  360
            + DL  IESG VP PNY+S+GTRR
Sbjct  61   LEDLHRIESGRVPYPNYKSSGTRR  84



>ref|XP_008782489.1| PREDICTED: protein RADIALIS-like 3 isoform X1 [Phoenix dactylifera]
Length=96

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS SL   + SSWT  QNK FE ALA +D+DTPDRWQN+AR V GKS  EVK+ Y++LV
Sbjct  1    MASGSLPCSSGSSWTPKQNKLFERALAVYDKDTPDRWQNVARAVGGKSAEEVKRHYELLV  60

Query  428  HDLKHIESGDVPVPNY  381
             DLKHIESG VP PNY
Sbjct  61   EDLKHIESGQVPFPNY  76



>ref|XP_009364936.1| PREDICTED: protein RADIALIS-like 6 [Pyrus x bretschneideri]
Length=91

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DT DRW N+A+ VG K+  EVK+ Y+ILVHDL HIESG VP+
Sbjct  2    WTPKQNKLFEKALAEYDKDTQDRWHNVAKAVGGKTVEEVKRHYEILVHDLMHIESGQVPI  61

Query  389  PNYRSTGT  366
            PNY++ G+
Sbjct  62   PNYKAAGS  69



>ref|XP_002310812.1| hypothetical protein POPTR_0007s13000g [Populus trichocarpa]
 gb|EEE91262.1| hypothetical protein POPTR_0007s13000g [Populus trichocarpa]
Length=78

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA HD+DTPDRW N+A+ V GKS  EVK+ Y+IL+ D++ IESG VP 
Sbjct  9    WTPKQNKLFEKALALHDKDTPDRWHNVAKAVGGKSAEEVKRHYEILIKDVREIESGRVPF  68

Query  389  PNYRSTG  369
            PNYRS+G
Sbjct  69   PNYRSSG  75



>ref|XP_007201464.1| hypothetical protein PRUPE_ppa014060mg [Prunus persica]
 gb|EMJ02663.1| hypothetical protein PRUPE_ppa014060mg [Prunus persica]
Length=89

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DT DRW N+A+ VG K+P EVK+ Y+ LV D+KHIESG VP 
Sbjct  9    WTAKQNKAFEKALALYDKDTADRWYNVAKAVGGKTPEEVKRHYERLVEDVKHIESGQVPF  68

Query  389  PNYRSTG  369
            P+YR+TG
Sbjct  69   PDYRTTG  75



>ref|XP_010088924.1| DnaJ homolog subfamily C member 2 [Morus notabilis]
 gb|EXB37128.1| DnaJ homolog subfamily C member 2 [Morus notabilis]
Length=95

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTPDRW N+A+ V GK+  EVK+ Y++L+ D+KHIESG VP 
Sbjct  9    WTAKQNKAFEKALAVYDKDTPDRWYNVAKAVGGKTAEEVKRHYELLLEDVKHIESGQVPF  68

Query  389  PNYRSTG  369
            P YR+TG
Sbjct  69   PYYRTTG  75



>emb|CAN68999.1| hypothetical protein VITISV_033596 [Vitis vinifera]
Length=96

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FEEALA +D+DTPDRW N+AR V GK+  EVK+ Y+ILV D+K I+S  VP 
Sbjct  10   WTAKQNKAFEEALAVYDKDTPDRWYNVARAVGGKTVEEVKRHYEILVEDIKSIDSDKVPF  69

Query  389  PNYRSTGTRRR  357
            PNY++TG   R
Sbjct  70   PNYKTTGASSR  80



>ref|XP_009378510.1| PREDICTED: protein RADIALIS-like 1 [Pyrus x bretschneideri]
Length=81

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DT DRW N+A+ V GK+P EVK+ Y++LV D+KHIESG V  
Sbjct  15   WTAKQNKAFEKALAVYDKDTADRWYNVAKAVGGKTPEEVKKHYELLVQDVKHIESGHVAF  74

Query  389  PNYRSTG  369
            P+YR+TG
Sbjct  75   PDYRTTG  81



>ref|XP_011092801.1| PREDICTED: protein RADIALIS-like 1 [Sesamum indicum]
Length=84

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDIL  432
            MAS SLSSR   SWT  +NK FE+ALAR D+DTPDRWQN+AREV  GKS  EVK+ YD+L
Sbjct  1    MASSSLSSRRPDSWTPQENKLFEKALARFDQDTPDRWQNVAREVGGGKSAEEVKRHYDVL  60

Query  431  VHDLKHIESGDVPVPNY  381
            + DL+ IESG VP+PNY
Sbjct  61   MEDLRRIESGHVPIPNY  77



>ref|XP_002306110.2| hypothetical protein POPTR_0004s16320g [Populus trichocarpa]
 gb|EEE86621.2| hypothetical protein POPTR_0004s16320g [Populus trichocarpa]
Length=100

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 2/67 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  +NK FE+ALA  D+DTPDRWQNIA+ VG  KS  E+K+ Y+IL+ DLKHIESG VP
Sbjct  15   WTPRENKLFEKALALFDKDTPDRWQNIAKAVGGVKSAEEMKRHYEILIEDLKHIESGRVP  74

Query  392  VPNYRST  372
            +PNY+S+
Sbjct  75   IPNYKSS  81



>ref|XP_002313044.2| hypothetical protein POPTR_0009s11990g [Populus trichocarpa]
 gb|EEE86999.2| hypothetical protein POPTR_0009s11990g [Populus trichocarpa]
Length=113

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 2/69 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  +NK FE+ALA  D+DTPDRWQNIA+ VG  KS  EVK+ Y+IL+ DL+HIESG +P
Sbjct  15   WTPRENKLFEKALALFDKDTPDRWQNIAKAVGGVKSAEEVKKHYEILIEDLQHIESGRIP  74

Query  392  VPNYRSTGT  366
            +P Y+S+G+
Sbjct  75   IPKYKSSGS  83



>gb|EYU40174.1| hypothetical protein MIMGU_mgv1a019621mg, partial [Erythranthe 
guttata]
Length=66

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = -1

Query  554  QNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPVPNYR  378
            QNK FE ALA +D++TPDRWQNIAR VG KS  EVK+ Y+ILV DLKHIESG++P P YR
Sbjct  1    QNKLFERALAVYDKETPDRWQNIARAVGGKSVEEVKRHYEILVEDLKHIESGNIPFPYYR  60

Query  377  STGTRR  360
            S G  R
Sbjct  61   SNGNSR  66



>ref|XP_006341953.1| PREDICTED: protein RADIALIS-like 6-like [Solanum tuberosum]
Length=91

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT+ QNK+FEEALA +DRDTPDRW NIAR V GKS AEVK+ Y +LV D+  IE+G VP+
Sbjct  4    WTSRQNKKFEEALALYDRDTPDRWHNIARCVGGKSAAEVKRHYGVLVKDIMQIENGQVPL  63

Query  389  PNYRSTG  369
            PNY++  
Sbjct  64   PNYKAAA  70



>ref|XP_010263639.1| PREDICTED: protein RADIALIS-like 3 [Nelumbo nucifera]
Length=100

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DTPDRWQN+A+ V GKS  EVK+ Y+IL+ DLKHIESG VP 
Sbjct  14   WTPKQNKLFEKALALYDKDTPDRWQNVAKAVGGKSAEEVKRHYEILIEDLKHIESGKVPF  73

Query  389  PNYR  378
            PNY+
Sbjct  74   PNYK  77



>ref|XP_006577922.1| PREDICTED: protein RADIALIS-like 6-like isoform X1 [Glycine max]
Length=101

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA++D+DTPDRW N+A+ + GKS  +VK+ Y IL+ DL+HIESG VP+
Sbjct  16   WTPKQNKVFEKALAKYDKDTPDRWHNVAKAIGGKSEDDVKRHYQILLEDLRHIESGHVPI  75

Query  389  PNYRSTGT  366
            PNY+ST T
Sbjct  76   PNYKSTPT  83



>ref|XP_009365547.1| PREDICTED: protein RADIALIS-like 3 [Pyrus x bretschneideri]
Length=101

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDIL  432
            MAS S S   +SSWT  +NK FE ALA +D+DT DRW N+A+ VG  K+  EVK+ Y+IL
Sbjct  1    MASVSSSRNLNSSWTPKENKLFEMALAVYDKDTQDRWHNVAKAVGGGKTAEEVKRHYEIL  60

Query  431  VHDLKHIESGDVPVPNYRSTG  369
            VHDL HIESG VP+PNY+S G
Sbjct  61   VHDLMHIESGQVPIPNYKSAG  81



>gb|KDP46261.1| hypothetical protein JCGZ_10101 [Jatropha curcas]
Length=86

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  +NK FE+ALA +D++TP+RWQNIA+ VG KSP EVK+ Y+ L+ D+KHIESG V  
Sbjct  15   WTPRENKMFEKALALYDKETPERWQNIAKAVGGKSPEEVKRHYERLIEDVKHIESGHVAF  74

Query  389  PNYRSTGTR  363
            PNY+S G+R
Sbjct  75   PNYKSGGSR  83



>ref|XP_009371617.1| PREDICTED: protein RADIALIS-like 4 [Pyrus x bretschneideri]
Length=82

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK+FE+ALA HD+DTPDRWQ +AR V GKS  EVK+ Y+IL+ D+KHIESG VP 
Sbjct  17   WTPKQNKEFEKALALHDKDTPDRWQKVARAVGGKSAEEVKRHYEILIEDVKHIESGRVPF  76

Query  389  PNYRS  375
            P+YR 
Sbjct  77   PDYRG  81



>ref|XP_003631660.1| PREDICTED: protein RADIALIS-like 1 [Vitis vinifera]
Length=101

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FEEALA +D+DTPDRW N+AR V GK+  EVK+ Y+ILV D+K I+S  VP 
Sbjct  15   WTAKQNKAFEEALAVYDKDTPDRWYNVARAVGGKTVEEVKRHYEILVEDIKSIDSDKVPF  74

Query  389  PNYRSTGTRRR  357
            PNY++TG   R
Sbjct  75   PNYKTTGASGR  85



>gb|EYU42614.1| hypothetical protein MIMGU_mgv1a021827mg, partial [Erythranthe 
guttata]
Length=87

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  +NK FE+ALAR DRDTPDRWQN+A  V  GKS  EVK+ YDIL+ DL+ IESG VP
Sbjct  15   WTVQENKLFEKALARFDRDTPDRWQNVAAAVGSGKSTDEVKRHYDILMEDLRRIESGRVP  74

Query  392  VPNYR  378
            +PNYR
Sbjct  75   LPNYR  79



>ref|XP_006577923.1| PREDICTED: protein RADIALIS-like 6-like isoform X2 [Glycine max]
Length=94

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA++D+DTPDRW N+A+ + GKS  +VK+ Y IL+ DL+HIESG VP+
Sbjct  16   WTPKQNKVFEKALAKYDKDTPDRWHNVAKAIGGKSEDDVKRHYQILLEDLRHIESGHVPI  75

Query  389  PNYRSTGT  366
            PNY+ST T
Sbjct  76   PNYKSTPT  83



>ref|XP_008220818.1| PREDICTED: protein RADIALIS-like 6 [Prunus mume]
Length=97

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DT DRW N+A+ VG KS  EVK+ Y+ILV DL HIESG VP+
Sbjct  12   WTPKQNKLFEKALAVYDKDTQDRWHNVAKAVGGKSVEEVKRHYEILVQDLMHIESGQVPI  71

Query  389  PNYRSTGT  366
            PNY+ TG+
Sbjct  72   PNYKGTGS  79



>ref|XP_007224604.1| hypothetical protein PRUPE_ppa026982mg, partial [Prunus persica]
 gb|EMJ25803.1| hypothetical protein PRUPE_ppa026982mg, partial [Prunus persica]
Length=89

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DT DRW N+A+ VG KS  EVK+ Y+ILV DL HIESG VP+
Sbjct  12   WTPKQNKLFEKALAVYDKDTQDRWHNVAKAVGGKSVEEVKRHYEILVQDLMHIESGQVPI  71

Query  389  PNYRSTGT  366
            PNY+ TG+
Sbjct  72   PNYKGTGS  79



>emb|CBI32595.3| unnamed protein product [Vitis vinifera]
Length=111

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FEEALA +D+DTPDRW N+AR V GK+  EVK+ Y+ILV D+K I+S  VP 
Sbjct  25   WTAKQNKAFEEALAVYDKDTPDRWYNVARAVGGKTVEEVKRHYEILVEDIKSIDSDKVPF  84

Query  389  PNYRSTGTRRR  357
            PNY++TG   R
Sbjct  85   PNYKTTGASGR  95



>ref|XP_010095252.1| hypothetical protein L484_014592 [Morus notabilis]
 gb|EXB59098.1| hypothetical protein L484_014592 [Morus notabilis]
Length=84

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNKQFE ALA +D+DTPDRWQ +AR V GKS  EVK+ Y+IL  D++HIESG VP 
Sbjct  15   WTPTQNKQFERALALYDKDTPDRWQKVARAVGGKSAEEVKRHYEILEEDIRHIESGKVPF  74

Query  389  PNYRSTG  369
            P YRS G
Sbjct  75   PIYRSAG  81



>ref|XP_011088399.1| PREDICTED: transcription factor RADIALIS-like [Sesamum indicum]
Length=79

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS S+S  A S+WTA +NK FE ALA  D+DTPDRW N+AR V G++P EVK+ Y+ILV
Sbjct  1    MASSSMSRGAGSTWTAQENKAFERALAIFDKDTPDRWANVARAVGGRTPEEVKRHYEILV  60

Query  428  HDLKHIESGDVPVPNYRSTG  369
             D+K+IESG VP P YR+TG
Sbjct  61   EDIKYIESGKVPFP-YRTTG  79



>ref|XP_010940077.1| PREDICTED: protein RADIALIS-like 3 [Elaeis guineensis]
Length=96

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRWQN+AR V GKS  EVK+ Y++LV DLKHIESG VP 
Sbjct  15   WTPKQNKLFERALAVYDKDTPDRWQNVARAVGGKSAEEVKRHYELLVEDLKHIESGQVPF  74

Query  389  PNY  381
            PNY
Sbjct  75   PNY  77



>ref|XP_009594360.1| PREDICTED: protein RADIALIS-like 1 [Nicotiana tomentosiformis]
Length=87

 Score = 91.3 bits (225),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA+QNK FE+ALA +D+DTPDRW N+AR V GK+  EVK+ Y+ILV D+  IE+G VP 
Sbjct  12   WTAEQNKAFEKALAVYDKDTPDRWSNVARAVGGKTAEEVKRHYEILVQDVMSIENGRVPF  71

Query  389  PNYRST  372
            PNYR+T
Sbjct  72   PNYRTT  77



>ref|XP_009336185.1| PREDICTED: protein RADIALIS-like 3 [Pyrus x bretschneideri]
Length=97

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DT DRW N+A  VG K+  EVK+ Y+ILVHDL HIESG VP+
Sbjct  8    WTPKQNKLFEKALAVYDKDTQDRWHNVAEAVGGKTVEEVKRHYEILVHDLMHIESGQVPI  67

Query  389  PNYRSTGT  366
            PNY++ G+
Sbjct  68   PNYKAAGS  75



>gb|KHN33753.1| DnaJ like subfamily C member 2 [Glycine soja]
Length=117

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA++D+DTPDRW N+A+ + GKS  +VK+ Y IL+ DL+HIESG VP+
Sbjct  16   WTPKQNKVFEKALAKYDKDTPDRWHNVAKAIGGKSEDDVKRHYQILLEDLRHIESGHVPI  75

Query  389  PNYRSTGT  366
            PNY+ST T
Sbjct  76   PNYKSTPT  83



>ref|XP_006340632.1| PREDICTED: protein RADIALIS-like 6-like [Solanum tuberosum]
Length=75

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  +NK+FE+ALA +D+DT DRWQNIAR V GKS  EVK  Y ILV DLKHIESGDVP 
Sbjct  9    WTPIENKKFEQALAVYDKDTSDRWQNIARYVGGKSVEEVKHHYAILVEDLKHIESGDVPF  68

Query  389  PNYRS  375
            P Y+S
Sbjct  69   PKYKS  73



>ref|XP_008352458.1| PREDICTED: protein RADIALIS-like 4 [Malus domestica]
Length=82

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNKQFE+ALA +D+DTPDRWQ +AR V GKS  EVK+ Y+IL+ D+KHIESG VP 
Sbjct  17   WTPKQNKQFEKALALYDKDTPDRWQKVARAVGGKSAEEVKRHYEILIEDVKHIESGRVPF  76

Query  389  PNYRS  375
            P+YR 
Sbjct  77   PDYRG  81



>ref|XP_007042186.1| Homeodomain-like superfamily protein [Theobroma cacao]
 gb|EOX98017.1| Homeodomain-like superfamily protein [Theobroma cacao]
Length=156

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +D+DTPDRW N+A+ V GK+  EVK+ Y++LV D+KHIESG VP 
Sbjct  14   WTAKQNKDFERALAVYDKDTPDRWYNVAKAVGGKTAEEVKRHYELLVQDVKHIESGQVPF  73

Query  389  PNYRSTGTRRR  357
            PNYR++    R
Sbjct  74   PNYRTSAGNSR  84



>ref|XP_011092800.1| PREDICTED: transcription factor RADIALIS-like [Sesamum indicum]
Length=101

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS S++  + S+WTA +NK FE+ALA +D+DTPDRW N+AR V G++  EV++ YDILV
Sbjct  1    MASSSMTRGSGSAWTAKENKDFEKALAVYDKDTPDRWANVARAVGGRTEEEVRRHYDILV  60

Query  428  HDLKHIESGDVPVPNYRSTGT  366
             D+  IESG VP PNYR+T +
Sbjct  61   EDINCIESGRVPFPNYRTTSS  81



>ref|XP_009340740.1| PREDICTED: protein RADIALIS-like 3 [Pyrus x bretschneideri]
Length=76

 Score = 90.9 bits (224),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNKQFE+ALA +D+DTPDRWQ +AR V GKS  EVK+ Y++L+ D+KHIESG VP 
Sbjct  11   WTPKQNKQFEKALALYDKDTPDRWQKVARAVGGKSAEEVKRHYELLIEDVKHIESGRVPF  70

Query  389  PNYRS  375
            P+YR 
Sbjct  71   PDYRG  75



>ref|XP_004287888.1| PREDICTED: protein RADIALIS-like 6-like [Fragaria vesca subsp. 
vesca]
Length=81

 Score = 90.5 bits (223),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNKQFE+ALA +D+DTPDRWQ +AR V GKS  EVK+ Y+IL+ D+KHIESG +P 
Sbjct  15   WTPKQNKQFEKALALYDKDTPDRWQKVARAVGGKSAEEVKRHYEILIEDVKHIESGRIPY  74

Query  389  PNYRST  372
            P+YR++
Sbjct  75   PDYRNS  80



>ref|XP_006595936.1| PREDICTED: protein RADIALIS-like 1-like isoform X2 [Glycine max]
Length=82

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK+FE ALA +DRDTPDRWQN+AR V GK+  EVK+ Y++LV DLK IE G VP+
Sbjct  7    WTTKQNKKFENALAIYDRDTPDRWQNLARAVGGKTVEEVKRHYEMLVDDLKQIEEGHVPL  66

Query  389  PNYRS  375
            PNYR+
Sbjct  67   PNYRN  71



>gb|ABH02884.1| MYB transcription factor MYB164 [Glycine max]
Length=100

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK+FE ALA +DRDTPDRWQN+AR V GK+  EVK+ Y++LV DLK IE G VP+
Sbjct  10   WTTKQNKKFENALAIYDRDTPDRWQNLARAVGGKTVEEVKRHYEMLVDDLKQIEEGHVPL  69

Query  389  PNYRS  375
            PNYR+
Sbjct  70   PNYRN  74



>ref|XP_002509493.1| transcription factor, putative [Ricinus communis]
 gb|EEF50880.1| transcription factor, putative [Ricinus communis]
Length=80

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  +NK FE+ALA +D++TPDRWQNIA+ V GKS  EVK+ YD+L+ D+KHIESG VP 
Sbjct  15   WTPRENKLFEKALALYDKETPDRWQNIAKAVGGKSADEVKRHYDVLIEDVKHIESGRVPF  74

Query  389  PNYRS  375
            PNY+S
Sbjct  75   PNYKS  79



>ref|XP_003545280.1| PREDICTED: protein RADIALIS-like 1-like isoform X1 [Glycine max]
 gb|KHN20978.1| DnaJ like subfamily C member 2 [Glycine soja]
Length=98

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK+FE ALA +DRDTPDRWQN+AR V GK+  EVK+ Y++LV DLK IE G VP+
Sbjct  7    WTTKQNKKFENALAIYDRDTPDRWQNLARAVGGKTVEEVKRHYEMLVDDLKQIEEGHVPL  66

Query  389  PNYRS  375
            PNYR+
Sbjct  67   PNYRN  71



>ref|XP_011004014.1| PREDICTED: protein RADIALIS-like 3 [Populus euphratica]
Length=99

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DTPDRWQN+A+ V GKS  EVK  YD LV DL +IESG  P+
Sbjct  14   WTPKQNKLFEKALAVYDKDTPDRWQNVAKAVGGKSAEEVKMHYDRLVEDLTYIESGQAPL  73

Query  389  PNYRSTGTRRR  357
            PNY+ +G+  R
Sbjct  74   PNYKPSGSNSR  84



>ref|XP_009779120.1| PREDICTED: protein RADIALIS-like 4 [Nicotiana sylvestris]
Length=96

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 2/69 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE ALA+ D+DTPDRWQN+AR V  GKS  EVK+ Y+IL+ DL+ IESG VP
Sbjct  10   WTPQQNKLFERALAQFDKDTPDRWQNVARAVGGGKSVDEVKRHYEILIEDLRRIESGLVP  69

Query  392  VPNYRSTGT  366
            +P YR+ GT
Sbjct  70   LPTYRNGGT  78



>ref|XP_006423271.1| hypothetical protein CICLE_v10029663mg [Citrus clementina]
 ref|XP_006469157.1| PREDICTED: protein RADIALIS-like 2-like [Citrus sinensis]
 gb|ESR36511.1| hypothetical protein CICLE_v10029663mg [Citrus clementina]
Length=96

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA+QNK FE ALA +D+DTPDRW N+AR V GK+  EVK+ Y++LV D+KHIESG VP 
Sbjct  15   WTAEQNKAFERALAVYDKDTPDRWYNVARAVGGKTADEVKKHYELLVEDIKHIESGHVPF  74

Query  389  PNYRS  375
            P YR+
Sbjct  75   PKYRT  79



>ref|XP_006423270.1| hypothetical protein CICLE_v10029663mg [Citrus clementina]
 gb|ESR36510.1| hypothetical protein CICLE_v10029663mg [Citrus clementina]
 gb|KDO49076.1| hypothetical protein CISIN_1g034615mg [Citrus sinensis]
Length=89

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA+QNK FE ALA +D+DTPDRW N+AR V GK+  EVK+ Y++LV D+KHIESG VP 
Sbjct  15   WTAEQNKAFERALAVYDKDTPDRWYNVARAVGGKTADEVKKHYELLVEDIKHIESGHVPF  74

Query  389  PNYRS  375
            P YR+
Sbjct  75   PKYRT  79



>ref|XP_008338377.1| PREDICTED: protein RADIALIS-like 4 [Malus domestica]
Length=82

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNKQFE+ALA +D+DTPDRWQ +AR V GKS  EVK+ Y++L+ D+KHIESG VP 
Sbjct  17   WTPKQNKQFEKALALYDKDTPDRWQKVARAVGGKSAEEVKRHYELLIEDVKHIESGRVPF  76

Query  389  PNYRS  375
            P+YR 
Sbjct  77   PDYRG  81



>ref|XP_003569420.1| PREDICTED: protein RADIALIS-like 4 [Brachypodium distachyon]
Length=96

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNKQFE+ALA +D++TPDRW NIAR V GK+  EVK+ Y++LV D+KHIE+G VP 
Sbjct  13   WTAKQNKQFEQALAVYDKETPDRWHNIARSVGGKTADEVKRYYELLVRDVKHIEAGKVPF  72

Query  389  PNYRS  375
            P YR 
Sbjct  73   PAYRC  77



>ref|NP_001151113.1| LOC100284746 [Zea mays]
 gb|ACG41660.1| DNA binding protein [Zea mays]
 tpg|DAA58424.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05900.1| MYB-related transcription factor, partial [Zea mays]
Length=93

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +DRDTPDRW NIAR V GKS  EV++ Y++LV DL+HIE+G V  
Sbjct  13   WTAKQNKLFEQALAVYDRDTPDRWHNIARAVGGKSADEVRRYYELLVKDLEHIEAGKVAF  72

Query  389  PNYRSTG  369
            P YR  G
Sbjct  73   PAYRCPG  79



>ref|XP_008388050.1| PREDICTED: protein RADIALIS-like 6 [Malus domestica]
Length=104

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DT DRW N+A+ V GK+  EVK+ Y+ILVHDL HIESG VP+
Sbjct  14   WTPKQNKLFEKALAVYDKDTQDRWHNVAKAVDGKTVEEVKRHYEILVHDLMHIESGQVPI  73

Query  389  PNYRST  372
            PNY++T
Sbjct  74   PNYKAT  79



>emb|CDY59758.1| BnaC08g49320D [Brassica napus]
Length=103

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS+S+S+  S SWT  QNK FE ALA +D DTPDRW N+AR V G +P E K+ YDILV
Sbjct  1    MASNSMSAYGSGSWTVKQNKAFERALATYDEDTPDRWYNVARAVGGTTPDEAKRQYDILV  60

Query  428  HDLKHIESGDVPVPNYRSTG  369
             D++ IE+G VP PNY++TG
Sbjct  61   RDIESIENGHVPFPNYKTTG  80



>ref|XP_010446463.1| PREDICTED: protein RADIALIS-like 1 [Camelina sativa]
Length=100

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTP+RWQNIA+ V GK+  EVK+ Y++LV D+ +IE+G VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWQNIAKVVGGKTTEEVKRHYELLVQDINNIENGHVPF  73

Query  389  PNYRSTG  369
            PNYR++G
Sbjct  74   PNYRTSG  80



>ref|XP_010690864.1| PREDICTED: protein RADIALIS-like 3 [Beta vulgaris subsp. vulgaris]
Length=101

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNKQFE ALA +D+DT DRWQN+AR V GKS  EVK+ Y+IL+ DL  IE+G VP 
Sbjct  16   WTAKQNKQFERALALYDKDTKDRWQNVARLVEGKSAEEVKRHYEILLEDLHQIEAGRVPF  75

Query  389  PNYRSTGT  366
            PNYR    
Sbjct  76   PNYRQNAA  83



>ref|XP_008810721.1| PREDICTED: protein RADIALIS-like 1 [Phoenix dactylifera]
Length=79

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA++D+DTPDRW N+AR V GKS  EVK+ Y+ LV D++ IESG VP 
Sbjct  10   WTPKQNKLFETALAKYDKDTPDRWHNVARAVGGKSAEEVKRHYERLVEDIRKIESGHVPF  69

Query  389  PNYRSTGTR  363
            P+YRS+G R
Sbjct  70   PSYRSSGGR  78



>ref|XP_009117377.1| PREDICTED: protein RADIALIS-like 2 [Brassica rapa]
Length=100

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS+S+S+  S SWT  QNK FE ALA +D DTPDRW N+AR V G +P E K+ YDILV
Sbjct  1    MASNSMSAYGSGSWTVKQNKAFERALATYDEDTPDRWYNVARAVGGTTPDEAKRQYDILV  60

Query  428  HDLKHIESGDVPVPNYRSTG  369
             D++ IE+G VP PNY++TG
Sbjct  61   RDIESIENGHVPFPNYKTTG  80



>emb|CDY13797.1| BnaA09g42990D [Brassica napus]
Length=103

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS+S+S+  S SWT  QNK FE ALA +D DTPDRW N+AR V G +P E K+ YDILV
Sbjct  1    MASNSMSAYGSGSWTVKQNKAFERALATYDEDTPDRWYNVARAVGGTTPDEAKRQYDILV  60

Query  428  HDLKHIESGDVPVPNYRSTG  369
             D++ IE+G VP PNY++TG
Sbjct  61   RDIESIENGHVPFPNYKTTG  80



>ref|XP_008447023.1| PREDICTED: protein RADIALIS-like 3 [Cucumis melo]
Length=96

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DTP+RWQNIA  V GKS  EV++ Y+IL+ DL+ IESG VP+
Sbjct  15   WTPKQNKLFEKALALYDKDTPERWQNIATAVGGKSADEVQRHYEILLEDLRQIESGRVPI  74

Query  389  PNYRSTGTR  363
            PNYR T  R
Sbjct  75   PNYRGTSNR  83



>ref|XP_011088407.1| PREDICTED: protein RADIALIS-like 4 [Sesamum indicum]
Length=89

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 2/69 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  +NK FE+ALAR DRDTPDRWQN+AR V  GKS  +VK  Y IL+ DL+ IESG VP
Sbjct  8    WTPQENKLFEKALARFDRDTPDRWQNVARAVGGGKSVEDVKTHYQILIEDLRRIESGHVP  67

Query  392  VPNYRSTGT  366
            +PNY +T +
Sbjct  68   IPNYTNTNS  76



>ref|XP_009602671.1| PREDICTED: protein RADIALIS-like 4 [Nicotiana tomentosiformis]
Length=96

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 2/69 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE ALA  D+DTPDRWQN+AR V  GKS  EVK+ Y+IL+ DL+ IESG VP
Sbjct  10   WTPQQNKLFERALAHFDKDTPDRWQNVARAVGGGKSVDEVKRHYEILIEDLRRIESGLVP  69

Query  392  VPNYRSTGT  366
            +P YR+ GT
Sbjct  70   LPTYRNGGT  78



>ref|XP_004231423.1| PREDICTED: transcription factor RADIALIS [Solanum lycopersicum]
Length=90

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WTA QNK FE ALA +D+DTPDRW N+AR VG  K+  +VKQ Y +L+HD+  IESG VP
Sbjct  14   WTAQQNKAFERALAVYDKDTPDRWSNVARAVGGNKTAEDVKQHYQLLLHDIMFIESGGVP  73

Query  392  VPNYRS-TGTRRR  357
             PNY + TG R R
Sbjct  74   FPNYTTPTGGRSR  86



>ref|XP_006383186.1| hypothetical protein POPTR_0005s12390g [Populus trichocarpa]
 gb|ERP60983.1| hypothetical protein POPTR_0005s12390g [Populus trichocarpa]
Length=85

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DTPDRW N+A+ V GKS  EV++ Y+IL+ D++ IESG VP 
Sbjct  16   WTPKQNKLFEKALALYDKDTPDRWHNVAKAVGGKSAEEVERHYEILIKDVREIESGRVPF  75

Query  389  PNYRSTG  369
            PNYRS+G
Sbjct  76   PNYRSSG  82



>ref|XP_002868895.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45154.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=100

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTP+RWQN+A+ V GK+  EVK+ Y++LV D+ +IE+G VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVKRHYELLVQDINNIENGHVPF  73

Query  389  PNYRSTG  369
            PNYR++G
Sbjct  74   PNYRTSG  80



>ref|XP_008800710.1| PREDICTED: protein RADIALIS-like 1 [Phoenix dactylifera]
Length=79

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA++D+DTPDRW ++AR V GKS  EVK+ Y+ LV D++ IESG VP 
Sbjct  10   WTPKQNKMFETALAKYDKDTPDRWHDVARAVGGKSAEEVKRHYERLVEDIRQIESGHVPF  69

Query  389  PNYRSTGTR  363
            P+YRS+G R
Sbjct  70   PSYRSSGGR  78



>ref|XP_009364794.1| PREDICTED: protein RADIALIS-like 3 [Pyrus x bretschneideri]
 ref|XP_009336315.1| PREDICTED: protein RADIALIS-like 3 [Pyrus x bretschneideri]
Length=94

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +D+DTPDRW N+AR V GKS  EVK+ Y +LV D+  IE+G+VP+
Sbjct  7    WTARQNKLFENALAVYDKDTPDRWHNLARAVGGKSVEEVKRHYQMLVEDVSKIEAGEVPL  66

Query  389  PNYRSTG  369
            PNYR +G
Sbjct  67   PNYRKSG  73



>ref|XP_010437040.1| PREDICTED: protein RADIALIS-like 1 [Camelina sativa]
Length=100

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTP+RWQN+A+ V GK+  EVK+ Y++LV D+ +IE+G VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVKRHYELLVQDINNIENGHVPF  73

Query  389  PNYRSTG  369
            PNYR++G
Sbjct  74   PNYRTSG  80



>ref|XP_011083676.1| PREDICTED: protein RADIALIS-like 4 [Sesamum indicum]
Length=95

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK+FE+ALA +D+DTPDRWQN+AR V GK+  EVK  Y  LV D+ HIESG VP+
Sbjct  7    WTAKQNKRFEDALAMYDKDTPDRWQNLARAVGGKTVEEVKSHYQKLVEDIDHIESGKVPL  66

Query  389  PNYRSTG  369
            P+YR  G
Sbjct  67   PDYRPYG  73



>ref|XP_004499158.1| PREDICTED: protein RADIALIS-like 5-like [Cicer arietinum]
Length=97

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK+FE ALA +D+DTPDRWQ +AR V GK+  EVK+ Y+ILV DLKHIE G VP+
Sbjct  7    WTPKQNKRFENALAIYDKDTPDRWQKLARAVGGKTVEEVKRHYEILVEDLKHIEQGLVPL  66

Query  389  PNYRSTGT  366
            P YR+  T
Sbjct  67   PKYRNAST  74



>emb|CDP07510.1| unnamed protein product [Coffea canephora]
Length=94

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +D+DTPDR+ N+A+ V GK+  EVK+ Y++LV D+ HIESG VP+
Sbjct  7    WTAKQNKLFENALATYDKDTPDRFHNLAKAVGGKTVEEVKRHYEMLVQDINHIESGKVPL  66

Query  389  PNYRSTGTRRR  357
            PNY S G   +
Sbjct  67   PNYSSNGNSNK  77



>gb|EYU42615.1| hypothetical protein MIMGU_mgv1a017293mg [Erythranthe guttata]
Length=83

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILV  429
            MAS S +  +   WTA +NK FEEALA  D+DTP+RW N+AR VG ++  EVK+ Y++L+
Sbjct  1    MASSSANRDSGRKWTAKENKDFEEALAEFDKDTPERWSNVARAVGTRTVEEVKKHYEVLL  60

Query  428  HDLKHIESGDVPVPNYRST  372
             DL  IESG VP+PNY++T
Sbjct  61   EDLNKIESGKVPLPNYKTT  79



>ref|NP_001043662.1| Os01g0635200 [Oryza sativa Japonica Group]
 dbj|BAF05576.1| Os01g0635200 [Oryza sativa Japonica Group]
 dbj|BAG99527.1| unnamed protein product [Oryza sativa Japonica Group]
Length=85

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS S+SS  +  WTA QN+QFE ALA +DRDTP+RW NIAR V GKS  EVK  YD+LV
Sbjct  1    MASMSVSSSRAPQWTARQNEQFERALAVYDRDTPERWHNIARAVAGKSADEVKLYYDLLV  60

Query  428  HDLKHIESGDVPVPNYRS  375
             D+K IE+G VP P YR 
Sbjct  61   EDVKRIETGKVPFPAYRC  78



>gb|EAY75088.1| hypothetical protein OsI_02982 [Oryza sativa Indica Group]
Length=85

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS S+SS  +  WTA QN+QFE ALA +DRDTP+RW NIAR V GKS  EVK  YD+LV
Sbjct  1    MASMSVSSSRAPQWTARQNEQFERALAVYDRDTPERWHNIARAVAGKSADEVKLYYDLLV  60

Query  428  HDLKHIESGDVPVPNYRS  375
             D+K IE+G VP P YR 
Sbjct  61   EDVKRIETGKVPFPAYRC  78



>ref|XP_002307660.2| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE94656.2| myb family transcription factor family protein [Populus trichocarpa]
Length=84

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DTPDRWQN+A+ V GKS  EVK  YD LV DL +IESG  P+
Sbjct  14   WTPKQNKLFEKALAVYDKDTPDRWQNVAKAVGGKSAEEVKMHYDRLVEDLTYIESGQAPL  73

Query  389  PNYRSTGT  366
            PNY+ +G+
Sbjct  74   PNYKPSGS  81



>gb|KHN36107.1| hypothetical protein glysoja_003230 [Glycine soja]
Length=84

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVGKSPAEVKQLYDILVHDLKHIESGDVPVP  387
            WT  QNK FEEALA HDR+TPDRWQN+AR VGKS  +VK+ Y+IL  D+K IE G +P+P
Sbjct  5    WTPRQNKLFEEALAIHDRETPDRWQNVARVVGKSVEDVKRHYEILKEDIKRIERGQIPLP  64

Query  386  NY  381
            NY
Sbjct  65   NY  66



>ref|XP_004151090.1| PREDICTED: protein RADIALIS-like 6-like [Cucumis sativus]
 ref|XP_004170174.1| PREDICTED: protein RADIALIS-like 6-like [Cucumis sativus]
 gb|KGN43144.1| hypothetical protein Csa_7G000020 [Cucumis sativus]
Length=96

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DTP+RWQNIA  V GKS  EV++ Y+IL+ DL+ IESG VP+
Sbjct  15   WTPKQNKLFEKALALYDKDTPERWQNIATAVGGKSADEVQRHYEILLEDLRRIESGRVPI  74

Query  389  PNYRSTGTR  363
            PNYR T  R
Sbjct  75   PNYRRTSNR  83



>ref|XP_007160753.1| hypothetical protein PHAVU_001G014300g [Phaseolus vulgaris]
 gb|ESW32747.1| hypothetical protein PHAVU_001G014300g [Phaseolus vulgaris]
Length=98

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK+FE ALA +D+DTPDRWQN+AR V GK+  EVK+ Y++LV DLK IE G VP+
Sbjct  7    WTTKQNKKFENALAIYDKDTPDRWQNLARAVGGKTVEEVKRHYEMLVDDLKQIEEGHVPL  66

Query  389  PNYR  378
            PNYR
Sbjct  67   PNYR  70



>ref|XP_007156953.1| hypothetical protein PHAVU_002G031300g [Phaseolus vulgaris]
 gb|ESW28947.1| hypothetical protein PHAVU_002G031300g [Phaseolus vulgaris]
Length=69

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVGKSPAEVKQLYDILVHDLKHIESGDVPVP  387
            WT  QNK FEEALA +DRDTPD+WQN+AR VGKS  EVK+ ++IL  D+K IE G VP+P
Sbjct  5    WTPRQNKLFEEALATYDRDTPDKWQNVARVVGKSVEEVKRHFEILKEDVKRIERGQVPLP  64

Query  386  NYRST  372
            NY  +
Sbjct  65   NYTGS  69



>ref|XP_008812249.1| PREDICTED: protein RADIALIS-like 4 [Phoenix dactylifera]
Length=89

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WTA ++K+FE ALA +D+DTPDRW+ +A  VG  KS A+VK+ YD+LV D++ IESGDVP
Sbjct  8    WTATEDKKFERALAIYDQDTPDRWEKVAAMVGGGKSAADVKRHYDLLVEDIQSIESGDVP  67

Query  392  VPNYRSTGTRR  360
             PNYR+T   R
Sbjct  68   FPNYRTTTNAR  78



>ref|XP_008241690.1| PREDICTED: protein RADIALIS-like 4 [Prunus mume]
Length=81

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNKQFE+ALA +D+DTPDRWQ +AR V GKS  EVKQ Y+IL+ D+ HIE+G VP 
Sbjct  16   WTPKQNKQFEKALALYDKDTPDRWQKVARAVGGKSAEEVKQHYEILLEDVNHIEAGRVPF  75

Query  389  PNYRS  375
            P YR 
Sbjct  76   PRYRG  80



>emb|CAB43640.1| putative protein [Arabidopsis thaliana]
 emb|CAB80588.1| putative protein [Arabidopsis thaliana]
 gb|AAS09997.1| MYB transcription factor [Arabidopsis thaliana]
 gb|ABD57475.1| At4g39250 [Arabidopsis thaliana]
Length=97

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTP+RWQN+A+ V GK+  EVK+ Y++LV D+  IE+G VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVKRHYELLVQDINSIENGHVPF  73

Query  389  PNYRSTG  369
            PNYR++G
Sbjct  74   PNYRTSG  80



>ref|NP_195636.2| protein RAD-like 1 [Arabidopsis thaliana]
 sp|F4JVB8.1|RADL1_ARATH RecName: Full=Protein RADIALIS-like 1; Short=AtRL1; Short=Protein 
RAD-like 1; AltName: Full=Protein RADIALIS-LIKE SANT/MYB 
2; Short=Protein RSM2 [Arabidopsis thaliana]
 gb|AEE87043.1| protein RAD-like 1 [Arabidopsis thaliana]
Length=100

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTP+RWQN+A+ V GK+  EVK+ Y++LV D+  IE+G VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVKRHYELLVQDINSIENGHVPF  73

Query  389  PNYRSTG  369
            PNYR++G
Sbjct  74   PNYRTSG  80



>ref|XP_006404620.1| hypothetical protein EUTSA_v10000389mg [Eutrema salsugineum]
 gb|ESQ46073.1| hypothetical protein EUTSA_v10000389mg [Eutrema salsugineum]
Length=100

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS+++SS  S SWT  QNK FE ALA +D+DTPDRW N+AR V GK+P E K+ YD+LV
Sbjct  1    MASNTMSSYGSGSWTVKQNKAFERALATYDQDTPDRWYNVARAVGGKTPEEAKRQYDLLV  60

Query  428  HDLKHIESGDVPVPNYRSTG  369
             D++ IE+G VP P+Y+S G
Sbjct  61   RDIESIENGHVPFPDYKSNG  80



>ref|XP_004961116.1| PREDICTED: protein RADIALIS-like 3-like [Setaria italica]
Length=99

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DTPDRW NIAR V GKS  EV++ Y++L  D+KHIESG VP 
Sbjct  16   WTKKQNKLFEQALAVYDKDTPDRWHNIARAVGGKSAEEVRRYYELLEEDVKHIESGKVPF  75

Query  389  PNYRSTG  369
            P YR  G
Sbjct  76   PAYRCPG  82



>ref|XP_009761204.1| PREDICTED: protein RADIALIS-like 1 [Nicotiana sylvestris]
Length=89

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK+FEEALA +D+DT DRW NIAR V GKS  EV++ Y++LV D+  IE+  VP+
Sbjct  4    WTAKQNKKFEEALALYDKDTCDRWNNIARCVGGKSAEEVRRHYELLVKDIMQIENDQVPL  63

Query  389  PNYRSTGTRRR*FS  348
            PNYR+ G+  R ++
Sbjct  64   PNYRTAGSDGRSYA  77



>ref|XP_002456020.1| hypothetical protein SORBIDRAFT_03g028960 [Sorghum bicolor]
 gb|EES01140.1| hypothetical protein SORBIDRAFT_03g028960 [Sorghum bicolor]
Length=98

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 2/66 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WTA QNK FE+ALA +DRDTPDRW NIAR V  GKS  EV++ Y++LV D++HIE+G VP
Sbjct  13   WTAKQNKLFEQALAVYDRDTPDRWHNIARAVGGGKSADEVRRYYELLVKDVEHIEAGKVP  72

Query  392  VPNYRS  375
             P YR 
Sbjct  73   FPAYRC  78



>ref|XP_007150886.1| hypothetical protein PHAVU_004G002400g [Phaseolus vulgaris]
 gb|ESW22880.1| hypothetical protein PHAVU_004G002400g [Phaseolus vulgaris]
Length=79

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA++NK FE ALA HD+DTP+RW NIA  V GK+P EVK+ YD+LV D++ IESG VP 
Sbjct  10   WTAEENKAFERALAVHDKDTPNRWCNIAMAVGGKTPEEVKRHYDLLVEDIRRIESGQVPF  69

Query  389  PNYRS  375
            P YR+
Sbjct  70   PTYRN  74



>ref|XP_009611761.1| PREDICTED: protein RADIALIS-like 5 [Nicotiana tomentosiformis]
Length=89

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK+FEEALA +D+DT DRW NIAR V GKS  EV++ Y++LV D+  IE+  VP+
Sbjct  4    WTAKQNKKFEEALALYDKDTSDRWNNIARCVGGKSAEEVRRHYELLVKDIMQIENDQVPL  63

Query  389  PNYRSTGTRRR*FS  348
            PNYR+ G+  R ++
Sbjct  64   PNYRTAGSDGRGYA  77



>ref|XP_004291870.1| PREDICTED: protein RADIALIS-like 6-like [Fragaria vesca subsp. 
vesca]
Length=101

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DT DRW N+A+ V GKS  EVK+ Y+ILV DL HIESG V +
Sbjct  15   WTPKQNKLFEKALAVYDKDTQDRWHNVAKAVGGKSAEEVKRHYEILVQDLMHIESGQVAI  74

Query  389  PNYRST  372
            PNYR+T
Sbjct  75   PNYRTT  80



>gb|ABI14756.1| AtRL1 [Arabidopsis thaliana]
Length=98

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTP+RWQN+A+ V GK+  EVK+ Y++LV D+  IE+G VP 
Sbjct  12   WTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVKRHYELLVQDINSIENGHVPF  71

Query  389  PNYRSTG  369
            PNYR++G
Sbjct  72   PNYRTSG  78



>ref|XP_006473515.1| PREDICTED: protein RADIALIS-like 6-like [Citrus sinensis]
Length=103

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 2/68 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT +QNK+FE ALA +D+DTPDRWQN+AR V  GKSP +VK+ YD LV DL  IES   P
Sbjct  17   WTPEQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFP  76

Query  392  VPNYRSTG  369
            +PNY++TG
Sbjct  77   LPNYKNTG  84



>ref|XP_009771192.1| PREDICTED: protein RADIALIS-like 3 [Nicotiana sylvestris]
Length=89

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK+FEEALA  D++TPDRW NIAR V GKS  EV++ Y++L+ D+  IE+G VP+
Sbjct  4    WTTRQNKKFEEALALFDKETPDRWHNIARCVGGKSAEEVRRHYELLLKDIMQIENGQVPL  63

Query  389  PNYRSTGTRRR*FS  348
            PNY++ G+  R ++
Sbjct  64   PNYKAVGSNSRGYA  77



>gb|KDP38508.1| hypothetical protein JCGZ_04433 [Jatropha curcas]
Length=96

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +DRDTPDRW N+AR V GK+  EVK+ Y++LV D++ IE+G VP+
Sbjct  9    WTPKQNKLFENALAIYDRDTPDRWHNLARAVGGKTVEEVKRHYELLVEDVRQIEAGQVPL  68

Query  389  PNYRSTGTRRR*FS  348
            PNYR  G   + +S
Sbjct  69   PNYRKAGLTAKPYS  82



>ref|XP_004252792.1| PREDICTED: protein RADIALIS-like 3 [Solanum lycopersicum]
Length=88

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT +QNK+FEEALA  D+DTPDRW NIAR V GKS  EVK+ Y++LV D+  IE+  VP+
Sbjct  4    WTKNQNKKFEEALALFDKDTPDRWHNIARCVGGKSAEEVKRHYELLVKDVMQIENDQVPL  63

Query  389  PNYRSTGTRRR*FS  348
            PNYR   +  R +S
Sbjct  64   PNYRGASSNGRSYS  77



>ref|XP_010690880.1| PREDICTED: protein RADIALIS-like 2 [Beta vulgaris subsp. vulgaris]
Length=82

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +DRDTPDRW NIAR V GK+  EVK+ Y+ L+ D+K+IESG VP 
Sbjct  15   WTPKQNKAFERALAIYDRDTPDRWHNIARAVGGKTAEEVKRHYEDLLEDIKNIESGQVPF  74

Query  389  PNYRSTG  369
            PNYR+ G
Sbjct  75   PNYRNIG  81



>ref|XP_009396486.1| PREDICTED: protein RADIALIS-like 3 [Musa acuminata subsp. malaccensis]
Length=79

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA +NK FE+ALA +DRDTPDRW  IAR + GK+  EVK+ YD+LV D++ IE+G +P 
Sbjct  10   WTAKENKMFEKALAVYDRDTPDRWHKIARAIGGKTADEVKRYYDLLVEDVRRIEAGQMPY  69

Query  389  PNYRSTGTR  363
             NYRS+  R
Sbjct  70   ANYRSSNGR  78



>ref|XP_011003722.1| PREDICTED: protein RADIALIS-like 3 [Populus euphratica]
Length=85

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DTPDRW N+A+ V GKS  EV++ Y+IL+ D++ IESG VP 
Sbjct  16   WTPKQNKLFEKALALYDKDTPDRWHNVAKAVGGKSAEEVQRHYEILIRDVREIESGRVPF  75

Query  389  PNYRSTG  369
            PNYRS+G
Sbjct  76   PNYRSSG  82



>ref|XP_008388061.1| PREDICTED: protein RADIALIS-like 3 [Malus domestica]
Length=96

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +D+DTPDRW N+AR V GKS  EVK+ Y +LV D+  IE+G+VP+
Sbjct  7    WTARQNKLFENALAVYDKDTPDRWHNLARAVGGKSVEEVKRHYQMLVEDVSKIEAGEVPL  66

Query  389  PNYRSTG  369
            PNYR +G
Sbjct  67   PNYRRSG  73



>ref|XP_009106182.1| PREDICTED: protein RADIALIS-like 6 [Brassica rapa]
 emb|CDX73153.1| BnaC06g36010D [Brassica napus]
Length=95

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW N+A+ V GKS  EVK+ YDILV DL +IE+G VP+
Sbjct  10   WTFKQNKMFERALAVYDKDTPDRWHNVAKAVGGKSAEEVKRHYDILVEDLINIETGRVPL  69

Query  389  PNYRSTGTRRR  357
            PNY++  +  R
Sbjct  70   PNYKTFESNSR  80



>ref|XP_009380360.1| PREDICTED: protein RADIALIS-like 3 [Musa acuminata subsp. malaccensis]
Length=98

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +D+DTPDRWQN+AR V GK+  EVK+ Y++LV DLK IES  VP 
Sbjct  14   WTAQQNKLFERALAVYDKDTPDRWQNVARAVGGKTVDEVKRHYELLVEDLKFIESNRVPY  73

Query  389  PNYRSTGTR  363
            P Y+S+ +R
Sbjct  74   PYYKSSSSR  82



>ref|XP_008220806.1| PREDICTED: protein RADIALIS-like 3 [Prunus mume]
Length=99

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT+ QNK FE ALA +D+DTPDRW N+AR V GKS  EVK+ Y++LV D+  IE+G+VP+
Sbjct  7    WTSRQNKMFENALAVYDKDTPDRWHNLARAVGGKSVEEVKRHYEMLVEDVNKIEAGEVPL  66

Query  389  PNYRSTGT  366
            PNYR  G 
Sbjct  67   PNYRKPGA  74



>ref|XP_004304977.1| PREDICTED: protein RADIALIS-like 1-like [Fragaria vesca subsp. 
vesca]
Length=112

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA   +DTPDRW NIAR VG K+P EVK+ YD+L+ D+K IESG+VP 
Sbjct  16   WTAKQNKTFEIALALFSKDTPDRWDNIARIVGNKTPEEVKRHYDLLLEDVKLIESGEVPF  75

Query  389  PNYRSTG  369
            P+YR++G
Sbjct  76   PDYRTSG  82



>ref|XP_009618694.1| PREDICTED: protein RADIALIS-like 2 [Nicotiana tomentosiformis]
Length=81

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DT DRW N+A+ V GK+  EVK+ Y+ILVHD+ +IESG VP 
Sbjct  13   WTAKQNKAFEKALAVYDKDTCDRWSNVAKAVGGKTAEEVKRHYEILVHDVLYIESGRVPF  72

Query  389  PNYRST  372
            P Y++T
Sbjct  73   PKYKTT  78



>dbj|BAJ85631.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=98

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 58/78 (74%), Gaps = 2/78 (3%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDIL  432
            MAS S+S+   + WT  QNK FE+ALA HDRDTPDRW N+AR V  GKS  +VK+ Y++L
Sbjct  1    MASLSMSTAGRAGWTPKQNKLFEQALAVHDRDTPDRWHNVARAVGSGKSADDVKRYYELL  60

Query  431  VHDLKHIESGDVPVPNYR  378
            VHD+ +IE+G VP P YR
Sbjct  61   VHDITNIEAGKVPFPAYR  78



>emb|CDY45420.1| BnaA07g32000D [Brassica napus]
Length=88

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW N+A+ V GKS  EVK+ YDILV DL +IE+G VP+
Sbjct  10   WTFKQNKMFERALAVYDKDTPDRWHNVAKAVGGKSAEEVKRHYDILVEDLINIETGRVPL  69

Query  389  PNYRSTGTRRR  357
            PNY++  +  R
Sbjct  70   PNYKTFESNSR  80



>ref|XP_009406294.1| PREDICTED: protein RADIALIS-like 3 [Musa acuminata subsp. malaccensis]
Length=79

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTPDRW N+AR V GKS  EVK+ Y++LV D+  IE G +P 
Sbjct  10   WTAKQNKMFEKALAVYDKDTPDRWHNVARAVGGKSAEEVKRHYELLVADIILIEKGQMPR  69

Query  389  PNYRSTGTR  363
             NYRS+G R
Sbjct  70   ANYRSSGHR  78



>ref|XP_006435008.1| hypothetical protein CICLE_v10003620mg [Citrus clementina]
 gb|ESR48248.1| hypothetical protein CICLE_v10003620mg [Citrus clementina]
Length=92

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 2/68 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT +QNK+FE ALA +D+DTPDRWQN+AR V  GKSP +VK+ YD LV DL  IES   P
Sbjct  17   WTPEQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFP  76

Query  392  VPNYRSTG  369
            +PNY++TG
Sbjct  77   LPNYKNTG  84



>ref|XP_006295299.1| hypothetical protein CARUB_v10024389mg [Capsella rubella]
 gb|EOA28197.1| hypothetical protein CARUB_v10024389mg [Capsella rubella]
Length=101

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW N+AR V GK+P E K+ YD+LV D++ IE+G VP 
Sbjct  15   WTVKQNKAFERALAVYDQDTPDRWYNVARAVGGKTPEEAKRQYDLLVRDIESIENGHVPF  74

Query  389  PNYRSTGTRRR  357
            P+Y++TG   R
Sbjct  75   PDYKTTGATNR  85



>gb|KDP26264.1| hypothetical protein JCGZ_22436 [Jatropha curcas]
Length=79

 Score = 87.8 bits (216),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 2/67 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE+ALA +D+DTPDRW N+A+ VG  KSP EV++ Y+IL+ D++ IESG VP
Sbjct  11   WTPKQNKLFEKALALYDKDTPDRWLNVAKAVGGNKSPEEVRRHYEILIKDVREIESGRVP  70

Query  392  VPNYRST  372
             PNY ST
Sbjct  71   FPNYTST  77



>ref|XP_009134001.1| PREDICTED: protein RADIALIS-like 2 isoform X3 [Brassica rapa]
Length=106

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREVGK-SPAEVKQLYDILV  429
            MAS+S+SS  S SWT  QNK FE ALA +D+DTPDRW N+AR VG  +P E K+ YD+LV
Sbjct  1    MASNSMSSYGSGSWTVKQNKAFERALATYDQDTPDRWYNVARAVGGTTPDEAKRQYDLLV  60

Query  428  HDLKHIESGDVPVPNYRSTGTRRR  357
             D++ I++G VP PNY +TG R +
Sbjct  61   RDIEIIDNGHVPFPNYTTTGGRTK  84



>ref|XP_009134000.1| PREDICTED: protein RADIALIS-like 2 isoform X2 [Brassica rapa]
Length=112

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS+S+SS  S SWT  QNK FE ALA +D+DTPDRW N+AR V G +P E K+ YD+LV
Sbjct  1    MASNSMSSYGSGSWTVKQNKAFERALATYDQDTPDRWYNVARAVGGTTPDEAKRQYDLLV  60

Query  428  HDLKHIESGDVPVPNYRSTGTRRR  357
             D++ I++G VP PNY +TG R +
Sbjct  61   RDIEIIDNGHVPFPNYTTTGGRTK  84



>gb|KHN08900.1| hypothetical protein glysoja_029477 [Glycine soja]
Length=97

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            W+   NK FE+ALA +D+DTPDRW N+A  VG K+P EVK+ Y++LV D+KHIESG VP 
Sbjct  12   WSVKDNKAFEKALAVYDKDTPDRWYNVAHAVGGKTPEEVKRHYELLVQDVKHIESGRVPF  71

Query  389  PNYRST  372
            PNY+ T
Sbjct  72   PNYKKT  77



>ref|XP_008364991.1| PREDICTED: protein RADIALIS-like 3 [Malus domestica]
 ref|XP_009365559.1| PREDICTED: protein RADIALIS-like 3 [Pyrus x bretschneideri]
Length=95

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +D+DTP+RW N+AR V GKS  EVK+ Y +LV D+  IE+G+VP+
Sbjct  7    WTARQNKLFENALAVYDKDTPERWYNLARAVGGKSVEEVKRHYQMLVEDVNKIEAGEVPL  66

Query  389  PNYRSTG  369
            PNYR +G
Sbjct  67   PNYRKSG  73



>ref|XP_010102066.1| DnaJ homolog subfamily C member 2 [Morus notabilis]
 gb|EXB91916.1| DnaJ homolog subfamily C member 2 [Morus notabilis]
Length=94

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +D+D+PDRW N+AR V GK+  EVK+ Y++LV D+  IE+G+VP+
Sbjct  6    WTAKQNKLFENALAIYDKDSPDRWHNLARAVGGKTVEEVKRHYEMLVEDVNKIEAGEVPL  65

Query  389  PNYRSTGTRRR  357
            PNYR  G   +
Sbjct  66   PNYRKIGANNK  76



>ref|XP_004152694.1| PREDICTED: protein RADIALIS-like 6-like [Cucumis sativus]
 ref|XP_004165398.1| PREDICTED: protein RADIALIS-like 6-like [Cucumis sativus]
 gb|KGN62607.1| hypothetical protein Csa_2G361710 [Cucumis sativus]
Length=101

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK+FE+AL  +  DTPDRWQ +AR VG K+P EVK+ YDIL+ DL HIESG VP+
Sbjct  16   WTLKQNKKFEDALVLYPEDTPDRWQKVARAVGGKTPEEVKRHYDILLQDLMHIESGKVPL  75

Query  389  PNYR  378
            PNY+
Sbjct  76   PNYK  79



>ref|NP_001236080.1| MYB transcription factor MYB142 [Glycine max]
 gb|ABH02867.1| MYB transcription factor MYB142 [Glycine max]
Length=97

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            W+   NK FE+ALA +D+DTPDRW N+A  VG K+P EVK+ Y++LV D+KHIESG VP 
Sbjct  12   WSVKDNKAFEKALAVYDKDTPDRWYNVAHAVGGKTPEEVKRHYELLVQDVKHIESGRVPF  71

Query  389  PNYRST  372
            PNY+ T
Sbjct  72   PNYKKT  77



>ref|XP_008236902.1| PREDICTED: protein RADIALIS-like 1 [Prunus mume]
Length=73

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DT DRW N+A+ V GK+P EVK+ Y+ LV D+KHIESG VP 
Sbjct  9    WTAKQNKAFEKALALYDKDTTDRWYNVAKAVGGKTPEEVKRHYERLVEDVKHIESGQVPF  68

Query  389  PNYRS  375
            P YR 
Sbjct  69   PAYRG  73



>ref|XP_007203252.1| hypothetical protein PRUPE_ppa019533mg [Prunus persica]
 gb|EMJ04451.1| hypothetical protein PRUPE_ppa019533mg [Prunus persica]
Length=81

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNKQFE+ALA +D+DTPDRWQ +AR V GKS  EVKQ Y++L+ D+ HIE+G VP 
Sbjct  16   WTPKQNKQFEKALALYDKDTPDRWQKVARAVGGKSAEEVKQHYEVLLEDVNHIEAGRVPF  75

Query  389  PNYRS  375
            P YR 
Sbjct  76   PRYRG  80



>gb|KHN14528.1| hypothetical protein glysoja_027137, partial [Glycine soja]
Length=86

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            W+   NK FE+ALA +D+DTPDRW N+A  VG K+P EVK+ Y++LV D+KHIESG VP 
Sbjct  7    WSVKDNKAFEKALAVYDKDTPDRWYNVAHAVGGKTPEEVKRHYELLVQDVKHIESGRVPF  66

Query  389  PNYRST  372
            PNY+ T
Sbjct  67   PNYKKT  72



>ref|XP_006423283.1| hypothetical protein CICLE_v10029669mg [Citrus clementina]
 ref|XP_006469147.1| PREDICTED: protein RADIALIS-like 6-like [Citrus sinensis]
 gb|ESR36523.1| hypothetical protein CICLE_v10029669mg [Citrus clementina]
 gb|KDO47527.1| hypothetical protein CISIN_1g034427mg [Citrus sinensis]
Length=95

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%), Gaps = 2/69 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  +NK FE+ALA +D++TPDRWQNIA+ V  GK+  EVK+ Y+ILV DL  IE+G VP
Sbjct  10   WTPKENKLFEKALALYDKETPDRWQNIAKAVGGGKTVEEVKKHYEILVDDLNRIEAGRVP  69

Query  392  VPNYRSTGT  366
            +PNY+S G+
Sbjct  70   IPNYKSPGS  78



>gb|KHN41969.1| hypothetical protein glysoja_003709 [Glycine soja]
Length=69

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVGKSPAEVKQLYDILVHDLKHIESGDVPVP  387
            WT  QNK FEEALA +DR+TPDRWQN+AR VGKS  +VK+ Y+IL  D+K IE G +P+P
Sbjct  5    WTPRQNKLFEEALAIYDRETPDRWQNVARVVGKSVEDVKRHYEILKEDIKRIERGQIPLP  64

Query  386  NY  381
            NY
Sbjct  65   NY  66



>ref|XP_011025809.1| PREDICTED: protein RADIALIS-like 3 [Populus euphratica]
 ref|XP_011016702.1| PREDICTED: protein RADIALIS-like 3 [Populus euphratica]
Length=78

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE+ALA +D+DTPDRW N+A+ V GKS  EVK  Y+IL+ D++ IESG VP 
Sbjct  9    WTPKQNKLFEKALALYDKDTPDRWHNVAKAVGGKSAEEVKMHYEILIKDVREIESGRVPF  68

Query  389  PNYRSTG  369
            PNY S+G
Sbjct  69   PNYWSSG  75



>ref|NP_177661.1| protein RADIALIS-like 6 [Arabidopsis thaliana]
 gb|AAG12684.1|AC025814_8 myb-related protein; 20671-21051 [Arabidopsis thaliana]
 gb|AAS09995.1| MYB transcription factor [Arabidopsis thaliana]
 gb|ABG48447.1| At1g75250 [Arabidopsis thaliana]
 gb|AEE35693.1| protein RADIALIS-like 6 [Arabidopsis thaliana]
Length=126

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW N+A+ V GK+  EVK+ YDILV DL +IE+G VP+
Sbjct  12   WTFSQNKMFERALAVYDKDTPDRWHNVAKAVGGKTVEEVKRHYDILVEDLINIETGRVPL  71

Query  389  PNYRSTGTRRR  357
            PNY++  +  R
Sbjct  72   PNYKTFESNSR  82



>ref|XP_008800712.1| PREDICTED: protein RADIALIS-like 3 [Phoenix dactylifera]
Length=102

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 4/73 (5%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  +NK FE+ALA++D++TPDRW  +A+ VG K+P EVK+ Y++LV D+KHIE+G VP 
Sbjct  16   WTLKENKLFEQALAKYDKETPDRWHKVAQAVGGKTPEEVKRHYELLVEDIKHIEAGHVPF  75

Query  389  PNYRST---GTRR  360
            PNY S+   G RR
Sbjct  76   PNYGSSSSMGGRR  88



>ref|XP_010539897.1| PREDICTED: protein RADIALIS-like 5 [Tarenaya hassleriana]
Length=93

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK+FE+ALA +D+DTPDRW+N+A+ V GKSP EVK  YDILV DL +IE   VP+
Sbjct  11   WTTKQNKKFEKALAVYDKDTPDRWENVAKAVGGKSPEEVKHHYDILVEDLMNIERDRVPL  70

Query  389  PNYRSTGTR  363
            P Y++   R
Sbjct  71   PKYKTLSRR  79



>gb|EMT00143.1| DnaJ homolog subfamily C member 2 [Aegilops tauschii]
Length=100

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 2/79 (3%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDIL  432
            MAS S+S+   + WT  QNK FE+ALA HDRDTPDRW N+AR V  GKS  +VK+ Y++L
Sbjct  1    MASLSMSAAGRAGWTPQQNKLFEQALAVHDRDTPDRWHNVARAVGGGKSADDVKRYYELL  60

Query  431  VHDLKHIESGDVPVPNYRS  375
            VHD+  IE+G V  P YRS
Sbjct  61   VHDIARIEAGKVAFPAYRS  79



>gb|KFK41962.1| hypothetical protein AALP_AA2G194600 [Arabis alpina]
Length=98

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW N+A+ V GK+  EVK+ YDILV DL +IE+G VP+
Sbjct  12   WTFKQNKMFERALAVYDKDTPDRWHNVAKAVGGKTAEEVKRHYDILVEDLINIETGRVPL  71

Query  389  PNYRST  372
            PNY+ T
Sbjct  72   PNYKKT  77



>emb|CDX83196.1| BnaA03g23100D [Brassica napus]
Length=118

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS+S+SS  S SWT  QNK FE ALA +D+DTPDRW N+AR V G +P E K+ YD+LV
Sbjct  1    MASNSMSSYGSGSWTVKQNKAFERALATYDQDTPDRWYNVARAVGGTTPDEAKRQYDLLV  60

Query  428  HDLKHIESGDVPVPNYRSTGTRRR  357
             D++ I++G VP PNY +TG R +
Sbjct  61   RDIEIIDNGHVPFPNYTTTGGRTK  84



>gb|KEH40146.1| MYB family transcription factor [Medicago truncatula]
Length=93

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK+FE ALA +D+DTPDRWQ +AR V GK+  EVK+ Y++LV DLK IE G VP+
Sbjct  7    WTTKQNKRFENALAIYDKDTPDRWQKLARAVGGKTVEEVKRHYEMLVEDLKQIEEGHVPL  66

Query  389  PNYRSTGT  366
            P YR+  T
Sbjct  67   PKYRNAAT  74



>ref|XP_009134002.1| PREDICTED: protein RADIALIS-like 2 isoform X4 [Brassica rapa]
Length=100

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS+S+SS  S SWT  QNK FE ALA +D+DTPDRW N+AR V G +P E K+ YD+LV
Sbjct  1    MASNSMSSYGSGSWTVKQNKAFERALATYDQDTPDRWYNVARAVGGTTPDEAKRQYDLLV  60

Query  428  HDLKHIESGDVPVPNYRSTGTR  363
             D++ I++G VP PNY +TG R
Sbjct  61   RDIEIIDNGHVPFPNYTTTGGR  82



>ref|XP_010060956.1| PREDICTED: protein RADIALIS-like 3 [Eucalyptus grandis]
 gb|KCW67855.1| hypothetical protein EUGRSUZ_F01576 [Eucalyptus grandis]
Length=101

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 53/75 (71%), Gaps = 6/75 (8%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE ALA +D+DTPDRW N+AR VG  KS  EVK+ YD+LV D+  IESG VP
Sbjct  13   WTPMQNKMFERALALYDKDTPDRWHNVARAVGGNKSAEEVKRRYDMLVQDVMSIESGQVP  72

Query  392  VPNYRST----GTRR  360
            +P YR++    GT R
Sbjct  73   LPKYRASSASYGTSR  87



>gb|KFK32873.1| hypothetical protein AALP_AA6G298600 [Arabis alpina]
Length=101

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS+S+SS  S SWT  QNK FE ALA +D+DTPDRW N+AR V GK+P E K+ YD+LV
Sbjct  1    MASNSMSSYGSGSWTVKQNKAFERALATYDQDTPDRWHNVARAVGGKTPEEAKRQYDLLV  60

Query  428  HDLKHIESGDVPVPNYRST  372
             D++ IE+G VP P+Y++T
Sbjct  61   LDIESIENGHVPFPDYKTT  79



>gb|EMS56253.1| DnaJ homolog subfamily C member 2 [Triticum urartu]
Length=100

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 2/79 (3%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDIL  432
            MAS S+S+   + WT  QNK FE+ALA HDRDTPDRW N+AR V  GKS  +VK+ Y++L
Sbjct  1    MASLSMSAAGRAGWTPQQNKLFEQALAVHDRDTPDRWHNVARAVGGGKSADDVKRYYELL  60

Query  431  VHDLKHIESGDVPVPNYRS  375
            VHD+  IE+G V  P YRS
Sbjct  61   VHDIARIEAGKVAFPAYRS  79



>ref|XP_002889017.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65276.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=95

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT +QNK FE ALA +D+DTPDRW N+A+ V GK+  EVK+ YDILV DL +IE+G VP+
Sbjct  12   WTFNQNKMFERALAVYDKDTPDRWHNVAKAVGGKTVEEVKRHYDILVEDLINIETGRVPL  71

Query  389  PNYRSTGTRRR  357
            PNY++  +  R
Sbjct  72   PNYKTFESNSR  82



>ref|XP_007225405.1| hypothetical protein PRUPE_ppa024375mg [Prunus persica]
 gb|EMJ26604.1| hypothetical protein PRUPE_ppa024375mg [Prunus persica]
Length=99

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT+ QNK FE ALA +D+DTPDRW N+AR V GKS  EVK+ Y++LV D+  IE+G+VP+
Sbjct  7    WTSRQNKMFENALAVYDKDTPDRWHNLARAVGGKSVEEVKKHYEMLVEDVNKIEAGEVPL  66

Query  389  PNYR  378
            PNYR
Sbjct  67   PNYR  70



>ref|XP_006342582.1| PREDICTED: protein RADIALIS-like 6-like [Solanum tuberosum]
Length=88

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT +QNK+FEEALA  D+DTPDRW NIAR V GKS  EVK+ Y++LV D+  IE+  VP+
Sbjct  4    WTKNQNKKFEEALALFDKDTPDRWHNIARCVGGKSAEEVKRHYELLVKDVMKIENDQVPL  63

Query  389  PNYRSTGTRRR*FS  348
            PNYR   +  R ++
Sbjct  64   PNYRGASSNGRSYA  77



>ref|NP_001077825.1| protein RADIALIS-like 6 [Arabidopsis thaliana]
 sp|Q1A173.1|RADL6_ARATH RecName: Full=Protein RADIALIS-like 6; Short=AtRL6; Short=Protein 
RAD-like 6; AltName: Full=Protein RADIALIS-LIKE SANT/MYB 
3; Short=Protein RSM3 [Arabidopsis thaliana]
 gb|ABD24442.1| RAD-like protein 6 [Arabidopsis thaliana]
 gb|AEE35694.1| protein RADIALIS-like 6 [Arabidopsis thaliana]
Length=97

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW N+A+ V GK+  EVK+ YDILV DL +IE+G VP+
Sbjct  12   WTFSQNKMFERALAVYDKDTPDRWHNVAKAVGGKTVEEVKRHYDILVEDLINIETGRVPL  71

Query  389  PNYRSTGTRRR  357
            PNY++  +  R
Sbjct  72   PNYKTFESNSR  82



>gb|ABM97744.1| RAD [Oreocharis leiophylla]
 gb|ABN13125.1| transcription factor RAD [Oreocharis leiophylla]
Length=85

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA +NK FE+ALA +D+DTPDRW N+A+ V G++  EVK+ Y+ILV D+K IESG VP 
Sbjct  8    WTAKENKAFEQALAVYDKDTPDRWVNVAKAVPGRTVEEVKRHYEILVEDVKSIESGKVPF  67

Query  389  PNYRS  375
            PNYR+
Sbjct  68   PNYRT  72



>ref|XP_010548326.1| PREDICTED: protein RADIALIS-like 3 [Tarenaya hassleriana]
Length=84

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +D+DTPDRWQN+A+ V GKS  EVK+ Y++L+ D+  IESG  P 
Sbjct  16   WTAKQNKLFERALAIYDKDTPDRWQNVAKAVGGKSAEEVKRHYELLIRDVNDIESGRYPH  75

Query  389  PNYRSTG  369
            PNYR++G
Sbjct  76   PNYRTSG  82



>ref|XP_010061304.1| PREDICTED: protein RADIALIS-like 3 isoform X1 [Eucalyptus grandis]
 gb|KCW68235.1| hypothetical protein EUGRSUZ_F01887 [Eucalyptus grandis]
Length=87

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 2/67 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT +QNK+FEEALA +D +TPDRWQ +AR V  GKS  EV++ Y++LV DL  IESG +P
Sbjct  5    WTREQNKRFEEALALYDENTPDRWQRVARAVGDGKSVEEVRRHYEVLVRDLVRIESGQIP  64

Query  392  VPNYRST  372
            +PNYR +
Sbjct  65   LPNYRGS  71



>ref|XP_006654838.1| PREDICTED: protein RADIALIS-like 1-like [Oryza brachyantha]
Length=97

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 2/66 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE+ALA +D++TPDRW NIAR V  GKS  EVK+ Y++LV D+ HIESG VP
Sbjct  9    WTPKQNKLFEQALAVYDKETPDRWHNIARAVGGGKSAEEVKRYYELLVEDINHIESGKVP  68

Query  392  VPNYRS  375
             P YR 
Sbjct  69   FPAYRC  74



>gb|EYU32775.1| hypothetical protein MIMGU_mgv1a016932mg [Erythranthe guttata]
Length=100

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNKQFEEA+A  DRDTPDRW NIAR+V GKS  EV++ Y+ L  D+  IE+  VP+
Sbjct  17   WTAKQNKQFEEAIAMFDRDTPDRWHNIARQVSGKSAEEVRRHYEALEKDIMKIETDQVPI  76

Query  389  PNYRSTGTRR  360
            PNY+S    R
Sbjct  77   PNYKSISNAR  86



>ref|XP_009133999.1| PREDICTED: protein RADIALIS-like 2 isoform X1 [Brassica rapa]
Length=138

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREVGK-SPAEVKQLYDILV  429
            MAS+S+SS  S SWT  QNK FE ALA +D+DTPDRW N+AR VG  +P E K+ YD+LV
Sbjct  1    MASNSMSSYGSGSWTVKQNKAFERALATYDQDTPDRWYNVARAVGGTTPDEAKRQYDLLV  60

Query  428  HDLKHIESGDVPVPNYRSTGTRRR  357
             D++ I++G VP PNY +TG R +
Sbjct  61   RDIEIIDNGHVPFPNYTTTGGRTK  84



>ref|XP_002878564.1| hypothetical protein ARALYDRAFT_481032 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54823.1| hypothetical protein ARALYDRAFT_481032 [Arabidopsis lyrata subsp. 
lyrata]
Length=96

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW NIAR V GK+P E K+ YD+LV D++ IE+G VP 
Sbjct  9    WTVKQNKAFERALAVYDQDTPDRWHNIARSVGGKTPEEAKRQYDLLVRDIESIENGHVPF  68

Query  389  PNYRST  372
            P+Y++T
Sbjct  69   PDYKTT  74



>ref|XP_004151116.1| PREDICTED: transcription factor RADIALIS-like [Cucumis sativus]
 ref|XP_004170039.1| PREDICTED: transcription factor RADIALIS-like [Cucumis sativus]
 gb|KGN44075.1| hypothetical protein Csa_7G169070 [Cucumis sativus]
Length=79

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 2/66 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FEEALA +D+DTPDRW N+A+ + GK+  EVK+ Y +L+ D+KHIESG VP 
Sbjct  12   WTAKQNKAFEEALAMYDKDTPDRWLNVAKAIGGKTEEEVKRHYQLLLEDVKHIESGKVPF  71

Query  389  PNYRST  372
            P YRS+
Sbjct  72   P-YRSS  76



>ref|XP_006390328.1| hypothetical protein EUTSA_v10019367mg [Eutrema salsugineum]
 gb|ESQ27614.1| hypothetical protein EUTSA_v10019367mg [Eutrema salsugineum]
Length=97

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW N+A  V GKS  EVK+ YDILV DL  IE+G VP+
Sbjct  12   WTFKQNKMFERALAVYDKDTPDRWHNVANAVGGKSAEEVKRHYDILVEDLISIETGRVPL  71

Query  389  PNYRSTGTRRR  357
            PNY++  +  R
Sbjct  72   PNYKTFESNSR  82



>ref|XP_004230980.1| PREDICTED: protein RADIALIS-like 4 [Solanum lycopersicum]
Length=88

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE ALA+ D+DTPDRWQN+AR V  GKS  EVK+ Y+IL+ DL+ IESG VP
Sbjct  11   WTPQQNKLFERALAQFDKDTPDRWQNVARAVGGGKSADEVKRHYEILIEDLRRIESGRVP  70

Query  392  VPNY  381
            +PNY
Sbjct  71   LPNY  74



>gb|KFK30501.1| hypothetical protein AALP_AA7G270400 [Arabis alpina]
Length=100

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTP+RW N+A+ V GK+  EVK+ Y++LV D+ +IE+G VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWHNVAKLVGGKTTEEVKRHYELLVQDINNIENGHVPF  73

Query  389  PNYRSTGT  366
            PNY+++G+
Sbjct  74   PNYKTSGS  81



>ref|XP_009340748.1| PREDICTED: protein RADIALIS-like 4 [Pyrus x bretschneideri]
Length=97

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +DR+TPDRW NIAR V G +  EVK+ Y+IL+ D+  IESG VP+
Sbjct  15   WTAKQNKLFENALATYDRETPDRWSNIARIVGGMTEEEVKRQYEILLADINRIESGKVPL  74

Query  389  PNYRSTG  369
            P YR  G
Sbjct  75   PKYRKVG  81



>ref|XP_010428536.1| PREDICTED: protein RADIALIS-like 6 [Camelina sativa]
Length=100

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT DQNK FE ALA +D+DTPDRW N+A+ V GKS  EVK+ YDILV DL +IE+G VP+
Sbjct  13   WTFDQNKMFERALAIYDKDTPDRWHNVAKAVEGKSVEEVKRHYDILVEDLINIETGRVPL  72

Query  389  PNYRS  375
            P Y++
Sbjct  73   PKYKN  77



>ref|XP_010927372.1| PREDICTED: protein RADIALIS-like 1 [Elaeis guineensis]
Length=162

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA++D++TPDRW N+AR V GKS  EVK+ Y+ LV D++ IESG VP 
Sbjct  10   WTPKQNKLFETALAKYDKETPDRWHNVARAVGGKSAEEVKRHYERLVEDIRQIESGHVPF  69

Query  389  PNYRSTGTR  363
            P+YRS+G R
Sbjct  70   PSYRSSGGR  78


 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -1

Query  560  ADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPVPN  384
            A QNK FEEALA++DRDTPDRWQ +A  VG KS  EVK+ Y++L+ D+ +IESG     N
Sbjct  102  ARQNKLFEEALAKYDRDTPDRWQKVANAVGDKSVEEVKRHYELLIKDINYIESGRAQHRN  161

Query  383  Y  381
            Y
Sbjct  162  Y  162



>ref|XP_010416923.1| PREDICTED: protein RADIALIS-like 2 [Camelina sativa]
 ref|XP_010472163.1| PREDICTED: protein RADIALIS-like 2 [Camelina sativa]
Length=103

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW N+AR V GK+P E K+ Y++LV D++ IE+G VP 
Sbjct  15   WTVKQNKAFERALAVYDQDTPDRWYNVARAVGGKTPEEAKRQYELLVRDIESIENGHVPF  74

Query  389  PNYRSTGTRRR  357
            P+Y++TG   R
Sbjct  75   PDYKTTGATNR  85



>gb|AHB59612.1| putative MYB-related protein 26 [Arachis hypogaea]
Length=81

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = -1

Query  560  ADQNKQFEEALARHDRDTPDRWQNIAREVG-KSPAEVKQLYDILVHDLKHIESGDVPVPN  384
            A  NK FE ALA +D+DTPDRW NIAR VG K+P +VK+ Y+ LVHD++HIESG VP PN
Sbjct  14   AKDNKAFERALAVYDKDTPDRWYNIARAVGGKTPEDVKRHYERLVHDVRHIESGQVPYPN  73

Query  383  YRSTG  369
            Y+ +G
Sbjct  74   YKKSG  78



>ref|XP_010102082.1| DnaJ homolog subfamily C member 1 [Morus notabilis]
 gb|EXB91932.1| DnaJ homolog subfamily C member 1 [Morus notabilis]
Length=94

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+D PDRWQN+A+ V GK+  EVK+ YDILV DL +IESG  P+
Sbjct  16   WTPKQNKLFEMALAVYDKDAPDRWQNVAKAVGGKTAEEVKRHYDILVQDLINIESGQFPI  75

Query  389  PNYRST  372
            PNYR  
Sbjct  76   PNYRGA  81



>ref|XP_009371599.1| PREDICTED: protein RADIALIS-like 4 [Pyrus x bretschneideri]
Length=97

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +DR+TPDRW NIAR V G +  EVK+ Y+IL+ D+  IESG VP+
Sbjct  15   WTAKQNKSFEIALATYDRETPDRWHNIARVVGGTTEEEVKRQYEILLADINRIESGKVPL  74

Query  389  PNYRSTG  369
            P YR  G
Sbjct  75   PKYRKVG  81



>ref|XP_010431894.1| PREDICTED: protein RADIALIS-like 1 [Camelina sativa]
Length=100

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTP+RWQN+A+ V GK+  EV + Y++LV D+  IE+G VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVTRHYELLVQDINSIENGHVPF  73

Query  389  PNYRSTG  369
            PNYR++G
Sbjct  74   PNYRTSG  80



>ref|XP_006409166.1| hypothetical protein EUTSA_v10023187mg [Eutrema salsugineum]
 gb|ESQ50619.1| hypothetical protein EUTSA_v10023187mg [Eutrema salsugineum]
Length=93

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA Q+KQFE ALA++D+DTPDRWQN+AR V GKS  EVK+ Y++L+ D+  IESG  P 
Sbjct  27   WTAKQDKQFEMALAKYDKDTPDRWQNVARAVGGKSAEEVKRHYELLIRDVNDIESGRYPQ  86

Query  389  PNYRST  372
            P YR+T
Sbjct  87   PRYRNT  92



>ref|XP_010416394.1| PREDICTED: protein RADIALIS-like 6 [Camelina sativa]
Length=100

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT DQNK FE ALA +D+DTPDRW N+A+ V GKS  EVK+ YDILV DL +IE+G VP+
Sbjct  13   WTFDQNKMFERALAIYDKDTPDRWHNVAKAVEGKSVEEVKRHYDILVEDLINIETGRVPL  72

Query  389  PNYRS  375
            P Y++
Sbjct  73   PKYKN  77



>ref|XP_009378514.1| PREDICTED: protein RADIALIS-like 3 [Pyrus x bretschneideri]
Length=104

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE+ALA +D++TP+RWQN+A+ VG  K+  EVK+ YDIL+ DL+ IESG VP
Sbjct  15   WTPKQNKLFEKALALYDKETPERWQNVAKAVGGNKTAEEVKKHYDILLEDLRQIESGRVP  74

Query  392  VPNYR  378
            +PNY+
Sbjct  75   IPNYK  79



>ref|XP_009128087.1| PREDICTED: protein RADIALIS-like 6 [Brassica rapa]
Length=96

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW N+A  V GKS  EVK+ YDILV DL  IE+G VP+
Sbjct  12   WTFRQNKMFERALAVYDKDTPDRWHNVANAVGGKSAEEVKRHYDILVEDLISIETGRVPL  71

Query  389  PNYRSTGTRR  360
            PNY++    R
Sbjct  72   PNYKTKSNSR  81



>ref|XP_010061305.1| PREDICTED: protein RADIALIS-like 3 isoform X2 [Eucalyptus grandis]
 gb|KCW68236.1| hypothetical protein EUGRSUZ_F01887 [Eucalyptus grandis]
Length=82

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 2/66 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT +QNK+FEEALA +D +TPDRWQ +AR V  GKS  EV++ Y++LV DL  IESG +P
Sbjct  5    WTREQNKRFEEALALYDENTPDRWQRVARAVGDGKSVEEVRRHYEVLVRDLVRIESGQIP  64

Query  392  VPNYRS  375
            +PNYR 
Sbjct  65   LPNYRG  70



>ref|XP_009347537.1| PREDICTED: protein RADIALIS-like 4 [Pyrus x bretschneideri]
Length=97

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +DR+TPDRW NIAR V G +  EVK+ Y+IL+ D+  IESG VP+
Sbjct  15   WTAKQNKLFENALATYDRETPDRWSNIARIVGGMTEEEVKRQYEILLADINRIESGKVPL  74

Query  389  PNYRSTG  369
            P YR  G
Sbjct  75   PKYRKVG  81



>ref|XP_008236907.1| PREDICTED: protein RADIALIS-like 3 [Prunus mume]
Length=106

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE ALA +D+DTP+RWQN+A+ VG  K+  EVK+ YDIL+ DL+ IESG VP
Sbjct  11   WTPKQNKLFERALALYDKDTPERWQNVAKAVGGNKTAEEVKRHYDILLEDLRQIESGHVP  70

Query  392  VPNYR  378
            +PNY+
Sbjct  71   IPNYK  75



>gb|EEE55045.1| hypothetical protein OsJ_02736 [Oryza sativa Japonica Group]
Length=88

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS S+SS  +  WTA QN+QFE ALA +DRDTP+RW NIAR V GKS  EVK  YD+LV
Sbjct  1    MASMSVSSSRAPQWTARQNEQFERALAVYDRDTPERWHNIARAVAGKSADEVKLYYDLLV  60

Query  428  HDLKHIESGDVPVPNYRSTGTRR  360
             D+K IE+G VP P  ++  + R
Sbjct  61   EDVKRIETGKVPFPGLKAPRSER  83



>gb|AEV91165.1| MYB-related protein [Aegilops speltoides]
 gb|EMT01033.1| DnaJ homolog subfamily C member 2 [Aegilops tauschii]
Length=96

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE+ALA HDRDTPDRW NIAR V  GKS  +V++ Y++LVHD+  IE+G VP
Sbjct  10   WTPKQNKLFEQALAVHDRDTPDRWHNIARAVGGGKSADDVRRYYELLVHDIARIEAGKVP  69

Query  392  VPNYR  378
             P YR
Sbjct  70   FPAYR  74



>ref|XP_010555296.1| PREDICTED: protein RADIALIS-like 2 [Tarenaya hassleriana]
Length=100

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS S+SS  S SWTA QNK FE ALA +D DTPDRW N+A+ V GK+P E KQ Y++LV
Sbjct  1    MASGSMSSHGSDSWTAKQNKAFERALAIYDTDTPDRWYNVAKAVGGKTPDEAKQHYELLV  60

Query  428  HDLKHIESGDVPVPNYRSTG  369
             D+  IE G VP P+Y++TG
Sbjct  61   RDVDSIEKGHVPFPDYKNTG  80



>ref|XP_009785808.1| PREDICTED: protein RADIALIS-like 1 [Nicotiana sylvestris]
Length=89

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA+QNK FE+ALA +D+DTPDRW N+AR V GK+  EVK+ Y+ILV D+  IE+G VP 
Sbjct  12   WTAEQNKAFEKALAVYDKDTPDRWSNVARAVGGKTAEEVKRHYEILVQDVMSIENGRVPF  71

Query  389  PNY  381
            PNY
Sbjct  72   PNY  74



>ref|XP_006365108.1| PREDICTED: transcription factor RADIALIS-like [Solanum tuberosum]
Length=90

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE ALA +D+D PDRW N+AR +G  K+  +VKQ Y++L+HD+K IESG VP
Sbjct  14   WTLQQNKAFERALAVYDKDAPDRWSNVARAIGGNKTAEDVKQHYEVLLHDIKFIESGGVP  73

Query  392  VPNYRS-TGTRRR  357
             PNY +  G R R
Sbjct  74   FPNYTTRNGGRGR  86



>ref|XP_010471632.1| PREDICTED: protein RADIALIS-like 6 [Camelina sativa]
Length=100

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT DQNK FE ALA +D+DTPDRW N+A+ + GKS  EVK+ YDILV DL +IE+G VP+
Sbjct  13   WTFDQNKMFERALAIYDKDTPDRWHNVAKAIEGKSVEEVKRHYDILVEDLINIETGRVPL  72

Query  389  PNYRS  375
            P Y++
Sbjct  73   PKYKN  77



>ref|XP_010936699.1| PREDICTED: protein RADIALIS-like 3 [Elaeis guineensis]
Length=95

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW N+AR V GKS  EVK+ Y++LV DLK+IESG VP 
Sbjct  14   WTPKQNKLFERALAVYDKDTPDRWHNVARAVGGKSAEEVKRHYELLVEDLKNIESGQVPF  73

Query  389  PNY  381
            PNY
Sbjct  74   PNY  76



>emb|CDY62533.1| BnaA02g35960D [Brassica napus]
Length=101

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW N+A  V GKS  EVK+ YDILV DL  IE+G VP+
Sbjct  12   WTFRQNKMFERALAVYDKDTPDRWHNVANAVGGKSAEEVKRHYDILVEDLISIETGRVPL  71

Query  389  PNYRSTGTRR  360
            PNY++    R
Sbjct  72   PNYKTKSNSR  81



>ref|XP_009616920.1| PREDICTED: protein RADIALIS-like 6 isoform X2 [Nicotiana tomentosiformis]
Length=82

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK+FEEALA  D++TPDRW NIAR V GKS  EV++ Y++LV D+  IE+G VP+
Sbjct  4    WTTRQNKKFEEALALFDKETPDRWHNIARCVGGKSAEEVRRHYELLVKDIMQIENGHVPL  63

Query  389  PNYRSTGTRRR  357
            PNY++  +  R
Sbjct  64   PNYKAVESNSR  74



>ref|XP_006284830.1| hypothetical protein CARUB_v10006110mg [Capsella rubella]
 gb|EOA17728.1| hypothetical protein CARUB_v10006110mg [Capsella rubella]
Length=100

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTP+RW N+A+ V GK+  EVK+ Y++LV D+  IE+G VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWYNVAKVVGGKTTEEVKRHYELLVQDINSIENGHVPF  73

Query  389  PNYRSTG  369
            PNYR++G
Sbjct  74   PNYRASG  80



>ref|XP_009616919.1| PREDICTED: protein RADIALIS-like 6 isoform X1 [Nicotiana tomentosiformis]
Length=88

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK+FEEALA  D++TPDRW NIAR V GKS  EV++ Y++LV D+  IE+G VP+
Sbjct  4    WTTRQNKKFEEALALFDKETPDRWHNIARCVGGKSAEEVRRHYELLVKDIMQIENGHVPL  63

Query  389  PNYRSTGTRRR  357
            PNY++  +  R
Sbjct  64   PNYKAVESNSR  74



>ref|XP_003547982.1| PREDICTED: protein RADIALIS-like 1-like [Glycine max]
 gb|KHN11105.1| hypothetical protein glysoja_033659 [Glycine soja]
Length=73

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVGKSPAEVKQLYDILVHDLKHIESGDVPVP  387
            WT  QNKQFE ALA++DR+TPDRWQN+A EVGKS  EVK+ Y+IL  D++ IE G V  P
Sbjct  5    WTPRQNKQFERALAKYDRETPDRWQNVANEVGKSVEEVKRHYEILKEDIRRIERGQVAFP  64

Query  386  NYRSTGT  366
             YR+  +
Sbjct  65   -YRTNNS  70



>ref|XP_007200670.1| hypothetical protein PRUPE_ppa015823mg, partial [Prunus persica]
 gb|EMJ01869.1| hypothetical protein PRUPE_ppa015823mg, partial [Prunus persica]
Length=97

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVG--KSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE ALA +D+DTP+RWQN+A+ VG  K+  EVK+ YDIL+ DL+ IESG VP
Sbjct  11   WTPKQNKLFERALALYDKDTPERWQNVAKAVGGNKTVEEVKRHYDILLEDLRQIESGHVP  70

Query  392  VPNYR  378
            +PNY+
Sbjct  71   IPNYK  75



>gb|EMS68204.1| DnaJ homolog subfamily C member 2 [Triticum urartu]
Length=96

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE+ALA HDRDTPDRW NIAR V  GKS  +V++ Y++LVHD+  IE+G VP
Sbjct  10   WTPMQNKLFEQALAVHDRDTPDRWHNIARAVGGGKSADDVRRYYELLVHDIARIEAGKVP  69

Query  392  VPNYR  378
             P YR
Sbjct  70   FPAYR  74



>ref|XP_007204842.1| hypothetical protein PRUPE_ppa026779mg [Prunus persica]
 gb|EMJ06041.1| hypothetical protein PRUPE_ppa026779mg [Prunus persica]
Length=91

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +D +TPDRW  IAR V G +  EVK+ Y+IL+ D+K IESG VP+
Sbjct  15   WTAKQNKLFENALATYDEETPDRWHKIARIVGGTTEEEVKRQYEILLSDIKRIESGKVPL  74

Query  389  PNYRSTGT  366
            P YR  GT
Sbjct  75   PKYRKVGT  82



>emb|CDO97041.1| unnamed protein product [Coffea canephora]
Length=97

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 2/67 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE+ALA++D++TPDRWQN+AR V  GKS  EVK+ Y+ILV D++ IE+G VP
Sbjct  23   WTPQQNKLFEKALAQYDKETPDRWQNVARVVGGGKSADEVKRHYEILVEDVRRIETGRVP  82

Query  392  VPNYRST  372
             PNY +T
Sbjct  83   YPNYTTT  89



>ref|NP_179759.1| MYB transcription factor RSM1 [Arabidopsis thaliana]
 sp|Q9SIJ5.1|RADL2_ARATH RecName: Full=Protein RADIALIS-like 2; Short=AtRL2; Short=Protein 
RAD-like 2; AltName: Full=Protein MATERNAL EFFECT EMBRYO 
ARREST 3; AltName: Full=Protein RADIALIS-LIKE SANT/MYB 1; 
Short=Protein RSM1 [Arabidopsis thaliana]
 gb|AAD23640.1| unknown protein [Arabidopsis thaliana]
 gb|AAP40381.1| putative myb family transcription factor [Arabidopsis thaliana]
 gb|AAP40504.1| putative myb family transcription factor [Arabidopsis thaliana]
 gb|AAS09996.1| MYB transcription factor [Arabidopsis thaliana]
 dbj|BAF01371.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07207.1| protein RADIALIS-like 2 [Arabidopsis thaliana]
Length=101

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW N+AR V GK+P E K+ YD+LV D++ IE+G VP 
Sbjct  14   WTVKQNKAFERALAVYDQDTPDRWHNVARAVGGKTPEEAKRQYDLLVRDIESIENGHVPF  73

Query  389  PNYRST  372
            P+Y++T
Sbjct  74   PDYKTT  79



>ref|XP_009102249.1| PREDICTED: protein RADIALIS-like 4 [Brassica rapa]
 emb|CDY25163.1| BnaC07g03440D [Brassica napus]
Length=82

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA Q+KQFE ALA +D+DTPDRWQN+AR V GKS  EVK+ Y++L+ D+  IESG  P 
Sbjct  16   WTAKQDKQFEVALATYDKDTPDRWQNVARAVGGKSAEEVKRHYELLIRDVNDIESGRYPQ  75

Query  389  PNYRST  372
            P YR+T
Sbjct  76   PRYRNT  81



>ref|XP_007156943.1| hypothetical protein PHAVU_002G030400g [Phaseolus vulgaris]
 gb|ESW28937.1| hypothetical protein PHAVU_002G030400g [Phaseolus vulgaris]
Length=99

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVGKSPAEVKQLYDILVHDLKHIESGDVPVP  387
            WT  +NK FE ALA +D+DTPDRW NIA  VG++ AEVK+ Y++L+ D+K+IESG VP+P
Sbjct  15   WTPQKNKLFENALAIYDKDTPDRWNNIAMFVGETEAEVKRQYEMLLEDIKNIESGKVPLP  74

Query  386  NYR  378
             YR
Sbjct  75   AYR  77



>ref|XP_008444724.1| PREDICTED: protein RADIALIS-like 4 [Cucumis melo]
Length=101

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK+FE+AL  +  DTPDRWQ +AR V GK+  EVK+ YDIL+ DL HIESG VP+
Sbjct  16   WTLKQNKKFEDALVLYPEDTPDRWQKVARAVGGKTAEEVKRHYDILLQDLMHIESGKVPL  75

Query  389  PNYR  378
            PNY+
Sbjct  76   PNYK  79



>ref|XP_004969265.1| PREDICTED: protein RADIALIS-like 3-like [Setaria italica]
Length=91

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  Q+K FE+ALA +D++TPDRW NIAR V GKS  EV++ Y+ILV D+K IE+G VP 
Sbjct  13   WTKKQDKLFEQALAVYDKETPDRWHNIARAVGGKSAEEVRRYYEILVEDVKRIEAGKVPF  72

Query  389  PNYRSTG  369
            P YR  G
Sbjct  73   PAYRCPG  79



>ref|XP_006298896.1| hypothetical protein CARUB_v10015016mg [Capsella rubella]
 gb|EOA31794.1| hypothetical protein CARUB_v10015016mg [Capsella rubella]
Length=82

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA Q+KQFE ALA +D+DTPDRWQN+AR V GKS  EVK+ Y++L+ D+  IESG  P 
Sbjct  16   WTAKQDKQFEMALATYDKDTPDRWQNVARAVGGKSAEEVKRHYELLLRDVNDIESGRYPQ  75

Query  389  PNYRST  372
            P YR+T
Sbjct  76   PRYRNT  81



>emb|CDY46299.1| BnaA07g02020D [Brassica napus]
Length=82

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA Q+KQFE ALA +D+DTPDRWQN+AR V GKS  EVK  Y++L+ D+  IESG  P 
Sbjct  16   WTAKQDKQFEVALATYDKDTPDRWQNVARAVGGKSAEEVKSHYELLIRDVNDIESGRYPQ  75

Query  389  PNYRST  372
            P YR+T
Sbjct  76   PRYRNT  81



>gb|ADE77540.1| unknown [Picea sitchensis]
Length=107

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW N+A  V GKSP EVK+ Y+IL+ DL  IE+G VP 
Sbjct  21   WTFKQNKLFENALAIYDKDTPDRWHNVASVVGGKSPEEVKRHYEILLEDLNSIEAGQVPF  80

Query  389  PNYRST  372
            PNY S+
Sbjct  81   PNYISS  86



>ref|XP_002441574.1| hypothetical protein SORBIDRAFT_09g029560 [Sorghum bicolor]
 gb|EES20004.1| hypothetical protein SORBIDRAFT_09g029560 [Sorghum bicolor]
Length=88

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 48/67 (72%), Gaps = 2/67 (3%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVP  393
            WT  QNK FE+ALA +D+DTPDRW NIAR V  GKS  +V++ YD+L  D+ HIESG VP
Sbjct  16   WTPKQNKLFEQALAVYDKDTPDRWHNIARAVGGGKSAEDVRRYYDLLEEDVGHIESGKVP  75

Query  392  VPNYRST  372
             P YR  
Sbjct  76   FPAYRCA  82



>ref|XP_002510392.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF52579.1| DNA binding protein, putative [Ricinus communis]
Length=95

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT  QNK FE ALA +D+DTPDRW N+AR V GK+  EVK+ Y++LV D++ IE+G VP+
Sbjct  7    WTPKQNKLFENALAIYDKDTPDRWHNLARAVGGKTIEEVKRHYELLVEDVREIEAGHVPL  66

Query  389  PNYRSTG  369
            PNY+  G
Sbjct  67   PNYKKAG  73



>emb|CDY42615.1| BnaC01g00270D [Brassica napus]
Length=95

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA +D+DTP+RW N+A+ V GK+  EVK+ Y++LV D+  IE+G VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWHNVAQVVGGKTTEEVKRHYELLVQDINSIETGHVPF  73

Query  389  PNYRSTG  369
            PNY++ G
Sbjct  74   PNYKTNG  80



>ref|XP_010523611.1| PREDICTED: protein RADIALIS-like 6 [Tarenaya hassleriana]
Length=88

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE+ALA  + +TPDRWQ +AR V GK+  EVK  YDILV D+ HIESG +P+
Sbjct  16   WTAKQNKMFEKALAVFEEETPDRWQKVARAVGGKTAEEVKAHYDILVWDIIHIESGKIPI  75

Query  389  PNYRSTGTRR  360
            P+Y+    +R
Sbjct  76   PDYKPCYHKR  85



>ref|XP_008465612.1| PREDICTED: protein RADIALIS-like 3 [Cucumis melo]
Length=87

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WTA QNK FE ALA +D+DTP+RW N+AR V GK+  EVK+ Y+ LV D+  IE+G VP 
Sbjct  7    WTAKQNKVFENALAIYDKDTPERWHNLARAVGGKTAEEVKRHYERLVEDVNKIETGQVPF  66

Query  389  PNYRSTGTRRR*FS  348
            PNYR +G   R F 
Sbjct  67   PNYRRSGPAARGFC  80



>ref|XP_010679739.1| PREDICTED: protein RADIALIS-like 1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679740.1| PREDICTED: protein RADIALIS-like 1 [Beta vulgaris subsp. vulgaris]
Length=77

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREVGKSPAEVKQLYDILVHDLKHIESGDVPVP  387
            WT  QNK FE+ALA +D+DT DRWQ +A  VGKSP EVK+ Y+ILV D+K IE G VP P
Sbjct  10   WTPKQNKLFEKALALYDKDTQDRWQKVANVVGKSPEEVKRHYEILVEDVKSIERGQVPYP  69

Query  386  NYRSTG  369
             YR TG
Sbjct  70   -YRPTG  74



>gb|KDO84586.1| hypothetical protein CISIN_1g034673mg [Citrus sinensis]
Length=87

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 2/66 (3%)
 Frame = -1

Query  557  DQNKQFEEALARHDRDTPDRWQNIAREV--GKSPAEVKQLYDILVHDLKHIESGDVPVPN  384
            +QNK+FE ALA +D+DTPDRWQN+AR V  GKSP +VK+ YD LV DL  IES   P+PN
Sbjct  4    EQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPLPN  63

Query  383  YRSTGT  366
            Y++TG 
Sbjct  64   YKNTGN  69



>ref|XP_004150820.1| PREDICTED: transcription factor RADIALIS-like [Cucumis sativus]
 ref|XP_004165879.1| PREDICTED: transcription factor RADIALIS-like [Cucumis sativus]
Length=82

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -1

Query  566  WTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILVHDLKHIESGDVPV  390
            WT +QNK FE+ALA +D+DTP+RW N+A+ + GK+  EVK  Y +LV D+KHIESG++P 
Sbjct  13   WTINQNKAFEKALAVYDKDTPERWLNVAKAIGGKTEEEVKSHYQLLVEDVKHIESGEIPF  72

Query  389  PNYRST  372
            P  RST
Sbjct  73   PYRRST  78



>ref|XP_008782490.1| PREDICTED: protein RADIALIS-like 5 isoform X2 [Phoenix dactylifera]
Length=76

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = -1

Query  605  MAsdslssrassSWTADQNKQFEEALARHDRDTPDRWQNIAREV-GKSPAEVKQLYDILV  429
            MAS SL   + SSWT  QNK FE ALA +D+DTPDRWQN+AR V GKS  EVK+ Y++LV
Sbjct  1    MASGSLPCSSGSSWTPKQNKLFERALAVYDKDTPDRWQNVARAVGGKSAEEVKRHYELLV  60

Query  428  HDLKHIESGDVPVP  387
             DLKHIESG   +P
Sbjct  61   EDLKHIESGQAKLP  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 944445735466