BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84407_g1_i1 len=642 path=[620:0-641]

Length=642
                                                                      Score     E

ref|XP_010693929.1|  PREDICTED: polcalcin Che a 3                       139   2e-38   
gb|AFK43460.1|  unknown                                                 137   7e-38   
ref|XP_009775325.1|  PREDICTED: polcalcin Nic t 2                       134   2e-36   
ref|XP_009604379.1|  PREDICTED: polcalcin Nic t 2                       134   2e-36   
ref|XP_007163394.1|  hypothetical protein PHAVU_001G231100g             134   2e-36   
sp|Q84V36.1|POLC3_CHEAL  RecName: Full=Polcalcin Che a 3; AltName...    133   5e-36   Chenopodium album [lamb's-quarters]
gb|KHN41079.1|  Polcalcin Nic t 1                                       133   5e-36   
ref|XP_006575498.1|  PREDICTED: polcalcin Nic t 1-like                  135   6e-36   
ref|XP_002284297.1|  PREDICTED: polcalcin Che a 3                       132   6e-36   Vitis vinifera
sp|O81092.1|ALL3_OLEEU  RecName: Full=Polcalcin Ole e 3; AltName:...    132   7e-36   Olea europaea
ref|XP_004490805.1|  PREDICTED: polcalcin Nic t 1-like                  132   7e-36   
dbj|BAO02543.1|  predicted calcium binding protein ortholog             132   1e-35   
ref|XP_003616372.1|  Polcalcin Nic t                                    131   2e-35   
ref|XP_007141894.1|  hypothetical protein PHAVU_008G234700g             131   2e-35   
ref|XP_008460520.1|  PREDICTED: polcalcin Ole e 3                       131   2e-35   
ref|XP_004140303.1|  PREDICTED: polcalcin Ole e 3-like                  130   4e-35   
ref|XP_003544995.1|  PREDICTED: polcalcin Nic t 1-like                  130   5e-35   
ref|XP_009625361.1|  PREDICTED: polcalcin Nic t 1                       130   5e-35   
emb|CCW28773.1|  EF hand calcium-binding protein                        130   7e-35   
ref|XP_009771751.1|  PREDICTED: polcalcin Nic t 1                       129   8e-35   
ref|XP_004231988.1|  PREDICTED: polcalcin Nic t 1                       128   2e-34   
gb|EYU41336.1|  hypothetical protein MIMGU_mgv1a021228mg                128   4e-34   
gb|EPS67685.1|  hypothetical protein M569_07091                         127   1e-33   
ref|XP_004303338.1|  PREDICTED: polcalcin Nic t 2-like                  127   1e-33   
ref|XP_003537449.1|  PREDICTED: polcalcin Che a 3-like                  127   1e-33   
gb|KHN17939.1|  Polcalcin Che a 3                                       127   1e-33   
ref|XP_006346895.1|  PREDICTED: polcalcin Nic t 2-like                  126   2e-33   
gb|EYU44574.1|  hypothetical protein MIMGU_mgv1a021541mg                125   5e-33   
ref|XP_004233477.1|  PREDICTED: polcalcin Nic t 2                       125   5e-33   
ref|XP_008229215.1|  PREDICTED: polcalcin Bet v 4                       124   8e-33   
ref|XP_007216880.1|  hypothetical protein PRUPE_ppa020988mg             124   1e-32   
gb|AHL24661.1|  Fra e 3.01 allergen                                     124   2e-32   
ref|XP_002532466.1|  dc3, putative                                      123   3e-32   Ricinus communis
gb|KDP33159.1|  hypothetical protein JCGZ_13424                         123   3e-32   
sp|O81701.1|POLC4_ALNGL  RecName: Full=Polcalcin Aln g 4; AltName...    122   7e-32   Alnus glutinosa
emb|CAA73147.1|  Bet v 4                                                121   1e-31   Betula pendula [white birch]
emb|CDP02703.1|  unnamed protein product                                121   1e-31   
ref|XP_010109031.1|  Polcalcin Ole e 3                                  120   2e-31   
sp|Q39419.1|POLC4_BETPN  RecName: Full=Polcalcin Bet v 4; AltName...    120   5e-31   Betula pendula [white birch]
pdb|1H4B|A  Chain A, Solution Structure Of The Birch Pollen Aller...    120   6e-31   
ref|XP_008381328.1|  PREDICTED: polcalcin Bet v 4                       119   8e-31   
ref|XP_008378128.1|  PREDICTED: polcalcin Bet v 4-like                  119   2e-30   
sp|P58171.1|POLC3_SYRVU  RecName: Full=Polcalcin Syr v 3; AltName...    118   3e-30   Syringa vulgaris
ref|XP_006357773.1|  PREDICTED: polcalcin Nic t 1-like                  117   7e-30   
ref|XP_007033047.1|  Calcium-binding EF-hand family protein             117   4e-29   
ref|XP_010510613.1|  PREDICTED: probable calcium-binding protein ...    114   6e-29   
ref|NP_186993.1|  putative calcium-binding protein CML28                114   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006482138.1|  PREDICTED: polcalcin Nic t 1-like                  114   9e-29   
ref|XP_006430626.1|  hypothetical protein CICLE_v10013229mg             114   1e-28   
ref|XP_010935826.1|  PREDICTED: polcalcin Phl p 7-like                  114   1e-28   
ref|XP_006299673.1|  hypothetical protein CARUB_v10015861mg             113   2e-28   
ref|XP_009119248.1|  PREDICTED: polcalcin Bra n 2-like                  112   3e-28   
ref|XP_002882293.1|  hypothetical protein ARALYDRAFT_896345             112   3e-28   
ref|XP_010549757.1|  PREDICTED: probable calcium-binding protein ...    112   6e-28   
ref|XP_011002779.1|  PREDICTED: polcalcin Syr v 3-like                  112   6e-28   
ref|XP_002307433.2|  Polcalcin Aln g 4 family protein                   111   8e-28   Populus trichocarpa [western balsam poplar]
pir||S65145  pollen allergen group II (clone 44) - rape                 111   9e-28
sp|P69198.1|POLC2_BRANA  RecName: Full=Polcalcin Bra n 2; AltName...    111   1e-27   Brassica napus [oilseed rape]
ref|NP_001062510.1|  Os08g0560700                                       111   1e-27   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA09633.1|  calcium-binding protein                                111   1e-27   Brassica napus [oilseed rape]
gb|AAX77684.1|  calcium-binding protein isoallergen 1                   111   1e-27   Ambrosia artemisiifolia [annual ragweed]
ref|XP_009134727.1|  PREDICTED: polcalcin Bra n 2                       110   2e-27   
emb|CAP05019.1|  calcium binding protein                                110   2e-27   Parietaria judaica
ref|XP_010237791.1|  PREDICTED: polcalcin Phl p 7                       110   2e-27   
gb|KFK38062.1|  hypothetical protein AALP_AA3G065000                    110   2e-27   
sp|P94092.2|POLC7_CYNDA  RecName: Full=Polcalcin Cyn d 7; AltName...    110   2e-27   Cynodon dactylon
gb|AAC49648.1|  calcium-binding pollen allergen                         110   2e-27   Cynodon dactylon
ref|XP_010261836.1|  PREDICTED: polcalcin Syr v 3-like                  110   2e-27   
emb|CDY50704.1|  BnaC05g47790D                                          110   3e-27   
gb|AAX77685.1|  calcium-binding protein isoallergen 2                   110   3e-27   Ambrosia artemisiifolia [annual ragweed]
ref|XP_006660388.1|  PREDICTED: polcalcin Phl p 7-like                  110   3e-27   
pir||S65143  pollen allergen group II (clone 4) - turnip (fragment)     109   4e-27
ref|XP_009130364.1|  PREDICTED: polcalcin Bra n 2-like                  109   4e-27   
gb|AEW67318.1|  group 7 grass pollen allergen                           109   5e-27   
pir||S65144  pollen allergen group II (clone 42) - rape                 109   5e-27
ref|XP_002305201.1|  Polcalcin Aln g 4 family protein                   109   5e-27   Populus trichocarpa [western balsam poplar]
sp|O82040.1|POLC7_PHLPR  RecName: Full=Polcalcin Phl p 7; AltName...    108   8e-27   Phleum pratense [timothy]
pdb|2LVI|A  Chain A, Solution Structure Of Apo-phl P 7                  108   8e-27   
ref|XP_008787459.1|  PREDICTED: polcalcin Phl p 7-like                  108   9e-27   
gb|AEW67317.1|  group 7 grass pollen allergen                           108   1e-26   
ref|XP_011099475.1|  PREDICTED: polcalcin Bet v 4-like                  108   2e-26   
gb|AAX85389.1|  polcalcin                                               107   2e-26   Artemisia vulgaris [common wormwood]
dbj|BAK07986.1|  predicted protein                                      107   3e-26   
gb|EAZ08013.1|  hypothetical protein OsI_30279                          111   4e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_004974225.1|  PREDICTED: polcalcin Cyn d 7-like                  107   5e-26   
gb|AEW67320.1|  group 7 grass pollen allergen                           106   6e-26   
ref|XP_008678425.1|  PREDICTED: polcalcin Phl p 7                       106   7e-26   
ref|NP_197250.1|  pollen calcium-binding protein 1                      106   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002445673.1|  hypothetical protein SORBIDRAFT_07g023990          106   1e-25   Sorghum bicolor [broomcorn]
ref|XP_003574943.1|  PREDICTED: polcalcin Phl p 7-like                  106   1e-25   
gb|ABK28700.1|  unknown                                                 106   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25964.1|  hypothetical protein AALP_AA8G185600                    106   1e-25   
ref|XP_002871768.1|  hypothetical protein ARALYDRAFT_909744             105   2e-25   
ref|XP_010420474.1|  PREDICTED: probable calcium-binding protein ...    105   2e-25   
gb|ACG36800.1|  hypothetical protein                                    105   3e-25   Zea mays [maize]
ref|XP_006400287.1|  hypothetical protein EUTSA_v10015161mg             105   3e-25   
ref|XP_006289791.1|  hypothetical protein CARUB_v10003393mg             104   5e-25   
gb|EAZ43661.1|  hypothetical protein OsJ_28287                          105   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010940522.1|  PREDICTED: polcalcin Phl p 7-like                  102   3e-24   
ref|XP_008779064.1|  PREDICTED: polcalcin Phl p 7-like                  102   4e-24   
ref|XP_010492704.1|  PREDICTED: probable calcium-binding protein ...    102   4e-24   
ref|XP_009126190.1|  PREDICTED: polcalcin Bra n 1                     97.8    1e-22   
ref|XP_004149790.1|  PREDICTED: probable calcium-binding protein ...  95.9    8e-22   
ref|XP_009396589.1|  PREDICTED: polcalcin Phl p 7-like                95.9    9e-22   
ref|XP_009396172.1|  PREDICTED: polcalcin Phl p 7-like                96.7    1e-21   
ref|XP_008457063.1|  PREDICTED: polcalcin Bra n 2-like                94.7    2e-21   
ref|XP_010092641.1|  Polcalcin Syr v 3                                90.9    6e-20   
ref|XP_009400923.1|  PREDICTED: polcalcin Phl p 7-like                90.9    7e-20   
ref|XP_007212731.1|  hypothetical protein PRUPE_ppa019115mg           89.7    2e-19   
ref|XP_004293729.1|  PREDICTED: polcalcin Phl p 7-like                89.0    3e-19   
ref|XP_008445690.1|  PREDICTED: polcalcin Syr v 3-like                82.8    7e-17   
ref|XP_004140868.1|  PREDICTED: polcalcin Syr v 3-like                82.0    1e-16   
ref|XP_003524846.1|  PREDICTED: polcalcin Phl p 7                     79.7    8e-16   
ref|XP_010262278.1|  PREDICTED: probable calcium-binding protein ...  81.3    1e-15   
ref|XP_007158776.1|  hypothetical protein PHAVU_002G181100g           79.0    2e-15   
ref|XP_004504594.1|  PREDICTED: polcalcin Cyn d 7-like                78.2    3e-15   
gb|AAO33897.1|  Ole e 3 allergen                                      77.4    3e-15   Olea europaea
ref|XP_007160530.1|  hypothetical protein PHAVU_002G329300g           79.0    1e-14   
ref|XP_010274712.1|  PREDICTED: calcium-binding allergen Ole e 8      77.8    2e-14   
ref|XP_003530955.1|  PREDICTED: calcium-binding allergen Ole e 8      76.6    6e-14   
ref|NP_001237156.1|  uncharacterized protein LOC100500636             76.3    9e-14   
ref|XP_006430624.1|  hypothetical protein CICLE_v10013012mg           75.5    1e-13   
ref|XP_010925997.1|  PREDICTED: probable calcium-binding protein ...  75.9    1e-13   
gb|ACH60081.1|  polcalcin                                             74.7    1e-13   Pseudotsuga menziesii
gb|ACH60077.1|  polcalcin                                             74.7    1e-13   Pseudotsuga menziesii
ref|XP_010663678.1|  PREDICTED: calcium-binding allergen Ole e 8      75.5    1e-13   
gb|ACH60082.1|  polcalcin                                             74.7    1e-13   Pseudotsuga menziesii
ref|XP_010908206.1|  PREDICTED: probable calcium-binding protein ...  75.9    1e-13   
gb|ACH60100.1|  polcalcin                                             74.7    2e-13   Pseudotsuga macrocarpa
ref|XP_010925995.1|  PREDICTED: probable calcium-binding protein ...  74.7    3e-13   
ref|XP_008240158.1|  PREDICTED: probable calcium-binding protein ...  74.3    4e-13   
ref|XP_008809156.1|  PREDICTED: probable calcium-binding protein ...  74.3    5e-13   
ref|XP_011008803.1|  PREDICTED: probable calcium-binding protein ...  73.9    5e-13   
ref|XP_007209701.1|  hypothetical protein PRUPE_ppa012426mg           73.9    6e-13   
ref|XP_004299534.1|  PREDICTED: probable calcium-binding protein ...  73.6    6e-13   
gb|EYU41337.1|  hypothetical protein MIMGU_mgv1a015814mg              73.2    7e-13   
ref|XP_011073627.1|  PREDICTED: probable calcium-binding protein ...  73.2    8e-13   
ref|XP_009775333.1|  PREDICTED: probable calcium-binding protein ...  73.2    8e-13   
gb|KDP23917.1|  hypothetical protein JCGZ_27077                       73.2    9e-13   
gb|EYU17655.1|  hypothetical protein MIMGU_mgv1a015081mg              73.2    9e-13   
ref|XP_009606381.1|  PREDICTED: probable calcium-binding protein ...  73.2    9e-13   
ref|XP_003631098.1|  SLR1/LCR-like protein                            73.2    1e-12   
ref|XP_007227671.1|  hypothetical protein PRUPE_ppa026485mg           73.9    1e-12   
ref|XP_011008351.1|  PREDICTED: probable calcium-binding protein ...  72.8    1e-12   
ref|XP_008782318.1|  PREDICTED: probable calcium-binding protein ...  72.8    2e-12   
emb|CDY70127.1|  BnaA06g38470D                                        72.4    2e-12   
ref|XP_007163958.1|  hypothetical protein PHAVU_L002000g              72.8    2e-12   
ref|XP_011084270.1|  PREDICTED: calcium-binding allergen Ole e 8-...  72.4    2e-12   
ref|XP_011099473.1|  PREDICTED: probable calcium-binding protein ...  72.0    2e-12   
gb|AAF31152.1|AF078680_1  calcium-binding protein                     72.4    2e-12   Olea europaea
ref|XP_002322096.1|  calcium binding family protein                   72.4    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009804163.1|  PREDICTED: calcium-binding protein CML24-like    72.0    2e-12   
ref|XP_008351927.1|  PREDICTED: probable calcium-binding protein ...  72.0    2e-12   
gb|AAX77686.1|  calcium-binding protein                               72.0    2e-12   Ambrosia artemisiifolia [annual ragweed]
ref|XP_010671432.1|  PREDICTED: calcium-binding allergen Ole e 8-...  72.0    2e-12   
emb|CDY19196.1|  BnaC05g13970D                                        71.6    3e-12   
gb|ABK78767.1|  putative allergen Cup a 4                             71.6    3e-12   Hesperocyparis arizonica
sp|O64943.2|POLC2_JUNOX  RecName: Full=Polcalcin Jun o 2; AltName...  71.6    4e-12   Juniperus oxycedrus [prickly juniper]
ref|XP_009596756.1|  PREDICTED: calcium-binding allergen Ole e 8-...  71.6    4e-12   
ref|XP_009797110.1|  PREDICTED: calcium-binding allergen Ole e 8-...  71.2    4e-12   
emb|CAC43238.1|  calcium binding protein                              71.2    4e-12   Sesbania rostrata
gb|ABP87672.1|  putative allergen Cup a 4                             71.2    4e-12   
ref|XP_006346894.1|  PREDICTED: probable calcium-binding protein ...  70.9    5e-12   
ref|XP_008356663.1|  PREDICTED: probable calcium-binding protein ...  71.2    5e-12   
emb|CBI15562.3|  unnamed protein product                              69.3    5e-12   
ref|XP_008374843.1|  PREDICTED: probable calcium-binding protein ...  70.9    6e-12   
ref|XP_009149267.1|  PREDICTED: probable calcium-binding protein ...  70.9    6e-12   
ref|XP_003528969.1|  PREDICTED: calcium-binding allergen Ole e 8-...  70.9    6e-12   
ref|XP_010938627.1|  PREDICTED: probable calcium-binding protein ...  70.9    6e-12   
ref|XP_009360087.1|  PREDICTED: probable calcium-binding protein ...  70.5    6e-12   
ref|XP_004159084.1|  PREDICTED: probable calcium-binding protein ...  70.9    7e-12   
ref|XP_009351545.1|  PREDICTED: probable calcium-binding protein ...  71.2    7e-12   
ref|XP_010692608.1|  PREDICTED: probable calcium-binding protein ...  70.9    7e-12   
ref|XP_003616365.1|  Polcalcin Nic t                                  70.1    7e-12   
ref|XP_009628802.1|  PREDICTED: probable calcium-binding protein ...  70.5    7e-12   
ref|XP_004142374.1|  PREDICTED: probable calcium-binding protein ...  70.9    8e-12   
emb|CDO98355.1|  unnamed protein product                              71.2    8e-12   
ref|XP_007036791.1|  Calcium-binding EF-hand family protein           70.5    8e-12   
ref|XP_010693960.1|  PREDICTED: probable calcium-binding protein ...  70.1    9e-12   
ref|XP_006357771.1|  PREDICTED: calcium-binding protein CML24-like    70.1    9e-12   
ref|XP_006469245.1|  PREDICTED: probable calcium-binding protein ...  70.9    9e-12   
ref|XP_010537496.1|  PREDICTED: probable calcium-binding protein ...  70.1    1e-11   
ref|XP_003519336.1|  PREDICTED: probable calcium-binding protein ...  69.7    1e-11   
ref|XP_002440821.1|  hypothetical protein SORBIDRAFT_09g007360        70.5    1e-11   Sorghum bicolor [broomcorn]
gb|KDO60746.1|  hypothetical protein CISIN_1g029304mg                 70.5    1e-11   
ref|XP_004231987.1|  PREDICTED: calcium-binding protein CML24         70.1    1e-11   
ref|XP_011072994.1|  PREDICTED: calcium-binding allergen Ole e 8-...  70.1    1e-11   
ref|XP_009356047.1|  PREDICTED: probable calcium-binding protein ...  70.1    1e-11   
ref|XP_008381742.1|  PREDICTED: probable calcium-binding protein ...  70.5    1e-11   
gb|ABK22364.1|  unknown                                               69.3    1e-11   Picea sitchensis
ref|XP_006416628.1|  hypothetical protein EUTSA_v10008945mg           69.7    2e-11   
ref|XP_008800225.1|  PREDICTED: probable calcium-binding protein ...  69.7    2e-11   
ref|XP_004145834.1|  PREDICTED: probable calcium-binding protein ...  68.9    2e-11   
emb|CDY16916.1|  BnaC09g40430D                                        67.4    2e-11   
ref|XP_008457051.1|  PREDICTED: probable calcium-binding protein ...  68.9    2e-11   
ref|XP_002274476.1|  PREDICTED: probable calcium-binding protein ...  68.9    2e-11   Vitis vinifera
ref|XP_009360088.1|  PREDICTED: probable calcium-binding protein ...  68.6    2e-11   
ref|XP_009414956.1|  PREDICTED: probable calcium-binding protein ...  68.9    3e-11   
ref|XP_004150619.1|  PREDICTED: probable calcium-binding protein ...  68.9    3e-11   
ref|XP_004235822.1|  PREDICTED: calcium-binding allergen Ole e 8-...  68.6    3e-11   
ref|XP_001779716.1|  predicted protein                                68.2    3e-11   
ref|XP_004233476.1|  PREDICTED: probable calcium-binding protein ...  68.2    3e-11   
gb|ABK26031.1|  unknown                                               68.9    3e-11   Picea sitchensis
gb|ABK26821.1|  unknown                                               68.9    3e-11   Picea sitchensis
sp|Q9M7R0.1|ALL8_OLEEU  RecName: Full=Calcium-binding allergen Ol...  68.6    4e-11   Olea europaea
ref|XP_008787648.1|  PREDICTED: probable calcium-binding protein ...  68.6    4e-11   
ref|XP_008389977.1|  PREDICTED: probable calcium-binding protein ...  69.7    4e-11   
sp|Q0DJV6.1|CML18_ORYSJ  RecName: Full=Probable calcium-binding p...  68.2    4e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAV59327.1|  unknown protein                                       68.2    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007204139.1|  hypothetical protein PRUPE_ppa022519mg           67.8    5e-11   
ref|XP_006451632.1|  hypothetical protein CICLE_v10009740mg           68.2    5e-11   
ref|XP_010916442.1|  PREDICTED: probable calcium-binding protein ...  68.2    5e-11   
ref|XP_010459434.1|  PREDICTED: probable calcium-binding protein ...  68.2    6e-11   
gb|KHM99973.1|  Putative calcium-binding protein CML25                67.8    6e-11   
gb|EEE62792.1|  hypothetical protein OsJ_17595                        68.2    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008221464.1|  PREDICTED: probable calcium-binding protein ...  68.2    7e-11   
ref|XP_007223528.1|  hypothetical protein PRUPE_ppa012032mg           68.2    7e-11   
gb|EAY97018.1|  hypothetical protein OsI_18939                        67.8    7e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_004960644.1|  PREDICTED: probable calcium-binding protein ...  67.8    8e-11   
ref|XP_008464718.1|  PREDICTED: probable calcium-binding protein ...  67.8    8e-11   
ref|XP_008809157.1|  PREDICTED: probable calcium-binding protein ...  67.4    8e-11   
gb|AFK37714.1|  unknown                                               67.0    9e-11   
ref|NP_001045400.1|  Os01g0949500                                     67.4    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006891943.1|  PREDICTED: calmodulin-like protein 5             67.0    1e-10   
ref|XP_010109033.1|  putative calcium-binding protein CML23           67.0    1e-10   
ref|XP_006654163.1|  PREDICTED: probable calcium-binding protein ...  67.0    1e-10   
ref|XP_003545326.2|  PREDICTED: probable calcium-binding protein ...  67.0    1e-10   
ref|XP_002314786.2|  hypothetical protein POPTR_0010s11740g           67.4    1e-10   Populus trichocarpa [western balsam poplar]
gb|KEH26932.1|  EF hand calcium-binding family protein                67.0    1e-10   
ref|XP_003544994.1|  PREDICTED: probable calcium-binding protein ...  66.6    1e-10   
ref|XP_002887495.1|  hypothetical protein ARALYDRAFT_476499           67.0    1e-10   
gb|KHN22489.1|  Calcium-binding allergen Ole e 8                      66.6    1e-10   
ref|XP_007163392.1|  hypothetical protein PHAVU_001G231000g           66.6    1e-10   
ref|XP_007141898.1|  hypothetical protein PHAVU_008G235100g           66.6    1e-10   
ref|XP_006574101.1|  PREDICTED: probable calcium-binding protein ...  67.4    1e-10   
ref|XP_010551871.1|  PREDICTED: calcium-binding protein CML24-like    66.6    1e-10   
ref|NP_173259.1|  putative calcium-binding protein CML27              66.6    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006341535.1|  PREDICTED: calcium-binding allergen Ole e 8-...  66.6    2e-10   
emb|CDX83860.1|  BnaC08g17850D                                        66.6    2e-10   
gb|KFK43984.1|  hypothetical protein AALP_AA1G199600                  66.6    2e-10   
ref|NP_177504.1|  putative calcium-binding protein CML26              66.2    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006365410.1|  PREDICTED: calcium-binding allergen Ole e 8-...  66.2    2e-10   
ref|XP_010271280.1|  PREDICTED: probable calcium-binding protein ...  67.0    2e-10   
gb|KHN17638.1|  Putative calcium-binding protein CML26                65.5    2e-10   
ref|XP_002970730.1|  hypothetical protein SELMODRAFT_94292            66.2    2e-10   
ref|XP_011021780.1|  PREDICTED: probable calcium-binding protein ...  66.6    2e-10   
ref|XP_008393420.1|  PREDICTED: probable calcium-binding protein ...  65.9    2e-10   
ref|XP_010231590.1|  PREDICTED: probable calcium-binding protein ...  66.2    3e-10   
ref|XP_008393421.1|  PREDICTED: probable calcium-binding protein ...  65.9    3e-10   
ref|XP_003568726.2|  PREDICTED: probable calcium-binding protein ...  66.2    3e-10   
ref|XP_004241666.2|  PREDICTED: calcium-binding allergen Ole e 8-...  66.2    3e-10   
ref|XP_006303188.1|  hypothetical protein CARUB_v10010474mg           65.9    3e-10   
ref|XP_002969393.1|  hypothetical protein SELMODRAFT_91501            65.9    3e-10   
gb|KHN17940.1|  Putative calcium-binding protein CML27                65.5    3e-10   
ref|XP_007153253.1|  hypothetical protein PHAVU_003G019600g           66.2    3e-10   
emb|CDP16307.1|  unnamed protein product                              65.9    3e-10   
ref|XP_010471425.1|  PREDICTED: probable calcium-binding protein ...  65.5    3e-10   
ref|XP_010416174.1|  PREDICTED: probable calcium-binding protein ...  65.5    3e-10   
ref|XP_003538397.1|  PREDICTED: probable calcium-binding protein ...  65.1    3e-10   
ref|XP_002892987.1|  hypothetical protein ARALYDRAFT_889234           65.9    4e-10   
ref|XP_010097572.1|  putative calcium-binding protein CML27           65.5    4e-10   
ref|XP_004169010.1|  PREDICTED: probable calcium-binding protein ...  65.9    4e-10   
ref|XP_010043960.1|  PREDICTED: probable calcium-binding protein ...  65.9    4e-10   
ref|XP_010428289.1|  PREDICTED: probable calcium-binding protein ...  65.5    4e-10   
ref|XP_010528534.1|  PREDICTED: calcium-binding protein CML24-like    65.5    4e-10   
ref|XP_002962635.1|  hypothetical protein SELMODRAFT_69135            65.1    4e-10   
ref|XP_010033692.1|  PREDICTED: probable calcium-binding protein ...  65.5    5e-10   
ref|XP_009106021.1|  PREDICTED: probable calcium-binding protein ...  65.1    5e-10   
ref|XP_002525994.1|  Polcalcin Jun o, putative                        65.5    6e-10   Ricinus communis
ref|NP_001055397.1|  Os05g0380900                                     65.5    7e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006383316.1|  putative calmodulin-related family protein       64.7    7e-10   
gb|EPS62655.1|  hypothetical protein M569_12136                       65.1    7e-10   
ref|XP_002312460.2|  hypothetical protein POPTR_0008s13390g           64.7    7e-10   Populus trichocarpa [western balsam poplar]
gb|EEE63541.1|  hypothetical protein OsJ_18357                        64.7    7e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EAY97840.1|  hypothetical protein OsI_19761                        65.1    7e-10   Oryza sativa Indica Group [Indian rice]
gb|EMS57491.1|  putative calcium-binding protein CML18                65.5    8e-10   
ref|XP_002459097.1|  hypothetical protein SORBIDRAFT_03g045770        65.1    8e-10   Sorghum bicolor [broomcorn]
ref|XP_010476999.1|  PREDICTED: probable calcium-binding protein ...  64.7    9e-10   
gb|KFK41806.1|  hypothetical protein AALP_AA2G174300                  64.3    9e-10   
emb|CDS34248.1|  calmodulin                                           64.7    9e-10   
gb|EMT07142.1|  Putative calcium-binding protein CML10                64.7    9e-10   
ref|XP_009797345.1|  PREDICTED: probable calcium-binding protein ...  64.7    9e-10   
emb|CAC34625.1|  putative calmodulin-related protein                  64.3    9e-10   
ref|XP_002980456.1|  hypothetical protein SELMODRAFT_59198            63.9    9e-10   
ref|XP_008374971.1|  PREDICTED: polcalcin Syr v 3-like                63.5    1e-09   
ref|XP_011070577.1|  PREDICTED: probable calcium-binding protein ...  64.7    1e-09   
ref|XP_003552973.1|  PREDICTED: calcium-binding protein CML24-lik...  63.9    1e-09   
ref|XP_011021404.1|  PREDICTED: calcium-binding protein CML24-like    63.9    1e-09   
ref|XP_009608299.1|  PREDICTED: probable calcium-binding protein ...  64.3    1e-09   
emb|CDM86427.1|  unnamed protein product                              64.3    1e-09   
emb|CDM86445.1|  unnamed protein product                              64.3    1e-09   
gb|EYU40733.1|  hypothetical protein MIMGU_mgv1a014669mg              64.3    1e-09   
emb|CBJ26717.1|  conserved unknown protein                            63.9    1e-09   
ref|XP_006355093.1|  PREDICTED: probable calcium-binding protein ...  64.3    1e-09   
ref|XP_004490807.1|  PREDICTED: calcium-binding protein CML24-like    63.5    1e-09   
ref|XP_006391395.1|  hypothetical protein EUTSA_v10019556mg           65.1    1e-09   
ref|XP_009595960.1|  PREDICTED: calcium-binding allergen Ole e 8-...  63.5    1e-09   
ref|XP_002820536.1|  PREDICTED: calmodulin-like protein 5             63.5    1e-09   
ref|XP_009013108.1|  hypothetical protein HELRODRAFT_110019           63.5    2e-09   
ref|XP_009801939.1|  PREDICTED: probable calcium-binding protein ...  63.9    2e-09   
ref|XP_009782225.1|  PREDICTED: calcium-binding allergen Ole e 8-...  63.5    2e-09   
ref|XP_007160425.1|  hypothetical protein PHAVU_002G320800g           63.9    2e-09   
ref|XP_008467096.1|  PREDICTED: probable calcium-binding protein ...  63.9    2e-09   
ref|XP_010250152.1|  PREDICTED: probable calcium-binding protein ...  64.3    2e-09   
ref|XP_010104706.1|  putative calcium-binding protein CML25           63.9    2e-09   
ref|XP_010477987.1|  PREDICTED: probable calcium-binding protein ...  63.9    2e-09   
ref|XP_010499149.1|  PREDICTED: probable calcium-binding protein ...  63.9    2e-09   
dbj|GAM27303.1|  hypothetical protein SAMD00019534_104780             63.2    2e-09   
ref|XP_006390534.1|  hypothetical protein EUTSA_v10019258mg           63.2    2e-09   
ref|XP_006302928.1|  hypothetical protein CARUB_v10021066mg           63.2    2e-09   
emb|CDX96729.1|  BnaA08g22720D                                        63.2    2e-09   
ref|XP_004298507.1|  PREDICTED: probable calcium-binding protein ...  63.5    3e-09   
gb|KHN40730.1|  Putative calcium-binding protein CML25                62.8    3e-09   
ref|XP_009596484.1|  PREDICTED: probable calcium-binding protein ...  63.2    3e-09   
ref|XP_010498205.1|  PREDICTED: probable calcium-binding protein ...  63.2    3e-09   
ref|XP_010498204.1|  PREDICTED: probable calcium-binding protein ...  63.2    3e-09   
ref|XP_009392676.1|  PREDICTED: probable calcium-binding protein ...  63.2    3e-09   
gb|EPS63975.1|  hypothetical protein M569_10810                       63.2    3e-09   
ref|XP_007045260.1|  Polcalcin Jun o, putative                        63.5    3e-09   
gb|KFK33273.1|  hypothetical protein AALP_AA6G353700                  62.8    3e-09   
ref|XP_006583713.1|  PREDICTED: probable calcium-binding protein ...  63.2    3e-09   
ref|XP_009110358.1|  PREDICTED: probable calcium-binding protein ...  62.8    3e-09   
ref|XP_002920390.1|  PREDICTED: calmodulin-like                       62.4    3e-09   
gb|AAM67075.1|  putative calmodulin                                   62.4    4e-09   
gb|EKC32562.1|  Calmodulin                                            65.5    4e-09   
gb|AFK34900.1|  unknown                                               62.8    4e-09   
gb|KDP33161.1|  hypothetical protein JCGZ_13426                       62.4    5e-09   
gb|EJY80148.1|  Calmodulin                                            62.0    5e-09   
gb|EMT17394.1|  Putative calcium-binding protein CML18                62.4    5e-09   
ref|XP_002721725.1|  PREDICTED: calmodulin-like protein 3             62.0    5e-09   
gb|EYU44572.1|  hypothetical protein MIMGU_mgv1a015576mg              62.0    5e-09   
ref|XP_006304603.1|  hypothetical protein CARUB_v10011672mg           62.4    6e-09   
ref|XP_001768479.1|  predicted protein                                62.0    6e-09   
ref|XP_003550642.1|  PREDICTED: probable calcium-binding protein ...  62.0    6e-09   
ref|XP_004137340.1|  PREDICTED: probable calcium-binding protein ...  62.4    6e-09   
ref|XP_004971250.1|  PREDICTED: probable calcium-binding protein ...  63.2    6e-09   
gb|AAF66821.1|AF172852_1  calmodulin-like skin protein                61.6    7e-09   
ref|XP_004712700.1|  PREDICTED: calmodulin-like protein 5             61.6    8e-09   
ref|XP_010271345.1|  PREDICTED: probable calcium-binding protein ...  62.0    8e-09   
ref|XP_006415824.1|  hypothetical protein EUTSA_v10008816mg           62.0    8e-09   
ref|XP_009766715.1|  PREDICTED: probable calcium-binding protein ...  62.8    8e-09   
ref|XP_011039125.1|  PREDICTED: probable calcium-binding protein ...  61.6    9e-09   
gb|KDP38112.1|  hypothetical protein JCGZ_04755                       62.0    9e-09   
ref|XP_002611701.1|  hypothetical protein BRAFLDRAFT_56804            61.2    9e-09   
ref|XP_008453475.1|  PREDICTED: probable calcium-binding protein ...  62.0    9e-09   
ref|XP_002317881.2|  calcium binding family protein                   61.6    9e-09   
ref|XP_008808789.1|  PREDICTED: probable calcium-binding protein ...  61.6    9e-09   
ref|XP_006120374.1|  PREDICTED: calmodulin, striated muscle-like      61.2    1e-08   
ref|NP_001152603.1|  polcalcin Jun o 2                                62.0    1e-08   
gb|EMS61162.1|  putative calcium-binding protein CML16                61.6    1e-08   
ref|XP_009103045.1|  PREDICTED: probable calcium-binding protein ...  61.6    1e-08   
ref|XP_008673034.1|  PREDICTED: polcalcin Jun o 2 isoform X1          61.6    1e-08   
gb|ACG44451.1|  polcalcin Jun o 2                                     61.6    1e-08   
ref|XP_011002781.1|  PREDICTED: calcium-binding protein CML24-like    60.8    1e-08   
ref|XP_004236933.1|  PREDICTED: probable calcium-binding protein ...  61.6    1e-08   
ref|XP_008703622.1|  PREDICTED: calmodulin-like protein 5             60.8    1e-08   
gb|AFW81600.1|  polcalcin Jun o 2                                     61.6    1e-08   
ref|XP_011024051.1|  PREDICTED: probable calcium-binding protein ...  61.6    1e-08   
ref|XP_001326924.1|  calmodulin                                       60.8    1e-08   
ref|XP_003903393.1|  PREDICTED: calmodulin-like protein 5             60.8    1e-08   
gb|KFK41060.1|  hypothetical protein AALP_AA2G080200                  60.8    1e-08   
dbj|BAJ88405.1|  predicted protein                                    61.2    1e-08   
ref|XP_010531587.1|  PREDICTED: probable calcium-binding protein ...  61.6    1e-08   
ref|XP_005617235.1|  PREDICTED: calmodulin                            60.8    1e-08   
ref|XP_006605046.1|  PREDICTED: calcium-binding allergen Ole e 8-...  60.8    1e-08   
ref|XP_010922191.1|  PREDICTED: probable calcium-binding protein ...  61.2    2e-08   
ref|XP_009413607.1|  PREDICTED: probable calcium-binding protein ...  61.2    2e-08   
emb|CDY40786.1|  BnaAnng06490D                                        61.2    2e-08   
ref|XP_009380286.1|  PREDICTED: probable calcium-binding protein ...  60.8    2e-08   
ref|XP_002305867.1|  putative calmodulin-related family protein       60.8    2e-08   
ref|XP_004962216.1|  PREDICTED: probable calcium-binding protein ...  61.6    2e-08   
gb|ABR17206.1|  unknown                                               62.0    2e-08   
ref|XP_002890700.1|  hypothetical protein ARALYDRAFT_335836           61.2    2e-08   
dbj|BAK01430.1|  predicted protein                                    60.8    2e-08   
ref|NP_059118.2|  calmodulin-like protein 5                           60.5    2e-08   
ref|NP_173866.1|  putative calcium-binding protein CML25              60.8    2e-08   
ref|XP_008231145.1|  PREDICTED: calcium-binding protein CML38         60.1    2e-08   
ref|XP_004498255.1|  PREDICTED: probable calcium-binding protein ...  61.2    2e-08   
dbj|BAK02108.1|  predicted protein                                    61.2    2e-08   
ref|XP_007216735.1|  hypothetical protein PRUPE_ppa025431mg           60.1    2e-08   
gb|AAH39172.1|  Calmodulin-like 5                                     60.1    2e-08   
gb|ELU00395.1|  hypothetical protein CAPTEDRAFT_170361                60.8    3e-08   
dbj|BAJ86493.1|  predicted protein                                    61.2    3e-08   
gb|AET05414.2|  EF hand calcium-binding family protein                60.5    3e-08   
ref|XP_009113828.1|  PREDICTED: probable calcium-binding protein ...  60.5    3e-08   
ref|XP_003630938.1|  Calcium-binding pollen allergen                  60.5    3e-08   
emb|CDX84967.1|  BnaC05g20880D                                        60.5    3e-08   
ref|XP_004517285.1|  PREDICTED: probable calcium-binding protein ...  59.3    4e-08   
gb|EYU30122.1|  hypothetical protein MIMGU_mgv1a025962mg              60.1    4e-08   
ref|NP_001150713.1|  LOC100284346                                     60.5    4e-08   
ref|XP_002888497.1|  hypothetical protein ARALYDRAFT_475742           59.7    4e-08   
ref|XP_010062249.1|  PREDICTED: calcium-binding protein CML24-like    60.1    4e-08   
ref|XP_003637661.1|  Calcium-binding pollen allergen                  60.1    4e-08   
emb|CDM80751.1|  unnamed protein product                              60.1    4e-08   
ref|XP_004495158.1|  PREDICTED: calmodulin-like protein 11-like       59.3    4e-08   
ref|XP_004503360.1|  PREDICTED: probable calcium-binding protein ...  60.1    4e-08   
ref|NP_001241810.1|  polcalcin Jun o 2                                60.5    4e-08   
ref|XP_007033045.1|  Calmodulin like 23, putative                     59.3    4e-08   
ref|XP_003568563.1|  PREDICTED: probable calcium-binding protein ...  60.1    4e-08   
ref|XP_003618823.1|  Calcium-binding protein CML38                    59.3    4e-08   
gb|ENN72095.1|  hypothetical protein YQE_11235                        60.5    5e-08   
ref|XP_006643684.1|  PREDICTED: probable calcium-binding protein ...  59.7    5e-08   
ref|XP_002981131.1|  hypothetical protein SELMODRAFT_233632           59.3    5e-08   
ref|XP_002982613.1|  hypothetical protein SELMODRAFT_233990           59.3    5e-08   
ref|XP_006285942.1|  hypothetical protein CARUB_v10007462mg           59.3    5e-08   
gb|EIE85632.1|  hypothetical protein RO3G_10342                       59.3    5e-08   
ref|XP_008801290.1|  PREDICTED: probable calcium-binding protein ...  59.7    5e-08   
gb|ADN07528.1|  calmodulin 4                                          58.9    5e-08   
ref|XP_006819033.1|  PREDICTED: calmodulin-like                       59.7    5e-08   
ref|XP_009403977.1|  PREDICTED: probable calcium-binding protein ...  59.7    6e-08   
gb|KFK44513.1|  hypothetical protein AALP_AA1G266400                  59.7    6e-08   
ref|XP_316652.4|  AGAP006622-PA                                       58.9    6e-08   
ref|XP_006819032.1|  PREDICTED: calmodulin-like                       58.9    7e-08   
ref|XP_010106049.1|  putative calcium-binding protein CML41           59.3    7e-08   
ref|XP_006367611.1|  PREDICTED: probable calcium-binding protein ...  59.3    7e-08   
ref|XP_006990266.1|  PREDICTED: calmodulin-4-like                     58.9    7e-08   
ref|XP_006158531.1|  PREDICTED: calmodulin-like protein 5             58.9    7e-08   
ref|XP_008000342.1|  PREDICTED: calmodulin-like protein 5             58.9    7e-08   
gb|ENN72096.1|  hypothetical protein YQE_11235                        60.8    7e-08   
ref|XP_009109853.1|  PREDICTED: probable calcium-binding protein ...  59.3    7e-08   
gb|KEH41232.1|  EF hand calcium-binding family protein                58.5    8e-08   
gb|EHH18861.1|  Calmodulin-like skin protein                          58.5    8e-08   
ref|XP_006088487.1|  PREDICTED: calmodulin-like                       58.5    8e-08   
ref|XP_006035364.1|  PREDICTED: calmodulin-like                       58.5    8e-08   
ref|XP_005869570.1|  PREDICTED: calmodulin-like                       58.5    8e-08   
ref|NP_001253591.1|  calmodulin-like 5                                58.5    8e-08   
gb|KDO85857.1|  hypothetical protein CISIN_1g047502mg                 58.5    9e-08   
ref|XP_010069294.1|  PREDICTED: calmodulin-like protein 3             59.7    9e-08   
ref|XP_008835071.1|  PREDICTED: calmodulin-like protein 5             58.5    9e-08   
ref|NP_198593.1|  calcium-binding protein CML24                       58.5    9e-08   
gb|KFO18269.1|  Calmodulin                                            58.9    9e-08   
emb|CDP17785.1|  unnamed protein product                              58.5    9e-08   
gb|EHH64528.1|  Calmodulin-like skin protein                          58.5    9e-08   
ref|XP_002870563.1|  hypothetical protein ARALYDRAFT_493755           58.5    9e-08   
ref|XP_007413756.1|  hypothetical protein MELLADRAFT_109742           58.5    1e-07   
ref|XP_001785095.1|  predicted protein                                58.2    1e-07   
gb|ADC80749.1|  calmodulin 24-like protein                            57.8    1e-07   
ref|XP_004049062.1|  PREDICTED: calmodulin-like protein 5             58.2    1e-07   
ref|XP_005354981.1|  PREDICTED: calmodulin-4-like                     58.2    1e-07   
ref|XP_001751654.1|  predicted protein                                58.5    1e-07   
gb|EPB84209.1|  calmodulin                                            58.2    1e-07   
gb|AAB66345.1|  calcium binding protein                               58.5    1e-07   
ref|XP_966558.2|  PREDICTED: neo-calmodulin-like                      58.9    1e-07   
gb|AAZ20284.1|  calcium-binding pollen allergen                       58.5    1e-07   
gb|EYC33921.1|  hypothetical protein Y032_0001g165                    57.4    1e-07   
ref|XP_001637998.1|  predicted protein                                58.2    1e-07   
emb|CDJ97215.1|  EF hand domain containing protein                    58.2    1e-07   
gb|ACM09117.1|  Calmodulin                                            57.0    1e-07   
gb|ETN74544.1|  EF hand                                               58.2    1e-07   
emb|CDY24421.1|  BnaCnng04880D                                        60.1    1e-07   
prf||1109190A  calmodulin                                             57.8    1e-07
ref|XP_010440886.1|  PREDICTED: calcium-binding protein CML24-like    58.2    1e-07   
ref|XP_001785090.1|  predicted protein                                58.5    1e-07   
ref|XP_010435616.1|  PREDICTED: calcium-binding protein CML24         58.2    1e-07   
ref|XP_010315235.1|  PREDICTED: calmodulin-like protein 1             58.5    2e-07   
gb|EYC33919.1|  hypothetical protein Y032_0001g165                    57.4    2e-07   
ref|XP_003293234.1|  calmodulin                                       57.8    2e-07   
ref|XP_010450535.1|  PREDICTED: calcium-binding protein CML24-like    58.2    2e-07   
dbj|BAD96464.1|  calmodulin-like skin protein variant                 57.8    2e-07   
ref|XP_006772691.1|  PREDICTED: calmodulin-like protein 5             57.8    2e-07   
ref|XP_004228711.1|  PREDICTED: probable calcium-binding protein ...  58.2    2e-07   
ref|XP_641695.1|  hypothetical protein DDB_G0279407                   57.8    2e-07   
gb|ADN07535.1|  calmodulin 4                                          57.8    2e-07   
ref|XP_003004863.1|  calmodulin                                       57.8    2e-07   
ref|XP_004288370.1|  PREDICTED: probable calcium-binding protein ...  57.8    2e-07   
ref|XP_006445234.1|  hypothetical protein CICLE_v10022392mg           58.5    2e-07   
ref|XP_008236514.1|  PREDICTED: calmodulin-like protein 1             58.2    2e-07   
ref|XP_005901002.1|  PREDICTED: calmodulin isoform X1                 58.2    2e-07   
ref|XP_003494994.1|  PREDICTED: calmodulin-like protein 5 isoform X1  57.4    2e-07   
ref|NP_001041950.2|  Os01g0135700                                     58.2    2e-07   
ref|XP_010036949.1|  PREDICTED: probable calcium-binding protein ...  57.8    2e-07   
emb|CDW53538.1|  Calmodulin                                           58.2    2e-07   
ref|XP_008049826.1|  PREDICTED: calmodulin-like protein 5             57.4    2e-07   
pdb|1SW8|A  Chain A, Solution Structure Of The N-Terminal Domain ...  56.2    2e-07   
ref|XP_011075365.1|  PREDICTED: probable calcium-binding protein ...  58.2    2e-07   
ref|XP_009417008.1|  PREDICTED: calmodulin-like protein 3             58.5    2e-07   
gb|ACO11546.1|  Calmodulin                                            58.2    2e-07   
gb|EFA05282.1|  hypothetical protein TcasGA2_TC015439                 59.3    2e-07   
gb|EKC26448.1|  Calmodulin                                            58.2    2e-07   
ref|XP_001762647.1|  predicted protein                                57.8    2e-07   
gb|EPS69688.1|  hypothetical protein M569_05080                       57.0    2e-07   
ref|XP_009107665.1|  PREDICTED: calmodulin-like protein 2             57.4    2e-07   
ref|XP_009059542.1|  hypothetical protein LOTGIDRAFT_192654           57.8    3e-07   
ref|XP_008796461.1|  PREDICTED: probable calcium-binding protein ...  58.2    3e-07   
dbj|GAM17285.1|  hypothetical protein SAMD00019534_004600             57.8    3e-07   
gb|AES60813.2|  EF hand calcium-binding family protein                57.4    3e-07   
gb|AAM67124.1|  calmodulin-related protein                            57.4    3e-07   
ref|XP_003590562.1|  Calmodulin                                       57.4    3e-07   
ref|XP_002441014.1|  hypothetical protein SORBIDRAFT_09g018860        58.2    3e-07   
pdb|3WLC|A  Chain A, Crystal Structure Of Dimeric Gcamp6m             59.7    3e-07   
ref|XP_003524362.1|  PREDICTED: probable calcium-binding protein ...  57.8    3e-07   
ref|NP_564874.1|  calmodulin like 23                                  57.4    3e-07   
emb|CDY27652.1|  BnaUnng00020D                                        57.4    3e-07   
ref|XP_737288.1|  hypothetical protein                                55.5    3e-07   
gb|EYC33922.1|  hypothetical protein Y032_0001g165                    57.4    3e-07   
ref|XP_009140162.1|  PREDICTED: calcium-binding protein CML24         57.4    3e-07   
ref|XP_009284610.1|  PREDICTED: calmodulin                            57.8    3e-07   
gb|EDL38633.1|  mCG15892                                              57.4    3e-07   
ref|XP_002279679.1|  PREDICTED: probable calcium-binding protein ...  58.2    3e-07   
ref|XP_006067530.1|  PREDICTED: calmodulin isoform X1                 57.0    3e-07   



>ref|XP_010693929.1| PREDICTED: polcalcin Che a 3 [Beta vulgaris subsp. vulgaris]
Length=86

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  448  AEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDG  269
            A  D PQDVADR++IFK FDTNGDGKISSTELGDAL+TLGSVT+EE+ RMM E+DTDGDG
Sbjct  2    AAEDTPQDVADRERIFKRFDTNGDGKISSTELGDALKTLGSVTSEEICRMMAEIDTDGDG  61

Query  268  FISFDEYLAFARANRGLMRDVAKI  197
            FISFDE+ AFA+ANRGL++DVAKI
Sbjct  62   FISFDEFTAFAQANRGLIKDVAKI  85



>gb|AFK43460.1| unknown [Lotus japonicus]
Length=84

 Score =   137 bits (346),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            ADDPQDVADR++IFK FD NGDG+ISS+ELG+AL+TLGSVT EEVQRMMDE+D DGDGFI
Sbjct  2    ADDPQDVADRERIFKRFDANGDGQISSSELGEALKTLGSVTAEEVQRMMDEIDIDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKI  197
            S++E+ +FARANRGL++DVAKI
Sbjct  62   SYEEFTSFARANRGLVKDVAKI  83



>ref|XP_009775325.1| PREDICTED: polcalcin Nic t 2 [Nicotiana sylvestris]
 sp|Q8VWY7.1|POLC2_TOBAC RecName: Full=Polcalcin Nic t 2; AltName: Full=Calcium-binding 
pollen allergen Nic t 2; AltName: Allergen=Nic t 2 [Nicotiana 
tabacum]
 dbj|BAB82486.1| pollen-specific calcium-binding protein [Nicotiana tabacum]
Length=86

 Score =   134 bits (337),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -3

Query  448  AEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDG  269
            AEADDPQD+ADR++IFK FD NGDG+IS+TELG+ L+TLGSVT EEV+ MMDE+DT+ DG
Sbjct  2    AEADDPQDIADRERIFKRFDANGDGQISATELGETLQTLGSVTPEEVKYMMDEIDTNKDG  61

Query  268  FISFDEYLAFARANRGLMRDVAKI  197
            FISF E++ FARANRGL+RDVAKI
Sbjct  62   FISFQEFIEFARANRGLIRDVAKI  85



>ref|XP_009604379.1| PREDICTED: polcalcin Nic t 2 [Nicotiana tomentosiformis]
Length=86

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  448  AEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDG  269
            AEADDPQD+ADR++IFK FD NGDG+IS+TELG+ L+TLGSVT EEV+ MMDE+DTD DG
Sbjct  2    AEADDPQDIADRERIFKRFDENGDGQISATELGETLQTLGSVTPEEVKYMMDEIDTDKDG  61

Query  268  FISFDEYLAFARANRGLMRDVAKII  194
            FISF E+  FARANRGL+RDVAKI 
Sbjct  62   FISFQEFTEFARANRGLIRDVAKIF  86



>ref|XP_007163394.1| hypothetical protein PHAVU_001G231100g [Phaseolus vulgaris]
 gb|ESW35388.1| hypothetical protein PHAVU_001G231100g [Phaseolus vulgaris]
Length=85

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -3

Query  439  DDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFIS  260
            DDPQDVADR++IFKHFD+NGDG+ISS ELG+AL+ LGSVT +EVQRMMDE+DTDGDGFIS
Sbjct  4    DDPQDVADRERIFKHFDSNGDGQISSQELGEALKALGSVTPDEVQRMMDEIDTDGDGFIS  63

Query  259  FDEYLAFARANRGLMRDVAKII  194
              E+  FARANRGL+RDVAKI 
Sbjct  64   HQEFTDFARANRGLVRDVAKIF  85



>sp|Q84V36.1|POLC3_CHEAL RecName: Full=Polcalcin Che a 3; AltName: Full=Calcium-binding 
pollen allergen Che a 3; AltName: Allergen=Che a 3 [Chenopodium 
album]
 pdb|2OPO|A Chain A, Crystal Structure Of The Calcium-Binding Pollen Allergen 
Che A 3
 pdb|2OPO|B Chain B, Crystal Structure Of The Calcium-Binding Pollen Allergen 
Che A 3
 pdb|2OPO|C Chain C, Crystal Structure Of The Calcium-Binding Pollen Allergen 
Che A 3
 pdb|2OPO|D Chain D, Crystal Structure Of The Calcium-Binding Pollen Allergen 
Che A 3
 gb|AAL92871.1| pollen allergen Che a 3 [Chenopodium album]
Length=86

 Score =   133 bits (334),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  448  AEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDG  269
            A  D PQD+ADR++IFK FDTNGDGKISS+ELGDAL+TLGSVT +EV+RMM E+DTDGDG
Sbjct  2    AAEDTPQDIADRERIFKRFDTNGDGKISSSELGDALKTLGSVTPDEVRRMMAEIDTDGDG  61

Query  268  FISFDEYLAFARANRGLMRDVAKII  194
            FISFDE+  FARANRGL++DV+KI 
Sbjct  62   FISFDEFTDFARANRGLVKDVSKIF  86



>gb|KHN41079.1| Polcalcin Nic t 1 [Glycine soja]
Length=84

 Score =   133 bits (334),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            A+DPQDVADR++IFK FD NGDG+ISS ELG+AL+ LGSVT EEVQRMM+E+DTDGDG+I
Sbjct  2    AEDPQDVADRERIFKRFDANGDGQISSAELGEALKALGSVTAEEVQRMMEEIDTDGDGYI  61

Query  262  SFDEYLAFARANRGLMRDVAKII  194
            S+ E+  FA+ANRGL+RDVAKI 
Sbjct  62   SYAEFTEFAKANRGLLRDVAKIF  84



>ref|XP_006575498.1| PREDICTED: polcalcin Nic t 1-like [Glycine max]
Length=161

 Score =   135 bits (340),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 77/89 (87%), Gaps = 4/89 (4%)
 Frame = -3

Query  463  STMAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELD  284
            +TMAE    DPQDVADR++IFK FD NGDG+ISS ELG+AL+ LGSVT EEVQRMM+E+D
Sbjct  76   TTMAE----DPQDVADRERIFKRFDANGDGQISSAELGEALKALGSVTAEEVQRMMEEID  131

Query  283  TDGDGFISFDEYLAFARANRGLMRDVAKI  197
            TDGDG+IS+ E+  FA+ANRGL+RDVAKI
Sbjct  132  TDGDGYISYAEFTEFAKANRGLLRDVAKI  160



>ref|XP_002284297.1| PREDICTED: polcalcin Che a 3 [Vitis vinifera]
Length=84

 Score =   132 bits (333),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            AD+PQD  +R++IFK FDTNGDGKISSTELGDAL+TLGSV+ +EVQRMM E+DTDGDGFI
Sbjct  2    ADNPQDQEERERIFKRFDTNGDGKISSTELGDALKTLGSVSADEVQRMMQEIDTDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKII  194
            SFDE+  F RANRGLM+DVAK+ 
Sbjct  62   SFDEFADFHRANRGLMKDVAKVF  84



>sp|O81092.1|ALL3_OLEEU RecName: Full=Polcalcin Ole e 3; AltName: Full=Calcium-binding 
pollen allergen Ole e 3; AltName: Allergen=Ole e 3 [Olea europaea]
 gb|AAD05375.1| calcium-binding pollen allergen [Olea europaea]
Length=84

 Score =   132 bits (333),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            ADDPQ+VA+ ++IFK FD NGDGKISS+ELG+ L+TLGSVT EE+QRMM E+DTDGDGFI
Sbjct  2    ADDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKI  197
            SF+E+  FARANRGL++DVAKI
Sbjct  62   SFEEFTVFARANRGLVKDVAKI  83



>ref|XP_004490805.1| PREDICTED: polcalcin Nic t 1-like [Cicer arietinum]
Length=84

 Score =   132 bits (333),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            A+DPQDVADR++IFK FD+NGDG+ISS ELG+AL+TLGSVT EEV RMM+E+DTDGDGFI
Sbjct  2    AEDPQDVADRERIFKRFDSNGDGQISSAELGEALKTLGSVTAEEVTRMMEEIDTDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKI  197
            S +E++ FA+ANRGL++DVAKI
Sbjct  62   SHEEFIEFAKANRGLVKDVAKI  83



>dbj|BAO02543.1| predicted calcium binding protein ortholog [Nicotiana alata]
Length=86

 Score =   132 bits (331),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  448  AEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDG  269
            AEADDPQD+ADR++IFK FD NGDG+IS+TELG+ L+ LGSVT EEV+ MMDE+DT+ DG
Sbjct  2    AEADDPQDIADRERIFKRFDANGDGQISATELGETLQALGSVTPEEVKYMMDEIDTNNDG  61

Query  268  FISFDEYLAFARANRGLMRDVAKII  194
            FISF E+  FARANRGL+RDVAKI 
Sbjct  62   FISFQEFTEFARANRGLIRDVAKIF  86



>ref|XP_003616372.1| Polcalcin Nic t [Medicago truncatula]
 gb|AES99330.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=84

 Score =   131 bits (330),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            A+DPQDVADR++IFK FD NGDGKISS ELG+AL TLGSVT +EV+RMM+E+DTDGDGFI
Sbjct  2    AEDPQDVADRERIFKRFDANGDGKISSAELGEALETLGSVTGDEVKRMMEEIDTDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKII  194
            S+DE+  FA+ANRGL++DVAKI 
Sbjct  62   SYDEFTEFAKANRGLVKDVAKIF  84



>ref|XP_007141894.1| hypothetical protein PHAVU_008G234700g [Phaseolus vulgaris]
 gb|ESW13888.1| hypothetical protein PHAVU_008G234700g [Phaseolus vulgaris]
Length=84

 Score =   131 bits (330),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            ADDPQDVADR++IFK FD NGDG+ISS ELG+AL+ LGSVT EEVQRMM+E+DTDGDG+I
Sbjct  2    ADDPQDVADRERIFKRFDANGDGQISSAELGEALKALGSVTAEEVQRMMEEIDTDGDGYI  61

Query  262  SFDEYLAFARANRGLMRDVAKI  197
            S +E+  FA+ANRGL++DVAKI
Sbjct  62   SHEEFTEFAKANRGLVKDVAKI  83



>ref|XP_008460520.1| PREDICTED: polcalcin Ole e 3 [Cucumis melo]
Length=84

 Score =   131 bits (329),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            ADDPQD A+R++IFK FD NGDGKISS+ELG+AL+TLGSVT +EVQRMM E+DTDGDGFI
Sbjct  2    ADDPQDQAERERIFKRFDANGDGKISSSELGEALKTLGSVTADEVQRMMAEIDTDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKII  194
            S++E+  FARANRGL++DVAKI 
Sbjct  62   SYEEFTDFARANRGLVKDVAKIF  84



>ref|XP_004140303.1| PREDICTED: polcalcin Ole e 3-like [Cucumis sativus]
 ref|XP_004155732.1| PREDICTED: polcalcin Ole e 3-like [Cucumis sativus]
 gb|KGN51049.1| hypothetical protein Csa_5G420320 [Cucumis sativus]
Length=84

 Score =   130 bits (328),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            ADDPQD A+R++IFK FD NGDGKISS ELG+AL+TLGSVT +EVQRMM E+DTDGDGFI
Sbjct  2    ADDPQDQAERERIFKRFDANGDGKISSAELGEALKTLGSVTADEVQRMMAEIDTDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKII  194
            S++E+  FARANRGL++DVAKI 
Sbjct  62   SYEEFTDFARANRGLVKDVAKIF  84



>ref|XP_003544995.1| PREDICTED: polcalcin Nic t 1-like [Glycine max]
 gb|KHN39452.1| Polcalcin Nic t 1 [Glycine soja]
Length=84

 Score =   130 bits (327),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            A+DPQDVADR++IFK FD NGDG+ISS ELG+AL+ LGSVT EEV+RMM+E+DTDGDG+I
Sbjct  2    AEDPQDVADRERIFKRFDANGDGQISSAELGEALKALGSVTAEEVKRMMEEIDTDGDGYI  61

Query  262  SFDEYLAFARANRGLMRDVAKI  197
            S+ E+  FA+ANRGL++DVAKI
Sbjct  62   SYQEFTEFAKANRGLVKDVAKI  83



>ref|XP_009625361.1| PREDICTED: polcalcin Nic t 1 [Nicotiana tomentosiformis]
 dbj|BAO02519.1| predicted calcium binding protein ortholog [Nicotiana alata]
Length=84

 Score =   130 bits (327),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            A+DPQDVADR++IFK FD NGDGKISS ELG+ L+ LGSVT+EEVQ MM ELDTDGDGFI
Sbjct  2    AEDPQDVADRERIFKRFDLNGDGKISSAELGETLKMLGSVTSEEVQHMMAELDTDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKII  194
            S++E+  FARANRGL++DVAK+ 
Sbjct  62   SYEEFEEFARANRGLIKDVAKVF  84



>emb|CCW28773.1| EF hand calcium-binding protein [Arachis duranensis]
Length=85

 Score =   130 bits (326),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 77/87 (89%), Gaps = 3/87 (3%)
 Frame = -3

Query  457  MAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTD  278
            MAE   D P+D+ADR++IFKHFD NGDG+ISS+ELG+AL++LGSVT EE+Q MM+ELDT+
Sbjct  1    MAE---DSPEDIADRERIFKHFDANGDGQISSSELGEALKSLGSVTPEEIQTMMEELDTN  57

Query  277  GDGFISFDEYLAFARANRGLMRDVAKI  197
             DGFIS++E+  FARANRGL++DVAKI
Sbjct  58   NDGFISYEEFTVFARANRGLVKDVAKI  84



>ref|XP_009771751.1| PREDICTED: polcalcin Nic t 1 [Nicotiana sylvestris]
 sp|Q8VWY6.1|POLC1_TOBAC RecName: Full=Polcalcin Nic t 1; AltName: Full=Calcium-binding 
pollen allergen Nic t 1; AltName: Allergen=Nic t 1 [Nicotiana 
tabacum]
 dbj|BAB82487.1| pollen-specific calcium-binding protein [Nicotiana tabacum]
Length=84

 Score =   129 bits (325),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            A+DPQD+ADR++IFK FD NGDGKISS ELG+ L+ LGSVT+EEVQ MM ELDTDGDGFI
Sbjct  2    AEDPQDIADRERIFKRFDLNGDGKISSAELGETLKMLGSVTSEEVQHMMAELDTDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKII  194
            S++E+  FARANRGL++DVAK+ 
Sbjct  62   SYEEFEEFARANRGLIKDVAKVF  84



>ref|XP_004231988.1| PREDICTED: polcalcin Nic t 1 [Solanum lycopersicum]
Length=84

 Score =   128 bits (322),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            A+DPQDVADR+ +FK FD NGDG+ISS ELG+AL+ LGSVT+EEVQ MM ELDTDGDGFI
Sbjct  2    AEDPQDVADRELVFKRFDLNGDGQISSAELGEALKMLGSVTSEEVQYMMAELDTDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKII  194
            SF E+  FARANRGL++DVAK+ 
Sbjct  62   SFKEFEEFARANRGLIKDVAKVF  84



>gb|EYU41336.1| hypothetical protein MIMGU_mgv1a021228mg [Erythranthe guttata]
Length=84

 Score =   128 bits (321),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            A+DPQDV DR++IFK  DTNGDGK+S+ ELGDAL+ LGSVT EEV RMM+ELDTDGDG +
Sbjct  2    AEDPQDVLDRERIFKRCDTNGDGKVSAAELGDALKALGSVTAEEVTRMMNELDTDGDGHV  61

Query  262  SFDEYLAFARANRGLMRDVAKI  197
            SF+E+  FARANRGL++DVAKI
Sbjct  62   SFEEFTQFARANRGLIKDVAKI  83



>gb|EPS67685.1| hypothetical protein M569_07091 [Genlisea aurea]
Length=84

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            A+DPQDVADR++IFK  D NGDGK+S++ELG+AL+ LGSVT EE+ RMM ELDTDGDGF+
Sbjct  2    AEDPQDVADRERIFKKCDANGDGKVSASELGEALKALGSVTPEEINRMMTELDTDGDGFV  61

Query  262  SFDEYLAFARANRGLMRDVAKII  194
            SF+E+  FA+ANRGL++DVAK+ 
Sbjct  62   SFEEFTHFAQANRGLIKDVAKVF  84



>ref|XP_004303338.1| PREDICTED: polcalcin Nic t 2-like [Fragaria vesca subsp. vesca]
Length=85

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 77/88 (88%), Gaps = 3/88 (3%)
 Frame = -3

Query  457  MAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTD  278
            MAE   +DP++ ADR++IFKHFDTNGDGKIS+ ELGDAL+ LG V+TEEV+ MM+E+DTD
Sbjct  1    MAE---EDPKEKADRERIFKHFDTNGDGKISADELGDALKALGCVSTEEVKFMMEEIDTD  57

Query  277  GDGFISFDEYLAFARANRGLMRDVAKII  194
             DGFIS++EYL+FA ANRGLM+D+AK+ 
Sbjct  58   RDGFISYEEYLSFALANRGLMKDIAKVF  85



>ref|XP_003537449.1| PREDICTED: polcalcin Che a 3-like [Glycine max]
Length=116

 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 75/92 (82%), Gaps = 10/92 (11%)
 Frame = -3

Query  439  DDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFIS  260
            DDPQDVADR++IFKHFD++GDG++SS ELGDAL+ LGSVT EEVQRMM E+DTDGDGFIS
Sbjct  4    DDPQDVADRERIFKHFDSDGDGQVSSQELGDALKALGSVTPEEVQRMMAEIDTDGDGFIS  63

Query  259  FD----------EYLAFARANRGLMRDVAKII  194
             D          E++ FARANRGL+RDVAKI 
Sbjct  64   HDTDGDGFISHEEFINFARANRGLVRDVAKIF  95



>gb|KHN17939.1| Polcalcin Che a 3 [Glycine soja]
Length=102

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 75/92 (82%), Gaps = 10/92 (11%)
 Frame = -3

Query  439  DDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFIS  260
            DDPQDVADR++IFKHFD++GDG++SS ELGDAL+ LGSVT EEVQRMM E+DTDGDGFIS
Sbjct  4    DDPQDVADRERIFKHFDSDGDGQVSSQELGDALKALGSVTPEEVQRMMAEIDTDGDGFIS  63

Query  259  FD----------EYLAFARANRGLMRDVAKII  194
             D          E++ FARANRGL+RDVAKI 
Sbjct  64   HDTDGDGFISHEEFINFARANRGLVRDVAKIF  95



>ref|XP_006346895.1| PREDICTED: polcalcin Nic t 2-like [Solanum tuberosum]
Length=86

 Score =   126 bits (316),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -3

Query  448  AEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDG  269
             E D+PQD+ADR++IFK FD NGDG+IS+TELG+ L+ LGSVT EEV+ MMDE+DTD DG
Sbjct  2    GEVDEPQDIADRERIFKRFDENGDGQISATELGETLQALGSVTPEEVKYMMDEIDTDKDG  61

Query  268  FISFDEYLAFARANRGLMRDVAKII  194
            FISF E+  FA+ANRGL+RDVAKI 
Sbjct  62   FISFQEFTEFAKANRGLIRDVAKIF  86



>gb|EYU44574.1| hypothetical protein MIMGU_mgv1a021541mg [Erythranthe guttata]
Length=84

 Score =   125 bits (314),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            ADDPQDVADR+++FK FD+NGDGKIS+ ELG+AL+ LGSVT+EEV+RMM E+DTDGDG I
Sbjct  2    ADDPQDVADRERLFKSFDSNGDGKISAVELGEALQKLGSVTSEEVKRMMAEIDTDGDGCI  61

Query  262  SFDEYLAFARANRGLMRDVAKII  194
            S+ E+  FARAN+GL++DVAK+ 
Sbjct  62   SYQEFDEFARANKGLVKDVAKLF  84



>ref|XP_004233477.1| PREDICTED: polcalcin Nic t 2 [Solanum lycopersicum]
Length=86

 Score =   125 bits (314),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -3

Query  448  AEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDG  269
             E D+PQD+ADR++IFK FD NGDG+IS+TELG+ L+ LGSVT EEV+ MMDE+DT+ DG
Sbjct  2    GEVDEPQDIADRERIFKRFDENGDGQISATELGETLQALGSVTPEEVKYMMDEIDTNKDG  61

Query  268  FISFDEYLAFARANRGLMRDVAKII  194
            FISF E+  FA+ANRGL+RDVAKI 
Sbjct  62   FISFQEFTEFAKANRGLIRDVAKIF  86



>ref|XP_008229215.1| PREDICTED: polcalcin Bet v 4 [Prunus mume]
Length=85

 Score =   124 bits (312),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 76/87 (87%), Gaps = 3/87 (3%)
 Frame = -3

Query  457  MAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTD  278
            MAE   +DPQ+  DR++IFK FDTNGDGKIS++ELGDAL+TLG V ++EV+ MM E+DTD
Sbjct  1    MAE---EDPQEKVDRERIFKRFDTNGDGKISASELGDALKTLGCVQSDEVKFMMAEIDTD  57

Query  277  GDGFISFDEYLAFARANRGLMRDVAKI  197
            GDG+IS++EY+AFA ANRGLM+D+AKI
Sbjct  58   GDGYISYEEYIAFALANRGLMKDIAKI  84



>ref|XP_007216880.1| hypothetical protein PRUPE_ppa020988mg [Prunus persica]
 gb|EMJ18079.1| hypothetical protein PRUPE_ppa020988mg [Prunus persica]
Length=85

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 75/87 (86%), Gaps = 3/87 (3%)
 Frame = -3

Query  457  MAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTD  278
            MAE   +DPQ+  DR++IFK FDTNGDGKIS++ELGDAL+TLG V ++EV+ MM E+DTD
Sbjct  1    MAE---EDPQEKVDRERIFKRFDTNGDGKISASELGDALKTLGCVQSDEVKFMMAEIDTD  57

Query  277  GDGFISFDEYLAFARANRGLMRDVAKI  197
            GDG+IS+ EY+AFA ANRGLM+D+AKI
Sbjct  58   GDGYISYQEYIAFALANRGLMKDIAKI  84



>gb|AHL24661.1| Fra e 3.01 allergen [Fraxinus excelsior]
Length=84

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            ADDPQ+VA  ++IFK  D NGDGKISS+ELG+ L+TLGS+T +E+QRMM E+DTDGDGFI
Sbjct  2    ADDPQEVAQLERIFKRLDANGDGKISSSELGETLKTLGSITPDEIQRMMAEIDTDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKI  197
            S++E+  FARANRGL++DVAKI
Sbjct  62   SYEEFTDFARANRGLVKDVAKI  83



>ref|XP_002532466.1| dc3, putative [Ricinus communis]
 gb|EEF29922.1| dc3, putative [Ricinus communis]
Length=84

 Score =   123 bits (309),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
             DD  D A+R++IFK FD NGDGKIS+TELGD L+TLGSVT +E++RMM E+DTDGDGFI
Sbjct  2    GDDAHDQAERERIFKRFDLNGDGKISATELGDCLKTLGSVTPDEIKRMMAEIDTDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKII  194
            SFDE+  FA+ANRGLM+DVAKI 
Sbjct  62   SFDEFTDFAKANRGLMKDVAKIF  84



>gb|KDP33159.1| hypothetical protein JCGZ_13424 [Jatropha curcas]
Length=84

 Score =   123 bits (309),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            ADD QD+ADR++IFK FD NGDGKIS+ ELGD L+TLGSVT +EV+RMM E+DTDGDG+I
Sbjct  2    ADDAQDLADRERIFKRFDLNGDGKISAAELGDCLKTLGSVTPDEVKRMMAEIDTDGDGYI  61

Query  262  SFDEYLAFARANRGLMRDVAKII  194
            S+ E+  FA ANRGLM+DVAKI 
Sbjct  62   SYQEFTDFATANRGLMKDVAKIF  84



>sp|O81701.1|POLC4_ALNGL RecName: Full=Polcalcin Aln g 4; AltName: Full=Calcium-binding 
pollen allergen Aln g 4; AltName: Allergen=Aln g 4 [Alnus 
glutinosa]
 emb|CAA76831.1| pollen allergen Aln g 4 [Alnus glutinosa]
Length=85

 Score =   122 bits (306),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -3

Query  439  DDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFIS  260
            D PQD A+ ++IFK FD NGDGKIS++ELGDAL+TLGSVT +EV+ MM E+DTDGDGFIS
Sbjct  4    DHPQDQAEHERIFKCFDANGDGKISASELGDALKTLGSVTPDEVKHMMAEIDTDGDGFIS  63

Query  259  FDEYLAFARANRGLMRDVAKII  194
            F E+  FARANRGL++DVAKI 
Sbjct  64   FQEFTNFARANRGLVKDVAKIF  85



>emb|CAA73147.1| Bet v 4 [Betula pendula]
Length=85

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -3

Query  439  DDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFIS  260
            D PQD A+R++IFK FD NGDGKIS+ ELG+AL+TLGS+T +EV+ MM E+DTDGDGFIS
Sbjct  4    DHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFIS  63

Query  259  FDEYLAFARANRGLMRDVAKII  194
            F E+  FARANRGL++DVAKI 
Sbjct  64   FQEFTDFARANRGLLKDVAKIF  85



>emb|CDP02703.1| unnamed protein product [Coffea canephora]
Length=84

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            ADD QD ADR+KIFK FD NGDG+IS+ ELGDAL+ LG VT +EV+RMMDE+DTDGDGFI
Sbjct  2    ADDAQDQADREKIFKRFDANGDGQISAAELGDALKALGCVTGDEVKRMMDEIDTDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKI  197
            S +E+ +FA ANRGL++DVAKI
Sbjct  62   SKEEFTSFALANRGLIKDVAKI  83



>ref|XP_010109031.1| Polcalcin Ole e 3 [Morus notabilis]
 gb|EXC20671.1| Polcalcin Ole e 3 [Morus notabilis]
Length=84

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            AD  ++  +R++IFK FD+NGDGKISSTELGDAL+ LGSVT++EVQRMM E+DTDGDGFI
Sbjct  2    ADAQKEKEERERIFKSFDSNGDGKISSTELGDALKALGSVTSDEVQRMMAEIDTDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKI  197
            S +E+  FA+ANRGL++DVAKI
Sbjct  62   SLEEFTEFAQANRGLIKDVAKI  83



>sp|Q39419.1|POLC4_BETPN RecName: Full=Polcalcin Bet v 4; AltName: Full=Calcium-binding 
pollen allergen Bet v 4; AltName: Allergen=Bet v 4 [Betula 
pendula]
 emb|CAA60628.1| BETV4 protein [Betula pendula]
Length=85

 Score =   120 bits (300),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -3

Query  439  DDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFIS  260
            D PQD A+R++IFK FD NGDGKIS+ ELG+AL+TLGS+T +EV+ MM E+DTDGDGFIS
Sbjct  4    DHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFIS  63

Query  259  FDEYLAFARANRGLMRDVAKII  194
            F E+  F RANRGL++DVAKI 
Sbjct  64   FQEFTDFGRANRGLLKDVAKIF  85



>pdb|1H4B|A Chain A, Solution Structure Of The Birch Pollen Allergen Bet 
V 4
Length=84

 Score =   120 bits (300),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -3

Query  439  DDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFIS  260
            D PQD A+R++IFK FD NGDGKIS+ ELG+AL+TLGS+T +EV+ MM E+DTDGDGFIS
Sbjct  3    DHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFIS  62

Query  259  FDEYLAFARANRGLMRDVAKII  194
            F E+  F RANRGL++DVAKI 
Sbjct  63   FQEFTDFGRANRGLLKDVAKIF  84



>ref|XP_008381328.1| PREDICTED: polcalcin Bet v 4 [Malus domestica]
Length=85

 Score =   119 bits (299),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 3/87 (3%)
 Frame = -3

Query  457  MAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTD  278
            MAE   +DP++ ADR++IFK FDTNGDGKIS+ ELGDAL TLG V  +EV+ MM E+DTD
Sbjct  1    MAE---EDPKEKADRERIFKRFDTNGDGKISAAELGDALETLGCVKPDEVKSMMTEIDTD  57

Query  277  GDGFISFDEYLAFARANRGLMRDVAKI  197
            GDGFIS+ EYL FA ANRGL++D+AKI
Sbjct  58   GDGFISYQEYLDFALANRGLIKDIAKI  84



>ref|XP_008378128.1| PREDICTED: polcalcin Bet v 4-like [Malus domestica]
Length=85

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 73/87 (84%), Gaps = 3/87 (3%)
 Frame = -3

Query  457  MAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTD  278
            MAE   +DP++ ADR++IFK FDTNGDG IS+TELGDAL+TLG V  +EV+ MM E+DTD
Sbjct  1    MAE---EDPKEKADRERIFKRFDTNGDGLISATELGDALKTLGCVQPDEVKFMMAEIDTD  57

Query  277  GDGFISFDEYLAFARANRGLMRDVAKI  197
            GDGFIS+ EYL FA ANRGL++DVAKI
Sbjct  58   GDGFISYKEYLDFALANRGLIKDVAKI  84



>sp|P58171.1|POLC3_SYRVU RecName: Full=Polcalcin Syr v 3; AltName: Full=Calcium-binding 
pollen allergen Syr v 3; AltName: Allergen=Syr v 3 [Syringa 
vulgaris]
 gb|AAK01144.1|AF078681_1 calcium-binding protein [Syringa vulgaris]
Length=81

 Score =   118 bits (295),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDE  251
            ++VA+ ++IFK FD NGDGKISS+ELG+ L+TLGSVT EE+QRMM E+DTDGDGFISF+E
Sbjct  3    EEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEE  62

Query  250  YLAFARANRGLMRDVAKI  197
            +  FARAN GL++DVAKI
Sbjct  63   FKDFARANSGLIKDVAKI  80



>ref|XP_006357773.1| PREDICTED: polcalcin Nic t 1-like [Solanum tuberosum]
Length=84

 Score =   117 bits (292),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            A+DPQDVADR+ +FK FD NGDG+ISS ELG+ L+ LGSVT+EEVQ MM ELDTDGDGFI
Sbjct  2    AEDPQDVADRELVFKRFDLNGDGQISSAELGETLKMLGSVTSEEVQYMMAELDTDGDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAKI  197
            SF+E+  FARANRGL++DVAK+
Sbjct  62   SFEEFEEFARANRGLIKDVAKV  83



>ref|XP_007033047.1| Calcium-binding EF-hand family protein [Theobroma cacao]
 gb|EOY03973.1| Calcium-binding EF-hand family protein [Theobroma cacao]
Length=172

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 85/134 (63%), Gaps = 10/134 (7%)
 Frame = -3

Query  565  PYSKDGHC*SGILSI*PNDFS-----I*FesereeEKNKSTM-----AEAEADDPQDVAD  416
            P SKD       LS+ P         I F     +  NK T+     ++ E  D  + A+
Sbjct  39   PLSKDNLISYYNLSLKPKTLPLPLALISFNKTSPKTINKFTLTATYHSKKEMADDAEKAE  98

Query  415  RDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAFA  236
            RD+IFK FD NGDGKIS+ ELGDAL+TLGSVT +E+ RMM E+DTDGDG+IS+ E+  FA
Sbjct  99   RDRIFKRFDANGDGKISAAELGDALKTLGSVTGDEITRMMAEIDTDGDGYISYQEFTDFA  158

Query  235  RANRGLMRDVAKII  194
             ANRGLM+DVAKI 
Sbjct  159  SANRGLMKDVAKIF  172



>ref|XP_010510613.1| PREDICTED: probable calcium-binding protein CML28 [Camelina sativa]
 ref|XP_010463793.1| PREDICTED: probable calcium-binding protein CML28 [Camelina sativa]
 ref|XP_010485684.1| PREDICTED: probable calcium-binding protein CML28 [Camelina sativa]
 ref|XP_010497370.1| PREDICTED: probable calcium-binding protein CML28 [Camelina sativa]
Length=83

 Score =   114 bits (286),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGDGKIS+ ELGDAL+ LGSVT E+++RMM E+DTDGDG+IS+
Sbjct  3    DATEKAEHDRIFKKFDANGDGKISAAELGDALKNLGSVTHEDIKRMMAEIDTDGDGYISY  62

Query  256  DEYLAFARANRGLMRDVAKII  194
            DE+  FA ANRGLM+DVAKI 
Sbjct  63   DEFSDFASANRGLMKDVAKIF  83



>ref|NP_186993.1| putative calcium-binding protein CML28 [Arabidopsis thaliana]
 sp|Q9SRP7.1|CML28_ARATH RecName: Full=Probable calcium-binding protein CML28; AltName: 
Full=Calmodulin-like protein 28 [Arabidopsis thaliana]
 gb|AAF01603.1|AC009895_24 pollen allergen Bra r II [Arabidopsis thaliana]
 gb|ABK32165.1| At3g03430 [Arabidopsis thaliana]
 gb|AEE73943.1| putative calcium-binding protein CML28 [Arabidopsis thaliana]
Length=83

 Score =   114 bits (285),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGDGKIS+ ELGDAL+ LGSVT E+++RMM E+DTDGDG+IS+
Sbjct  3    DATEKAEHDRIFKKFDANGDGKISAAELGDALKNLGSVTHEDIKRMMAEIDTDGDGYISY  62

Query  256  DEYLAFARANRGLMRDVAKI  197
             E++ FA ANRGLM+DVAKI
Sbjct  63   QEFIDFASANRGLMKDVAKI  82



>ref|XP_006482138.1| PREDICTED: polcalcin Nic t 1-like [Citrus sinensis]
Length=84

 Score =   114 bits (285),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            AD+ QD ADR+++FK FD NGDGKIS++EL D L  L SV+ EEV++MM E+DTDGDG I
Sbjct  2    ADEEQDKADRERVFKRFDLNGDGKISASELADCLNALASVSDEEVKKMMAEIDTDGDGVI  61

Query  262  SFDEYLAFARANRGLMRDVAKI  197
            S+DE+ AFA ANRGL+++VAKI
Sbjct  62   SYDEFTAFAEANRGLIKNVAKI  83



>ref|XP_006430626.1| hypothetical protein CICLE_v10013229mg [Citrus clementina]
 gb|ESR43866.1| hypothetical protein CICLE_v10013229mg [Citrus clementina]
 gb|KDO63086.1| hypothetical protein CISIN_1g046921mg [Citrus sinensis]
Length=84

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            AD+ QD ADR+++FK FD NGDGKIS++EL D L  L SV+ EEV++MM E+DTDGDG I
Sbjct  2    ADEEQDKADRERVFKRFDLNGDGKISASELADCLNALSSVSDEEVKKMMAEIDTDGDGVI  61

Query  262  SFDEYLAFARANRGLMRDVAKI  197
            S+DE+ AFA ANRGL+++VAKI
Sbjct  62   SYDEFTAFAEANRGLIKNVAKI  83



>ref|XP_010935826.1| PREDICTED: polcalcin Phl p 7-like [Elaeis guineensis]
Length=87

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 69/92 (75%), Gaps = 7/92 (8%)
 Frame = -3

Query  469  NKSTMAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDE  290
            NK  M E          + +++FK FDTNGDGKISS ELG+ALRTLGS +T+E+QRMM E
Sbjct  3    NKDKMGEV-------TPEMERMFKRFDTNGDGKISSAELGEALRTLGSTSTDEIQRMMAE  55

Query  289  LDTDGDGFISFDEYLAFARANRGLMRDVAKII  194
            LDTDGDG+I F+E+ AF RAN GLM+DVAK+ 
Sbjct  56   LDTDGDGYIDFNEFSAFCRANPGLMKDVAKVF  87



>ref|XP_006299673.1| hypothetical protein CARUB_v10015861mg [Capsella rubella]
 gb|EOA32571.1| hypothetical protein CARUB_v10015861mg [Capsella rubella]
Length=83

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGDGKIS+ ELGDAL+ LGSVT E+++RMM E+DTDGDG+IS+
Sbjct  3    DATEKAEHDRIFKRFDANGDGKISAAELGDALKNLGSVTHEDIKRMMAEIDTDGDGYISY  62

Query  256  DEYLAFARANRGLMRDVAKII  194
            +E+  FA ANRGLM+DVAKI 
Sbjct  63   EEFSDFASANRGLMKDVAKIF  83



>ref|XP_009119248.1| PREDICTED: polcalcin Bra n 2-like [Brassica rapa]
 emb|CDY49942.1| BnaCnng18520D [Brassica napus]
 emb|CDY21208.1| BnaA01g34390D [Brassica napus]
Length=83

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D++FK FD NGDG ISSTELGDAL+ LGSVT ++++RMM E+DTDGDGFIS+
Sbjct  3    DATEKAEHDRVFKKFDANGDGTISSTELGDALKNLGSVTHDDIKRMMAEIDTDGDGFISY  62

Query  256  DEYLAFARANRGLMRDVAKII  194
             E+  FA+ANRGLM+DVAKI 
Sbjct  63   QEFSDFAKANRGLMKDVAKIF  83



>ref|XP_002882293.1| hypothetical protein ARALYDRAFT_896345 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58552.1| hypothetical protein ARALYDRAFT_896345 [Arabidopsis lyrata subsp. 
lyrata]
Length=83

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGDGKIS+ ELGDAL+ LGSVT E+++RMM E+DTDGDG+IS+
Sbjct  3    DATEKAEHDRIFKKFDANGDGKISAAELGDALKNLGSVTHEDIKRMMAEIDTDGDGYISY  62

Query  256  DEYLAFARANRGLMRDVAKII  194
             E+  FA ANRGLM+DVAKI 
Sbjct  63   QEFSDFASANRGLMKDVAKIF  83



>ref|XP_010549757.1| PREDICTED: probable calcium-binding protein CML28 [Tarenaya hassleriana]
Length=83

 Score =   112 bits (279),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGDGKIS+ ELG++L+TLGSVT E+V+RMM E+DTDGDG+IS+
Sbjct  3    DAGEKAEHDRIFKKFDANGDGKISAAELGESLKTLGSVTGEDVKRMMAEIDTDGDGYISY  62

Query  256  DEYLAFARANRGLMRDVAKII  194
             E+  FA ANRGLM+DVAKI 
Sbjct  63   QEFTDFAAANRGLMKDVAKIF  83



>ref|XP_011002779.1| PREDICTED: polcalcin Syr v 3-like [Populus euphratica]
Length=81

 Score =   112 bits (279),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            ++IFK FD NGDG+IS+ ELGD L+TLGSVT EE++RMM E+DTDGDGFISF E+L FA+
Sbjct  9    ERIFKLFDLNGDGQISAAELGDCLKTLGSVTAEEIKRMMAEIDTDGDGFISFQEFLDFAK  68

Query  232  ANRGLMRDVAKI  197
            AN GLM+DVAKI
Sbjct  69   ANSGLMKDVAKI  80



>ref|XP_002307433.2| Polcalcin Aln g 4 family protein [Populus trichocarpa]
 ref|XP_011021401.1| PREDICTED: polcalcin Syr v 3-like [Populus euphratica]
 gb|EEE94429.2| Polcalcin Aln g 4 family protein [Populus trichocarpa]
Length=81

 Score =   111 bits (278),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLA  242
            A+ ++IFK FD NGDGKIS+ ELGD L+TLGSVT EEV+RMM E+DTDGDG IS+ E+L 
Sbjct  6    AELNRIFKRFDLNGDGKISAAELGDCLKTLGSVTAEEVKRMMAEIDTDGDGSISYQEFLD  65

Query  241  FARANRGLMRDVAKI  197
            FA+AN GLM+DVAKI
Sbjct  66   FAKANSGLMKDVAKI  80



>pir||S65145 pollen allergen group II (clone 44) - rape
Length=83

 Score =   111 bits (278),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+ FK FD NGDG ISSTELGDAL+ LGSVT ++++RMM E+DTDGDGFIS+
Sbjct  3    DATEKAEHDRFFKKFDANGDGTISSTELGDALKNLGSVTHDDIKRMMAEIDTDGDGFISY  62

Query  256  DEYLAFARANRGLMRDVAKII  194
             E+  FA+ANRGLM+DVAKI 
Sbjct  63   QEFSDFAKANRGLMKDVAKIF  83



>sp|P69198.1|POLC2_BRANA RecName: Full=Polcalcin Bra n 2; AltName: Full=Calcium-binding 
pollen allergen Bra n 2; AltName: Allergen=Bra n 2 [Brassica 
napus]
 sp|P69199.1|POLC2_BRACM RecName: Full=Polcalcin Bra r 2; AltName: Full=Calcium-binding 
pollen allergen Bra r 2; AltName: Allergen=Bra r 2 [Brassica 
rapa]
 dbj|BAA09635.1| calcium-binding protein [Brassica rapa]
 emb|CDX92040.1| BnaC03g33420D [Brassica napus]
Length=83

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGDGKIS++ELGDAL+ LGSVT ++++RMM E+DTDGDG+IS+
Sbjct  3    DATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISY  62

Query  256  DEYLAFARANRGLMRDVAKII  194
             E+  FA ANRGLM+DVAKI 
Sbjct  63   QEFSDFASANRGLMKDVAKIF  83



>ref|NP_001062510.1| Os08g0560700 [Oryza sativa Japonica Group]
 dbj|BAD13150.1| putative polcalcin Phl p 7 (Calcium-binding pollen allergen Phl 
p 7) (P7) [Oryza sativa Japonica Group]
 dbj|BAD13211.1| putative polcalcin Phl p 7 (Calcium-binding pollen allergen Phl 
p 7) (P7) [Oryza sativa Japonica Group]
 dbj|BAF24424.1| Os08g0560700 [Oryza sativa Japonica Group]
Length=82

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLA  242
            AD ++IFK FDTNGDGKIS +EL DALRTLGS + +EVQRMM E+DTDGDGFI F+E+++
Sbjct  7    ADMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFIS  66

Query  241  FARANRGLMRDVAKII  194
            F  AN GLM+DVAK+ 
Sbjct  67   FCNANPGLMKDVAKVF  82



>dbj|BAA09633.1| calcium-binding protein [Brassica napus]
Length=82

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGDGKIS++ELGDAL+ LGSVT ++++RMM E+DTDGDG+IS+
Sbjct  2    DATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISY  61

Query  256  DEYLAFARANRGLMRDVAKII  194
             E+  FA ANRGLM+DVAKI 
Sbjct  62   QEFSDFASANRGLMKDVAKIF  82



>gb|AAX77684.1| calcium-binding protein isoallergen 1 [Ambrosia artemisiifolia]
Length=83

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            + +D A+RD+IF  FD N DGKISSTELG++L+ LGSV+ EEVQ MM+ELDTDGDGFIS+
Sbjct  3    EEEDKAERDRIFGAFDANKDGKISSTELGESLKNLGSVSPEEVQTMMEELDTDGDGFISY  62

Query  256  DEYLAFARANRGLMRDVAKII  194
            +E+  F  ANRGLM+DV KI 
Sbjct  63   EEFTDFYNANRGLMKDVGKIF  83



>ref|XP_009134727.1| PREDICTED: polcalcin Bra n 2 [Brassica rapa]
 emb|CDX92038.1| BnaC03g33400D [Brassica napus]
Length=83

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGDGKIS++ELGDAL+ LGSVT ++++RMM E+DTDGDG+IS+
Sbjct  3    DATERAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISY  62

Query  256  DEYLAFARANRGLMRDVAKII  194
             E+  FA ANRGLM+DVAKI 
Sbjct  63   QEFSDFASANRGLMKDVAKIF  83



>emb|CAP05019.1| calcium binding protein [Parietaria judaica]
Length=84

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            AD   D A++++IFK FD+NGDGKISS+ELG+AL+ LGSVT +EV RMM E+DTDGDG I
Sbjct  2    ADKQIDRAEQERIFKRFDSNGDGKISSSELGEALKALGSVTADEVHRMMAEIDTDGDGAI  61

Query  262  SFDEYLAFARANRGLMRDVAKI  197
            S +E+ +FA ANRGL++D+AKI
Sbjct  62   SLEEFSSFADANRGLIKDIAKI  83



>ref|XP_010237791.1| PREDICTED: polcalcin Phl p 7 [Brachypodium distachyon]
Length=80

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  418  DRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            D ++IFK FDTNGDGKIS +EL DALRTLGS + +EVQRMM E+DTDGDGFI FDE+++F
Sbjct  6    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEFISF  65

Query  238  ARANRGLMRDVAKII  194
              AN GLM+DVAK+ 
Sbjct  66   CNANPGLMKDVAKVF  80



>gb|KFK38062.1| hypothetical protein AALP_AA3G065000 [Arabis alpina]
Length=83

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -3

Query  439  DDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFIS  260
            DD  +  + D+IFK FD NGDGKIS+ ELGDAL+ LGSVT ++++RMM E+DTDGDG+IS
Sbjct  2    DDTTEKVEHDRIFKKFDANGDGKISAAELGDALKNLGSVTHDDIKRMMAEIDTDGDGYIS  61

Query  259  FDEYLAFARANRGLMRDVAKII  194
            ++E+  FA ANRGLM+DVAKI 
Sbjct  62   YEEFSDFASANRGLMKDVAKIF  83



>sp|P94092.2|POLC7_CYNDA RecName: Full=Polcalcin Cyn d 7; AltName: Full=Calcium-binding 
pollen allergen Cyn d 7; AltName: Full=Calcium-binding protein 
B1; AltName: Allergen=Cyn d 7 [Cynodon dactylon]
 gb|AAD00247.1| calcium binding protein [Cynodon dactylon]
Length=80

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  427  DVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEY  248
            D  D + IFK FDTNGDGKIS  EL DALRTLGS + +EVQRMM E+DTDGDGFI FDE+
Sbjct  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF  62

Query  247  LAFARANRGLMRDVAKII  194
            ++F  AN GLM+DVAK+ 
Sbjct  63   ISFCNANPGLMKDVAKVF  80



>gb|AAC49648.1| calcium-binding pollen allergen, partial [Cynodon dactylon]
 emb|CAA62634.1| calcium-binding pollen allergen [Cynodon dactylon]
Length=82

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  427  DVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEY  248
            D  D + IFK FDTNGDGKIS  EL DALRTLGS + +EVQRMM E+DTDGDGFI FDE+
Sbjct  5    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF  64

Query  247  LAFARANRGLMRDVAKII  194
            ++F  AN GLM+DVAK+ 
Sbjct  65   ISFCNANPGLMKDVAKVF  82



>ref|XP_010261836.1| PREDICTED: polcalcin Syr v 3-like [Nelumbo nucifera]
Length=82

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDE  251
            +D+A R++IFK FD NGDG+ISS ELG+ L+ LG+ T EE+QRMM E+DTDGDG+ISF E
Sbjct  4    EDLAMRERIFKRFDINGDGQISSAELGETLKQLGAATPEEIQRMMAEIDTDGDGYISFQE  63

Query  250  YLAFARANRGLMRDVAKI  197
            +  F  ANRGLM+DVAKI
Sbjct  64   FTDFCNANRGLMKDVAKI  81



>emb|CDY50704.1| BnaC05g47790D [Brassica napus]
 emb|CDY43125.1| BnaA05g32610D [Brassica napus]
Length=83

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D++FK FD NGDGKIS+TELGDAL+ LGS T ++++RMM E+DTDGDG+IS+
Sbjct  3    DATEKAEHDRVFKKFDANGDGKISATELGDALKNLGSATHDDIKRMMAEIDTDGDGYISY  62

Query  256  DEYLAFARANRGLMRDVAKII  194
             E+  FA ANRGLM+DVAKI 
Sbjct  63   QEFSDFASANRGLMKDVAKIF  83



>gb|AAX77685.1| calcium-binding protein isoallergen 2 [Ambrosia artemisiifolia]
Length=83

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDE  251
            +D A+RD+IF  FD N DGKISS ELG+AL+ LGSV+ EEVQ MM+ELDTDGDGFIS++E
Sbjct  5    EDKAERDRIFGAFDANKDGKISSNELGEALKNLGSVSPEEVQTMMEELDTDGDGFISYEE  64

Query  250  YLAFARANRGLMRDVAKII  194
            +  F  ANRGLM+DV KI 
Sbjct  65   FTDFYNANRGLMKDVGKIF  83



>ref|XP_006660388.1| PREDICTED: polcalcin Phl p 7-like [Oryza brachyantha]
Length=81

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLA  242
            AD ++IFK FD+NGDGKIS +EL DALRTLGS + +EVQRMM E+DTDGDGFI F+E+++
Sbjct  6    ADMERIFKRFDSNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFIS  65

Query  241  FARANRGLMRDVAKII  194
            F  AN GLM+DVAK+ 
Sbjct  66   FCNANPGLMKDVAKVF  81



>pir||S65143 pollen allergen group II (clone 4) - turnip (fragment)
Length=80

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLA  242
            A+ D+IFK FD NGDGKIS++ELGDAL+ LGSVT ++++RMM E+DTDGDG+IS+ E+  
Sbjct  5    AEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQEFSD  64

Query  241  FARANRGLMRDVAKII  194
            FA ANRGLM+DVAKI 
Sbjct  65   FASANRGLMKDVAKIF  80



>ref|XP_009130364.1| PREDICTED: polcalcin Bra n 2-like [Brassica rapa]
Length=83

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D++FK FD NGDGKIS+TELGDAL+ LGS T ++++RMM E+DTDGDG+IS+
Sbjct  3    DATEKAEHDRVFKKFDANGDGKISATELGDALKNLGSATHDDIKRMMVEIDTDGDGYISY  62

Query  256  DEYLAFARANRGLMRDVAKII  194
             E+  FA ANRGLM+DVAKI 
Sbjct  63   QEFSDFASANRGLMKDVAKIF  83



>gb|AEW67318.1| group 7 grass pollen allergen [Secale cereale x Triticum turgidum 
subsp. durum]
 gb|EMS54174.1| Polcalcin Phl p 7 [Triticum urartu]
 gb|EMT22575.1| Polcalcin Phl p 7 [Aegilops tauschii]
Length=78

 Score =   109 bits (273),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  418  DRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            D ++IFK FDTNGDGKIS TEL DALRTLGS + +EVQRMM E+DTDGDGFI F E+++F
Sbjct  4    DMERIFKRFDTNGDGKISLTELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFSEFISF  63

Query  238  ARANRGLMRDVAKII  194
              AN GLM+DVAK+ 
Sbjct  64   CNANPGLMKDVAKVF  78



>pir||S65144 pollen allergen group II (clone 42) - rape
Length=83

 Score =   109 bits (273),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  +  + D+ FK FD NGDG ISSTELGDAL+ LGSVT ++++RMM E+DTDGDGFIS+
Sbjct  3    DATEKTEHDRFFKKFDANGDGTISSTELGDALKNLGSVTHDDIKRMMAEIDTDGDGFISY  62

Query  256  DEYLAFARANRGLMRDVAKII  194
             E+  FA+ANRGLM+DVAKI 
Sbjct  63   QEFSDFAKANRGLMKDVAKIF  83



>ref|XP_002305201.1| Polcalcin Aln g 4 family protein [Populus trichocarpa]
 gb|EEE85712.1| Polcalcin Aln g 4 family protein [Populus trichocarpa]
Length=81

 Score =   109 bits (273),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            ++IFK FD NGDG+IS+ ELGD ++TLGSVT EE++RMM E+DTDGDGFISF E+L FA+
Sbjct  9    ERIFKRFDLNGDGQISAAELGDCVKTLGSVTAEEIKRMMAEIDTDGDGFISFQEFLDFAK  68

Query  232  ANRGLMRDVAKI  197
            AN GL++DVAKI
Sbjct  69   ANSGLIKDVAKI  80



>sp|O82040.1|POLC7_PHLPR RecName: Full=Polcalcin Phl p 7; AltName: Full=Calcium-binding 
pollen allergen Phl p 7; Short=P7; AltName: Allergen=Phl p 
7 [Phleum pratense]
 pdb|1K9U|A Chain A, Crystal Structure Of The Calcium-Binding Pollen Allergen 
Phl P 7 (Polcalcin) At 1.75 Angstroem
 pdb|1K9U|B Chain B, Crystal Structure Of The Calcium-Binding Pollen Allergen 
Phl P 7 (Polcalcin) At 1.75 Angstroem
 emb|CAA76887.1| p7 protein [Phleum pratense]
Length=78

 Score =   108 bits (271),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  418  DRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            D ++IFK FDTNGDGKIS +EL DALRTLGS + +EVQRMM E+DTDGDGFI F+E+++F
Sbjct  4    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISF  63

Query  238  ARANRGLMRDVAKII  194
              AN GLM+DVAK+ 
Sbjct  64   CNANPGLMKDVAKVF  78



>pdb|2LVI|A Chain A, Solution Structure Of Apo-phl P 7
 pdb|2LVJ|A Chain A, Solution Structure Of Hemi-mg-bound Phl P 7
 pdb|2LVK|A Chain A, Solution Structure Of Ca-bound Phl P 7
Length=77

 Score =   108 bits (271),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  418  DRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            D ++IFK FDTNGDGKIS +EL DALRTLGS + +EVQRMM E+DTDGDGFI F+E+++F
Sbjct  3    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISF  62

Query  238  ARANRGLMRDVAKII  194
              AN GLM+DVAK+ 
Sbjct  63   CNANPGLMKDVAKVF  77



>ref|XP_008787459.1| PREDICTED: polcalcin Phl p 7-like [Phoenix dactylifera]
Length=81

 Score =   108 bits (271),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            +++FK FD NGDGKISS ELG+ALRTLGS +T+E+ RMM ELDTDGDG+I F E+ AF R
Sbjct  9    ERMFKRFDANGDGKISSAELGEALRTLGSTSTDEIHRMMAELDTDGDGYIDFSEFSAFCR  68

Query  232  ANRGLMRDVAKII  194
            AN GLM+DVAK+ 
Sbjct  69   ANPGLMKDVAKVF  81



>gb|AEW67317.1| group 7 grass pollen allergen [Secale cereale x Triticum turgidum 
subsp. durum]
 gb|AEW67319.1| group 7 grass pollen allergen [Secale cereale x Triticum turgidum 
subsp. durum]
Length=78

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  418  DRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            D ++IFK FDTNGDGKIS +EL DALRTLGS + +EVQRMM E+DTDGDGFI F E+++F
Sbjct  4    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFSEFISF  63

Query  238  ARANRGLMRDVAKII  194
              AN GLM+DVAK+ 
Sbjct  64   CNANPGLMKDVAKVF  78



>ref|XP_011099475.1| PREDICTED: polcalcin Bet v 4-like [Sesamum indicum]
Length=83

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D Q+ AD +++FK FD NGDGKIS+ ELG+AL+ LG V+ +EV+ MMDE+DTD DG+IS+
Sbjct  3    DDQERADWERLFKRFDANGDGKISAVELGEALKQLGCVSPDEVKHMMDEIDTDKDGYISY  62

Query  256  DEYLAFARANRGLMRDVAKII  194
            DE+  FA ANRGL++DVAKI 
Sbjct  63   DEFTEFASANRGLVKDVAKIF  83



>gb|AAX85389.1| polcalcin [Artemisia vulgaris]
Length=82

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDE  251
            +D A+ D+IF  FD NGDGKIS+ ELG++L  LGSV+ EEVQ MMDELDTDGDG+IS+DE
Sbjct  4    EDKAECDRIFGAFDKNGDGKISAAELGESLTKLGSVSPEEVQTMMDELDTDGDGYISYDE  63

Query  250  YLAFARANRGLMRDVAKII  194
            +  F  ANRGLM+DV KI 
Sbjct  64   FAEFFNANRGLMKDVGKIF  82



>dbj|BAK07986.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=78

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  418  DRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            D ++IFK FDTNGDGKIS +EL DALRTLGS + +EVQRMM E+DTDGDGFI F E+++F
Sbjct  4    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFSEFISF  63

Query  238  ARANRGLMRDVAK  200
              AN GLM+DVAK
Sbjct  64   CNANPGLMKDVAK  76



>gb|EAZ08013.1| hypothetical protein OsI_30279 [Oryza sativa Indica Group]
Length=223

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLA  242
            AD ++IFK FDTNGDGKIS +EL DALRTLGS + +EVQRMM E+DTDGDGFI F+E+++
Sbjct  7    ADMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFIS  66

Query  241  FARANRGLMRDVAK  200
            F  AN GLM+DVAK
Sbjct  67   FCNANPGLMKDVAK  80



>ref|XP_004974225.1| PREDICTED: polcalcin Cyn d 7-like [Setaria italica]
 ref|XP_008664560.1| PREDICTED: polcalcin Phl p 7 [Zea mays]
 tpg|DAA48605.1| TPA: hypothetical protein ZEAMMB73_486331 [Zea mays]
 gb|AGN33442.1| polcalcin [Cenchrus americanus]
Length=80

 Score =   107 bits (266),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  427  DVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEY  248
            + AD ++IFK FDTNGDGKIS +EL +ALRTLGS + +EVQRMM E+DTDGDG I F+E+
Sbjct  3    ETADMERIFKRFDTNGDGKISLSELTEALRTLGSTSADEVQRMMAEIDTDGDGCIDFNEF  62

Query  247  LAFARANRGLMRDVAKI  197
            + F  AN GLM+DVAK+
Sbjct  63   ITFCNANPGLMKDVAKV  79



>gb|AEW67320.1| group 7 grass pollen allergen [Secale cereale x Triticum turgidum 
subsp. durum]
Length=78

 Score =   106 bits (265),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -3

Query  418  DRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            D ++IFK FDTN DGKIS TEL DALRTLGS + +EVQRMM E+DTDGDGFI F E+++F
Sbjct  4    DMERIFKRFDTNDDGKISLTELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFSEFISF  63

Query  238  ARANRGLMRDVAKII  194
              AN GLM+DVAK+ 
Sbjct  64   CNANPGLMKDVAKVF  78



>ref|XP_008678425.1| PREDICTED: polcalcin Phl p 7 [Zea mays]
 gb|ACG40904.1| hypothetical protein [Zea mays]
 gb|AFW61680.1| hypothetical protein ZEAMMB73_307585 [Zea mays]
Length=80

 Score =   106 bits (265),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLA  242
            AD ++IFK FDTNGDGKIS +EL +ALRTLGS + +EVQRMM E+DTDGDG I F+E++ 
Sbjct  5    ADMERIFKRFDTNGDGKISLSELTEALRTLGSTSADEVQRMMAEIDTDGDGCIDFNEFIT  64

Query  241  FARANRGLMRDVAKI  197
            F+ AN GLM+DVAK+
Sbjct  65   FSNANPGLMKDVAKV  79



>ref|NP_197250.1| pollen calcium-binding protein 1 [Arabidopsis thaliana]
 sp|Q9LF54.1|CML29_ARATH RecName: Full=Probable calcium-binding protein CML29; AltName: 
Full=Calmodulin-like protein 29 [Arabidopsis thaliana]
 emb|CAC01892.1| calcium-binding protein [Arabidopsis thaliana]
 gb|ABE66163.1| polcalcin/calcium-binding pollen allergen [Arabidopsis thaliana]
 gb|AED92432.1| pollen calcium-binding protein 1 [Arabidopsis thaliana]
Length=83

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGDGKIS+ EL +AL+TLGSVT ++V+RMM E+DTDGDG IS+
Sbjct  3    DATEKAEHDRIFKKFDANGDGKISAAELEEALKTLGSVTADDVKRMMAEIDTDGDGNISY  62

Query  256  DEYLAFARANRGLMRDVAKI  197
             E+  FA ANRGLM+DVAKI
Sbjct  63   QEFTDFAGANRGLMKDVAKI  82



>ref|XP_002445673.1| hypothetical protein SORBIDRAFT_07g023990 [Sorghum bicolor]
 gb|EES15168.1| hypothetical protein SORBIDRAFT_07g023990 [Sorghum bicolor]
 gb|AGN33440.1| polcalcin [Sorghum bicolor]
Length=80

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  427  DVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEY  248
            + AD ++IFK FDTNGDGKIS +EL DALR LGS + +EVQRMM E+DTDGDG I F+E+
Sbjct  3    ETADMERIFKRFDTNGDGKISLSELTDALRQLGSTSADEVQRMMAEIDTDGDGCIDFNEF  62

Query  247  LAFARANRGLMRDVAKI  197
            + F  AN GLM+DVAK+
Sbjct  63   ITFCNANPGLMKDVAKV  79



>ref|XP_003574943.1| PREDICTED: polcalcin Phl p 7-like [Brachypodium distachyon]
Length=80

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  418  DRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            D ++IFK FD NGDGKIS +EL +ALRTLGS + +EVQRMM E+DTDGDGFI F+E+++F
Sbjct  6    DMERIFKRFDMNGDGKISLSELTEALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISF  65

Query  238  ARANRGLMRDVAKII  194
              AN GLM+DVAK+ 
Sbjct  66   CNANPGLMKDVAKVF  80



>gb|ABK28700.1| unknown [Arabidopsis thaliana]
Length=84

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGDGKIS+ EL +AL+TLGSVT ++V+RMM E+DTDGDG IS+
Sbjct  3    DATEKAEHDRIFKKFDANGDGKISAAELEEALKTLGSVTADDVKRMMAEIDTDGDGNISY  62

Query  256  DEYLAFARANRGLMRDVAKI  197
             E+  FA ANRGLM+DVAKI
Sbjct  63   QEFTDFAGANRGLMKDVAKI  82



>gb|KFK25964.1| hypothetical protein AALP_AA8G185600 [Arabis alpina]
Length=83

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + AD D+IFK FD+NGDGKIS+ EL +AL+TLGSVT +++ RMM E+DTDGDG IS+
Sbjct  3    DAAEKADHDRIFKKFDSNGDGKISAAELEEALKTLGSVTHDDITRMMAEIDTDGDGNISY  62

Query  256  DEYLAFARANRGLMRDVAKI  197
             E+  FA ANRGLM+DVAKI
Sbjct  63   QEFTDFAGANRGLMKDVAKI  82



>ref|XP_002871768.1| hypothetical protein ARALYDRAFT_909744 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48027.1| hypothetical protein ARALYDRAFT_909744 [Arabidopsis lyrata subsp. 
lyrata]
Length=83

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGDGKIS+ EL +AL+TLGSVT ++V+RMM E+DTDGDG IS+
Sbjct  3    DATEKAEHDRIFKKFDANGDGKISAAELEEALKTLGSVTPDDVKRMMAEIDTDGDGNISY  62

Query  256  DEYLAFARANRGLMRDVAKI  197
             E+  FA ANRGLM+DVAKI
Sbjct  63   QEFTDFAGANRGLMKDVAKI  82



>ref|XP_010420474.1| PREDICTED: probable calcium-binding protein CML29 [Camelina sativa]
 ref|XP_010453947.1| PREDICTED: probable calcium-binding protein CML29 [Camelina sativa]
Length=83

 Score =   105 bits (261),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGDGKIS+ EL +AL+TLGSV+ ++V+RMM E+DTDGDG IS+
Sbjct  3    DATEKAEHDRIFKKFDANGDGKISAAELEEALKTLGSVSPDDVKRMMAEIDTDGDGNISY  62

Query  256  DEYLAFARANRGLMRDVAKI  197
             E+  FA ANRGLM+DVAKI
Sbjct  63   QEFTDFAAANRGLMKDVAKI  82



>gb|ACG36800.1| hypothetical protein [Zea mays]
Length=80

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 65/87 (75%), Gaps = 8/87 (9%)
 Frame = -3

Query  457  MAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTD  278
            MAE E        D ++IFK FDTNGDGKIS +EL +ALRTLGS + +EVQRMM E+DTD
Sbjct  1    MAETE--------DMERIFKRFDTNGDGKISLSELTEALRTLGSTSADEVQRMMAEIDTD  52

Query  277  GDGFISFDEYLAFARANRGLMRDVAKI  197
            GDG I F+E++ F  AN GLM+DVAK+
Sbjct  53   GDGCIDFNEFITFCNANPGLMKDVAKV  79



>ref|XP_006400287.1| hypothetical protein EUTSA_v10015161mg [Eutrema salsugineum]
 gb|ESQ41740.1| hypothetical protein EUTSA_v10015161mg [Eutrema salsugineum]
Length=83

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGDGKIS+ EL +AL+TLGSVT ++V RMM E+DTDGDG IS+
Sbjct  3    DATEKAEHDRIFKRFDANGDGKISAAELEEALKTLGSVTHDDVNRMMAEIDTDGDGNISY  62

Query  256  DEYLAFARANRGLMRDVAKII  194
             E+  FA ANRGLM+DVAKI 
Sbjct  63   QEFTDFAGANRGLMKDVAKIF  83



>ref|XP_006289791.1| hypothetical protein CARUB_v10003393mg [Capsella rubella]
 gb|EOA22689.1| hypothetical protein CARUB_v10003393mg [Capsella rubella]
Length=83

 Score =   104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGDGKIS+ EL +AL+TLGSV+ ++V+RMM E+DTDGDG IS+
Sbjct  3    DATEKAEHDRIFKKFDANGDGKISAAELEEALKTLGSVSPDDVKRMMAEIDTDGDGNISY  62

Query  256  DEYLAFARANRGLMRDVAKI  197
             E+  FA ANRGLM+DVAKI
Sbjct  63   QEFTDFAGANRGLMKDVAKI  82



>gb|EAZ43661.1| hypothetical protein OsJ_28287 [Oryza sativa Japonica Group]
Length=193

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLA  242
            AD ++IFK FDTNGDGKIS +EL DALRTLGS + +EVQRMM E+DTDGDGFI F+E+++
Sbjct  7    ADMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFIS  66

Query  241  FARANRGLMRD  209
            F  AN GLM+D
Sbjct  67   FCNANPGLMKD  77



>ref|XP_010940522.1| PREDICTED: polcalcin Phl p 7-like [Elaeis guineensis]
Length=81

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  418  DRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            + +++F+ FDTNGDGKIS  ELG+AL TLGS + ++VQRMM E+DTDGDG+I F+E+ AF
Sbjct  7    EMERMFQRFDTNGDGKISLAELGEALLTLGSTSADDVQRMMAEIDTDGDGYIDFNEFSAF  66

Query  238  ARANRGLMRDVAKII  194
             RAN GLM+DVAK+ 
Sbjct  67   CRANPGLMKDVAKVF  81



>ref|XP_008779064.1| PREDICTED: polcalcin Phl p 7-like [Phoenix dactylifera]
Length=81

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            +++FK FDTNGDGKIS  ELG+ALRTLGS + ++V RMM E+D DGDG+I F E+ AF R
Sbjct  9    ERMFKRFDTNGDGKISLAELGEALRTLGSTSADDVHRMMAEIDADGDGYIDFSEFSAFCR  68

Query  232  ANRGLMRDVAKII  194
            AN GLM+DVAK+ 
Sbjct  69   ANPGLMKDVAKVF  81



>ref|XP_010492704.1| PREDICTED: probable calcium-binding protein CML29 [Camelina sativa]
Length=83

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISF  257
            D  + A+ D+IFK FD NGD KIS+ EL +AL+TLGSV+ ++V+RMM E+DTDGDG IS+
Sbjct  3    DATEKAEHDRIFKKFDANGDRKISAAELEEALKTLGSVSPDDVKRMMAEIDTDGDGNISY  62

Query  256  DEYLAFARANRGLMRDVAKI  197
             E+  FA ANRGLM+DVAKI
Sbjct  63   QEFTDFAAANRGLMKDVAKI  82



>ref|XP_009126190.1| PREDICTED: polcalcin Bra n 1 [Brassica rapa]
 sp|P69196.1|POLC1_BRANA RecName: Full=Polcalcin Bra n 1; AltName: Full=Calcium-binding 
pollen allergen Bra n 1; AltName: Allergen=Bra n 1 [Brassica 
napus]
 sp|P69197.1|POLC1_BRACM RecName: Full=Polcalcin Bra r 1; AltName: Full=Calcium-binding 
pollen allergen Bra r 1; AltName: Allergen=Bra r 1 [Brassica 
rapa]
 dbj|BAA09632.1| calcium-binding protein [Brassica napus]
 dbj|BAA09634.1| calcium-binding protein [Brassica rapa]
 dbj|BAA93509.1| pollen calcium-binding protein [Brassica rapa]
 emb|CDY55935.1| BnaC02g44140D [Brassica napus]
 emb|CDX85450.1| BnaA02g03630D [Brassica napus]
Length=79

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLA  242
            A+ ++IFK FDT+GDGKIS+ EL +AL+ LGSVT ++V RMM ++DTDGDG ISF E+  
Sbjct  4    AEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQEFTE  63

Query  241  FARANRGLMRDVAKII  194
            FA AN GLM+DVAK+ 
Sbjct  64   FASANPGLMKDVAKVF  79



>ref|XP_004149790.1| PREDICTED: probable calcium-binding protein CML28-like [Cucumis 
sativus]
 ref|XP_004161612.1| PREDICTED: probable calcium-binding protein CML28-like [Cucumis 
sativus]
 gb|KGN57835.1| putative calcium-binding protein CML28 [Cucumis sativus]
Length=83

 Score = 95.9 bits (237),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            AD   + AD ++IFK FD NGDGKIS+TELGDAL   G V++E+ +RMMD +D DGDG+I
Sbjct  2    ADSGVNSADLERIFKRFDANGDGKISATELGDALNEFG-VSSEDAKRMMDAIDKDGDGYI  60

Query  262  SFDEYLAFARANRGLMRDVAK  200
            SF E+  FA+ NR LM+D AK
Sbjct  61   SFQEFFDFAKDNRALMKDFAK  81



>ref|XP_009396589.1| PREDICTED: polcalcin Phl p 7-like [Musa acuminata subsp. malaccensis]
Length=82

 Score = 95.9 bits (237),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            ++IFK FDTNGDGKIS  ELG+ LRTLGS + ++V+R M E+DTDGDG I F E+ AF  
Sbjct  9    ERIFKRFDTNGDGKISLAELGEVLRTLGSTSGDDVKRTMAEIDTDGDGNIDFKEFAAFCH  68

Query  232  ANRGLMRDVAKI  197
            AN GLM+DVAK+
Sbjct  69   ANPGLMKDVAKV  80



>ref|XP_009396172.1| PREDICTED: polcalcin Phl p 7-like [Musa acuminata subsp. malaccensis]
Length=113

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLA  242
             + +++FK FDTNGDGKIS  EL + LRTLGS + ++V+R M E+DTDGDG I F E+ A
Sbjct  37   PEMEQVFKRFDTNGDGKISLAELAEVLRTLGSTSADDVKRTMAEIDTDGDGNIDFKEFGA  96

Query  241  FARANRGLMRDVAKI  197
            F RAN GLM+DVAK+
Sbjct  97   FCRANPGLMKDVAKV  111



>ref|XP_008457063.1| PREDICTED: polcalcin Bra n 2-like [Cucumis melo]
Length=83

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            AD   + AD ++IFK FD NGDGKIS+TELGDAL   G V++E+ +RMMD +D DGDG+I
Sbjct  2    ADSGVNSADCERIFKRFDANGDGKISATELGDALNGFG-VSSEDAKRMMDAIDKDGDGYI  60

Query  262  SFDEYLAFARANRGLMRDVAK  200
            SF E+  FA+ NR LM+D AK
Sbjct  61   SFQEFSDFAKDNRALMKDFAK  81



>ref|XP_010092641.1| Polcalcin Syr v 3 [Morus notabilis]
 gb|EXB51892.1| Polcalcin Syr v 3 [Morus notabilis]
Length=84

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDE  251
            ++ A  ++IFK FD NGDGKIS TEL DAL +LGS + +EV R M E+D DGDGFIS DE
Sbjct  6    EERAQCERIFKRFDANGDGKISWTELADALNSLGSGSPDEVHRRMAEIDKDGDGFISLDE  65

Query  250  YLAFARANRGLMRDVAK  200
              AF  AN  LM+DV+K
Sbjct  66   LYAFQLANPDLMKDVSK  82



>ref|XP_009400923.1| PREDICTED: polcalcin Phl p 7-like [Musa acuminata subsp. malaccensis]
Length=82

 Score = 90.9 bits (224),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -3

Query  412  DKIFKHFDTNGD-GKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAFA  236
            +++FK F    D GKISS ELG+ALR LGS   +E++RMM ELDTDGDG+I F E+ AF 
Sbjct  9    ERVFKRFGAEEDDGKISSAELGEALRVLGSTAPDEIRRMMAELDTDGDGYIDFQEFSAFC  68

Query  235  RANRGLMRDVAKII  194
            RAN GLM+DVA++ 
Sbjct  69   RANPGLMQDVAEVF  82



>ref|XP_007212731.1| hypothetical protein PRUPE_ppa019115mg [Prunus persica]
 gb|EMJ13930.1| hypothetical protein PRUPE_ppa019115mg [Prunus persica]
Length=84

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLA  242
            A+ +++FK FD NGDGKIS TEL DAL  LGS + +EV++ M+E+D D DGFIS DE  A
Sbjct  8    AECERVFKRFDVNGDGKISLTELADALTALGSFSPDEVRKRMEEIDMDHDGFISLDELFA  67

Query  241  FARANRGLMRDVAK  200
            F RAN  LM++V K
Sbjct  68   FQRANPDLMKEVVK  81



>ref|XP_004293729.1| PREDICTED: polcalcin Phl p 7-like [Fragaria vesca subsp. vesca]
Length=86

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            ADD    A  ++IFK FD NGDGKIS  EL DAL+ LGS + EEV + M E+D D DGFI
Sbjct  2    ADDADAKAGCERIFKRFDYNGDGKISLNELADALKALGSSSEEEVHQRMKEIDMDHDGFI  61

Query  262  SFDEYLAFARANRGLMRDVAK  200
            S +E  AF RAN  LM++V K
Sbjct  62   SLEELFAFQRANPDLMKEVIK  82



>ref|XP_008445690.1| PREDICTED: polcalcin Syr v 3-like [Cucumis melo]
Length=83

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            ++IFK FD NGDGKIS +EL  AL  LGS   EEV R M E+D DG+GFIS +E   F R
Sbjct  11   ERIFKRFDINGDGKISLSELETALHALGSSAPEEVGRRMSEIDKDGNGFISLEELCDFQR  70

Query  232  ANRGLMRDVAK  200
            AN  LM++V K
Sbjct  71   ANPDLMKEVCK  81



>ref|XP_004140868.1| PREDICTED: polcalcin Syr v 3-like [Cucumis sativus]
 ref|XP_004160812.1| PREDICTED: polcalcin Syr v 3-like [Cucumis sativus]
 gb|KGN45979.1| hypothetical protein Csa_6G041150 [Cucumis sativus]
Length=84

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            ++IFK FD NGDGKIS +EL  AL  LGS   EEV R M E+D DG+G+IS +E   F R
Sbjct  12   ERIFKRFDVNGDGKISLSELEAALHALGSSAPEEVGRRMSEIDKDGNGYISLEELCDFQR  71

Query  232  ANRGLMRDVAK  200
            AN  LM++V K
Sbjct  72   ANPDLMKEVCK  82



>ref|XP_003524846.1| PREDICTED: polcalcin Phl p 7 [Glycine max]
 gb|ACU14154.1| unknown [Glycine max]
 gb|KHN25974.1| Polcalcin Phl p 7 [Glycine soja]
Length=81

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            +++FK FD NGDG IS +E  DAL+ LG  + EEV+R M E+D DGDG I+ +E + F  
Sbjct  9    ERVFKRFDVNGDGNISLSEFADALKVLGLTSQEEVERRMAEIDKDGDGHITLNELIEFHT  68

Query  232  ANRGLMRDVAK  200
            AN  LM+DV K
Sbjct  69   ANPSLMKDVLK  79



>ref|XP_010262278.1| PREDICTED: probable calcium-binding protein CML23 [Nelumbo nucifera]
Length=164

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFD  254
            Q+V + +K+FK FD NGDGKISSTEL D L  LGS T+ EE+ RMM E+DTDGDGFI   
Sbjct  14   QNVDEVEKVFKRFDANGDGKISSTELRDVLGALGSDTSPEEIHRMMSEIDTDGDGFIDLK  73

Query  253  EYLAFARAN  227
            E+  F ++N
Sbjct  74   EFAEFHKSN  82



>ref|XP_007158776.1| hypothetical protein PHAVU_002G181100g [Phaseolus vulgaris]
 gb|ESW30770.1| hypothetical protein PHAVU_002G181100g [Phaseolus vulgaris]
Length=80

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            +++FK FD NGDGKIS +E  +AL+ LG  + EEV+R M+E+D DGDGFI+ +E + F  
Sbjct  8    ERVFKRFDENGDGKISLSEFAEALKVLGLTSQEEVERRMEEIDKDGDGFITLEELIQFRN  67

Query  232  ANRGLMRDV  206
             N  LM DV
Sbjct  68   DNPNLMNDV  76



>ref|XP_004504594.1| PREDICTED: polcalcin Cyn d 7-like [Cicer arietinum]
Length=80

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            ++IFK FD NGDGKIS  E  DAL+ LG  + +EVQR M E+D DGDGFI+ +E + F  
Sbjct  8    ERIFKRFDVNGDGKISLAEFADALKVLGLTSQDEVQRRMAEIDKDGDGFITIEELIEFQN  67

Query  232  ANRGLMRDVAK  200
             +  LM ++ K
Sbjct  68   GHPNLMNEIMK  78



>gb|AAO33897.1| Ole e 3 allergen [Olea europaea]
Length=52

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  418  DRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFI  263
            + ++IFK FD  GDGKISS+ELG+ L+ LGSVT EE+QRMM E+DTDGDGF+
Sbjct  1    EHERIFKRFDAKGDGKISSSELGETLKPLGSVTLEEIQRMMAEIDTDGDGFL  52



>ref|XP_007160530.1| hypothetical protein PHAVU_002G329300g [Phaseolus vulgaris]
 gb|ESW32524.1| hypothetical protein PHAVU_002G329300g [Phaseolus vulgaris]
Length=172

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFD  254
            QD+ +  ++F  FDTNGDGKIS +EL + LR+LGS V  EE+Q +MD+LDTD DGFI+  
Sbjct  28   QDMDEMKRVFSRFDTNGDGKISVSELDNVLRSLGSGVPPEELQNVMDDLDTDHDGFINLS  87

Query  253  EYLAFARA  230
            E+ AF RA
Sbjct  88   EFAAFCRA  95



>ref|XP_010274712.1| PREDICTED: calcium-binding allergen Ole e 8 [Nelumbo nucifera]
Length=163

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = -3

Query  442  ADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGF  266
            A D +   + +++F+ FD NGDGKISS ELGD LR LG+ V+ +EV+RMM+E+DTDGDGF
Sbjct  10   ALDAEKREEIERVFRRFDMNGDGKISSKELGDVLRALGTEVSADEVKRMMEEMDTDGDGF  69

Query  265  ISFDEYLAF  239
            I  +E+  F
Sbjct  70   IDLNEFADF  78



>ref|XP_003530955.1| PREDICTED: calcium-binding allergen Ole e 8 [Glycine max]
Length=180

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFD  254
            QD  +  ++F  FD NGDGKIS +EL + LR+LGS V  EE+QR+M++LDTD DGFI+  
Sbjct  28   QDSEELKRVFSRFDANGDGKISVSELDNVLRSLGSGVPPEELQRVMEDLDTDHDGFINLS  87

Query  253  EYLAFARA  230
            E+ AF R+
Sbjct  88   EFAAFCRS  95



>ref|NP_001237156.1| uncharacterized protein LOC100500636 [Glycine max]
 gb|ACU15777.1| unknown [Glycine max]
Length=180

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFD  254
            QD  +  ++F  FD N DGKIS TEL + LR+LGS V  E++QR+MD+LDTD DGFI+  
Sbjct  28   QDTEELKRVFSRFDANCDGKISVTELDNVLRSLGSGVPPEDIQRVMDDLDTDHDGFINLS  87

Query  253  EYLAFARA  230
            E+ AF R+
Sbjct  88   EFAAFCRS  95



>ref|XP_006430624.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|ESR43864.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|KDO63083.1| hypothetical protein CISIN_1g031791mg [Citrus sinensis]
Length=153

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAFAR  233
            K+F  FD NGDGKIS+ EL D LR+LGS T+ EEV+R+MDE+DTDGDG+I F E+  F  
Sbjct  20   KVFNKFDKNGDGKISADELKDVLRSLGSKTSPEEVKRVMDEIDTDGDGYIDFKEFSTFHL  79

Query  232  A  230
            A
Sbjct  80   A  80



>ref|XP_010925997.1| PREDICTED: probable calcium-binding protein CML18 [Elaeis guineensis]
Length=171

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 57/90 (63%), Gaps = 13/90 (14%)
 Frame = -3

Query  436  DPQD---------VADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDEL  287
            DPQ+         V D +++F  +DTNGDGKIS +EL D +R LGS V+ EE++ MM EL
Sbjct  3    DPQESEKTSELVSVNDVERVFTRYDTNGDGKISPSELADVMRALGSEVSDEELKAMMAEL  62

Query  286  DTDGDGFISFDEYLAFARA---NRGLMRDV  206
            D+DGDGF+   E++AF R      G +RD 
Sbjct  63   DSDGDGFVDLKEFVAFHRGLGEKEGELRDA  92



>gb|ACH60081.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60094.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60097.1| polcalcin [Pseudotsuga menziesii]
Length=124

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -3

Query  463  STMAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDEL  287
            S   E+     Q V D + +FK FD NGDGKISS ELG  + +LG + T EEVQRM+ E 
Sbjct  1    SNQIESSLASAQHVKDLEDVFKKFDANGDGKISSMELGSIMSSLGYNATEEEVQRMVKEA  60

Query  286  DTDGDGFISFDEYL  245
            D DGDGFI F E++
Sbjct  61   DRDGDGFIDFQEFV  74



>gb|ACH60077.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60078.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60079.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60080.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60083.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60084.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60086.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60087.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60089.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60090.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60091.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60092.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60093.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60095.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60096.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60098.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60099.1| polcalcin [Pseudotsuga menziesii]
Length=129

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -3

Query  463  STMAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDEL  287
            S   E+     Q V D + +FK FD NGDGKISS ELG  + +LG + T EEVQRM+ E 
Sbjct  1    SNQIESSLASAQHVKDLEDVFKKFDANGDGKISSMELGSIMSSLGYNATEEEVQRMVKEA  60

Query  286  DTDGDGFISFDEYL  245
            D DGDGFI F E++
Sbjct  61   DRDGDGFIDFQEFV  74



>ref|XP_010663678.1| PREDICTED: calcium-binding allergen Ole e 8 [Vitis vinifera]
 emb|CAN60554.1| hypothetical protein VITISV_014971 [Vitis vinifera]
Length=163

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 5/84 (6%)
 Frame = -3

Query  433  PQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISF  257
            PQD  +  K+F  FD NGDGKISS+EL + LR LGS ++ EE+ R+M E+DTD DG I+ 
Sbjct  16   PQDKDELQKVFNRFDANGDGKISSSELANVLRALGSESSPEEMSRVMKEIDTDDDGCINL  75

Query  256  DEYLAFAR----ANRGLMRDVAKI  197
            +E+  F +    A+ G +RD  ++
Sbjct  76   EEFAQFCKSGSNADAGELRDAFQL  99



>gb|ACH60082.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60085.1| polcalcin [Pseudotsuga menziesii]
 gb|ACH60088.1| polcalcin [Pseudotsuga menziesii]
Length=126

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -3

Query  463  STMAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDEL  287
            S   E+     Q V D + +FK FD NGDGKISS ELG  + +LG + T EEVQRM+ E 
Sbjct  1    SNQIESSLASAQHVKDLEDVFKKFDANGDGKISSMELGSIMSSLGYNATEEEVQRMVKEA  60

Query  286  DTDGDGFISFDEYL  245
            D DGDGFI F E++
Sbjct  61   DRDGDGFIDFQEFV  74



>ref|XP_010908206.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=186

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEYL  245
            +++FK FDTNGDGKISS+EL    ++LG  VT EE++RMM E DTDGDGFISFDE++
Sbjct  41   ERVFKKFDTNGDGKISSSELAAIFQSLGHPVTDEELERMMGEADTDGDGFISFDEFV  97


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = -3

Query  439  DDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFI  263
            DD   + D  + F  FD + +G IS+ EL   LR++G   +  + +RM+D +D DGDG I
Sbjct  105  DDSAALEDLRQAFSVFDLDRNGSISADELARVLRSIGEGASVAQCKRMIDGVDRDGDGLI  164

Query  262  SFDEY  248
            SF+E+
Sbjct  165  SFEEF  169



>gb|ACH60100.1| polcalcin [Pseudotsuga macrocarpa]
Length=129

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 6/75 (8%)
 Frame = -3

Query  466  KSTMAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDE  290
            +ST+A A     Q V D + +FK FD NGDGKISS ELG  + +LG + T EEVQRM+ E
Sbjct  5    ESTLASA-----QHVKDLEDVFKKFDANGDGKISSMELGSIMSSLGYNATEEEVQRMVKE  59

Query  289  LDTDGDGFISFDEYL  245
             D DGDGFI F E++
Sbjct  60   ADRDGDGFIDFQEFV  74



>ref|XP_010925995.1| PREDICTED: probable calcium-binding protein CML18 [Elaeis guineensis]
Length=171

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEY  248
            V D  ++F  +DTNGDGKIS +EL D +R LGS V+ EE++ MM ELD+DGDGF+   E+
Sbjct  16   VNDIKRVFTRYDTNGDGKISPSELADVMRALGSEVSDEELKAMMAELDSDGDGFVDLKEF  75

Query  247  LAFARA  230
            +AF R 
Sbjct  76   VAFHRG  81



>ref|XP_008240158.1| PREDICTED: probable calcium-binding protein CML27 [Prunus mume]
Length=170

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            ++FK FD NGDGKIS +ELG+ L+ LGS V+ +E+QR+M +LDTD DGFI  DE+ AF
Sbjct  28   RVFKSFDANGDGKISVSELGNVLKALGSNVSADELQRVMGDLDTDRDGFICLDEFNAF  85



>ref|XP_008809156.1| PREDICTED: probable calcium-binding protein CML18 [Phoenix dactylifera]
Length=177

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFIS  260
            +P  + D +++F  +D NGDGKIS++EL + +R LGS V+ EE++ MM ELD+DGDGF+ 
Sbjct  12   EPASMNDVERVFTRYDANGDGKISASELANVMRALGSEVSDEELKAMMAELDSDGDGFVD  71

Query  259  FDEYLAF  239
             +E+ AF
Sbjct  72   LNEFAAF  78



>ref|XP_011008803.1| PREDICTED: probable calcium-binding protein CML27 [Populus euphratica]
Length=174

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = -3

Query  427  DVADRDKIFKHFDTNGDGKISSTELGDALRTLGSV-TTEEVQRMMDELDTDGDGFISFDE  251
            D+A+  K+F  FDTNGDGKIS++ELGD L+++GS  T EE++R+M+++DTD DG+I   E
Sbjct  25   DMAELRKVFNQFDTNGDGKISASELGDVLKSMGSTYTMEELRRVMEDVDTDKDGYIDLAE  84

Query  250  YLAFAR  233
            +    R
Sbjct  85   FAKLCR  90



>ref|XP_007209701.1| hypothetical protein PRUPE_ppa012426mg [Prunus persica]
 gb|EMJ10900.1| hypothetical protein PRUPE_ppa012426mg [Prunus persica]
Length=170

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            ++FK FD NGDGKIS +ELG+ L+ LG SV+ +E+QR+M +LDTD DGFI  DE+ AF
Sbjct  28   RVFKSFDANGDGKISVSELGNVLKALGSSVSADELQRVMGDLDTDRDGFICLDEFNAF  85



>ref|XP_004299534.1| PREDICTED: probable calcium-binding protein CML27-like [Fragaria 
vesca subsp. vesca]
Length=170

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            ++FK FDTNGDG+IS +ELG+ L+ LGS V  +E+QR+M ELDTD DGFI  DE+ AF  
Sbjct  24   RVFKSFDTNGDGRISVSELGNVLKALGSNVGEDELQRVMVELDTDRDGFICLDEFNAFWV  83

Query  232  A  230
            A
Sbjct  84   A  84



>gb|EYU41337.1| hypothetical protein MIMGU_mgv1a015814mg [Erythranthe guttata]
Length=145

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAFA  236
            +K+F  FD NGDGKISS ELG  L  LGS T+ EEV RMM ELDTDGDGFI   E+  F 
Sbjct  11   EKVFSKFDANGDGKISSAELGAVLNGLGSKTSDEEVARMMTELDTDGDGFIDIVEFRKFN  70

Query  235  RA  230
            R 
Sbjct  71   RG  72


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            A+  + F  +D + +G+IS++EL   LRTLG + + ++  RM++  D DGDG I+FDE+
Sbjct  79   AELKEAFDMYDKDKNGQISASELHAVLRTLGENCSVKDCGRMIESFDVDGDGSINFDEF  137



>ref|XP_011073627.1| PREDICTED: probable calcium-binding protein CML18 [Sesamum indicum]
Length=148

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -3

Query  451  EAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDG  275
            E  +D  Q   + +K+F  FD NGDGKISS ELG  L  LGS ++ +EV+R+M ELDTDG
Sbjct  2    ERNSDSNQQHDEVEKVFNKFDANGDGKISSAELGAVLNGLGSAMSADEVERVMLELDTDG  61

Query  274  DGFISFDEYLAF  239
            DGFI  +E+ AF
Sbjct  62   DGFIDLNEFKAF  73



>ref|XP_009775333.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
sylvestris]
Length=157

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAF  239
            K+FK FDTNGDGKIS +ELG  L  LG+ TT +E +RMM E+DTDGDGFI   E+ AF
Sbjct  23   KVFKKFDTNGDGKISLSELGGILNALGTKTTPDEAKRMMIEVDTDGDGFIDLKEFAAF  80



>gb|KDP23917.1| hypothetical protein JCGZ_27077 [Jatropha curcas]
Length=158

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSV-TTEEVQRMMDELDTDGDGFISFD  254
            QD+ +  K+F  FDTNGDGKIS+ ELG  L+ +GS  T  E+ R+MD++DTD DGFI+ +
Sbjct  6    QDMKELKKVFDQFDTNGDGKISTAELGGILKAMGSTYTIAELDRVMDDVDTDKDGFINLE  65

Query  253  EYLAFARANRG  221
            E+    R++ G
Sbjct  66   EFAQLCRSSSG  76



>gb|EYU17655.1| hypothetical protein MIMGU_mgv1a015081mg [Erythranthe guttata]
Length=168

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 7/81 (9%)
 Frame = -3

Query  457  MAEAEADDPQ------DVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRM  299
            MA   A +PQ      D+ +  K+F+ FDTNGDGKISS ELG  L  LGS T+ +EV RM
Sbjct  1    MATNAAANPQASMYLQDMDEVRKVFQRFDTNGDGKISSDELGGVLNALGSGTSADEVARM  60

Query  298  MDELDTDGDGFISFDEYLAFA  236
            M+E+DTD DG I+  E+ AF 
Sbjct  61   MEEIDTDKDGHINLQEFAAFC  81


 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%), Gaps = 3/66 (5%)
 Frame = -3

Query  436  DPQDVADRD--KIFKHFDTNGDGKISSTELGDALRTLGSVTTEE-VQRMMDELDTDGDGF  266
            DP + A+++  + F+ +D + +GKIS+ EL   L  LG   +E+    M+  +D+DGDGF
Sbjct  86   DPYNSAEKELREAFQLYDQDHNGKISAAELHQILTRLGEHCSEQDCAGMIRTVDSDGDGF  145

Query  265  ISFDEY  248
            +SFDE+
Sbjct  146  VSFDEF  151



>ref|XP_009606381.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
tomentosiformis]
Length=157

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAF  239
            +K+FK FDTNGDGKIS +ELG  L  LG+ TT +E +RMM E+DTDGDGFI   E+ AF
Sbjct  22   EKVFKKFDTNGDGKISLSELGGILNALGTKTTPDEAKRMMLEVDTDGDGFIDLKEFAAF  80



>ref|XP_003631098.1| SLR1/LCR-like protein [Medicago truncatula]
 gb|AET05574.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK37389.1| unknown [Medicago truncatula]
Length=165

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  406  IFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYLAFARA  230
            +F  FDTNGDGKIS TEL + LR+LGS V  +E+QR+M++LDTD DGFI+  E+ AF R+
Sbjct  28   VFTRFDTNGDGKISVTELDNILRSLGSTVPKDELQRVMEDLDTDRDGFINLAEFAAFCRS  87


 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = -3

Query  427  DVADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDE  251
            DV++  + F  +D + +G IS+TEL   L TLG   + EE   M+  +D+DGDG ++F+E
Sbjct  93   DVSELREAFDLYDKDKNGLISATELCQVLNTLGMKCSVEECHTMIKSVDSDGDGNVNFEE  152

Query  250  YLAFARANRG  221
            +      N+ 
Sbjct  153  FKKMMNNNQA  162



>ref|XP_007227671.1| hypothetical protein PRUPE_ppa026485mg [Prunus persica]
 gb|EMJ28870.1| hypothetical protein PRUPE_ppa026485mg [Prunus persica]
Length=246

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            ++FK FD NGDGKIS +ELG+ L+ LG SV+ +E+QR+M  LDTD DGFI  DE+ AF
Sbjct  28   RVFKSFDANGDGKISVSELGNVLKALGSSVSADELQRVMGNLDTDRDGFICLDEFNAF  85



>ref|XP_011008351.1| PREDICTED: probable calcium-binding protein CML27 [Populus euphratica]
Length=174

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = -3

Query  427  DVADRDKIFKHFDTNGDGKISSTELGDALRTLGSV-TTEEVQRMMDELDTDGDGFISFDE  251
            D+A+  K+F  FDTNGDGKIS++ELGD L+++GS  T EE+ R+M+++DTD DG+I   E
Sbjct  25   DMAELRKVFNQFDTNGDGKISASELGDVLKSMGSTYTMEELLRVMEDVDTDKDGYIDLAE  84

Query  250  YLAFAR  233
            +    R
Sbjct  85   FAKLCR  90



>ref|XP_008782318.1| PREDICTED: probable calcium-binding protein CML18 [Phoenix dactylifera]
Length=178

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -3

Query  418  DRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYLA  242
            D +++F  +D NGDGKIS +EL D LR LGS V+ EE++ MM ELD+DGDGF++  E+ A
Sbjct  18   DVERVFARYDANGDGKISPSELADVLRALGSEVSDEELKAMMAELDSDGDGFVTLKEFAA  77

Query  241  F  239
            F
Sbjct  78   F  78



>emb|CDY70127.1| BnaA06g38470D [Brassica napus]
Length=167

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 54/80 (68%), Gaps = 4/80 (5%)
 Frame = -3

Query  466  KSTMAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDE  290
            K T A  +  +P+++    K+F  FD+NGDGKIS TELG   + +G+  TE E+ R+++E
Sbjct  10   KPTPAPVDMANPEELK---KVFDQFDSNGDGKISVTELGGVFKAMGTSYTETEINRVLEE  66

Query  289  LDTDGDGFISFDEYLAFARA  230
            +DTD DGFI+ DE+ A  R+
Sbjct  67   VDTDRDGFINVDEFSALCRS  86



>ref|XP_007163958.1| hypothetical protein PHAVU_L002000g [Phaseolus vulgaris]
 gb|ESW35952.1| hypothetical protein PHAVU_L002000g [Phaseolus vulgaris]
Length=177

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFD  254
            +D+ + +++F  FD NGDGKIS+ EL   L+TLGS V+ E+++R+M++LDTD DGFIS  
Sbjct  27   EDMNELERVFNRFDANGDGKISTDELDSVLKTLGSGVSPEDLRRVMEDLDTDRDGFISLT  86

Query  253  EYLAFARAN  227
            E+ AF R++
Sbjct  87   EFAAFCRSD  95



>ref|XP_011084270.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=160

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFD  254
            Q++ +  ++F  FD NGDGKISS ELG  +  LGS T+ +EV RMM+E+DTD DGFIS +
Sbjct  16   QNMEEVKRVFDRFDANGDGKISSDELGGVIEALGSETSADEVARMMEEIDTDKDGFISLE  75

Query  253  EYLAFARAN  227
            E+  F  A+
Sbjct  76   EFAVFCSAD  84



>ref|XP_011099473.1| PREDICTED: probable calcium-binding protein CML18 [Sesamum indicum]
Length=152

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAF  239
            +K+F  FDTNGDG+IS TELG  L  LGS T  +EV R+M ELDTDGDGFI  +E+ AF
Sbjct  17   EKVFSKFDTNGDGRISLTELGAILNGLGSATPGDEVARIMSELDTDGDGFIDLNEFKAF  75



>gb|AAF31152.1|AF078680_1 calcium-binding protein [Olea europaea]
Length=171

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFD  254
            Q+  +   +F  FD NGDGKIS  EL  AL+ LGS T+ EE+ RMM+E+DTD DGFI+  
Sbjct  16   QEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQ  75

Query  253  EYLAFARA  230
            E+ AF +A
Sbjct  76   EFAAFVKA  83



>ref|XP_002322096.1| calcium binding family protein [Populus trichocarpa]
 gb|EEF06223.1| calcium binding family protein [Populus trichocarpa]
Length=174

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = -3

Query  427  DVADRDKIFKHFDTNGDGKISSTELGDALRTLGSV-TTEEVQRMMDELDTDGDGFISFDE  251
            D A+  K+F  FDTNGDGKIS++ELG+ L+++GS  T EE+ R+M+++DTD DG+I   E
Sbjct  25   DTAELRKVFNQFDTNGDGKISASELGEVLKSMGSTYTMEELHRVMEDVDTDKDGYIDLAE  84

Query  250  YLAFAR  233
            +    R
Sbjct  85   FAKLCR  90



>ref|XP_009804163.1| PREDICTED: calcium-binding protein CML24-like [Nicotiana sylvestris]
Length=158

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAF  239
            K+F+ FDTNGDGKIS +ELG  L  LGS T+ +EV+R+M E+DTDGDGFI   E+ AF
Sbjct  23   KVFRKFDTNGDGKISLSELGAILNALGSTTSPDEVKRIMLEVDTDGDGFIDLKEFAAF  80



>ref|XP_008351927.1| PREDICTED: probable calcium-binding protein CML27 [Malus domestica]
Length=159

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            K+FK FD NGDGKIS  ELG+ L+ LGS V+ +E++R+M +LDTD DGFI  DE+ AF  
Sbjct  22   KVFKSFDANGDGKISVNELGNVLKALGSNVSGDELKRVMVDLDTDNDGFICLDEFNAFWV  81

Query  232  A  230
            A
Sbjct  82   A  82



>gb|AAX77686.1| calcium-binding protein [Ambrosia artemisiifolia]
Length=160

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = -3

Query  433  PQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISF  257
            P D  +  KIF  FDTNGDG+IS  EL   L++LGS T+ +EV+R+M E+D DGDGFIS 
Sbjct  12   PTDKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADGDGFISL  71

Query  256  DEYLAFARA  230
            DE++ F + 
Sbjct  72   DEFILFCKG  80



>ref|XP_010671432.1| PREDICTED: calcium-binding allergen Ole e 8-like [Beta vulgaris 
subsp. vulgaris]
Length=172

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = -3

Query  427  DVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDE  251
            D+A+  K+F  FDTNGDGKIS+TEL + ++ LGS T+ EEV++MM+E+D D D +IS +E
Sbjct  24   DMAEVKKVFDRFDTNGDGKISATELKNVMKALGSETSPEEVKQMMEEMDIDKDSYISLEE  83

Query  250  YLAFA  236
            +  F 
Sbjct  84   FAEFC  88



>emb|CDY19196.1| BnaC05g13970D [Brassica napus]
Length=177

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 54/80 (68%), Gaps = 4/80 (5%)
 Frame = -3

Query  466  KSTMAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDE  290
            K T A  +  +P+++    K+F  FD+NGDGKIS TELG   + +G+  TE E+ R+++E
Sbjct  10   KPTPAPVDMANPEEL---KKVFDQFDSNGDGKISVTELGGVFKAMGTSYTETELNRVLEE  66

Query  289  LDTDGDGFISFDEYLAFARA  230
            +DTD DGFI+ DE+ A  R+
Sbjct  67   VDTDRDGFINVDEFSALCRS  86



>gb|ABK78767.1| putative allergen Cup a 4 [Hesperocyparis arizonica]
 gb|ACY01951.1| putative Cup a 4 allergen [Hesperocyparis arizonica]
Length=165

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFD  254
            Q V + +++FK FD NGDGKIS +EL D LR++GS V   EV+ MM+E DTDGDG++S  
Sbjct  22   QSVHELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQ  81

Query  253  EYL  245
            E++
Sbjct  82   EFV  84



>sp|O64943.2|POLC2_JUNOX RecName: Full=Polcalcin Jun o 2; AltName: Full=Calcium-binding 
pollen allergen Jun o 2; AltName: Allergen=Jun o 2 [Juniperus 
oxycedrus]
 gb|AAC15474.2| pollen allergen Jun o 4 [Juniperus oxycedrus]
Length=165

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFD  254
            Q V + +++FK FD NGDGKIS +EL D LR+LGS V   EV+ MM+E D DGDG++S  
Sbjct  22   QSVHELEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEVKAMMEEADADGDGYVSLQ  81

Query  253  EYL  245
            E++
Sbjct  82   EFV  84



>ref|XP_009596756.1| PREDICTED: calcium-binding allergen Ole e 8-like [Nicotiana tomentosiformis]
Length=166

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFD  254
            QD+ +  K+FK FDTNGDG IS+ EL   +  LGS T+ +EV RMMDE+DTD DG+I+ D
Sbjct  22   QDMDEVQKVFKRFDTNGDGMISADELSGVINALGSDTSPDEVARMMDEIDTDRDGYINLD  81

Query  253  EYLAFAR  233
            E+  F +
Sbjct  82   EFAEFCK  88



>ref|XP_009797110.1| PREDICTED: calcium-binding allergen Ole e 8-like [Nicotiana sylvestris]
Length=167

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFD  254
            QD+ +  K+FK FDTNGDG IS+ EL   +  LGS T+ +EV RMMDE+DTD DG+I+ D
Sbjct  23   QDMDEVQKVFKRFDTNGDGMISADELSGVINALGSDTSPDEVARMMDEIDTDRDGYINLD  82

Query  253  EYLAFAR  233
            E+  F +
Sbjct  83   EFAEFCK  89



>emb|CAC43238.1| calcium binding protein [Sesbania rostrata]
Length=172

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFD  254
            +D+ +  ++F  FD NGDGKIS  EL + LR LGS V ++E++R+M +LDTD DGFI+  
Sbjct  28   EDMDELKRVFSRFDANGDGKISVNELDNVLRALGSTVPSDELERVMKDLDTDNDGFINLT  87

Query  253  EYLAFARA  230
            E+ AF R+
Sbjct  88   EFAAFCRS  95



>gb|ABP87672.1| putative allergen Cup a 4 [synthetic construct]
Length=177

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFD  254
            Q V + +++FK FD NGDGKIS +EL D LR++GS V   EV+ MM+E DTDGDG++S  
Sbjct  34   QSVHELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQ  93

Query  253  EYL  245
            E++
Sbjct  94   EFV  96



>ref|XP_006346894.1| PREDICTED: probable calcium-binding protein CML18-like [Solanum 
tuberosum]
Length=145

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAF  239
            +K+F+ FDTNGDGKIS  EL + L+ LG+ TT +E +RMM E+DTDGDGFI  +E+ AF
Sbjct  12   EKVFRKFDTNGDGKISLLELDEVLKALGTKTTPDEAKRMMLEVDTDGDGFIDLEEFAAF  70



>ref|XP_008356663.1| PREDICTED: probable calcium-binding protein CML27 [Malus domestica]
Length=175

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDELDTDGDGFISFDEYLAFAR  233
            K+FK FD+NGDGKIS  ELG+ L  LGS  +E E++R M +LDTD DGFI  DE+ AF  
Sbjct  29   KVFKSFDSNGDGKISVNELGNVLTALGSTVSEDELKRFMVDLDTDNDGFICLDEFNAFWV  88

Query  232  A  230
            A
Sbjct  89   A  89



>emb|CBI15562.3| unnamed protein product [Vitis vinifera]
Length=93

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = -3

Query  433  PQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEE--VQRMMDELDTDGDGFIS  260
            PQD  +  K+F  FD NGDGKISS+EL + LR LGS ++ E   ++M+   D+DGDG IS
Sbjct  16   PQDKDELQKVFNRFDANGDGKISSSELANVLRALGSESSPEEMSRKMIGSFDSDGDGNIS  75

Query  259  FDEY  248
            FDE+
Sbjct  76   FDEF  79



>ref|XP_008374843.1| PREDICTED: probable calcium-binding protein CML27 [Malus domestica]
Length=175

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDELDTDGDGFISFDEYLAFAR  233
            K+FK FD+NGDGKIS  ELG+ L  LGS  +E E++R M +LDTD DGFI  DE+ AF  
Sbjct  29   KVFKSFDSNGDGKISVNELGNVLTALGSTVSEDELKRFMVDLDTDNDGFICLDEFNAFWV  88

Query  232  A  230
            A
Sbjct  89   A  89



>ref|XP_009149267.1| PREDICTED: probable calcium-binding protein CML27 [Brassica rapa]
Length=167

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = -3

Query  433  PQDVADRD---KIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDELDTDGDGF  266
            P D+A+ +   K+F  FD+NGDGKIS TELG   + +G+  TE E+ R+++E+DTD DGF
Sbjct  15   PVDMANPEELKKVFDQFDSNGDGKISVTELGGVFKAMGTSYTETEINRVLEEVDTDRDGF  74

Query  265  ISFDEYLAFARAN  227
            I+ DE+ A  R++
Sbjct  75   INVDEFSALCRSS  87



>ref|XP_003528969.1| PREDICTED: calcium-binding allergen Ole e 8-like [Glycine max]
Length=179

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFD  254
            +D+ + + +F  FD NGDGKIS+ EL   LR+LGS V+ E+++R M++LDTD DGFIS  
Sbjct  26   EDMNELETVFNRFDANGDGKISADELDSVLRSLGSGVSPEDLRRFMEDLDTDRDGFISLT  85

Query  253  EYLAFARA  230
            E+ AF R+
Sbjct  86   EFAAFCRS  93



>ref|XP_010938627.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
 ref|XP_010938628.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=189

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEYL  245
            +++FK FD+NGDGKISS EL    + LG   T EE+QRMM E D DGDGFIS DE++
Sbjct  44   ERVFKKFDSNGDGKISSAELAAIFQNLGHPATEEELQRMMGEADADGDGFISLDEFV  100



>ref|XP_009360087.1| PREDICTED: probable calcium-binding protein CML27 [Pyrus x bretschneideri]
Length=159

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            K+FK FD NGDGKIS  ELG+ L+ LGS V+ +E++R+M +LDTD DGFI  DE+ +F  
Sbjct  22   KVFKSFDANGDGKISVNELGNVLKALGSNVSGDELKRVMVDLDTDNDGFICLDEFNSFWV  81

Query  232  A  230
            A
Sbjct  82   A  82



>ref|XP_004159084.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
Length=185

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = -3

Query  439  DDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFI  263
            D    + + +++FK FD NGDGKISS ELG  +R+LG + T EE+ +M+DE D DGDGFI
Sbjct  35   DSESQITELEEVFKKFDVNGDGKISSAELGSTMRSLGHNATEEELGKMIDEFDADGDGFI  94

Query  262  SFDEYL  245
            +  E++
Sbjct  95   NLHEFV  100



>ref|XP_009351545.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=197

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEY  248
            +A+ D++FK FD NGDGKISS+ELG  + +LG  ++ EE+  M+ E+D+DGDGFI+F E+
Sbjct  49   IAELDQVFKKFDVNGDGKISSSELGAIMSSLGQASSDEELNSMISEVDSDGDGFINFKEF  108

Query  247  L  245
            +
Sbjct  109  V  109


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -3

Query  403  FKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            F  +D +G+G IS+ EL + LR+LG   + +E ++M+  +D+DGDG ISF+E+
Sbjct  129  FSVYDIDGNGSISAEELYEVLRSLGDECSIDECRKMIGGVDSDGDGMISFEEF  181



>ref|XP_010692608.1| PREDICTED: probable calcium-binding protein CML25 [Beta vulgaris 
subsp. vulgaris]
Length=193

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = -3

Query  427  DVADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDE  251
            ++ + +++FK FD NGDGKISS+ELG  + +LG  VT EE+Q M+ E+D DGDGFI F+E
Sbjct  43   NIEELEQVFKKFDVNGDGKISSSELGSMMGSLGQQVTEEELQTMIKEVDADGDGFIDFNE  102

Query  250  YLAF  239
            ++  
Sbjct  103  FITL  106



>ref|XP_003616365.1| Polcalcin Nic t [Medicago truncatula]
 gb|AES99323.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=139

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAF  239
            KIF  FD NGDGKIS +EL + L TLGS TT EEV+RMM+ELD +GDGFI   E+  F
Sbjct  7    KIFSKFDKNGDGKISRSELKEMLLTLGSETTSEEVKRMMEELDQNGDGFIDLKEFADF  64



>ref|XP_009628802.1| PREDICTED: probable calcium-binding protein CML18 [Nicotiana 
tomentosiformis]
Length=158

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAF  239
            K+F+ FD NGDGKIS +ELG  L  LGS T+ +EV+R+M E+DTDGDGFI   E+ AF
Sbjct  23   KVFRKFDANGDGKISLSELGAILNALGSTTSPDEVKRIMLEVDTDGDGFIDLKEFAAF  80



>ref|XP_004142374.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
 gb|KGN52351.1| hypothetical protein Csa_5G627080 [Cucumis sativus]
Length=185

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = -3

Query  439  DDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFI  263
            D    + + +++FK FD NGDGKISS ELG  +R+LG + T EE+ +M+DE D DGDGFI
Sbjct  35   DSESQITELEEVFKKFDVNGDGKISSAELGSIMRSLGHNATEEELGKMIDEFDADGDGFI  94

Query  262  SFDEYL  245
            +  E++
Sbjct  95   NLHEFV  100



>emb|CDO98355.1| unnamed protein product [Coffea canephora]
Length=216

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFD  254
            QD  +  K+F+ FD N DGKISS EL   ++ LGS T+ +E+ RMM E+DTD DGFI+ +
Sbjct  66   QDADEVQKVFERFDANSDGKISSEELAGVMKALGSDTSPDEISRMMVEIDTDKDGFINLE  125

Query  253  EYLAFARAN  227
            E+ AF  +N
Sbjct  126  EFTAFCSSN  134



>ref|XP_007036791.1| Calcium-binding EF-hand family protein [Theobroma cacao]
 gb|EOY21292.1| Calcium-binding EF-hand family protein [Theobroma cacao]
Length=169

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            K+F  FD N DGKIS +ELGD L+ +G S + EE++R+M+++DTD DGFI+  E+ AF R
Sbjct  25   KVFNQFDANKDGKISVSELGDVLKAMGSSYSKEELERVMEDIDTDKDGFINLSEFSAFCR  84



>ref|XP_010693960.1| PREDICTED: probable calcium-binding protein CML18 [Beta vulgaris 
subsp. vulgaris]
Length=142

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVT-TEEVQRMMDELDTDGDGFI---SFDEYL  245
            ++IF  FD NGDGKIS+TEL   L+ LGS T TEEV++MM+E+D DGDGF+    F E+ 
Sbjct  8    ERIFSKFDANGDGKISATELKSLLQALGSETSTEEVKKMMEEMDKDGDGFVDLLEFSEFH  67

Query  244  AFARANRGLMRDV  206
            A +  N G  +++
Sbjct  68   AGSGGNAGSTKEL  80


 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            ++ F+ +D +G+GKIS+ EL D L++LG   + ++ ++M+  +D DGDG + F+E+
Sbjct  81   EEAFRLYDKDGNGKISARELYDVLKSLGEKCSLKDCKKMISSVDADGDGHVDFEEF  136



>ref|XP_006357771.1| PREDICTED: calcium-binding protein CML24-like [Solanum tuberosum]
Length=156

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAF  239
            +K+F+ FD NGDGKIS +ELG  L  LGS T+ +EV+R+M E+DTDGDGFI   E+ AF
Sbjct  22   EKVFRKFDANGDGKISLSELGAILNALGSKTSPDEVKRIMLEVDTDGDGFIDLKEFAAF  80



>ref|XP_006469245.1| PREDICTED: probable calcium-binding protein CML25-like [Citrus 
sinensis]
Length=212

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -3

Query  427  DVADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDE  251
            DV +  ++F  FD NGDGKIS++ELG  L +LG + T EE+Q+M+ E+D DGDGF+ FDE
Sbjct  57   DVHELRQVFNKFDANGDGKISASELGSILTSLGHAATEEELQKMVKEIDADGDGFVDFDE  116

Query  250  YL  245
            ++
Sbjct  117  FV  118



>ref|XP_010537496.1| PREDICTED: probable calcium-binding protein CML27 [Tarenaya hassleriana]
Length=171

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -3

Query  433  PQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDELDTDGDGFISF  257
            P    +  K+F  FD NGDGKIS+ ELG+ ++ +G+  TE E+QR+M+++D D DGFI+ 
Sbjct  17   PVSTEELKKVFDQFDANGDGKISAVELGNVMKAMGTPYTEAELQRVMEDVDVDRDGFINL  76

Query  256  DEYLAFAR  233
            DE+ A  R
Sbjct  77   DEFSALCR  84



>ref|XP_003519336.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine 
max]
Length=141

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAFAR  233
            +IF  FD NGDGKIS TEL D L  LGS TT EE++RMM+ELD +GDGFI   E+  F  
Sbjct  7    QIFNKFDKNGDGKISVTELKDMLAALGSKTTDEELKRMMEELDQNGDGFIDLKEFADF-H  65

Query  232  ANRGLMRDVAK  200
             N G  +D +K
Sbjct  66   CNGGAGKDDSK  76



>ref|XP_002440821.1| hypothetical protein SORBIDRAFT_09g007360 [Sorghum bicolor]
 gb|EES19251.1| hypothetical protein SORBIDRAFT_09g007360 [Sorghum bicolor]
Length=179

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDELDTDGDGFISFDEY  248
            VA+ +++F+ +D NGDGKIS+ EL   LR LG+     EV+RMMDE+D+D DGF+   E+
Sbjct  24   VAEVEQVFRRYDANGDGKISAEELASVLRALGAPPGPGEVRRMMDEMDSDRDGFVDLAEF  83

Query  247  LAFARAN  227
            +AF  +N
Sbjct  84   IAFHCSN  90



>gb|KDO60746.1| hypothetical protein CISIN_1g029304mg [Citrus sinensis]
Length=195

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -3

Query  427  DVADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDE  251
            DV +  ++F  FD NGDGKIS++ELG  L +LG + T EE+Q+M+ E+D DGDGF+ FDE
Sbjct  40   DVHELRQVFNKFDANGDGKISASELGSILTSLGHAATEEELQKMVREIDADGDGFVDFDE  99

Query  250  YL  245
            ++
Sbjct  100  FV  101



>ref|XP_004231987.1| PREDICTED: calcium-binding protein CML24 [Solanum lycopersicum]
Length=156

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAF  239
            +K+F+ FD NGDGKIS +ELG  L  LGS T+ +EV R+M E+DTDGDGFI   E+ AF
Sbjct  22   EKVFRKFDANGDGKISLSELGAILNALGSKTSPDEVNRIMLEVDTDGDGFIDLKEFAAF  80



>ref|XP_011072994.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=166

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFD  254
            +D+A+  K+F  FDTN DGKIS  ELG  L+ LGS ++ +EV RMM E+DTD DG I+  
Sbjct  16   EDMAEVQKVFDRFDTNNDGKISPGELGGVLKALGSESSPDEVARMMGEIDTDKDGNINLQ  75

Query  253  EYLAFARA  230
            E+ AF  A
Sbjct  76   EFAAFCSA  83


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 47/83 (57%), Gaps = 4/83 (5%)
 Frame = -3

Query  463  STMAEAEADDPQDVADRD--KIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMD  293
            +    AEAD P   A+++  + F+ +D N DGKIS+ EL   L  LG   + E+   M+ 
Sbjct  78   AAFCSAEAD-PYHSAEKELREAFELYDQNHDGKISAAELQKTLLRLGEHCSIEDCAGMIK  136

Query  292  ELDTDGDGFISFDEYLAFARANR  224
             +D +GDG++SF+E+      N+
Sbjct  137  PIDANGDGYVSFEEFKKMMTNNK  159



>ref|XP_009356047.1| PREDICTED: probable calcium-binding protein CML27 [Pyrus x bretschneideri]
Length=168

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            K+FK FD+NGDGKIS  ELG+ L  LGS V+ +E++R M +LDTD DGFI  DE+ AF  
Sbjct  22   KVFKSFDSNGDGKISVNELGNVLTALGSTVSDDELKRFMVDLDTDNDGFICLDEFNAFWV  81

Query  232  A  230
            A
Sbjct  82   A  82



>ref|XP_008381742.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
 ref|XP_008348739.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=202

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEY  248
            +A+ D++FK FD NGDGKISS+ELG  + +LG  ++ EE+  M+ E+D+DGDGFI+F E+
Sbjct  54   IAELDQVFKKFDVNGDGKISSSELGAIMSSLGQPSSDEELNSMISEVDSDGDGFINFKEF  113

Query  247  L  245
            +
Sbjct  114  V  114


 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -3

Query  403  FKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            F  +D +G+G IS+ EL + LR+LG   + +E ++M+  +D+DGDG ISF+E+
Sbjct  134  FSVYDIDGNGSISAEELYEVLRSLGDECSIDECRQMIGGVDSDGDGMISFEEF  186



>gb|ABK22364.1| unknown [Picea sitchensis]
Length=140

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = -3

Query  406  IFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYL  245
            +FK FD NGDGKISS+ELGD LR++G  V   E+  MM E D DGDGFIS +E++
Sbjct  55   VFKRFDANGDGKISSSELGDILRSMGCRVGPRELGLMMKEADADGDGFISLEEFI  109



>ref|XP_006416628.1| hypothetical protein EUTSA_v10008945mg [Eutrema salsugineum]
 ref|XP_006416629.1| hypothetical protein EUTSA_v10008945mg [Eutrema salsugineum]
 gb|ESQ34981.1| hypothetical protein EUTSA_v10008945mg [Eutrema salsugineum]
 gb|ESQ34982.1| hypothetical protein EUTSA_v10008945mg [Eutrema salsugineum]
Length=166

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = -3

Query  466  KSTMAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDE  290
            KST A  +  +P+++    K+F  FD+NGDGKIS  ELG   + +G+  TE E+ R++++
Sbjct  6    KSTPASVDMANPEELK---KVFDQFDSNGDGKISVAELGGVFKAMGTSYTETELNRVLED  62

Query  289  LDTDGDGFISFDEYLAFARAN  227
            +DTD DGFI+ DE+ A  R++
Sbjct  63   VDTDRDGFINVDEFSALCRSS  83



>ref|XP_008800225.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=189

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYL  245
            +++FK FD NGDGKISS EL    ++LG   T EE+QRMM E D DGDGFIS DE++
Sbjct  44   ERVFKKFDLNGDGKISSAELAAIFQSLGHPPTEEELQRMMGEADADGDGFISLDEFV  100



>ref|XP_004145834.1| PREDICTED: probable calcium-binding protein CML23-like [Cucumis 
sativus]
 ref|XP_004160107.1| PREDICTED: probable calcium-binding protein CML23-like [Cucumis 
sativus]
 gb|KGN57816.1| hypothetical protein Csa_3G319280 [Cucumis sativus]
Length=156

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTL-GSVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            ++F  FD NGDGKIS TEL  AL  L G+++T+E+ R+M E+D DGDGFI  DE+  F  
Sbjct  25   RVFNKFDKNGDGKISVTELAAALGELSGNISTDEIHRIMSEIDKDGDGFIDLDEFTDFTS  84

Query  232  ANRGLMRDV  206
            ++ G  +D+
Sbjct  85   SSTGGNKDL  93



>emb|CDY16916.1| BnaC09g40430D [Brassica napus]
Length=82

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  394  FDTNGDGKISSTELGDALRTLGSVTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            FD N DGKIS+ EL +AL+ LGSVT ++V RMM E+DTDGDG IS+ E++ F
Sbjct  15   FDANADGKISAAELEEALKKLGSVTHDDVNRMMTEIDTDGDGNISYQEFIDF  66



>ref|XP_008457051.1| PREDICTED: probable calcium-binding protein CML27 [Cucumis melo]
Length=157

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTL-GSVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            ++F  FD NGDGKIS +ELG AL  L G+++T E+ R+M E+D DGDGFI  DE+  F  
Sbjct  26   RVFNKFDKNGDGKISVSELGAALGELSGNISTGEIHRIMSEIDKDGDGFIDLDEFTDFTS  85

Query  232  ANRGLMRDV  206
            ++ G  +D+
Sbjct  86   SSTGGNKDL  94



>ref|XP_002274476.1| PREDICTED: probable calcium-binding protein CML23 [Vitis vinifera]
 emb|CAN68471.1| hypothetical protein VITISV_028194 [Vitis vinifera]
Length=150

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = -3

Query  457  MAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDT  281
            MA+        + + +++F  FD NGDGKIS+ E G+ L+ LGS T+ +E+ R+M E+DT
Sbjct  1    MAKNSCGSLGTMEEVERVFNRFDKNGDGKISAEEFGEVLQALGSTTSPDELTRIMSEIDT  60

Query  280  DGDGFISFDEYLAFARA  230
            DGDGFI   E+  F RA
Sbjct  61   DGDGFIDLKEFADFHRA  77



>ref|XP_009360088.1| PREDICTED: probable calcium-binding protein CML27 [Pyrus x bretschneideri]
Length=139

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            K+FK+FD NGDGKIS  ELG+ L+ LGS V+ ++++R+M +LDTD DGFI  DE+ +F
Sbjct  22   KVFKNFDANGDGKISVNELGNDLKALGSNVSGDKLKRVMVDLDTDNDGFICLDEFNSF  79



>ref|XP_009414956.1| PREDICTED: probable calcium-binding protein CML15 [Musa acuminata 
subsp. malaccensis]
Length=180

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -3

Query  472  KNKSTMAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS--VTTEEVQRM  299
            ++K   + A      D  + +++F  FD+NGDGKISS EL D L +LG    + EE+ RM
Sbjct  12   RSKPQPSHAAIPSAADPGNLERVFNKFDSNGDGKISSAELADVLESLGGQRPSEEELGRM  71

Query  298  MDELDTDGDGFISFDEYL  245
            M E D DGDGFIS  E++
Sbjct  72   MREADADGDGFISLAEFV  89



>ref|XP_004150619.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
Length=164

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = -3

Query  433  PQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISF  257
            P  +A+ +++F  FD NGDGKI S+ELG  + +LG   T EE+Q M+ E+D DGDG+I  
Sbjct  14   PCQIAELEQVFNKFDVNGDGKICSSELGSIMGSLGQPATEEELQNMIKEVDADGDGYIDL  73

Query  256  DEYL  245
            DE++
Sbjct  74   DEFI  77



>ref|XP_004235822.1| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum lycopersicum]
Length=164

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFD  254
            Q++ +  K+F+ FDTNGDG IS  EL   +  LGS T+ EEV RMM+E+D+D DGFIS  
Sbjct  20   QNMDEVQKVFQRFDTNGDGMISGEELSGVISALGSGTSPEEVSRMMNEIDSDRDGFISLQ  79

Query  253  EYLAFARA  230
            E+  F + 
Sbjct  80   EFAEFCKG  87



>ref|XP_001779716.1| predicted protein [Physcomitrella patens]
 gb|EDQ55512.1| predicted protein [Physcomitrella patens]
Length=140

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 45/63 (71%), Gaps = 4/63 (6%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            ++FK+FD NGDGKIS+TELG  LR LG S T EE+  M+ E+D D DGFI  DE   FA+
Sbjct  5    EVFKYFDKNGDGKISATELGQVLRVLGISSTDEELAAMVREVDCDSDGFIDLDE---FAK  61

Query  232  ANR  224
             N+
Sbjct  62   LNK  64



>ref|XP_004233476.1| PREDICTED: probable calcium-binding protein CML18 [Solanum lycopersicum]
Length=145

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -3

Query  412  DKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAF  239
            +K+F+ +DTNGDGKIS +EL   L  LG+ TT +E +RMM E+DTDGDGFI  +E+ AF
Sbjct  12   EKVFRKYDTNGDGKISLSELDGVLNALGTKTTPDEAKRMMLEVDTDGDGFIDLEEFAAF  70



>gb|ABK26031.1| unknown [Picea sitchensis]
Length=194

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = -3

Query  406  IFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYL  245
            +FK FD NGDGKISS+ELGD LR++G  V   E+  MM E D DGDGFIS +E++
Sbjct  55   VFKRFDANGDGKISSSELGDILRSMGCRVGPRELGLMMKEADADGDGFISLEEFI  109



>gb|ABK26821.1| unknown [Picea sitchensis]
Length=194

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = -3

Query  406  IFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYL  245
            +FK FD NGDGKISS+ELGD LR++G  V   E+  MM E D DGDGFIS +E++
Sbjct  55   VFKRFDANGDGKISSSELGDILRSMGCRVGPRELGLMMKEADADGDGFISLEEFI  109



>sp|Q9M7R0.1|ALL8_OLEEU RecName: Full=Calcium-binding allergen Ole e 8; AltName: Full=PCA18/PCA23; 
AltName: Allergen=Ole e 8 [Olea europaea]
 gb|AAF31151.1|AF078679_1 calcium-binding protein [Olea europaea]
Length=171

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFD  254
            Q+  +   +F  FD NGDGKIS  EL   L+ LGS T+ EE+ R+M+E+DTD DGFI+  
Sbjct  16   QEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQ  75

Query  253  EYLAFARA  230
            E+ AF +A
Sbjct  76   EFAAFVKA  83



>ref|XP_008787648.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=187

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -3

Query  406  IFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYL  245
            +FK FD+NGDG+ISS EL    ++LG   + EE++RMM E DTDGDGFIS+DE++
Sbjct  44   VFKKFDSNGDGRISSPELAAIFQSLGHPASDEELERMMGEADTDGDGFISYDEFV  98


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 1/65 (2%)
 Frame = -3

Query  439  DDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFI  263
            DD   + D    F  FD + +G IS+ EL   LR++G   +  + +RM+D +D DGDG I
Sbjct  106  DDSTALEDLRHAFSVFDLDRNGAISADELASVLRSIGEGASVAQCKRMIDGVDRDGDGVI  165

Query  262  SFDEY  248
            SF+E+
Sbjct  166  SFEEF  170



>ref|XP_008389977.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=269

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEY  248
            +A+ D++FK FD NGDGKISS+ELG  + +LG   + EE+  M+ E+D+DGDGFI+F E+
Sbjct  121  IAELDQVFKKFDVNGDGKISSSELGAIMSSLGQPASDEELNGMISEVDSDGDGFINFKEF  180

Query  247  L  245
            +
Sbjct  181  V  181



>sp|Q0DJV6.1|CML18_ORYSJ RecName: Full=Probable calcium-binding protein CML18; AltName: 
Full=Calmodulin-like protein 18 [Oryza sativa Japonica Group]
 dbj|BAG92613.1| unnamed protein product [Oryza sativa Japonica Group]
Length=158

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEY  248
            +A+ +++F+ +D NGDGKIS+ EL   LR LG+ +   EV+RMMDE+D+D DGF+   E+
Sbjct  3    MAELEQVFRRYDANGDGKISAEELASVLRALGAPLGPGEVRRMMDEMDSDRDGFVDLSEF  62

Query  247  LAF  239
             AF
Sbjct  63   AAF  65


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            A+  + F+ +D + +GKIS+ EL   LR LG   +  +  RM+  +D DGDG ++FDE+
Sbjct  89   AELREAFRMYDADSNGKISARELHRVLRQLGDKCSVADCSRMIRSVDADGDGCVNFDEF  147



>gb|AAV59327.1| unknown protein [Oryza sativa Japonica Group]
Length=156

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEY  248
            +A+ +++F+ +D NGDGKIS+ EL   LR LG+ +   EV+RMMDE+D+D DGF+   E+
Sbjct  1    MAELEQVFRRYDANGDGKISAEELASVLRALGAPLGPGEVRRMMDEMDSDRDGFVDLSEF  60

Query  247  LAF  239
             AF
Sbjct  61   AAF  63


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            A+  + F+ +D + +GKIS+ EL   LR LG   +  +  RM+  +D DGDG ++FDE+
Sbjct  87   AELREAFRMYDADSNGKISARELHRVLRQLGDKCSVADCSRMIRSVDADGDGCVNFDEF  145



>ref|XP_007204139.1| hypothetical protein PRUPE_ppa022519mg, partial [Prunus persica]
 gb|EMJ05338.1| hypothetical protein PRUPE_ppa022519mg, partial [Prunus persica]
Length=144

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            ++FK FD NGDGKIS +ELG+ L+ LG SV+ +E+QR+M +LDTD D F   DE+ AF
Sbjct  29   RVFKSFDANGDGKISVSELGNMLKALGSSVSADELQRVMGDLDTDRDDFTCLDEFNAF  86



>ref|XP_006451632.1| hypothetical protein CICLE_v10009740mg [Citrus clementina]
 ref|XP_006490767.1| PREDICTED: probable calcium-binding protein CML27-like [Citrus 
sinensis]
 gb|ESR64872.1| hypothetical protein CICLE_v10009740mg [Citrus clementina]
 gb|KDO63811.1| hypothetical protein CISIN_1g031226mg [Citrus sinensis]
Length=163

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = -3

Query  451  EAEADDPQDVADRD---KIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELD  284
            EA+++  Q +  R+   KIF  FD N DGKIS TEL   L+++G S   EE+ R+M++LD
Sbjct  6    EADSNRKQLIVSREEMQKIFNQFDANKDGKISLTELATVLKSMGSSYKEEELVRVMEDLD  65

Query  283  TDGDGFISFDEYLAFARANRG  221
            TD DGFIS  E+    R + G
Sbjct  66   TDKDGFISLSEFETICRTSSG  86



>ref|XP_010916442.1| PREDICTED: probable calcium-binding protein CML18 [Elaeis guineensis]
Length=177

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -3

Query  418  DRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYLA  242
            D +++F  +D NGDGKIS++EL + +R L S V+ EE++ MM ELDTDGDGF+   E+ A
Sbjct  18   DVERVFMRYDANGDGKISASELAEVMRALRSEVSDEELKAMMAELDTDGDGFVDLKEFAA  77

Query  241  F  239
            F
Sbjct  78   F  78



>ref|XP_010459434.1| PREDICTED: probable calcium-binding protein CML27 [Camelina sativa]
Length=169

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 4/80 (5%)
 Frame = -3

Query  466  KSTMAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDE  290
            K T A  +  +P+++    K+F  FD+NGDGKIS  ELG   + +G+  TE E+ R+++E
Sbjct  10   KPTPASVDMANPEELK---KVFDQFDSNGDGKISVLELGGVFKAMGTSYTETELNRVLEE  66

Query  289  LDTDGDGFISFDEYLAFARA  230
            +DTD DGFI+ DE+    R+
Sbjct  67   VDTDRDGFINLDEFSTLCRS  86



>gb|KHM99973.1| Putative calcium-binding protein CML25 [Glycine soja]
Length=152

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -3

Query  418  DRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYL  245
            D + +FK FD NGDGKISS+ELG  +++LG   T EEV+RM+ E+D +GDG I+  E+L
Sbjct  8    DLEYVFKKFDANGDGKISSSELGSIMKSLGQPATEEEVKRMIQEVDANGDGHINLGEFL  66



>gb|EEE62792.1| hypothetical protein OsJ_17595 [Oryza sativa Japonica Group]
Length=189

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYL  245
            A+ +++F+ +D NGDGKIS+ EL   LR LG+ +   EV+RMMDE+D+D DGF+   E+ 
Sbjct  35   AELEQVFRRYDANGDGKISAEELASVLRALGAPLGPGEVRRMMDEMDSDRDGFVDLSEFA  94

Query  244  AF  239
            AF
Sbjct  95   AF  96


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            A+  + F+ +D + +GKIS+ EL   LR LG   +  +  RM+  +D DGDG ++FDE+
Sbjct  120  AELREAFRMYDADSNGKISARELHRVLRQLGDKCSVADCSRMIRSVDADGDGCVNFDEF  178



>ref|XP_008221464.1| PREDICTED: probable calcium-binding protein CML25 [Prunus mume]
Length=186

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            +A+ D++FK FD NGDGKISS+ELG  + +LG     EE+  M+ E+D+DGDGFI F E+
Sbjct  38   IAELDQVFKKFDVNGDGKISSSELGAIMSSLGQPANEEELSHMILEVDSDGDGFIDFKEF  97

Query  247  L  245
            +
Sbjct  98   V  98



>ref|XP_007223528.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
 gb|EMJ24727.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
Length=186

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEY  248
            +A+ D++FK FD NGDGKISS+ELG  + +LG     EE+  M+ E+D+DGDGFI F E+
Sbjct  38   IAELDQVFKKFDVNGDGKISSSELGAIMSSLGQPANEEELSHMILEVDSDGDGFIDFKEF  97

Query  247  L  245
            +
Sbjct  98   V  98


 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = -3

Query  403  FKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            F  +D +G+G IS+ EL   LR+LG   +  E ++M+  +D+DGDG I+F+E+
Sbjct  118  FSVYDIDGNGSISAEELYKVLRSLGDECSIAECKKMISAVDSDGDGMINFEEF  170



>gb|EAY97018.1| hypothetical protein OsI_18939 [Oryza sativa Indica Group]
Length=189

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDELDTDGDGFISFDEYL  245
            A+ +++F+ +D NGDGKIS+ EL   LR LG+     EV+RMMDE+D+D DGF+   E+ 
Sbjct  35   AELEQVFRRYDANGDGKISAEELASVLRALGAPPGPGEVRRMMDEMDSDRDGFVDLSEFA  94

Query  244  AF  239
            AF
Sbjct  95   AF  96


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            A+  + F+ +D + +GKIS+ EL   LR LG   +  +  RM+  +D DGDG ++FDE+
Sbjct  120  AELREAFRMYDADSNGKISARELHRVLRQLGDKCSVADCSRMIRSVDADGDGCVNFDEF  178



>ref|XP_004960644.1| PREDICTED: probable calcium-binding protein CML18-like [Setaria 
italica]
Length=179

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDELDTDGDGFISFDEY  248
             A+ +++F+ +D NGDGKIS+ EL   LR LG+     EV+RMMDE+D D DGF+   E+
Sbjct  29   AAEVEQVFRRYDANGDGKISAEELASVLRALGAPPGPGEVRRMMDEMDADRDGFVDLAEF  88

Query  247  LAF  239
            +AF
Sbjct  89   VAF  91



>ref|XP_008464718.1| PREDICTED: probable calcium-binding protein CML25 [Cucumis melo]
Length=185

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            +A+ +++FK FD NGDGKISS ELG  + +LG + T EE+ +M++E D DGDGFI+  E+
Sbjct  40   IAELEEVFKKFDVNGDGKISSAELGSIMTSLGHNATEEELGKMIEEFDADGDGFINLHEF  99

Query  247  L  245
            +
Sbjct  100  V  100



>ref|XP_008809157.1| PREDICTED: probable calcium-binding protein CML18 [Phoenix dactylifera]
Length=174

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -3

Query  436  DPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFIS  260
            +P  + D +++F  +D NGDGKIS++EL + +R LG   + EE++ MM ELD+DGDGF+ 
Sbjct  12   EPASMNDVERVFARYDANGDGKISASELANGMRALGFEGSDEELKAMMAELDSDGDGFVD  71

Query  259  FDEYLAF  239
             +++ AF
Sbjct  72   LNDFAAF  78



>gb|AFK37714.1| unknown [Medicago truncatula]
 gb|KEH34669.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=138

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEY  248
            KIF  FD NGDGKIS TEL + +  LGS  TTEEV RMM+ELD +GDG+I   E+
Sbjct  8    KIFNKFDKNGDGKISRTELKEMMTALGSKTTTEEVTRMMEELDRNGDGYIDLKEF  62



>ref|NP_001045400.1| Os01g0949500 [Oryza sativa Japonica Group]
 sp|Q8RZB5.1|CML10_ORYSJ RecName: Full=Probable calcium-binding protein CML10; AltName: 
Full=Calmodulin-like protein 10 [Oryza sativa Japonica Group]
 dbj|BAB86193.1| putative pollen allergen Jun o 4 [Oryza sativa Japonica Group]
 dbj|BAF07314.1| Os01g0949500 [Oryza sativa Japonica Group]
 dbj|BAG96408.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96462.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92083.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72159.1| hypothetical protein OsI_05196 [Oryza sativa Indica Group]
 gb|EEE56004.1| hypothetical protein OsJ_04761 [Oryza sativa Japonica Group]
Length=185

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = -3

Query  433  PQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISF  257
            P    + +++F+ FD NGDG+IS +ELG    +LG   T +E+ RMM E D DGDGFIS 
Sbjct  35   PTPEEEMERVFRKFDANGDGRISRSELGALFESLGHAATDDELARMMAEADADGDGFISL  94

Query  256  DEYLAF  239
            DE+ A 
Sbjct  95   DEFAAL  100


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = -3

Query  403  FKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            F+ FD +G+G IS+ EL   L  LG   T ++ +RM++ +D +GDG ISF+E+
Sbjct  119  FRVFDADGNGTISAAELARVLHGLGEKATVQQCRRMIEGVDQNGDGLISFEEF  171



>ref|XP_006891943.1| PREDICTED: calmodulin-like protein 5 [Elephantulus edwardii]
Length=149

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = -3

Query  448  AEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGD  272
            AE   P+ + +    F  FDT+GDGKI+  ELG  +++LG  V+ EE++ +M  +DTDGD
Sbjct  2    AENLSPEQMEEYKAAFTQFDTDGDGKINLQELGQVMKSLGKEVSEEELKMIMKMVDTDGD  61

Query  271  GFISFDEYL-AFARANRG  221
            G ISF E+L A ++A +G
Sbjct  62   GSISFQEFLAALSKARKG  79



>ref|XP_010109033.1| putative calcium-binding protein CML23 [Morus notabilis]
 gb|EXC20673.1| putative calcium-binding protein CML23 [Morus notabilis]
Length=151

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAF  239
            KIF  FD N DGKIS +EL D L  LGS T+ +EV+R+M E+D DGDG+I FDE++ F
Sbjct  14   KIFNKFDKNRDGKISRSELRDVLGALGSKTSDDEVKRVMAEIDADGDGYIDFDEFVKF  71



>ref|XP_006654163.1| PREDICTED: probable calcium-binding protein CML18-like [Oryza 
brachyantha]
Length=154

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDELDTDGDGFISFDEY  248
            +A+ +++F+ +D NGDGKIS+ EL   LR LG+     EV+RMMDE+D+D DGF+   E+
Sbjct  3    MAELEQVFRRYDANGDGKISAEELASVLRALGAPPGPGEVRRMMDEMDSDRDGFVDLTEF  62

Query  247  LAF  239
             AF
Sbjct  63   TAF  65


 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -3

Query  421  ADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            A+  + F+ +D + +GKIS+ EL   LR LG   +  +  RM+  +D DGDG ++FDE+
Sbjct  84   AELREAFRMYDADSNGKISARELHRVLRQLGDKCSVADCSRMIRSVDADGDGCVNFDEF  142



>ref|XP_003545326.2| PREDICTED: probable calcium-binding protein CML27-like [Glycine 
max]
Length=164

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFD  254
            Q++ + + IF  FDTNG+GKIS+ EL   LR+LGS V+ E+++ +M++LDTD D FI+  
Sbjct  19   QNMNELETIFNRFDTNGNGKISADELDSVLRSLGSDVSPEDLRHVMEDLDTDRDDFINLM  78

Query  253  EYLAFARANRGL  218
            E++AF R++  +
Sbjct  79   EFVAFCRSDASI  90



>ref|XP_002314786.2| hypothetical protein POPTR_0010s11740g [Populus trichocarpa]
 gb|EEF00957.2| hypothetical protein POPTR_0010s11740g [Populus trichocarpa]
Length=197

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 2/66 (3%)
 Frame = -3

Query  433  PQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDELDTDGDGFISF  257
            PQ V + +++FK FD NGDGKISS ELG  +  LG   TE E+Q M+ E D DGDGFI  
Sbjct  42   PQ-VEELEQVFKKFDVNGDGKISSAELGSIMANLGHEATEDELQTMITEFDADGDGFIDL  100

Query  256  DEYLAF  239
             E++A 
Sbjct  101  QEFVAL  106



>gb|KEH26932.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=174

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  427  DVADRDKIFKHFDTNGDGKISSTELGDALRTLGS--VTTEEVQRMMDELDTDGDGFISFD  254
            D+ +  K+F +FD NGDGKIS  EL   LRTL S     EE++R+M+EL TD DGFI+  
Sbjct  23   DMDELKKVFNNFDANGDGKISVNELETVLRTLRSDVPQQEELRRVMEELSTDRDGFINLS  82

Query  253  EYLAFARA  230
            E+ AF R+
Sbjct  83   EFAAFCRS  90



>ref|XP_003544994.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine 
max]
Length=141

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAFAR  233
            +IF  FD NGDGKIS  EL D L  LGS TT EE++RM++ELD +GDGFI   E+  F  
Sbjct  7    QIFNKFDKNGDGKISMAELKDMLSALGSKTTDEELKRMIEELDQNGDGFIDLKEFADF-H  65

Query  232  ANRGLMRDVAK  200
             N G  +D +K
Sbjct  66   CNGGAGKDDSK  76



>ref|XP_002887495.1| hypothetical protein ARALYDRAFT_476499 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63754.1| hypothetical protein ARALYDRAFT_476499 [Arabidopsis lyrata subsp. 
lyrata]
Length=163

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEYLAFAR  233
            K+F  FD+NGDGKIS +ELG+  +++G S T EE+ R++DE+D D DGFI+ +E+    R
Sbjct  23   KVFDQFDSNGDGKISVSELGNVFKSMGTSYTEEELNRVLDEIDIDRDGFINQEEFATICR  82

Query  232  A  230
            +
Sbjct  83   S  83



>gb|KHN22489.1| Calcium-binding allergen Ole e 8, partial [Glycine soja]
Length=149

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFD  254
            +D+ + + IF  FDTNG+GKIS+ EL   LR+LGS V+ E+++ +M++LDTD D FI+  
Sbjct  15   EDMNELETIFNRFDTNGNGKISADELDSVLRSLGSDVSPEDLRHVMEDLDTDRDDFINLM  74

Query  253  EYLAFARANRGL  218
            E++AF R++  +
Sbjct  75   EFVAFCRSDASI  86



>ref|XP_007163392.1| hypothetical protein PHAVU_001G231000g [Phaseolus vulgaris]
 gb|ESW35386.1| hypothetical protein PHAVU_001G231000g [Phaseolus vulgaris]
Length=139

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            KIF  FD NGDGKIS +EL + +  LGS  TTEEV+RMM ELD +GDG+I   E+  F
Sbjct  7    KIFNKFDKNGDGKISCSELRELMAALGSKTTTEEVRRMMAELDRNGDGYIDLKEFGEF  64



>ref|XP_007141898.1| hypothetical protein PHAVU_008G235100g [Phaseolus vulgaris]
 gb|ESW13892.1| hypothetical protein PHAVU_008G235100g [Phaseolus vulgaris]
Length=140

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFDEYLAF  239
            +IF  FD NGDGKIS TEL D L TLGS TT EE++R+M+ELD +GDG+I   E+  F
Sbjct  7    QIFNKFDKNGDGKISITELRDMLGTLGSKTTKEELKRIMEELDQNGDGYIDLKEFADF  64



>ref|XP_006574101.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=195

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -3

Query  418  DRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYL  245
            D + +FK FD NGDGKISS+ELG  +++LG   T EEV+RM+ E+D +GDG I+  E+L
Sbjct  51   DLEYVFKKFDANGDGKISSSELGSIMKSLGQPATEEEVKRMIQEVDANGDGHINLGEFL  109



>ref|XP_010551871.1| PREDICTED: calcium-binding protein CML24-like [Tarenaya hassleriana]
Length=167

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            +A+  ++F+ FD NGDGKIS  EL D +R L  S T EE  RMM ELD DG+GFI  DE+
Sbjct  16   MAEIREVFQRFDKNGDGKISGDELKDVIRALSPSATPEEAARMMKELDRDGNGFIDMDEF  75

Query  247  LA  242
            +A
Sbjct  76   VA  77



>ref|NP_173259.1| putative calcium-binding protein CML27 [Arabidopsis thaliana]
 ref|NP_849686.1| putative calcium-binding protein CML27 [Arabidopsis thaliana]
 sp|Q9LE22.1|CML27_ARATH RecName: Full=Probable calcium-binding protein CML27; AltName: 
Full=Calmodulin-like protein 27 [Arabidopsis thaliana]
 gb|AAF78384.1|AC069551_17 T10O22.19 [Arabidopsis thaliana]
 gb|AAF97837.1|AC034107_20 Strong similarity to calcium-binding protein (PCA23) from Olea 
europaea gb|AF078680 and contains multiple EF-hand PF|00036 
domains. ESTs gb|T21585, gb|T21589, gb|T41586, gb|Z37721, 
gb|Z29218, gb|AI100607, gb|AI997012, gb|AV540453, gb|AV544989, 
gb|AV544493, gb|AV554674 come from this gene [Arabidopsis 
thaliana]
 gb|AAK76479.1| putative calcium-binding protein [Arabidopsis thaliana]
 gb|AAL85125.1| putative calcium-binding protein [Arabidopsis thaliana]
 dbj|BAF01230.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29687.1| putative calcium-binding protein CML27 [Arabidopsis thaliana]
 gb|AEE29688.1| putative calcium-binding protein CML27 [Arabidopsis thaliana]
Length=170

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 53/81 (65%), Gaps = 4/81 (5%)
 Frame = -3

Query  466  KSTMAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDE  290
            K T A  +  +P+++    K+F  FD+NGDGKIS  ELG   + +G+  TE E+ R+++E
Sbjct  10   KPTPATVDMANPEELK---KVFDQFDSNGDGKISVLELGGVFKAMGTSYTETELNRVLEE  66

Query  289  LDTDGDGFISFDEYLAFARAN  227
            +DTD DG+I+ DE+    R++
Sbjct  67   VDTDRDGYINLDEFSTLCRSS  87



>ref|XP_006341535.1| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum tuberosum]
Length=164

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFD  254
            Q++ +  K+F+ FDTNGDG IS  EL   +  LGS T+ +EV RMMDE+D D DGFIS  
Sbjct  20   QNMDEVQKVFQRFDTNGDGMISGDELSGVISALGSGTSPDEVARMMDEIDADRDGFISLK  79

Query  253  EYLAFARA  230
            E+  F + 
Sbjct  80   EFAEFCKG  87



>emb|CDX83860.1| BnaC08g17850D [Brassica napus]
Length=177

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = -3

Query  466  KSTMAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDE  290
            K+T A  +  +P+++    K+F  FD+NGDGKIS  ELG   + +G+  TE E+ R +++
Sbjct  10   KATPASVDIANPEELK---KVFDQFDSNGDGKISVGELGGVFKAMGTSYTESELNRALED  66

Query  289  LDTDGDGFISFDEYLAFARAN  227
            +DTD DGFI+ DE+ A  R++
Sbjct  67   VDTDRDGFINVDEFSALCRSS  87



>gb|KFK43984.1| hypothetical protein AALP_AA1G199600 [Arabis alpina]
Length=170

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 52/80 (65%), Gaps = 4/80 (5%)
 Frame = -3

Query  466  KSTMAEAEADDPQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDE  290
            KST A  +  +P ++    K+F  FD+NGDGKIS  ELG   + +G+  TE E+ R+++E
Sbjct  6    KSTPATVDMANPDELK---KVFNQFDSNGDGKISVLELGGVFKAMGTSYTETELNRVLEE  62

Query  289  LDTDGDGFISFDEYLAFARA  230
            +D+D DG+I+ DE+    R+
Sbjct  63   VDSDRDGYINLDEFSTLCRS  82



>ref|NP_177504.1| putative calcium-binding protein CML26 [Arabidopsis thaliana]
 sp|Q9C9U8.1|CML26_ARATH RecName: Full=Probable calcium-binding protein CML26; AltName: 
Full=Calmodulin-like protein 26 [Arabidopsis thaliana]
 gb|AAG52088.1|AC012679_26 putative calmodulin; 12692-13183 [Arabidopsis thaliana]
 gb|ABF58935.1| At1g73630 [Arabidopsis thaliana]
 gb|AEE35487.1| putative calcium-binding protein CML26 [Arabidopsis thaliana]
Length=163

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  433  PQDVADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISF  257
            P    +  K+F  FD NGDGKIS +ELG+  +++G S T EE+ R++DE+D D DGFI+ 
Sbjct  15   PSTDMELKKVFDKFDANGDGKISVSELGNVFKSMGTSYTEEELNRVLDEIDIDCDGFINQ  74

Query  256  DEYLAFARA  230
            +E+    R+
Sbjct  75   EEFATICRS  83



>ref|XP_006365410.1| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum tuberosum]
Length=154

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = -3

Query  430  QDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTT-EEVQRMMDELDTDGDGFISFD  254
            QD+ +  K+F  FD NGDG IS  EL   L+ LGS T+ EEV RMM E+DTD DG I+ D
Sbjct  13   QDMEEVKKVFARFDANGDGMISGDELSGVLKALGSDTSPEEVARMMAEIDTDKDGCINID  72

Query  253  EYLAFAR  233
            E+  F +
Sbjct  73   EFADFCK  79



>ref|XP_010271280.1| PREDICTED: probable calcium-binding protein CML25 [Nelumbo nucifera]
Length=205

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLG-SVTTEEVQRMMDELDTDGDGFISFDEY  248
            + + + +FK FD NGDGKIS +ELG  + +LG   T EE+Q+M++E+D+DGDGFI  +E+
Sbjct  42   IEELEHVFKRFDVNGDGKISWSELGSIMGSLGHPATEEELQKMVEEVDSDGDGFIDLNEF  101

Query  247  L  245
            +
Sbjct  102  I  102



>gb|KHN17638.1| Putative calcium-binding protein CML26, partial [Glycine soja]
Length=124

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -3

Query  427  DVADRDKIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDE  251
            D+ + + +F HFD NGD KIS+ EL + L +L S V+ E++ R+M++LDTD D FISF +
Sbjct  1    DMNELETVFNHFDANGDDKISADELDNVLWSLKSGVSPEDLHRVMEDLDTDCDSFISFTK  60

Query  250  YLAFARA  230
            + AF R+
Sbjct  61   FAAFCRS  67



>ref|XP_002970730.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
 gb|EFJ28056.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
Length=160

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -3

Query  433  PQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTEE-VQRMMDELDTDGDGFISF  257
            P+ + + +  F++FD NGDGKIS  ELG  L++LG   +EE ++ M+ E+D DGDGF+ F
Sbjct  7    PRHIQELEHAFRYFDANGDGKISVAELGGVLKSLGENPSEEDLRTMVREVDADGDGFVDF  66

Query  256  DEYL  245
            DE++
Sbjct  67   DEFV  70



>ref|XP_011021780.1| PREDICTED: probable calcium-binding protein CML25 [Populus euphratica]
Length=197

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 2/66 (3%)
 Frame = -3

Query  433  PQDVADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDELDTDGDGFISF  257
            PQ V + +++FK FD NGDGKISS ELG  + +LG   TE E++ M+ E D DGDGFI  
Sbjct  42   PQ-VQELEQVFKKFDVNGDGKISSAELGSIMASLGHEATEDELKTMITEFDADGDGFIDL  100

Query  256  DEYLAF  239
             E++A 
Sbjct  101  QEFVAL  106



>ref|XP_008393420.1| PREDICTED: probable calcium-binding protein CML27 [Malus domestica]
Length=159

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            K+FK FD +GDGKIS  ELG+ L+ LGS V+ ++++R+M +LDTD DGFI  DE+ AF
Sbjct  22   KVFKGFDASGDGKISVNELGNDLKALGSNVSGDKLKRVMVDLDTDNDGFICLDEFNAF  79



>ref|XP_010231590.1| PREDICTED: probable calcium-binding protein CML18 isoform X2 
[Brachypodium distachyon]
Length=170

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDELDTDGDGFISFDEY  248
            +A+ +++F+ +D NGDGKIS+ EL   LR LG+     EV RMM+E+D D DGF+   E+
Sbjct  24   MAELEQVFRRYDANGDGKISAEELASVLRALGAAPGPGEVARMMEEMDADRDGFVDLREF  83

Query  247  LAF  239
             AF
Sbjct  84   AAF  86



>ref|XP_008393421.1| PREDICTED: probable calcium-binding protein CML27 [Malus domestica]
Length=159

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -3

Query  409  KIFKHFDTNGDGKISSTELGDALRTLGS-VTTEEVQRMMDELDTDGDGFISFDEYLAF  239
            K+FK FD +GDGKIS  ELG+ L+ LGS V+ ++++R+M +LDTD DGFI  DE+ AF
Sbjct  22   KVFKGFDASGDGKISVNELGNDLKALGSNVSGDKLKRVMVDLDTDNDGFICLDEFNAF  79



>ref|XP_003568726.2| PREDICTED: probable calcium-binding protein CML18 isoform X1 
[Brachypodium distachyon]
Length=178

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = -3

Query  424  VADRDKIFKHFDTNGDGKISSTELGDALRTLGSVTTE-EVQRMMDELDTDGDGFISFDEY  248
            +A+ +++F+ +D NGDGKIS+ EL   LR LG+     EV RMM+E+D D DGF+   E+
Sbjct  24   MAELEQVFRRYDANGDGKISAEELASVLRALGAAPGPGEVARMMEEMDADRDGFVDLREF  83

Query  247  LAF  239
             AF
Sbjct  84   AAF  86



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906157394839