BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8433_g2_i1 len=1272 path=[2300:0-1271]

Length=1272
                                                                      Score     E

ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...    585   0.0      
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   584   0.0      
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   583   0.0      
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             580   0.0      
ref|XP_004234932.2|  PREDICTED: probable pectinesterase/pectinest...    579   0.0      
ref|XP_007038413.1|  Pectinesterase                                     577   0.0      
ref|XP_009773838.1|  PREDICTED: pectinesterase 2-like                   573   0.0      
emb|CDP20891.1|  unnamed protein product                                573   0.0      
ref|XP_002322401.1|  putative pectin methylesterase family protein      555   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   544   0.0      
ref|XP_011010931.1|  PREDICTED: pectinesterase 2-like                   543   0.0      
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   543   0.0      
gb|KDP22414.1|  hypothetical protein JCGZ_26245                         539   0.0      
ref|XP_006367816.1|  PREDICTED: probable pectinesterase/pectinest...    535   0.0      
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   536   0.0      
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   533   0.0      
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   532   0.0      
ref|XP_010101099.1|  putative pectinesterase/pectinesterase inhib...    532   0.0      
ref|XP_011029953.1|  PREDICTED: pectinesterase 2-like                   530   0.0      
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             528   0.0      
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   528   0.0      
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       528   1e-180   
ref|XP_002318285.1|  putative pectin methylesterase family protein      525   4e-180   Populus trichocarpa [western balsam poplar]
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    523   5e-180   
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   532   7e-180   
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     519   4e-177   
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   518   4e-177   
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               514   5e-177   Ricinus communis
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     512   5e-175   
ref|XP_009340592.1|  PREDICTED: pectinesterase 2-like                   503   1e-171   
ref|XP_009374493.1|  PREDICTED: pectinesterase 2-like                   502   3e-171   
ref|XP_008377824.1|  PREDICTED: pectinesterase 2-like                   500   2e-170   
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   495   3e-168   
gb|AFW03484.1|  pectin methylesterase 5                                 489   3e-166   
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   488   1e-165   
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   487   3e-165   
gb|KHG19575.1|  Uncharacterized protein F383_07269                      487   3e-165   
gb|AFW03479.1|  pectin methylesterase 5                                 486   5e-165   
gb|AER38244.1|  PME5                                                    486   8e-165   
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        487   1e-164   
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               485   1e-164   Ricinus communis
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   484   4e-164   
ref|XP_003526378.1|  PREDICTED: probable pectinesterase/pectinest...    484   8e-164   
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        481   7e-163   Vitis vinifera
gb|EYU24970.1|  hypothetical protein MIMGU_mgv1a022192mg                480   2e-162   
ref|XP_004307817.1|  PREDICTED: pectinesterase 2-like                   477   4e-162   
gb|KDP28780.1|  hypothetical protein JCGZ_14551                         477   2e-161   
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    476   6e-161   Populus trichocarpa [western balsam poplar]
ref|XP_007052106.1|  Pectinesterase 2                                   476   6e-161   
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        473   1e-159   
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   472   2e-159   
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   472   2e-159   
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   470   9e-159   
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   470   1e-158   
ref|XP_010544633.1|  PREDICTED: probable pectinesterase/pectinest...    469   3e-158   
ref|XP_002320714.1|  putative pectin methylesterase LuPME1 family...    469   3e-158   Populus trichocarpa [western balsam poplar]
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   468   5e-158   
ref|XP_010257625.1|  PREDICTED: pectinesterase 2-like                   468   7e-158   
emb|CDP08022.1|  unnamed protein product                                468   9e-158   
emb|CDP20872.1|  unnamed protein product                                468   1e-157   
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        468   1e-157   
ref|XP_011034009.1|  PREDICTED: pectinesterase 2                        465   8e-157   
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    464   2e-156   
emb|CBI24286.3|  unnamed protein product                                458   2e-155   
gb|EYU31969.1|  hypothetical protein MIMGU_mgv1a005025mg                461   4e-155   
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     458   2e-154   
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                   458   4e-154   Vitis vinifera
ref|XP_010325628.1|  PREDICTED: pectinesterase 2                        459   5e-154   
ref|XP_010056340.1|  PREDICTED: pectinesterase 2-like                   456   2e-153   
ref|NP_566038.1|  putative pectinesterase/pectinesterase inhibito...    455   7e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293950.1|  hypothetical protein CARUB_v10022941mg             456   7e-153   
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                        454   2e-152   Vitis vinifera
emb|CAN83663.1|  hypothetical protein VITISV_017689                     454   2e-152   Vitis vinifera
ref|XP_002882002.1|  predicted protein                                  454   2e-152   
emb|CAN78759.1|  hypothetical protein VITISV_000562                     454   2e-152   Vitis vinifera
ref|XP_010259196.1|  PREDICTED: pectinesterase 2-like                   453   7e-152   
ref|XP_010508199.1|  PREDICTED: probable pectinesterase/pectinest...    452   1e-151   
ref|XP_010506460.1|  PREDICTED: probable pectinesterase/pectinest...    452   1e-151   
ref|XP_006397702.1|  hypothetical protein EUTSA_v10001409mg             451   2e-151   
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        451   3e-151   Vitis vinifera
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...    451   3e-151   
ref|XP_009599511.1|  PREDICTED: pectinesterase 2-like                   451   4e-151   
ref|XP_009133718.1|  PREDICTED: probable pectinesterase/pectinest...    451   4e-151   
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   450   7e-151   
ref|XP_003521940.1|  PREDICTED: pectinesterase 2-like                   450   9e-151   
ref|XP_010672022.1|  PREDICTED: pectinesterase-like                     449   2e-150   
gb|KHN35617.1|  Pectinesterase 2                                        448   4e-150   
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   447   6e-150   
gb|KEH29125.1|  pectinesterase/pectinesterase inhibitor                 447   7e-150   
ref|XP_003521947.1|  PREDICTED: pectinesterase 2-like                   446   2e-149   
ref|XP_009143104.1|  PREDICTED: probable pectinesterase/pectinest...    446   2e-149   
ref|XP_010098938.1|  Pectinesterase 2                                   444   1e-148   
ref|XP_006347887.1|  PREDICTED: pectinesterase 2-like                   444   2e-148   
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg             443   5e-148   
gb|KFK37315.1|  hypothetical protein AALP_AA4G241100                    440   4e-147   
ref|XP_009378667.1|  PREDICTED: pectinesterase 2-like                   440   7e-147   
gb|KHN42767.1|  Pectinesterase 2                                        437   1e-146   
gb|KCW73025.1|  hypothetical protein EUGRSUZ_E01468                     439   1e-146   
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   439   1e-146   
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   438   4e-146   
ref|XP_010058471.1|  PREDICTED: pectinesterase 2-like                   439   7e-146   
gb|KHN47891.1|  Pectinesterase 2                                        437   7e-146   
gb|KEH29121.1|  pectinesterase/pectinesterase inhibitor                 437   1e-145   
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   432   3e-145   
ref|XP_010662407.1|  PREDICTED: probable pectinesterase/pectinest...    434   1e-144   
ref|XP_007134831.1|  hypothetical protein PHAVU_010G079900g             434   2e-144   
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                        433   4e-144   
emb|CDY27388.1|  BnaC04g50170D                                          433   4e-144   
ref|XP_008343201.1|  PREDICTED: pectinesterase 2                        432   5e-144   
gb|KHN47892.1|  Pectinesterase 2                                        432   5e-144   
ref|XP_003517028.1|  PREDICTED: pectinesterase 2-like                   432   7e-144   
ref|XP_004514850.1|  PREDICTED: pectinesterase 2-like                   430   4e-143   
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    429   8e-143   Citrus sinensis [apfelsine]
ref|XP_009142324.1|  PREDICTED: probable pectinesterase/pectinest...    429   8e-143   
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   428   2e-142   
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             428   2e-142   
emb|CAN76835.1|  hypothetical protein VITISV_043176                     427   3e-142   Vitis vinifera
gb|KCW73024.1|  hypothetical protein EUGRSUZ_E01466                     428   5e-142   
ref|NP_001275775.1|  pectinesterase 2 precursor                         426   1e-141   
ref|XP_006490218.1|  PREDICTED: probable pectinesterase/pectinest...    427   2e-141   
ref|XP_006421696.1|  hypothetical protein CICLE_v10004719mg             426   2e-141   
ref|XP_008234390.1|  PREDICTED: probable pectinesterase/pectinest...    426   3e-141   
ref|XP_002322399.1|  putative pectin methylesterase family protein      425   4e-141   Populus trichocarpa [western balsam poplar]
ref|XP_008438193.1|  PREDICTED: pectinesterase 2                        424   8e-141   
ref|XP_010692197.1|  PREDICTED: pectinesterase 2                        424   1e-140   
ref|XP_010058469.1|  PREDICTED: pectinesterase 2-like                   427   2e-140   
ref|XP_011010930.1|  PREDICTED: pectinesterase-like                     423   3e-140   
ref|XP_010058468.1|  PREDICTED: pectinesterase 2-like                   429   4e-140   
gb|KDP22413.1|  hypothetical protein JCGZ_26244                         423   5e-140   
ref|XP_004306939.1|  PREDICTED: probable pectinesterase/pectinest...    422   9e-140   
ref|XP_011010924.1|  PREDICTED: pectinesterase-like isoform X1          421   1e-139   
emb|CDO97716.1|  unnamed protein product                                419   1e-138   
ref|XP_004133929.1|  PREDICTED: pectinesterase 2-like                   419   1e-138   
ref|XP_002510939.1|  Pectinesterase-2 precursor, putative               419   2e-138   Ricinus communis
ref|XP_007038414.1|  Plant invertase/pectin methylesterase inhibi...    417   8e-138   
ref|XP_011010925.1|  PREDICTED: pectinesterase-like isoform X2          416   2e-137   
emb|CDX83392.1|  BnaA03g21140D                                          413   2e-137   
emb|CDX95641.1|  BnaC03g25220D                                          413   2e-137   
ref|XP_010035022.1|  PREDICTED: probable pectinesterase/pectinest...    415   4e-137   
emb|CDY18944.1|  BnaC04g04060D                                          410   2e-136   
ref|XP_008376203.1|  PREDICTED: probable pectinesterase/pectinest...    412   1e-135   
emb|CDX74715.1|  BnaA05g04610D                                          408   3e-135   
ref|XP_009799202.1|  PREDICTED: probable pectinesterase/pectinest...    411   3e-135   
emb|CBI24285.3|  unnamed protein product                                407   5e-135   
ref|XP_009609130.1|  PREDICTED: probable pectinesterase/pectinest...    410   7e-135   
ref|XP_004234933.2|  PREDICTED: probable pectinesterase/pectinest...    410   7e-135   
ref|XP_006367817.1|  PREDICTED: probable pectinesterase/pectinest...    408   4e-134   
ref|XP_007220716.1|  hypothetical protein PRUPE_ppa022308mg             405   1e-133   
ref|XP_010277646.1|  PREDICTED: pectinesterase 2-like                   405   3e-133   
ref|XP_011010932.1|  PREDICTED: probable pectinesterase/pectinest...    404   1e-132   
ref|XP_006401969.1|  hypothetical protein EUTSA_v10013189mg             402   2e-131   
ref|XP_009627971.1|  PREDICTED: probable pectinesterase/pectinest...    401   2e-131   
ref|XP_010062172.1|  PREDICTED: probable pectinesterase/pectinest...    400   8e-131   
ref|XP_008354203.1|  PREDICTED: probable pectinesterase/pectinest...    399   1e-130   
ref|XP_011101124.1|  PREDICTED: probable pectinesterase/pectinest...    398   2e-130   
ref|XP_009773839.1|  PREDICTED: probable pectinesterase/pectinest...    396   2e-129   
ref|XP_009107418.1|  PREDICTED: probable pectinesterase/pectinest...    396   2e-129   
ref|XP_009773841.1|  PREDICTED: probable pectinesterase/pectinest...    395   2e-129   
ref|XP_010532250.1|  PREDICTED: probable pectinesterase/pectinest...    395   3e-129   
ref|XP_006281620.1|  hypothetical protein CARUB_v10027747mg             395   3e-129   
ref|XP_010442652.1|  PREDICTED: probable pectinesterase/pectinest...    394   7e-129   
ref|XP_010550793.1|  PREDICTED: probable pectinesterase/pectinest...    394   1e-128   
ref|XP_002865863.1|  pectinesterase family protein                      394   1e-128   
ref|XP_004240801.1|  PREDICTED: probable pectinesterase/pectinest...    392   5e-128   
ref|XP_010443361.1|  PREDICTED: probable pectinesterase/pectinest...    392   6e-128   
ref|XP_006401970.1|  hypothetical protein EUTSA_v10013190mg             392   1e-127   
ref|NP_190324.1|  Probable pectinesterase/pectinesterase inhibito...    393   1e-127   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199962.1|  putative pectinesterase/pectinesterase inhibito...    390   3e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443353.1|  PREDICTED: probable pectinesterase/pectinest...    390   4e-127   
ref|XP_002875838.1|  pectinesterase family protein                      392   5e-127   
ref|XP_008343734.1|  PREDICTED: probable pectinesterase/pectinest...    385   6e-127   
ref|XP_006404388.1|  hypothetical protein EUTSA_v10010228mg             391   6e-127   
ref|XP_010482485.1|  PREDICTED: probable pectinesterase/pectinest...    389   6e-127   
ref|XP_006290793.1|  hypothetical protein CARUB_v10016896mg             391   6e-127   
ref|XP_006357927.1|  PREDICTED: probable pectinesterase/pectinest...    389   7e-127   
emb|CDY00480.1|  BnaA10g07930D                                          389   8e-127   
ref|XP_009374495.1|  PREDICTED: probable pectinesterase/pectinest...    387   1e-126   
ref|XP_009107408.1|  PREDICTED: probable pectinesterase/pectinest...    389   1e-126   
ref|XP_009149919.1|  PREDICTED: probable pectinesterase/pectinest...    391   1e-126   
ref|XP_009340595.1|  PREDICTED: probable pectinesterase/pectinest...    387   2e-126   
ref|XP_010442655.1|  PREDICTED: probable pectinesterase/pectinest...    388   2e-126   
ref|XP_011029954.1|  PREDICTED: probable pectinesterase/pectinest...    388   3e-126   
ref|XP_009402517.1|  PREDICTED: pectinesterase-like                     387   4e-126   
emb|CDX99055.1|  BnaA06g17460D                                          389   6e-126   
ref|XP_010426182.1|  PREDICTED: probable pectinesterase/pectinest...    389   8e-126   
ref|XP_010503340.1|  PREDICTED: probable pectinesterase/pectinest...    389   8e-126   
ref|XP_010443373.1|  PREDICTED: probable pectinesterase/pectinest...    387   9e-126   
gb|KFK34037.1|  hypothetical protein AALP_AA5G093700                    388   1e-125   
ref|NP_199963.1|  putative pectinesterase/pectinesterase inhibito...    386   1e-125   Arabidopsis thaliana [mouse-ear cress]
emb|CDY55029.1|  BnaC03g75510D                                          387   2e-125   
emb|CDX99914.1|  BnaC09g27910D                                          385   4e-125   
ref|XP_009150639.1|  PREDICTED: probable pectinesterase/pectinest...    386   7e-125   
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     383   2e-124   
ref|XP_009400700.1|  PREDICTED: pectinesterase-like                     382   2e-124   
ref|XP_010672014.1|  PREDICTED: probable pectinesterase/pectinest...    383   3e-124   
ref|XP_006838619.1|  hypothetical protein AMTR_s00002p00230630          382   4e-124   
emb|CDX83016.1|  BnaA01g20160D                                          383   1e-123   
ref|XP_010058445.1|  PREDICTED: pectinesterase 2-like                   377   2e-123   
gb|AES69711.2|  pectinesterase/pectinesterase inhibitor                 380   2e-123   
ref|XP_009374496.1|  PREDICTED: probable pectinesterase/pectinest...    378   3e-123   
ref|XP_003599460.1|  Pectinesterase                                     380   3e-123   
ref|XP_009107426.1|  PREDICTED: probable pectinesterase/pectinest...    380   4e-123   
ref|XP_002318284.2|  pectinesterase family protein                      379   5e-123   Populus trichocarpa [western balsam poplar]
ref|XP_003540571.1|  PREDICTED: probable pectinesterase/pectinest...    379   7e-123   
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     378   1e-122   
ref|XP_010482487.1|  PREDICTED: probable pectinesterase/pectinest...    378   1e-122   
gb|KEH22545.1|  pectinesterase/pectinesterase inhibitor                 377   3e-122   
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     376   1e-121   
ref|XP_004499656.1|  PREDICTED: probable pectinesterase/pectinest...    375   1e-121   
ref|XP_009132604.1|  PREDICTED: probable pectinesterase/pectinest...    375   2e-121   
ref|XP_003598225.1|  Pectinesterase                                     375   2e-121   
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     374   3e-121   
gb|KGN56178.1|  hypothetical protein Csa_3G088980                       374   4e-121   
ref|XP_003523880.1|  PREDICTED: probable pectinesterase/pectinest...    374   7e-121   
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     374   7e-121   
ref|XP_003598229.1|  Pectinesterase                                     374   8e-121   
ref|XP_003598230.1|  Pectinesterase                                     373   1e-120   
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     373   1e-120   
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     373   1e-120   
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     372   2e-120   
ref|XP_010930858.1|  PREDICTED: pectinesterase-like                     371   2e-120   
ref|XP_002322402.2|  putative pectin methylesterase family protein      370   3e-120   Populus trichocarpa [western balsam poplar]
ref|XP_008452338.1|  PREDICTED: probable pectinesterase/pectinest...    372   3e-120   
emb|CDP05321.1|  unnamed protein product                                369   4e-120   
ref|XP_004516727.1|  PREDICTED: probable pectinesterase/pectinest...    371   1e-119   
ref|XP_007148706.1|  hypothetical protein PHAVU_005G007800g             370   2e-119   
ref|XP_010271283.1|  PREDICTED: pectinesterase                          369   5e-119   
gb|KEH29375.1|  pectinesterase/pectinesterase inhibitor                 366   9e-118   
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               366   9e-118   Ricinus communis
ref|XP_006282103.1|  hypothetical protein CARUB_v10028350mg             365   3e-117   
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     364   4e-117   
ref|XP_003537030.1|  PREDICTED: probable pectinesterase/pectinest...    363   2e-116   
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     362   2e-116   
ref|XP_003533518.1|  PREDICTED: probable pectinesterase/pectinest...    362   2e-116   
ref|XP_010919483.1|  PREDICTED: pectinesterase 2-like                   362   2e-116   
ref|XP_007131333.1|  hypothetical protein PHAVU_011G005000g             362   4e-116   
emb|CDX99916.1|  BnaC09g27890D                                          359   1e-115   
ref|XP_004503381.1|  PREDICTED: probable pectinesterase/pectinest...    360   2e-115   
ref|XP_010933723.1|  PREDICTED: pectinesterase-like                     359   2e-115   
ref|XP_008812365.1|  PREDICTED: pectinesterase                          359   3e-115   
gb|EYU43523.1|  hypothetical protein MIMGU_mgv1a026199mg                357   6e-115   
gb|KFK26750.1|  hypothetical protein AALP_AA8G288600                    355   3e-114   
ref|XP_004160315.1|  PREDICTED: probable pectinesterase/pectinest...    354   7e-114   
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          354   2e-113   
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    353   4e-113   
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      353   5e-113   
gb|KEH21379.1|  pectinesterase/pectinesterase inhibitor                 353   7e-113   
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         352   3e-112   
gb|KHG13344.1|  Uncharacterized protein F383_18528                      350   8e-112   
ref|XP_008781656.1|  PREDICTED: pectinesterase-like                     348   9e-112   
ref|XP_009409661.1|  PREDICTED: pectinesterase-like                     350   1e-111   
ref|XP_011076834.1|  PREDICTED: probable pectinesterase/pectinest...    349   2e-111   
ref|XP_006580437.1|  PREDICTED: probable pectinesterase/pectinest...    348   6e-111   
ref|XP_008389982.1|  PREDICTED: pectinesterase                          348   6e-111   
ref|XP_002314796.1|  pectin methylesterase 6 family protein             348   9e-111   Populus trichocarpa [western balsam poplar]
emb|CDY38867.1|  BnaA03g13120D                                          345   9e-111   
ref|XP_011038599.1|  PREDICTED: pectinesterase-like                     348   1e-110   
ref|XP_010684811.1|  PREDICTED: pectinesterase-like                     347   1e-110   
ref|XP_010044212.1|  PREDICTED: pectinesterase                          348   1e-110   
emb|CDY64024.1|  BnaCnng43010D                                          345   2e-110   
ref|XP_010654104.1|  PREDICTED: pectinesterase                          347   3e-110   
gb|KHN21590.1|  Putative pectinesterase/pectinesterase inhibitor 6      345   1e-109   
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     344   2e-109   
gb|EYU33116.1|  hypothetical protein MIMGU_mgv1a022674mg                342   1e-108   
ref|XP_011070723.1|  PREDICTED: LOW QUALITY PROTEIN: pectinesterase     340   4e-108   
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             340   4e-108   
ref|XP_010932734.1|  PREDICTED: pectinesterase-like                     340   7e-108   
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    340   9e-108   
ref|XP_011076510.1|  PREDICTED: pectinesterase-like                     340   1e-107   
ref|XP_007045218.1|  Plant invertase/pectin methylesterase inhibi...    339   2e-107   
ref|XP_009351519.1|  PREDICTED: pectinesterase-like                     338   6e-107   
ref|XP_008796891.1|  PREDICTED: pectinesterase-like                     335   8e-107   
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    334   1e-105   
ref|XP_004297462.1|  PREDICTED: probable pectinesterase/pectinest...    335   1e-105   
emb|CDP00815.1|  unnamed protein product                                333   7e-105   
ref|XP_009351517.1|  PREDICTED: pectinesterase-like                     333   7e-105   
ref|XP_006448208.1|  hypothetical protein CICLE_v10014888mg             330   5e-104   
ref|XP_011076333.1|  PREDICTED: probable pectinesterase/pectinest...    328   1e-103   
ref|XP_006469215.1|  PREDICTED: probable pectinesterase/pectinest...    329   1e-103   
ref|XP_002872964.1|  predicted protein                                  324   2e-102   
gb|KDO64577.1|  hypothetical protein CISIN_1g047288mg                   324   8e-102   
gb|EYU24929.1|  hypothetical protein MIMGU_mgv1a025888mg                322   3e-101   
ref|XP_008467117.1|  PREDICTED: pectinesterase                          321   3e-100   
ref|XP_004150118.1|  PREDICTED: probable pectinesterase/pectinest...    318   5e-99    
ref|XP_006289025.1|  hypothetical protein CARUB_v10002406mg             315   7e-99    
gb|KHN25547.1|  Pectinesterase 2                                        311   9e-99    
ref|XP_004167644.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    317   1e-98    
gb|EYU24971.1|  hypothetical protein MIMGU_mgv1a004327mg                316   2e-98    
gb|KHN11656.1|  Putative pectinesterase/pectinesterase inhibitor 33     312   6e-98    
ref|XP_008221458.1|  PREDICTED: pectinesterase                          313   1e-97    
gb|ABQ42392.1|  pectin methylesterase-like protein                      315   2e-97    
ref|XP_010426712.1|  PREDICTED: putative pectinesterase/pectinest...    311   3e-97    
emb|CAN77092.1|  hypothetical protein VITISV_026596                     311   5e-97    
ref|NP_191930.1|  pectin methylesterase 38                              310   5e-97    
gb|KHN35620.1|  Pectinesterase 2                                        306   6e-97    
ref|XP_009625343.1|  PREDICTED: pectinesterase-like                     311   6e-97    
emb|CDY21422.1|  BnaA09g30050D                                          312   7e-97    
ref|XP_010101979.1|  putative pectinesterase/pectinesterase inhib...    309   1e-96    
emb|CDY04739.1|  BnaC05g18500D                                          310   4e-96    
gb|KHN35618.1|  Pectinesterase 2                                        304   4e-96    
ref|XP_010552690.1|  PREDICTED: probable pectinesterase/pectinest...    308   3e-95    
ref|XP_007024771.1|  Pectin methylesterase 3 isoform 2                  303   6e-94    
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            304   1e-93    
ref|XP_010273801.1|  PREDICTED: pectinesterase                          305   1e-93    
ref|XP_010477609.1|  PREDICTED: probable pectinesterase/pectinest...    304   1e-93    
ref|XP_007134832.1|  hypothetical protein PHAVU_010G080000g             298   1e-93    
gb|ABZ89800.1|  pectin methylesterase-like protein                      305   2e-93    
ref|XP_010498826.1|  PREDICTED: probable pectinesterase/pectinest...    303   3e-93    
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             304   3e-93    
gb|KHN35616.1|  Pectinesterase 2                                        296   4e-93    
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     303   4e-93    
ref|XP_007222925.1|  hypothetical protein PRUPE_ppa005208mg             300   5e-93    
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     300   6e-93    
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     301   1e-92    
gb|AFQ23194.1|  pectin methylesterase                                   302   2e-92    
ref|XP_009115554.1|  PREDICTED: probable pectinesterase/pectinest...    301   2e-92    
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  301   3e-92    
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    301   3e-92    
ref|XP_002890570.1|  predicted protein                                  300   5e-92    
ref|XP_010460102.1|  PREDICTED: probable pectinesterase/pectinest...    300   6e-92    
ref|XP_002265171.1|  PREDICTED: pectinesterase                          301   7e-92    
gb|ABK24761.1|  unknown                                                 300   8e-92    
ref|XP_011000694.1|  PREDICTED: pectinesterase                          299   9e-92    
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    299   9e-92    
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             299   9e-92    
ref|XP_002317208.1|  pectin methylesterase family protein               298   1e-91    
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            298   2e-91    
dbj|BAJ34238.1|  unnamed protein product                                298   3e-91    
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    298   3e-91    
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     298   4e-91    
ref|XP_006416115.1|  hypothetical protein EUTSA_v10007274mg             298   4e-91    
gb|KHN16553.1|  Pectinesterase 2                                        293   4e-91    
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    298   4e-91    
ref|XP_010424032.1|  PREDICTED: putative pectinesterase/pectinest...    295   5e-91    
gb|AHB84678.1|  pectin methylesterase                                   297   6e-91    
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     297   9e-91    
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    295   1e-90    
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     296   1e-90    
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     297   1e-90    
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    296   2e-90    
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 294   2e-90    
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             295   3e-90    
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     295   3e-90    
gb|AFW03480.1|  pectin methylesterase 1                                 296   5e-90    
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   291   5e-90    
gb|AFB77929.1|  pectin methylesterase                                   295   5e-90    
emb|CBI23178.3|  unnamed protein product                                293   8e-90    
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     294   9e-90    
ref|XP_002304257.2|  pectinesterase family protein                      295   1e-89    
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 294   1e-89    
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    294   2e-89    
gb|KHG08631.1|  Pectinesterase 3                                        294   2e-89    
gb|AFW03475.1|  pectin methylesterase 1                                 294   2e-89    
ref|XP_007157169.1|  hypothetical protein PHAVU_002G048400g             293   2e-89    
ref|XP_006307093.1|  hypothetical protein CARUB_v10008680mg             294   2e-89    
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     293   2e-89    
ref|XP_004234960.1|  PREDICTED: probable pectinesterase/pectinest...    293   3e-89    
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     293   3e-89    
ref|XP_002266980.1|  PREDICTED: pectinesterase                          292   3e-89    
emb|CBI36883.3|  unnamed protein product                                292   3e-89    
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         292   4e-89    
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          293   5e-89    
ref|XP_010267633.1|  PREDICTED: probable pectinesterase/pectinest...    293   5e-89    
gb|KDP42887.1|  hypothetical protein JCGZ_23829                         293   6e-89    
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               291   1e-88    
ref|NP_173733.1|  probable pectinesterase/pectinesterase inhibitor 6    291   1e-88    
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             292   1e-88    
ref|XP_007157172.1|  hypothetical protein PHAVU_002G048700g             291   1e-88    
ref|XP_004290811.1|  PREDICTED: probable pectinesterase/pectinest...    291   1e-88    
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     291   2e-88    
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     290   2e-88    
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     290   3e-88    
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     288   4e-88    
gb|AFK44272.1|  unknown                                                 290   4e-88    
ref|XP_008228105.1|  PREDICTED: pectinesterase                          290   5e-88    
ref|XP_002522859.1|  Pectinesterase-2 precursor, putative               289   6e-88    
gb|KHG01688.1|  Uncharacterized protein F383_22979                      285   6e-88    
emb|CAA47810.1|  pectinesterase                                         288   2e-87    
ref|XP_004492227.1|  PREDICTED: pectinesterase/pectinesterase inh...    288   2e-87    
dbj|BAC67661.1|  pectin methylesterase                                  288   2e-87    
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                286   2e-87    
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     288   2e-87    
gb|KFK44409.1|  hypothetical protein AALP_AA1G253400                    285   2e-87    
gb|KDO65444.1|  hypothetical protein CISIN_1g0366962mg                  280   2e-87    
ref|XP_002518523.1|  Pectinesterase precursor, putative                 287   3e-87    
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             288   3e-87    
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     287   4e-87    
ref|XP_003630890.1|  Pectinesterase                                     286   4e-87    
ref|XP_010267745.1|  PREDICTED: pectinesterase                          287   5e-87    
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   287   5e-87    
ref|XP_008245555.1|  PREDICTED: putative pectinesterase/pectinest...    286   5e-87    
gb|AAK69696.1|AF355057_1  putative pectin methylesterase LuPME5         286   6e-87    
ref|XP_006646399.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    286   6e-87    
ref|XP_006426799.1|  hypothetical protein CICLE_v10025232mg             288   6e-87    
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     286   8e-87    
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...    287   1e-86    
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    288   1e-86    
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             286   1e-86    
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     286   1e-86    
ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     286   1e-86    
ref|NP_001275859.1|  pectinesterase 1 precursor                         286   2e-86    
gb|KEH21378.1|  pectinesterase                                          280   2e-86    
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             286   2e-86    
ref|XP_003622688.1|  Pectinesterase                                     285   2e-86    
ref|XP_010523198.1|  PREDICTED: putative pectinesterase/pectinest...    283   2e-86    
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     285   2e-86    
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     285   2e-86    
gb|AAC14742.1|  pectin methylesterase                                   285   3e-86    
gb|AGG23325.1|  pectin methylesterase 1                                 285   3e-86    
gb|AFW03481.1|  pectin methylesterase 2                                 284   3e-86    
ref|XP_006465803.1|  PREDICTED: pectinesterase 3-like                   285   5e-86    
ref|XP_008224789.1|  PREDICTED: pectinesterase                          285   5e-86    
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     285   5e-86    
ref|XP_009364480.1|  PREDICTED: pectinesterase                          284   5e-86    
ref|XP_009614734.1|  PREDICTED: probable pectinesterase/pectinest...    285   6e-86    
gb|KDP23440.1|  hypothetical protein JCGZ_23273                         283   8e-86    
ref|XP_004134752.1|  PREDICTED: pectinesterase/pectinesterase inh...    284   8e-86    
ref|XP_010273808.1|  PREDICTED: pectinesterase 3                        285   8e-86    
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...    285   9e-86    
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                     283   9e-86    
emb|CAD29733.1|  pectin methylesterase                                  284   9e-86    
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    285   9e-86    
ref|XP_004155595.1|  PREDICTED: pectinesterase/pectinesterase inh...    283   1e-85    
gb|AFK35109.1|  unknown                                                 283   1e-85    
gb|ACQ85264.1|  pectin methylesterase                                   284   1e-85    
gb|AFW03476.1|  pectin methylesterase 2                                 282   1e-85    
gb|ACJ85768.1|  unknown                                                 283   1e-85    
dbj|BAC67662.1|  pectin methylesterase                                  283   1e-85    
gb|AER38243.1|  PME2                                                    282   1e-85    
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     283   2e-85    
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    283   2e-85    
ref|XP_006382445.1|  pectinesterase family protein                      281   2e-85    
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     283   2e-85    
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         283   2e-85    
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     280   2e-85    
ref|XP_007012502.1|  Pectin methylesterase 3                            283   3e-85    
emb|CAC01624.1|  putative pectin methylesterase                         283   3e-85    
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     282   3e-85    
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     283   4e-85    
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3              282   4e-85    
ref|XP_004293266.1|  PREDICTED: pectinesterase/pectinesterase inh...    281   4e-85    
ref|XP_009391194.1|  PREDICTED: pectinesterase-like                     280   5e-85    
gb|KHN30453.1|  Pectinesterase 2.2                                      279   5e-85    
ref|XP_009397166.1|  PREDICTED: pectinesterase-like                     281   5e-85    
gb|AFB77928.1|  pectin methylesterase                                   282   5e-85    
ref|XP_009413991.1|  PREDICTED: pectinesterase-like                     282   5e-85    
ref|XP_006360163.1|  PREDICTED: probable pectinesterase/pectinest...    283   5e-85    
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1              281   7e-85    
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 281   7e-85    
ref|XP_010544635.1|  PREDICTED: probable pectinesterase/pectinest...    279   8e-85    
ref|XP_006573891.1|  PREDICTED: pectinesterase/pectinesterase inh...    281   8e-85    
ref|XP_006433467.1|  hypothetical protein CICLE_v10000816mg             280   9e-85    
gb|ABJ99595.1|  pectinesterase inhibitor                                282   9e-85    
ref|XP_008228106.1|  PREDICTED: pectinesterase 3                        282   1e-84    
gb|KDP33985.1|  hypothetical protein JCGZ_07556                         281   1e-84    
emb|CDX98441.1|  BnaC05g39340D                                          281   1e-84    
ref|XP_006852649.1|  hypothetical protein AMTR_s00021p00242180          282   1e-84    
emb|CDO99718.1|  unnamed protein product                                280   1e-84    
dbj|BAK05307.1|  predicted protein                                      280   1e-84    
ref|XP_007207382.1|  hypothetical protein PRUPE_ppa004437mg             279   2e-84    
ref|XP_002318977.1|  pectinesterase family protein                      280   2e-84    
ref|XP_004958677.1|  PREDICTED: pectinesterase 3-like                   281   2e-84    
ref|XP_011092101.1|  PREDICTED: putative pectinesterase/pectinest...    280   2e-84    
ref|XP_010261671.1|  PREDICTED: pectinesterase-like                     281   2e-84    
ref|XP_008783207.1|  PREDICTED: probable pectinesterase/pectinest...    281   2e-84    
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     280   2e-84    
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     280   3e-84    
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     280   3e-84    
ref|XP_002278061.1|  PREDICTED: probable pectinesterase/pectinest...    281   3e-84    
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   280   4e-84    
ref|XP_010925933.1|  PREDICTED: probable pectinesterase/pectinest...    280   4e-84    
ref|XP_011036906.1|  PREDICTED: putative pectinesterase/pectinest...    279   4e-84    
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         275   4e-84    
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             279   4e-84    
sp|P83947.1|PME1_FICPW  RecName: Full=Pectinesterase/pectinestera...    279   5e-84    
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    279   6e-84    
ref|XP_008371117.1|  PREDICTED: pectinesterase                          279   7e-84    
gb|ABJ99594.1|  pectinesterase inhibitor                                280   7e-84    
ref|XP_003554631.1|  PREDICTED: putative pectinesterase/pectinest...    278   7e-84    
gb|AFI23411.1|  pectin methylesterase                                   280   7e-84    
gb|EEC82670.1|  hypothetical protein OsI_27314                          279   7e-84    
ref|NP_001060620.1|  Os07g0675100                                       279   8e-84    
gb|KDP33984.1|  hypothetical protein JCGZ_07555                         279   9e-84    
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   280   9e-84    
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   274   1e-83    
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                     279   1e-83    
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    278   1e-83    
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    279   1e-83    
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     278   1e-83    
gb|KHN43320.1|  Putative pectinesterase/pectinesterase inhibitor 22     276   1e-83    
gb|EYU21271.1|  hypothetical protein MIMGU_mgv1a022830mg                278   1e-83    
emb|CDY49170.1|  BnaA02g10290D                                          275   1e-83    
ref|XP_007146997.1|  hypothetical protein PHAVU_006G088000g             277   2e-83    
gb|KEH29120.1|  pectinesterase/pectinesterase inhibitor                 276   2e-83    
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     278   2e-83    
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             277   2e-83    
ref|XP_002512462.1|  Pectinesterase PPE8B precursor, putative           277   2e-83    
ref|XP_010692199.1|  PREDICTED: probable pectinesterase/pectinest...    273   3e-83    
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     277   4e-83    
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     277   4e-83    



>ref|XP_009627969.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Nicotiana tomentosiformis]
Length=521

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/400 (73%), Positives = 342/400 (86%), Gaps = 7/400 (2%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             +K+  F++  SFS+F+  A S+       ++N WC++ P+P+QCKYF+ H   HF APK 
Sbjct  3     TKLGFFVLFISFSAFLFPAFSIT--LFDNDINNWCNKAPYPNQCKYFMNHGPYHF-APKH  59

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD--  838
              ++FKKMA +IA++ A+QAET+ K+LG +CRN REKAAW+DCV LYE TILQLN+TLD  
Sbjct  60    NTDFKKMAMQIAMERALQAETYTKQLGTKCRNEREKAAWSDCVNLYESTILQLNKTLDPN  119

Query  837   EKCTQFDALTWLSTALTNLETCRTGFVELG-NSRNVLPLISNNNVSQLIGNTLALNNNGS  661
              KCT FD  TWLSTALTNLETCRTGFVELG NS  +LP I +NNVS+LI NTLALNNNGS
Sbjct  120   TKCTDFDTQTWLSTALTNLETCRTGFVELGVNSDYILPSIMSNNVSELICNTLALNNNGS  179

Query  660   VPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGR  481
               KQTYK GFP W S GDR+LLQ SS V+P++VVA+DG+GN++TIK ALDAA KRSG+GR
Sbjct  180   TLKQTYKYGFPTWFSPGDRKLLQ-SSTVRPNIVVAQDGTGNFRTIKAALDAAAKRSGNGR  238

Query  480   FVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGF  301
             F+IH+KRGVY ENL+IG+K+KNIMLVGDG+RYT I+GSRSVVGGSTTF SATVAVTG+GF
Sbjct  239   FIIHVKRGVYRENLEIGSKMKNIMLVGDGLRYTIITGSRSVVGGSTTFKSATVAVTGEGF  298

Query  300   IAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTV  121
             IA+GITFRNTAGP+NHQAVALRSG+D SVFY+CGFEGYQDTLY HSQRQFYK+CYIYGTV
Sbjct  299   IARGITFRNTAGPQNHQAVALRSGSDQSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTV  358

Query  120   DFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             DFIFGNAAVV QNCMI+AR+PMDKQKITITAQGRTDPNQN
Sbjct  359   DFIFGNAAVVLQNCMIFARQPMDKQKITITAQGRTDPNQN  398



>ref|XP_006490097.1| PREDICTED: pectinesterase 2-like [Citrus sinensis]
Length=518

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/398 (72%), Positives = 337/398 (85%), Gaps = 8/398 (2%)
 Frame = -1

Query  1188  KIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRK  1009
             K+ +FL++ S  SF + ALS     A+  V+ WCS+TPHP+ CKYF+  + +HF  PK+K
Sbjct  4     KLSVFLLVISLISFFAPALS---SVASYSVDYWCSKTPHPEPCKYFMQQNSKHFAVPKQK  60

Query  1008  SEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--  835
             SEF++MA  +ALD A+ A++H K LG +CRN +EK AWADC+KLY+DTI QLN TLD   
Sbjct  61    SEFRRMAMSLALDRALTAQSHNKWLGSKCRNHKEKVAWADCLKLYQDTINQLNHTLDSNT  120

Query  834   KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP  655
             KCT FDA TWLSTALTNLETCR GFVELG    VLPL+SNN V++LI NTLAL N  +VP
Sbjct  121   KCTDFDAQTWLSTALTNLETCRAGFVELGVPDYVLPLMSNN-VTKLISNTLALRNASTVP  179

Query  654   KQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFV  475
              +TYK GFP+WV  GDR+LLQ +SPV+P+LVVA+DGSGNY+TIK ALDAA KR+GSGRFV
Sbjct  180   -ETYKGGFPSWVKPGDRKLLQ-TSPVRPNLVVAQDGSGNYRTIKAALDAAAKRTGSGRFV  237

Query  474   IHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIA  295
             IH+KRGVY ENL+IGNK+KNIMLVGDG+RYT I+GSRSV GG TTFNSATVAVTGDGFIA
Sbjct  238   IHVKRGVYKENLEIGNKMKNIMLVGDGLRYTIITGSRSVGGGFTTFNSATVAVTGDGFIA  297

Query  294   QGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDF  115
             +GITFRNTAGP+NHQAVALR+G+DLSVFY+CGFEGYQDTLY HSQRQFYK+CYIYGTVDF
Sbjct  298   RGITFRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDF  357

Query  114   IFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             IFGNAAVV QNCMIYAR+PMDKQK  +TAQGRTDPNQN
Sbjct  358   IFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQN  395



>gb|KDO65446.1| hypothetical protein CISIN_1g010103mg [Citrus sinensis]
Length=518

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/398 (72%), Positives = 335/398 (84%), Gaps = 8/398 (2%)
 Frame = -1

Query  1188  KIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRK  1009
             K+ +FL+  S  SF + ALS     A+  V+ WCS+TPHP+ CKYF+  + +HF  PK+K
Sbjct  4     KLSVFLLFISLISFFAPALS---SVASNGVDYWCSKTPHPEPCKYFMQQNSKHFAVPKQK  60

Query  1008  SEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--  835
             SEF++MA  +ALD A+ A+ H K LG +CRN +EK AWADC+KLY+DTI QLN TLD   
Sbjct  61    SEFRRMAMSLALDRALTAQNHNKWLGSKCRNHKEKVAWADCLKLYQDTINQLNHTLDSNT  120

Query  834   KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP  655
             KCT FDA TWLSTALTNLETCR GFVELG    VLPL+SNN V++LI NTLAL N  +VP
Sbjct  121   KCTDFDAQTWLSTALTNLETCRAGFVELGVPDYVLPLMSNN-VTKLISNTLALRNASTVP  179

Query  654   KQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFV  475
              +TYK GFP+WV  GDR+LLQ +SPV+P+LVVA+DGSGNY+TIK ALDAA KR+GSGRFV
Sbjct  180   -ETYKGGFPSWVKPGDRKLLQ-TSPVRPNLVVAQDGSGNYRTIKAALDAAAKRTGSGRFV  237

Query  474   IHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIA  295
             IH+KRGVY ENL+IGNK+KNIMLVGDG+RYT I+GSRSV GG TTFNSATVAVTGDGFIA
Sbjct  238   IHVKRGVYKENLEIGNKMKNIMLVGDGLRYTIITGSRSVGGGFTTFNSATVAVTGDGFIA  297

Query  294   QGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDF  115
             +GITFRNTAGP+NHQAVALR+G+DLSVFY+CGFEGYQDTLY HSQRQFYK+CYIYGTVDF
Sbjct  298   RGITFRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDF  357

Query  114   IFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             IFGNAAVV QNCMIYAR+PMDKQK  +TAQGRTDPNQN
Sbjct  358   IFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQN  395



>ref|XP_006421695.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
 gb|ESR34935.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
Length=518

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/398 (72%), Positives = 335/398 (84%), Gaps = 8/398 (2%)
 Frame = -1

Query  1188  KIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRK  1009
             K+ +FL+  S  SF + A+S     A+  V+ WCS+TPHP+ CKYF+  + +HF  PK++
Sbjct  4     KLSVFLLFISLISFFAPAVS---SVASNGVDYWCSKTPHPEPCKYFMQQNSKHFAVPKQE  60

Query  1008  SEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--  835
             SEF++MA  +ALD A+ A+ H K LG +CRN +EK AWADC+KLY+DTI QLN TLD   
Sbjct  61    SEFRRMAMSLALDRALTAQNHNKWLGSKCRNHKEKVAWADCLKLYQDTINQLNHTLDSNT  120

Query  834   KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP  655
             KCT FDA TWLSTALTNLETCR GFVELG    VLPL+SNN V++LI NTLAL N  +VP
Sbjct  121   KCTDFDAQTWLSTALTNLETCRAGFVELGVPDYVLPLMSNN-VTKLISNTLALRNASTVP  179

Query  654   KQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFV  475
              +TYK GFP+WV  GDR+LLQ +SPV+P+LVVA+DGSGNY+TIK ALDAA KR+GSGRFV
Sbjct  180   -ETYKGGFPSWVKPGDRKLLQ-TSPVRPNLVVAQDGSGNYRTIKAALDAAAKRTGSGRFV  237

Query  474   IHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIA  295
             IH+KRGVY ENL+IGNK+KNIMLVGDG+RYT I+GSRSV GG TTFNSATVAVTGDGFIA
Sbjct  238   IHVKRGVYKENLEIGNKMKNIMLVGDGLRYTIITGSRSVGGGFTTFNSATVAVTGDGFIA  297

Query  294   QGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDF  115
             +GITFRNTAGP+NHQAVALR+G+DLSVFY+CGFEGYQDTLY HSQRQFYK+CYIYGTVDF
Sbjct  298   RGITFRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDF  357

Query  114   IFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             IFGNAAVV QNCMIYAR+PMDKQK  +TAQGRTDPNQN
Sbjct  358   IFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQN  395



>ref|XP_004234932.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Solanum lycopersicum]
Length=523

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/401 (73%), Positives = 338/401 (84%), Gaps = 9/401 (2%)
 Frame = -1

Query  1188  KIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRK  1009
             K+  F++L SFSSF    LS+N   +   +N WC++TP+PDQCKYF+ H   HF APK K
Sbjct  4     KLSFFVLLISFSSFFFPILSINIFDSG--INAWCNKTPYPDQCKYFMNHGSYHF-APKNK  60

Query  1008  SEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--  835
              +FKKMA +IAL+ A+QAET+ K LG +CRN  E+AAW+DCVKLYE TILQLN+TLD   
Sbjct  61    IDFKKMAVKIALERALQAETYTKGLGVKCRNELERAAWSDCVKLYESTILQLNKTLDSNT  120

Query  834   KCTQFDALTWLSTALTNLETCRTGFVELG-NSRNVLPLISNNNVSQLIGNTLALNNNGSV  658
             KCT FD  TWLSTA+TNLETC+TGF+ELG NS  +LP + +NNVS+LI NTLALNN   V
Sbjct  121   KCTDFDIQTWLSTAMTNLETCQTGFIELGVNSDYILPSLMSNNVSELICNTLALNNVDFV  180

Query  657   P--KQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSG  484
                KQTYKDGFP+WVS GDR+LLQ SS + P+LVVA+DG+GN+ TIK ALDAA KRSG+ 
Sbjct  181   SNRKQTYKDGFPSWVSPGDRKLLQLSS-ISPNLVVAQDGTGNFLTIKAALDAAAKRSGNE  239

Query  483   RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDG  304
             RFVI +KRGVY ENL+IGNK+KNIMLVGDGM+YT I+GSRSV GGSTTFNS TV VTG+G
Sbjct  240   RFVIRVKRGVYRENLEIGNKMKNIMLVGDGMKYTIITGSRSVGGGSTTFNSGTVVVTGEG  299

Query  303   FIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGT  124
             FIAQGITFRNTAGPENHQAVALRSG+DLSVFY+CGFEGYQDTLY HSQRQFYK+CYIYGT
Sbjct  300   FIAQGITFRNTAGPENHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGT  359

Query  123   VDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             VDFIFGNAAVV QNCMI+AR+PMDKQKITITAQGRTDPNQN
Sbjct  360   VDFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQN  400



>ref|XP_007038413.1| Pectinesterase [Theobroma cacao]
 gb|EOY22914.1| Pectinesterase [Theobroma cacao]
Length=516

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/398 (73%), Positives = 333/398 (84%), Gaps = 8/398 (2%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             +K+ LF++  SFS       SV        ++ WC +TP+P  CKYF+    + +  PK+
Sbjct  3     TKLALFVIFMSFSLVPPTLSSV----VTNGIDYWCDRTPNPQPCKYFMRQKGKSY-VPKQ  57

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE-  835
             KSEF+KMA +IALD A+ A++H K LG +CRN +EKAAWADC+KLYE+TILQLNQTLD  
Sbjct  58    KSEFRKMAVQIALDRALNAQSHNKGLGKKCRNDKEKAAWADCLKLYEETILQLNQTLDST  117

Query  834   KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP  655
             KCT FD  TWLSTALTNLETCR GFVELG S  +LPL+SNN VS+LI NTLALNNN S  
Sbjct  118   KCTDFDVQTWLSTALTNLETCRAGFVELGVSDYILPLMSNN-VSKLISNTLALNNNASFV  176

Query  654   KQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFV  475
              QTYK GFP W+  GDR+LLQ+SSP  P+LVVA+DGSGN++TIK+ALDAA KRSGSGRFV
Sbjct  177   PQTYKHGFPRWLKAGDRKLLQSSSPT-PNLVVAQDGSGNHRTIKEALDAAAKRSGSGRFV  235

Query  474   IHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIA  295
             IH+KRGVY ENL+IGNKLKNIMLVGDG+RYT I+GSRSV GGSTTFNSATVAVTG+GFIA
Sbjct  236   IHVKRGVYKENLEIGNKLKNIMLVGDGLRYTIITGSRSVGGGSTTFNSATVAVTGEGFIA  295

Query  294   QGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDF  115
             +GITFRNTAGP+NHQAVALRSG+DLSVFY+CGFEGYQDTLY HSQRQFYK+CYIYGTVDF
Sbjct  296   RGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDF  355

Query  114   IFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             IFGNAAVV QNCMIYAR+PMDKQK  +TAQGRTDPNQN
Sbjct  356   IFGNAAVVLQNCMIYARRPMDKQKNIVTAQGRTDPNQN  393



>ref|XP_009773838.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=524

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/403 (71%), Positives = 340/403 (84%), Gaps = 10/403 (2%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             +K+  F +  SFS+F+  A S+       ++N WC++ P+P+QCKYF+ H   HF APK 
Sbjct  3     TKLGFFALFISFSTFLFPAFSIT--LFDNDINDWCNKAPYPNQCKYFMNHGMYHF-APKH  59

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE-  835
              ++FK MA +IA++ A++AET+ K+LG +CRN REKAAW+DCV LYE TILQLN+TLD  
Sbjct  60    TTDFKNMAMQIAMERALEAETYTKQLGAKCRNEREKAAWSDCVNLYESTILQLNKTLDPN  119

Query  834   -KCTQFDALTWLSTALTNLETCRTGFVELG-NSRNVLPLISNNNVSQLIGNTLALNN-NG  664
              KCT FD  TWLSTALTNLETCRTGFVELG NS  +LP + +NNVS+LI NTLALNN NG
Sbjct  120   TKCTDFDTQTWLSTALTNLETCRTGFVELGVNSDYILPSLMSNNVSELICNTLALNNING  179

Query  663   SVPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSG  484
             S  KQTY+DGFP WV  GDR+LLQ SS ++P+LVVA+DG+GN++TIK ALDAA KRSG+G
Sbjct  180   STLKQTYRDGFPTWVPPGDRKLLQLSS-IRPNLVVAQDGTGNFRTIKAALDAAAKRSGNG  238

Query  483   --RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTG  310
               RF+IH+KRG Y ENL+IGNK+KNIMLVGDG+RYT I+GSRSVVGGSTTF SATVAVTG
Sbjct  239   NGRFIIHVKRGAYRENLEIGNKMKNIMLVGDGLRYTIITGSRSVVGGSTTFKSATVAVTG  298

Query  309   DGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIY  130
             +GFIA+GITFRNTAGP+NHQAVALRSG+D SVFY+CGFEGYQDTLY HSQRQFYK+CYIY
Sbjct  299   EGFIARGITFRNTAGPQNHQAVALRSGSDRSVFYRCGFEGYQDTLYVHSQRQFYKECYIY  358

Query  129   GTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             GTVDFIFGNAAVV QNCMI+AR+PMDKQKITITAQGRTDPNQN
Sbjct  359   GTVDFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQN  401



>emb|CDP20891.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/398 (74%), Positives = 335/398 (84%), Gaps = 10/398 (3%)
 Frame = -1

Query  1179  LFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYF-LTHSRRHFTAPKRKSE  1003
             LF    S SSF S   S NP  ++G++N WC+QTP+P+QC YF L H   HF  PK K++
Sbjct  8     LFFTFISLSSFFSPCFSKNP--SSGDINWWCNQTPYPEQCNYFFLNHGTNHF-MPKEKAD  64

Query  1002  FKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KC  829
              KKMA +I L+ A++A+TH + L  +CRN REKAAWADC+KLYE+TILQLN+TLD   KC
Sbjct  65    VKKMAMQITLERALKAKTHTENLESKCRNEREKAAWADCLKLYENTILQLNRTLDSNTKC  124

Query  828   TQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNN--GSVP  655
             T FDA TWLSTALTNLETCR+GF ELG S  VLPL+SNN VS+LI NTLALNNN   SV 
Sbjct  125   TDFDAQTWLSTALTNLETCRSGFQELGVSDFVLPLMSNN-VSKLICNTLALNNNINVSVE  183

Query  654   KQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFV  475
              QTYKDGFP WV+ GDR+LLQ SS V+P+L+VA+DGSGNY+TIK ALDAA KRSGSGRFV
Sbjct  184   TQTYKDGFPTWVTPGDRKLLQ-SSLVRPNLIVAQDGSGNYRTIKAALDAAAKRSGSGRFV  242

Query  474   IHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIA  295
             I +KRG Y ENL+IGNK+KNIML+G GMR T I+GSRSV GGSTTF+SATVAVTGDGFIA
Sbjct  243   IQVKRGTYRENLEIGNKMKNIMLLGAGMRDTIITGSRSVGGGSTTFDSATVAVTGDGFIA  302

Query  294   QGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDF  115
             QGITFRNTAGP+NHQAVALRSG+DLSVF++CGFEGYQDTLY HSQRQFYK+CYIYGTVDF
Sbjct  303   QGITFRNTAGPQNHQAVALRSGSDLSVFHRCGFEGYQDTLYVHSQRQFYKECYIYGTVDF  362

Query  114   IFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             IFGNAAVV QNCMIYAR+PMDKQK TITAQGRTDPNQN
Sbjct  363   IFGNAAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQN  400



>ref|XP_002322401.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06528.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=517

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/401 (70%), Positives = 332/401 (83%), Gaps = 13/401 (3%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             +K+ L L+     S +S +++ N      +++ WCS+TP+P+ CKYF+  + +HF  PK+
Sbjct  3     TKLCLSLLFMCLCSLLSSSIASN-----DQIDYWCSKTPNPEPCKYFMKQNPKHF-VPKQ  56

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE-  835
             KS+F+KMA E+A+  A+ A+ H K LGP+CRN +EKAAWADC+KLYEDTI +LN T+D  
Sbjct  57    KSDFRKMAIELAVQRALNAQNHNKWLGPKCRNEKEKAAWADCLKLYEDTIAELNHTIDSN  116

Query  834   -KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGS-  661
              KCTQFDA TWLSTALTNLETC+ GF +LG S  VLPL+SNN VS+LI NTLAL +N S 
Sbjct  117   TKCTQFDAQTWLSTALTNLETCKAGFKDLGVSDFVLPLMSNN-VSKLIRNTLALKDNASS  175

Query  660   -VPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSG  484
              +P QTYKDGFP+WV  GDR+LLQ SSP  P+LVVA+DGSGN++TIK ALDAA KRSGS 
Sbjct  176   TLP-QTYKDGFPSWVKAGDRKLLQTSSP-SPNLVVAQDGSGNHRTIKAALDAAAKRSGSR  233

Query  483   RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDG  304
             RFVI IK GVY ENLDIG KLKNIMLVGDG+R T I+GSRSV GG TTFNSATVAVTG+G
Sbjct  234   RFVIRIKSGVYRENLDIGKKLKNIMLVGDGLRNTIITGSRSVGGGFTTFNSATVAVTGEG  293

Query  303   FIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGT  124
             FIA+GITFRNTAGP+NHQAVALRSG+DLSVFY+CGFEGYQDTLY HSQRQFYK+CYIYGT
Sbjct  294   FIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGT  353

Query  123   VDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             VDFIFGNAAV+ QNCMIYAR+PMDKQK  +TAQGRTDPNQN
Sbjct  354   VDFIFGNAAVILQNCMIYARRPMDKQKNVVTAQGRTDPNQN  394



>ref|XP_003634048.1| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=520

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/401 (70%), Positives = 334/401 (83%), Gaps = 12/401 (3%)
 Frame = -1

Query  1188  KIHLFLV-LASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             K+ LF + + S S F S  L+ +    +G+VN WC +TP+P  CKYF++H    + APK+
Sbjct  4     KLELFAIFMLSLSFFSSTILASD----SGDVNWWCDKTPYPAPCKYFMSHGGHKYNAPKK  59

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD--  838
             KSEF+KMA ++A++ A+ A++H K LG +CRN REKAAWADC+K Y+DTI QLNQTLD  
Sbjct  60    KSEFQKMAMQVAMERALTAQSHNKWLGSKCRNEREKAAWADCLKQYQDTIQQLNQTLDPA  119

Query  837   EKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSV  658
              KCT FD  TWLSTALTNL+TCR GFVELG S  VLPL+SNN VS+LI N+LA+ N+  +
Sbjct  120   TKCTDFDQQTWLSTALTNLDTCRAGFVELGVSDFVLPLMSNN-VSKLISNSLAMKND--I  176

Query  657   P-KQTYKDGFPAWVSLGDRRLLQASS-PVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSG  484
             P K TYK+GFP+WV  GDRRLLQ++S   K +LVVA+DGSGNYKTIK A++AA KRSGSG
Sbjct  177   PEKHTYKEGFPSWVKAGDRRLLQSTSTAAKANLVVAQDGSGNYKTIKAAIEAAAKRSGSG  236

Query  483   RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDG  304
             R+VIH+K+GVY EN++IGNK+KNIMLVGDG+R T I+GSRSV GG TTFNSATVAVTG+G
Sbjct  237   RYVIHVKKGVYKENIEIGNKMKNIMLVGDGLRNTIITGSRSVGGGFTTFNSATVAVTGEG  296

Query  303   FIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGT  124
             FIA+GITFRNTAGP+NHQAVALRSG+DLSVFY+C FEGYQDTLY HSQRQFYK+CYIYGT
Sbjct  297   FIARGITFRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYKECYIYGT  356

Query  123   VDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             VDFIFGNAAVV QNCMIYAR+PMDKQK  +TAQGRTDPNQN
Sbjct  357   VDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQN  397



>ref|XP_011010931.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=517

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/376 (73%), Positives = 318/376 (85%), Gaps = 8/376 (2%)
 Frame = -1

Query  1116  AAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKR  937
             A+  +++ WCS+TP+P+ CKYF+  + +HF  PK+KS+F+KMA E+A+  AV A+ H K 
Sbjct  23    ASNDQIDYWCSKTPNPEPCKYFMKQNPKHFV-PKQKSDFRKMAIELAVQRAVDAQNHNKW  81

Query  936   LGPRCRNAREKAAWADCVKLYEDTILQLNQTL--DEKCTQFDALTWLSTALTNLETCRTG  763
             LG +CRN +EKAAWADC+KLYEDTI +LN T+  + KCT+FDA TWLSTALTNLETC+ G
Sbjct  82    LGTKCRNEKEKAAWADCLKLYEDTIAELNHTIASNTKCTEFDAQTWLSTALTNLETCKAG  141

Query  762   FVELGNSRNVLPLISNNNVSQLIGNTLALNNNGS--VPKQTYKDGFPAWVSLGDRRLLQA  589
             F + G S  VLPL+SNN VS+LI NTLAL +N S  +P QTY DGFP+WV  GDR+LLQ 
Sbjct  142   FKDFGVSDFVLPLMSNN-VSKLIRNTLALKDNASSTLP-QTYNDGFPSWVKAGDRKLLQK  199

Query  588   SSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIM  409
             SSP  P+LVVA+DGSGN++TIK ALDAA KRSGS RFVI IKRGVY ENLDIG  LKNIM
Sbjct  200   SSP-SPNLVVAQDGSGNHRTIKAALDAAAKRSGSKRFVIRIKRGVYRENLDIGKNLKNIM  258

Query  408   LVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSG  229
             LVGDG+R T I+GSRSV GG TTFNSATVAVTG+GFIA+GITFRNTAGP+NHQAVALRSG
Sbjct  259   LVGDGLRNTSITGSRSVGGGFTTFNSATVAVTGEGFIARGITFRNTAGPQNHQAVALRSG  318

Query  228   ADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDK  49
             +DLSVFY+CGFEGYQDTLY HSQRQFYK+CYIYGTVDFIFGNAAVV QNCMIYAR+PMDK
Sbjct  319   SDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDK  378

Query  48    QKITITAQGRTDPNQN  1
             QK  +TAQGRTDPNQN
Sbjct  379   QKNVVTAQGRTDPNQN  394



>ref|XP_008234391.1| PREDICTED: pectinesterase 2-like [Prunus mume]
Length=517

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/401 (70%), Positives = 330/401 (82%), Gaps = 13/401 (3%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             +K+  FL+  SF+   S ALS         +N WCS+TP+P+ CKY LTH+++ ++ P R
Sbjct  3     TKMSSFLLCFSFALLFSPALS---NILNTGINSWCSKTPYPETCKYTLTHAQK-YSVPTR  58

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE-  835
              S+FKK+A ++ +  A++A++H K LGP+CRN  EKAAWADC+ LY+DTI+ LNQT+D  
Sbjct  59    MSDFKKLAVQVTMQQALKAQSHNKWLGPKCRNKIEKAAWADCLSLYQDTIMLLNQTIDPA  118

Query  834   -KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSV  658
              KCT +DA TWLSTALTNL+TCR GFVELG S  VLPL+SNN VS+LI NTL++ N  +V
Sbjct  119   TKCTDYDAQTWLSTALTNLDTCRAGFVELGVSDFVLPLMSNN-VSKLISNTLSIGNGSNV  177

Query  657   PKQT--YKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSG  484
             P  T  YK+GFP WVS GDR+LLQ S P   D+VVA+DGSGNYKTIK+AL AA KRSGS 
Sbjct  178   PAVTNRYKEGFPTWVSPGDRKLLQ-SLPAA-DVVVAQDGSGNYKTIKEALAAAAKRSGSK  235

Query  483   RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDG  304
             RFVIH+KRGVY ENL+I   LKNIML+GDG+RYT I+GSRSVVGGSTTFNSATVAVTGDG
Sbjct  236   RFVIHVKRGVYKENLEI--TLKNIMLLGDGLRYTIITGSRSVVGGSTTFNSATVAVTGDG  293

Query  303   FIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGT  124
             FIA+GITFRNTAGPENHQAVALRSGADLSVFY+CGFEGYQDTLY HSQRQFYK+CY+YGT
Sbjct  294   FIARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECYVYGT  353

Query  123   VDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             VDFIFGNAAVV QNCMIYAR+PM+ QK TITAQGRTDPNQN
Sbjct  354   VDFIFGNAAVVLQNCMIYARRPMNGQKNTITAQGRTDPNQN  394



>gb|KDP22414.1| hypothetical protein JCGZ_26245 [Jatropha curcas]
Length=523

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/408 (68%), Positives = 327/408 (80%), Gaps = 16/408 (4%)
 Frame = -1

Query  1206  LNLEMSKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFL---THSR  1036
             + L +  I LFL    FS  +     ++   A+  ++ WC+QTP+P+ CKYF+     +R
Sbjct  3     MKLGLPIIFLFLY---FSPRV-----LSSTVASSSIDSWCNQTPNPEPCKYFMNQIAQNR  54

Query  1035  RHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQ  856
              HF  PK KS+F K+A ++A+  A  A++  K LG +CRN +EKAA ADC+KLYEDTI+ 
Sbjct  55    NHFRFPKNKSDFLKLAIDLAMQRAQTAQSQNKWLGKKCRNEKEKAALADCLKLYEDTIIN  114

Query  855   LNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTL  682
             LN T+D   KCT +D  TWLSTALTNLETC+ GFVELG +  +LPL+SNN VS LI NTL
Sbjct  115   LNHTIDPSAKCTDYDVQTWLSTALTNLETCKAGFVELGVTDFMLPLMSNN-VSSLIRNTL  173

Query  681   ALNNNG-SVPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAA  505
             A+NN+  SV  QTYKDGFP WV+ GDR+LLQ SSP  P+LVVA+DGSGN++TIK ALDAA
Sbjct  174   AINNSSTSVLPQTYKDGFPHWVTSGDRKLLQTSSP-SPNLVVAQDGSGNFRTIKQALDAA  232

Query  504   GKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSAT  325
              KRSGSGRFVIHIK G+Y ENL+IGN + NIMLVGDG+R T I+GSRSV GGSTTFNSAT
Sbjct  233   AKRSGSGRFVIHIKSGIYRENLEIGNDMINIMLVGDGLRNTIITGSRSVGGGSTTFNSAT  292

Query  324   VAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYK  145
             VAVTGDGFIA+GITFRNTAGP+NHQAVALRSG+DLSVFY+CGFEGYQDTLY HSQRQFYK
Sbjct  293   VAVTGDGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYK  352

Query  144   DCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             +CYIYGTVDFIFGNAAVV QNCMIYAR+PMDKQK  +TAQGRTDPNQN
Sbjct  353   ECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQN  400



>ref|XP_006367816.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Solanum tuberosum]
Length=474

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/353 (76%), Positives = 305/353 (86%), Gaps = 5/353 (1%)
 Frame = -1

Query  1050  LTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYE  871
             + H   HF APK K +FKKMA +IAL+ A+ AET+ K LG +C N  E+AAW+DCVKLYE
Sbjct  1     MNHGSYHF-APKNKIDFKKMAVKIALERALHAETYTKGLGVKCSNELERAAWSDCVKLYE  59

Query  870   DTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVELG-NSRNVLPLISNNNVSQ  700
              TILQLN+TLD   KCT FD  TWLSTA+TNLETC+TGF+ELG NS  +LP + +NNVS+
Sbjct  60    STILQLNKTLDSNTKCTDFDIQTWLSTAMTNLETCQTGFIELGVNSDYILPSLMSNNVSE  119

Query  699   LIGNTLALNNNGSVPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKD  520
             LI NTL+LNN GS  KQTYKDGFP WVS GDR+LLQ SS + P+LVVA+DG+GN+ TIK 
Sbjct  120   LICNTLSLNNIGSNMKQTYKDGFPTWVSPGDRKLLQLSS-ISPNLVVAQDGTGNFLTIKA  178

Query  519   ALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTT  340
             ALDAA KRSG+ RFVIH+KRGVY ENL+IGNK+KNIMLVGDGM+YT I+GSRSV GGSTT
Sbjct  179   ALDAAAKRSGNERFVIHVKRGVYRENLEIGNKMKNIMLVGDGMKYTIITGSRSVGGGSTT  238

Query  339   FNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQ  160
             FNS TV VTG+GFIAQGITFRNTAGP+NHQAVALRSG+DLSVFY+CGFEGYQDTLY HSQ
Sbjct  239   FNSGTVVVTGEGFIAQGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQ  298

Query  159   RQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             RQFYK+CYIYGTVDFIFGNAAVV QNCMI+AR+PMDKQKITITAQGRTDPNQN
Sbjct  299   RQFYKECYIYGTVDFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQN  351



>ref|XP_009372890.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/396 (70%), Positives = 322/396 (81%), Gaps = 12/396 (3%)
 Frame = -1

Query  1176  FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFK  997
             F +  SF+ F S ALS         ++ WC +TP+PD CKY LTH ++  + P + S+FK
Sbjct  9     FFLCVSFALFFSPALS---NILNTGIDSWCKKTPYPDTCKYTLTHDQKSLSIPNKISDFK  65

Query  996   KMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQ  823
             K+A ++AL  A++A++H K LG +CRN +EKAAWADC+ LYE+TI  LN T+D   KCT 
Sbjct  66    KLAIQVALKRALKAQSHNKWLGQKCRNKKEKAAWADCLSLYEETIKLLNHTVDPAIKCTD  125

Query  822   FDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQT-  646
             +D+ TWLSTALTNL+TCR GFVELG S  VLPL+SNN VS+LI NTL+L N+ +VP  T 
Sbjct  126   YDSQTWLSTALTNLDTCRAGFVELGVSDFVLPLMSNN-VSKLISNTLSLGNSSNVPPVTN  184

Query  645   -YKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIH  469
              Y +GFP+WVS GDR+LLQ S+P   D+VVA+DGSGNYKTIK+ALD A KRSGS RFVIH
Sbjct  185   LYTEGFPSWVSPGDRKLLQ-STPAA-DVVVAQDGSGNYKTIKEALDVAAKRSGSKRFVIH  242

Query  468   IKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQG  289
             +KRGVY ENLDI  KLKN+ L+GDG+RYT I+GSRSVVGGSTTFNSATVAVTG+GFIA+G
Sbjct  243   VKRGVYKENLDI--KLKNVFLLGDGLRYTIITGSRSVVGGSTTFNSATVAVTGEGFIARG  300

Query  288   ITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIF  109
             ITFRNTAGPENHQAVALRSGADLSVFY C FEGYQDTLY HSQRQFYKDCY+YGTVDFIF
Sbjct  301   ITFRNTAGPENHQAVALRSGADLSVFYHCSFEGYQDTLYTHSQRQFYKDCYVYGTVDFIF  360

Query  108   GNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             GNAAVV QNCMIYARKPM  QK TITAQGRTDPNQN
Sbjct  361   GNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQN  396



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/401 (68%), Positives = 324/401 (81%), Gaps = 12/401 (3%)
 Frame = -1

Query  1185  IHLFLV-LASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRK  1009
             I++FL+ +  FS  +S A S + P   G VN WC +TP+PD CK F+ H   H    + K
Sbjct  11    INVFLIFVVQFSFLLSPAASFDVP---GGVNWWCGKTPYPDACKSFINHDP-HTYVTRTK  66

Query  1008  SEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--  835
             SEF+KMA ++A+D A++AE+H K L P+CRN REKAAWADC+KLY+DT+LQLN+TLD   
Sbjct  67    SEFRKMALQVAMDRALRAESHTKWLEPKCRNEREKAAWADCLKLYQDTVLQLNRTLDPSI  126

Query  834   KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP  655
             KCT FDA TWLSTALTNL+TCR GF+ELG S  +LPL+SNN VS+LI NTLA+N   S  
Sbjct  127   KCTDFDAQTWLSTALTNLQTCRAGFIELGVSDFMLPLMSNN-VSKLISNTLAINKAIS-Q  184

Query  654   KQTYKDG-FPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGK-RSGSG  484
              Q Y DG FP+WVS GDR+LLQ+SSP  + ++VVA+DGSGN++TIK ALDA  K R GSG
Sbjct  185   NQNYTDGRFPSWVSPGDRKLLQSSSPASRANMVVAQDGSGNFRTIKAALDAVSKQRKGSG  244

Query  483   RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDG  304
             RF+IH+K GVY ENL+IGN +KNIMLVGDGMR T I+GSRSV GG TTFNSATVAVTG+G
Sbjct  245   RFIIHVKAGVYRENLEIGNGMKNIMLVGDGMRSTIITGSRSVGGGFTTFNSATVAVTGEG  304

Query  303   FIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGT  124
             FIA GITFRNTAGP+NHQAVALRSG+DLSVFY+CGFEGYQDTLY HSQRQFY++CYIYGT
Sbjct  305   FIAMGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYRECYIYGT  364

Query  123   VDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             VDFIFGNAAVV QNCMI  R+PMD Q   +TAQGRTDPNQN
Sbjct  365   VDFIFGNAAVVLQNCMILPRRPMDGQSNVVTAQGRTDPNQN  405



>ref|XP_009370475.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/396 (69%), Positives = 321/396 (81%), Gaps = 12/396 (3%)
 Frame = -1

Query  1176  FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFK  997
             F +  SF+ F S ALS         ++ WC +TP+PD CKY LT  ++  + P + S+FK
Sbjct  9     FFLCVSFALFFSPALS---NILNTGIDSWCKKTPYPDTCKYTLTQDQKSLSIPNKVSDFK  65

Query  996   KMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQ  823
             K+A ++AL  A++A++H K LG +CRN +EKAAWADC+ LYE+TI  LN T+D   KCT 
Sbjct  66    KIAIQVALKRALKAQSHNKWLGQKCRNKKEKAAWADCLSLYEETIKLLNHTVDPAIKCTD  125

Query  822   FDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQT-  646
             +D+ TWLSTALTNL+TCR GFVELG S  VLPL+SNN VS+LI NTL+L N+ +VP  T 
Sbjct  126   YDSQTWLSTALTNLDTCRAGFVELGVSDFVLPLMSNN-VSKLISNTLSLGNSSNVPPVTN  184

Query  645   -YKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIH  469
              Y +GFP+WVS GDR+LLQ S+P   D+VVA+DGSGNYKTIK+ALD A KRSGS RFVIH
Sbjct  185   LYTEGFPSWVSPGDRKLLQ-STPAA-DVVVAQDGSGNYKTIKEALDVAAKRSGSKRFVIH  242

Query  468   IKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQG  289
             +KRGVY ENLDI  KLKN+ L+GDG+RYT I+GSRSVVGGSTTFNSATVAVTG+GFIA+G
Sbjct  243   VKRGVYKENLDI--KLKNVFLLGDGLRYTIITGSRSVVGGSTTFNSATVAVTGEGFIARG  300

Query  288   ITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIF  109
             ITFRNTAGPENHQAVALRSGADLSVFY C FEGYQDTLY HSQRQFYKDCY+YGTVDFIF
Sbjct  301   ITFRNTAGPENHQAVALRSGADLSVFYHCSFEGYQDTLYTHSQRQFYKDCYVYGTVDFIF  360

Query  108   GNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             GNAAVV QNCMIYARKPM  QK TITAQGRTDPNQN
Sbjct  361   GNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQN  396



>ref|XP_010101099.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
 gb|EXC45243.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
Length=523

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/373 (73%), Positives = 312/373 (84%), Gaps = 8/373 (2%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYFLTHSRRH--FTAPKRKSEFKKMATEIALDTAVQAETHAKRLGP  928
             ++ WC++TP+P+ CK     +  H     PK K++FKK+  +I+L  A++A++H K LG 
Sbjct  30    IDWWCNRTPYPETCKQSWRDNDNHQKLFIPKLKADFKKLELQISLKQALKADSHNKWLGS  89

Query  927   RCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVE  754
             +CRN +EKAAW+DC+KLYED IL LN+TLD   KCT FDA TWLSTALTNL+TCR GFVE
Sbjct  90    KCRNDKEKAAWSDCLKLYEDAILLLNKTLDPSTKCTDFDAQTWLSTALTNLDTCRAGFVE  149

Query  753   LGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP-KQTYKDGFPAWVSLGDRRLLQASSPV  577
             LG S  V PL+SNN VS+LI NTLA NN  + P    YKDGFP W+S GDR+LLQ+SS  
Sbjct  150   LGVSDFVWPLMSNN-VSKLISNTLATNNASAPPVTNAYKDGFPIWLSPGDRKLLQSSSQ-  207

Query  576   KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGD  397
              P+LVVAKDGSG+++TIK ALDAA KRSGSGRF+IH+KRGVYNENL+IGNKLKNIMLVGD
Sbjct  208   SPNLVVAKDGSGDHETIKAALDAAAKRSGSGRFIIHVKRGVYNENLEIGNKLKNIMLVGD  267

Query  396   GMRYTYIsgsrsvvgg-STTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             G+RYT I+GSRSV GG  TTFNSATVAVTG+GFIAQGITFRNTAGPENHQAVALRSGADL
Sbjct  268   GLRYTIITGSRSVGGGGYTTFNSATVAVTGEGFIAQGITFRNTAGPENHQAVALRSGADL  327

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+CGFEGYQDTLY HSQRQFYK+CYIYGTVDFIFGNAA V QNCMIYAR+PM KQK 
Sbjct  328   SVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAAVLQNCMIYARRPMSKQKN  387

Query  39    TITAQGRTDPNQN  1
             TITAQGRTDPNQN
Sbjct  388   TITAQGRTDPNQN  400



>ref|XP_011029953.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=519

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/401 (67%), Positives = 326/401 (81%), Gaps = 9/401 (2%)
 Frame = -1

Query  1194  MSKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPK  1015
             ++K  + L+L  F S +S +++ N      +++ WC++TP+P+ CKYF+  + +HF  P+
Sbjct  2     VTKFFISLLLICFCSLLSSSVASNHDH---QIDYWCNKTPNPEPCKYFMKQNPKHFV-PQ  57

Query  1014  RKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE  835
             +KS+F+K+A E+++  A  A  H K LG +CRN +E+AAWADC++LYEDTI++LN TLD 
Sbjct  58    QKSDFRKLAIELSMQRAHTALIHNKGLGSKCRNDKERAAWADCLRLYEDTIVELNHTLDS  117

Query  834   --KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGS  661
               KCT+FDA TWLSTALTNLETC+ GF + G S  +LPL+SNN VS+LI N+LAL +N S
Sbjct  118   HTKCTEFDAQTWLSTALTNLETCKAGFKDFGVSDFMLPLMSNN-VSKLICNSLALKDNAS  176

Query  660   V-PKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSG  484
               P QTY DGFP+WV  GDR+LLQASS    +LVVA+DGSGN++TIK ALDAA KRSGSG
Sbjct  177   SNPPQTYNDGFPSWVKPGDRKLLQASSSTS-NLVVAQDGSGNHRTIKAALDAAAKRSGSG  235

Query  483   RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDG  304
             RFVI IK GVY ENLDIG  LKNIMLVGDG++ T I+GSRSV GGSTTF SATVAVTG G
Sbjct  236   RFVIRIKSGVYRENLDIGKNLKNIMLVGDGLKNTIITGSRSVGGGSTTFKSATVAVTGGG  295

Query  303   FIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGT  124
             FIA+GITFRNTAGP+NHQAVALRSGADLSVFY+CGFEGYQDTLY HSQRQFYK+C IYGT
Sbjct  296   FIARGITFRNTAGPQNHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECDIYGT  355

Query  123   VDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             VDFIFGNAAVV QNCMIYAR+PMDKQK  +TAQGRTDPNQN
Sbjct  356   VDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQN  396



>ref|XP_007220109.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
 gb|EMJ21308.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
Length=482

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/365 (73%), Positives = 313/365 (86%), Gaps = 10/365 (3%)
 Frame = -1

Query  1083  QTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREK  904
             +TP+P+ CKY LTH+++ ++ P R S+FKK+A ++ +  A++A++H K LGP+CRN  EK
Sbjct  1     KTPYPETCKYTLTHAQK-YSVPTRMSDFKKLAVQVTMQQALKAQSHNKWLGPKCRNKIEK  59

Query  903   AAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVL  730
             AAWADC+ LY+DTI+ LNQT+D   KCT +DA TWLSTALTNL+TCR GFVELG S  VL
Sbjct  60    AAWADCLSLYQDTIMLLNQTIDPATKCTDYDAQTWLSTALTNLDTCRAGFVELGVSDFVL  119

Query  729   PLISNNNVSQLIGNTLALNNNGSVPKQT--YKDGFPAWVSLGDRRLLQASSPVKPDLVVA  556
             PL+SNN VS+LI NTL++ N  +VP  T  YK+GFP WVS GDR+LLQ SSP   D+VVA
Sbjct  120   PLMSNN-VSKLISNTLSIGNGSNVPAVTNRYKEGFPTWVSPGDRKLLQ-SSPAA-DVVVA  176

Query  555   KDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYI  376
             +DGSGNYKTIK+ L AA KRSGS RFVIH+KRGVY ENL+I  KLKNIML+GDG+RYT I
Sbjct  177   QDGSGNYKTIKEGLAAAEKRSGSNRFVIHVKRGVYKENLEI--KLKNIMLLGDGLRYTII  234

Query  375   sgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGF  196
             +GSRSVVGGSTTFNSATVAVTGDGFIA+GITFRNTAGPENHQAVALRSGADLSVFY+CGF
Sbjct  235   TGSRSVVGGSTTFNSATVAVTGDGFIARGITFRNTAGPENHQAVALRSGADLSVFYRCGF  294

Query  195   EGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRT  16
             EGYQDTLY HSQRQFYK+CY+YGTVDFIFGNAAVV QNCMIYAR+PM+ QK TITAQGRT
Sbjct  295   EGYQDTLYVHSQRQFYKECYVYGTVDFIFGNAAVVLQNCMIYARRPMNGQKNTITAQGRT  354

Query  15    DPNQN  1
             DPNQN
Sbjct  355   DPNQN  359



>ref|XP_004148139.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=526

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/381 (69%), Positives = 314/381 (82%), Gaps = 15/381 (4%)
 Frame = -1

Query  1119  PAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAK  940
             PA+ G ++ WC +T +P+ CKYF  H  +  + PK  ++FKKM  + A++ A+ AE+H K
Sbjct  30    PASNG-IDWWCKKTTYPETCKYFFNHGTK--SPPKDMTDFKKMVIQFAMERALSAESHTK  86

Query  939   RLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRT  766
              +G +CRN +EKAAWADC+KLY++TILQLNQTLD   K T+FD  TWLSTALTNLETCRT
Sbjct  87    GVGSKCRNGKEKAAWADCLKLYQNTILQLNQTLDSSTKSTEFDIQTWLSTALTNLETCRT  146

Query  765   GFVELGNSRNVLPLISNNNVSQLIGNTLALNN------NGSVPKQTYKDGFPAWVSLGDR  604
             GF EL  S  +LPLI ++NV++LI N+LA+NN      NG   K+TYK GFP+W+S GDR
Sbjct  147   GFAELNVSDYILPLIMSDNVTELISNSLAINNASAGVGNG---KETYKKGFPSWLSGGDR  203

Query  603   RLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNK  424
             RLLQ+SS  K DLVVA+DGSGNY T+  AL+ A KR  SGRFVI +KRGVY ENL+IG+K
Sbjct  204   RLLQSSS-TKVDLVVAQDGSGNYTTVGAALEEAAKRKTSGRFVIQVKRGVYRENLEIGSK  262

Query  423   LKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAV  244
             +KNIML+GDGMR+T+I+G+RSV GGSTTFNSATVAVTG+GFIA+GITFRNTAGPENHQAV
Sbjct  263   MKNIMLIGDGMRFTFITGNRSVGGGSTTFNSATVAVTGEGFIARGITFRNTAGPENHQAV  322

Query  243   ALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYAR  64
             ALRSGADLSVFY+C FEGYQDTLY HSQRQFYK+CYIYGTVDFIFGNAAVV QNCMIYAR
Sbjct  323   ALRSGADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYAR  382

Query  63    KPMDKQKITITAQGRTDPNQN  1
             KPM+ QK  +TAQGRTDPNQN
Sbjct  383   KPMNGQKNAVTAQGRTDPNQN  403



>gb|KGN57272.1| hypothetical protein Csa_3G175720 [Cucumis sativus]
Length=571

 Score =   528 bits (1360),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 263/381 (69%), Positives = 314/381 (82%), Gaps = 15/381 (4%)
 Frame = -1

Query  1119  PAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAK  940
             PA+ G ++ WC +T +P+ CKYF  H  +  + PK  ++FKKM  + A++ A+ AE+H K
Sbjct  75    PASNG-IDWWCKKTTYPETCKYFFNHGTK--SPPKDMTDFKKMVIQFAMERALSAESHTK  131

Query  939   RLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRT  766
              +G +CRN +EKAAWADC+KLY++TILQLNQTLD   K T+FD  TWLSTALTNLETCRT
Sbjct  132   GVGSKCRNGKEKAAWADCLKLYQNTILQLNQTLDSSTKSTEFDIQTWLSTALTNLETCRT  191

Query  765   GFVELGNSRNVLPLISNNNVSQLIGNTLALNN------NGSVPKQTYKDGFPAWVSLGDR  604
             GF EL  S  +LPLI ++NV++LI N+LA+NN      NG   K+TYK GFP+W+S GDR
Sbjct  192   GFAELNVSDYILPLIMSDNVTELISNSLAINNASAGVGNG---KETYKKGFPSWLSGGDR  248

Query  603   RLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNK  424
             RLLQ+SS  K DLVVA+DGSGNY T+  AL+ A KR  SGRFVI +KRGVY ENL+IG+K
Sbjct  249   RLLQSSS-TKVDLVVAQDGSGNYTTVGAALEEAAKRKTSGRFVIQVKRGVYRENLEIGSK  307

Query  423   LKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAV  244
             +KNIML+GDGMR+T+I+G+RSV GGSTTFNSATVAVTG+GFIA+GITFRNTAGPENHQAV
Sbjct  308   MKNIMLIGDGMRFTFITGNRSVGGGSTTFNSATVAVTGEGFIARGITFRNTAGPENHQAV  367

Query  243   ALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYAR  64
             ALRSGADLSVFY+C FEGYQDTLY HSQRQFYK+CYIYGTVDFIFGNAAVV QNCMIYAR
Sbjct  368   ALRSGADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYAR  427

Query  63    KPMDKQKITITAQGRTDPNQN  1
             KPM+ QK  +TAQGRTDPNQN
Sbjct  428   KPMNGQKNAVTAQGRTDPNQN  448



>ref|XP_002318285.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE96505.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=520

 Score =   525 bits (1352),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 268/400 (67%), Positives = 323/400 (81%), Gaps = 8/400 (2%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             +K+ + L+   F S +S +++ N      +++ WC++TP+P+ CKYF+  + +HF  P++
Sbjct  3     TKLFISLLFICFCSLLSSSVASNHDH--DQIDYWCNKTPNPEPCKYFMKQNPKHFV-PQQ  59

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE-  835
             KS+F+K+A E+++  A  A +H K LG +CRN +E+AAWADC+ LYEDTI++LN TLD  
Sbjct  60    KSDFRKLAIELSMQRAHTALSHNKGLGSKCRNEKERAAWADCLSLYEDTIVELNHTLDSH  119

Query  834   -KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSV  658
              KCT FDA TWLSTALTNLETC+ GF + G S  +LPL+SNN VS+LI N+LAL +N S 
Sbjct  120   TKCTDFDAQTWLSTALTNLETCKAGFKDFGVSDFMLPLMSNN-VSKLIRNSLALKDNASS  178

Query  657   -PKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGR  481
              P QTY DGFP+WV  GDR+LL ASS    +LVVA+DGSGN++TIK ALDAA KRSGSGR
Sbjct  179   NPPQTYNDGFPSWVKPGDRKLLLASSSTS-NLVVAQDGSGNHRTIKAALDAAAKRSGSGR  237

Query  480   FVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGF  301
             FVI IK GVY ENLDIG  LKNIMLVGDG++ T I+GSRSV GGSTTFNSATVAVTG GF
Sbjct  238   FVIRIKSGVYRENLDIGKNLKNIMLVGDGLKNTIITGSRSVGGGSTTFNSATVAVTGGGF  297

Query  300   IAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTV  121
             IA+GITFRNTAGP+NHQAVALRSGADLSVFY+CGFEGYQDTLY HSQRQFYK+C IYGTV
Sbjct  298   IARGITFRNTAGPQNHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECDIYGTV  357

Query  120   DFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             DFIFGNAAVV QNCMIYAR+PMDKQK  +TAQGRTD NQN
Sbjct  358   DFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDANQN  397



>ref|XP_011076334.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Sesamum indicum]
Length=475

 Score =   523 bits (1347),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 268/355 (75%), Positives = 310/355 (87%), Gaps = 8/355 (2%)
 Frame = -1

Query  1050  LTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYE  871
             ++H+ R F  PK KS+F+KMA ++AL+ A++A  + K LG +CRN REKAAWADCVKLY+
Sbjct  1     MSHNPRRF-VPKHKSDFRKMAVQLALERAIRAGDNTKSLGHKCRNEREKAAWADCVKLYD  59

Query  870   DTILQLNQTLD--EKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQL  697
             + I QLN+T+D   KCT FDA TWLSTALTNLETCRTGFVELG S  VLPL+SNN VS+L
Sbjct  60    NAIEQLNKTIDPNTKCTDFDAQTWLSTALTNLETCRTGFVELGVSDFVLPLMSNN-VSKL  118

Query  696   IGNTLALNNNGSVPKQT--YKD-GFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTI  526
             I NTLAL +N +  + +  YKD GFP WVS GDRRLLQ+SS V+P+LVVA+DGSGNY+TI
Sbjct  119   ICNTLALGSNKTTHETSGYYKDDGFPTWVSPGDRRLLQSSS-VRPNLVVAQDGSGNYRTI  177

Query  525   KDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggS  346
             K ALDAA  RSGSGRFVIH+KRGVY ENL+IG+KL+NIMLVGDGM+YT I+GSRSV GGS
Sbjct  178   KAALDAAAGRSGSGRFVIHVKRGVYRENLEIGSKLRNIMLVGDGMKYTIITGSRSVGGGS  237

Query  345   TTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAH  166
             TTFNSATVAVTG+GFIA+GITFRNTAGP+NHQAVALRSG+DLSVFY+CGFEGYQDTLY H
Sbjct  238   TTFNSATVAVTGEGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVH  297

Query  165   SQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             SQRQFYK+CY++GTVDFIFGNAAVV QNCMIYAR+PMDKQK TITAQGRTDPNQN
Sbjct  298   SQRQFYKECYVFGTVDFIFGNAAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQN  352



>ref|XP_004160886.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=742

 Score =   532 bits (1371),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 263/381 (69%), Positives = 314/381 (82%), Gaps = 15/381 (4%)
 Frame = -1

Query  1119  PAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAK  940
             PA+ G ++ WC +T +P+ CKYF  H  +  + PK  ++FKKM  + A++ A+ AE+H K
Sbjct  246   PASNG-IDWWCKKTTYPETCKYFFNHGTK--SPPKDMTDFKKMVIQFAMERALSAESHTK  302

Query  939   RLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRT  766
              +G +CRN +EKAAWADC+KLY++TILQLNQTLD   K T+FD  TWLSTALTNLETCRT
Sbjct  303   GVGSKCRNGKEKAAWADCLKLYQNTILQLNQTLDSSTKSTEFDIQTWLSTALTNLETCRT  362

Query  765   GFVELGNSRNVLPLISNNNVSQLIGNTLALNN------NGSVPKQTYKDGFPAWVSLGDR  604
             GF EL  S  +LPLI ++NV++LI N+LA+NN      NG   K+TYK GFP+W+S GDR
Sbjct  363   GFAELNVSDYILPLIMSDNVTELISNSLAINNASAGVGNG---KETYKKGFPSWLSGGDR  419

Query  603   RLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNK  424
             RLLQ+SS  K DLVVA+DGSGNY T+  AL+ A KR  SGRFVI +KRGVY ENL+IG+K
Sbjct  420   RLLQSSS-TKVDLVVAQDGSGNYTTVAAALEEAAKRKTSGRFVIQVKRGVYRENLEIGSK  478

Query  423   LKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAV  244
             +KNIML+GDGMR+T+I+G+RSV GGSTTFNSATVAVTG+GFIA+GITFRNTAGPENHQAV
Sbjct  479   MKNIMLIGDGMRFTFITGNRSVGGGSTTFNSATVAVTGEGFIARGITFRNTAGPENHQAV  538

Query  243   ALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYAR  64
             ALRSGADLSVFY+C FEGYQDTLY HSQRQFYK+CYIYGTVDFIFGNAAVV QNCMIYAR
Sbjct  539   ALRSGADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYAR  598

Query  63    KPMDKQKITITAQGRTDPNQN  1
             KPM+ QK  +TAQGRTDPNQN
Sbjct  599   KPMNGQKNAVTAQGRTDPNQN  619



>ref|XP_008439095.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=571

 Score =   519 bits (1337),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 257/378 (68%), Positives = 310/378 (82%), Gaps = 9/378 (2%)
 Frame = -1

Query  1119  PAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAK  940
             PA+ G ++ WC +T +P+ CKYF  H  +  + PK  ++FKKM  + A++ A+ AE+H K
Sbjct  75    PASNG-IDWWCKKTTYPETCKYFFNHGTK--SPPKDMTDFKKMVIQFAMERALSAESHTK  131

Query  939   RLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRT  766
              +G +CRN +EKAAWADC+KLY++TILQLNQTLD   K T+FD  TWLSTALTNLETCRT
Sbjct  132   GVGSKCRNGKEKAAWADCLKLYQNTILQLNQTLDSSTKRTEFDIQTWLSTALTNLETCRT  191

Query  765   GFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSV---PKQTYKDGFPAWVSLGDRRLL  595
             GF EL     + PLI ++NV++LI N+LA+NN  +     K TYK GFP+W+S GDRRLL
Sbjct  192   GFAELNVLDYIWPLIMSDNVTKLISNSLAINNASAAVGNGKVTYKKGFPSWLSGGDRRLL  251

Query  594   QASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKN  415
             Q++S  K DLVVA+DGSGNY T+  AL+ A KR  SGRFVI +KRGVY ENL+IG+K+KN
Sbjct  252   QSAS-TKVDLVVAQDGSGNYTTVGAALEEAAKRKTSGRFVIQVKRGVYRENLEIGSKMKN  310

Query  414   IMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALR  235
             IML+GDGMR+T+I+G+RSV GGSTTFNSATVAVTG+GFIA+GITF+NTAGPENHQAVALR
Sbjct  311   IMLIGDGMRFTFITGNRSVGGGSTTFNSATVAVTGEGFIARGITFQNTAGPENHQAVALR  370

Query  234   SGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPM  55
             SGADLSVFY+C FEGYQDTLY HSQRQFYK+CYIYGTVDFIFGNAAVV QNCMIYARKPM
Sbjct  371   SGADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARKPM  430

Query  54    DKQKITITAQGRTDPNQN  1
             + QK  +TAQGRTDPNQN
Sbjct  431   NGQKNAVTAQGRTDPNQN  448



>ref|XP_010264199.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   518 bits (1333),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 260/388 (67%), Positives = 318/388 (82%), Gaps = 10/388 (3%)
 Frame = -1

Query  1149  FISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALD  970
              +S A S + P   G VN WC++TP+PD CK  +    R   APKRK EF+KM+ + A++
Sbjct  22    ILSAAASHDVP---GGVNWWCNRTPYPDTCKSSMNPDPRS-NAPKRKHEFRKMSLQAAME  77

Query  969   TAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD--EKCTQFDALTWLST  796
              A++AE+H K LGP+CRN REK AWADC++LY++T+LQLN TL+   + T  D  TWLST
Sbjct  78    RALRAESHTKWLGPKCRNKREKVAWADCLQLYQNTVLQLNTTLNPYSRYTDVDVQTWLST  137

Query  795   ALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPK-QTYKDGFPAWV  619
             ALTNLETC+TGF+ELG S  +LPL+SNN VS+LI NTLA+NNN +  + Q+Y  G+P+WV
Sbjct  138   ALTNLETCKTGFIELGVSDFMLPLMSNN-VSKLISNTLAINNNATTTQNQSYTGGYPSWV  196

Query  618   SLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGK-RSGSGRFVIHIKRGVYNE  445
             S GDR+LLQ+SSP  + ++VVA+DGSGN++TIK+AL AA + R+GSGRFVI++K+G Y E
Sbjct  197   SAGDRKLLQSSSPASQANIVVAQDGSGNFRTIKEALSAASQQRTGSGRFVIYVKKGAYIE  256

Query  444   NLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAG  265
             NL+IG+ L+NIMLVGDGMR T I+G+RSV GGSTTFNSATVAVTG GFIA GITFRNTAG
Sbjct  257   NLEIGSSLQNIMLVGDGMRNTIITGNRSVGGGSTTFNSATVAVTGQGFIAMGITFRNTAG  316

Query  264   PENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQ  85
             PENHQAVALRSG+DLSVFY+CGFEGYQDTLY HSQRQ YK+CYIYGTVDFIFGNAAVV Q
Sbjct  317   PENHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQLYKECYIYGTVDFIFGNAAVVLQ  376

Query  84    NCMIYARKPMDKQKITITAQGRTDPNQN  1
             NCMI+AR+PMD Q   +TAQGRTDPNQN
Sbjct  377   NCMIFARRPMDNQNNVVTAQGRTDPNQN  404



>ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF51542.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=455

 Score =   514 bits (1325),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 259/334 (78%), Positives = 291/334 (87%), Gaps = 5/334 (1%)
 Frame = -1

Query  993  MATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD--EKCTQF  820
            MA ++A+  A+ A++H K LG +CRN +EKAAWADC+KLYEDTI+QLN TLD   KCT +
Sbjct  1    MAIDLAMQRAITAQSHNKYLGSKCRNEKEKAAWADCLKLYEDTIIQLNHTLDPNTKCTDY  60

Query  819  DALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN-NGSVPKQTY  643
            DA TWLSTALTNLETCR GFVELG S  +LPL+SNN VS+LIGNTLA+NN + S   QTY
Sbjct  61   DAQTWLSTALTNLETCRAGFVELGVSDFMLPLMSNN-VSKLIGNTLAINNGSSSASPQTY  119

Query  642  KDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIK  463
            KDGFP+WV  GDR+LLQ SS   P+LVVA+DGSGNY+TIK ALDAA KRSG GRFVI IK
Sbjct  120  KDGFPSWVKPGDRKLLQTSSST-PNLVVAQDGSGNYRTIKQALDAAAKRSGKGRFVIRIK  178

Query  462  RGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGIT  283
             G+Y ENL+IGNK+KNIMLVGDG+R T I+GSRSV GGSTTFNSATVAVTG+GFIA GIT
Sbjct  179  SGIYRENLEIGNKMKNIMLVGDGLRNTIITGSRSVGGGSTTFNSATVAVTGEGFIASGIT  238

Query  282  FRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGN  103
            FRNTAGP+NHQAVALRSG+DLSVFY+CGFEGYQDTLY HSQRQFYK+CYIYGTVDFIFGN
Sbjct  239  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYIHSQRQFYKECYIYGTVDFIFGN  298

Query  102  AAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
            AAVV QNCMIYAR+PMDKQK TITAQGRTDPNQN
Sbjct  299  AAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQN  332



>ref|XP_010062184.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=519

 Score =   512 bits (1318),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 253/370 (68%), Positives = 307/370 (83%), Gaps = 9/370 (2%)
 Frame = -1

Query  1092  WCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNA  913
             WC++TP+P+QCKYF+ ++ R F  P R SEF+KMA E+A++ A+QA++H K LGP+CR  
Sbjct  30    WCNKTPYPEQCKYFMQNAPRRFV-PARMSEFRKMAVEMAMEGALQAQSHNKWLGPKCRGH  88

Query  912   REKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNV  733
             +E+AAWADC+KLY++TI +LN+T  + CT  D  TWLS ALTNL+TCRTGF ELG +  V
Sbjct  89    KERAAWADCLKLYQETIHRLNRTAGD-CTDSDQQTWLSAALTNLDTCRTGFAELGVADYV  147

Query  732   LPLISNNNVSQLIGNTLALNNN----GSVPKQTYKDG--FPAWVSLGDRRLLQASSPVKP  571
               L+ N+NV++LI N LAL NN     +    T+ DG  FP+WV+ G RRLLQ++SP  P
Sbjct  148   FQLMYNSNVTKLISNALALKNNNASSSATQDTTHNDGQGFPSWVTAGVRRLLQSASPT-P  206

Query  570   DLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGM  391
             D+ VA+DGSGN++TI+ ALDAA KRSGS RFVI++KRGVY ENL IG+ L NIM+VGDG+
Sbjct  207   DVTVAQDGSGNFRTIQQALDAAAKRSGSKRFVIYVKRGVYQENLVIGSGLDNIMMVGDGL  266

Query  390   RYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVF  211
             R+T I+GSRSV GGSTTFNSATVAVTGDGFIA+GITFRNTAGP+NHQAVALRSG+DLSVF
Sbjct  267   RFTVITGSRSVGGGSTTFNSATVAVTGDGFIARGITFRNTAGPQNHQAVALRSGSDLSVF  326

Query  210   YKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITIT  31
             Y+CGFEGYQDTLY HS+RQFYK+CYIYGTVDFIFGNAAVV QNCMIYAR+PM  QK TIT
Sbjct  327   YRCGFEGYQDTLYVHSERQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMSGQKNTIT  386

Query  30    AQGRTDPNQN  1
             AQGRTDPNQN
Sbjct  387   AQGRTDPNQN  396



>ref|XP_009340592.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   503 bits (1295),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 265/396 (67%), Positives = 317/396 (80%), Gaps = 12/396 (3%)
 Frame = -1

Query  1176  FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFK  997
             F++  SF  F S ALS         ++ WC +TP+P+ CKY +T   +  + PK+ S FK
Sbjct  8     FVLCVSFVLFFSHALS---NILHTSIDSWCEKTPYPETCKYTMTQDEKSLSIPKQLSNFK  64

Query  996   KMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD--EKCTQ  823
             K+A ++ L+ A++A++H K L  +CRN +E+AAWADC+ LYE+TI  LNQT+D   KCT 
Sbjct  65    KLAVQVTLERALKAQSHNKWLREKCRNKKERAAWADCMSLYEETIKLLNQTIDPATKCTD  124

Query  822   FDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQT-  646
             +D  TWLSTALTNL+TCR GFVEL  S  V PL+SNN VS+LI NTL+L N+ +V   T 
Sbjct  125   YDTQTWLSTALTNLDTCRAGFVELAVSDFVFPLMSNN-VSKLISNTLSLWNSSNVSPLTN  183

Query  645   -YKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIH  469
              Y +G+P+WVS G+R+LLQ S+P   D+VVA+DGSGNYKTIK ALDAA  RSGS RFVIH
Sbjct  184   MYTEGYPSWVSPGNRKLLQ-STPT-ADVVVAQDGSGNYKTIKAALDAAAARSGSKRFVIH  241

Query  468   IKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQG  289
             +KRGVY ENL+I  KLKNI L+GDG+RYT I+GSRSVVGGSTTF SATVAVTG+GFIA+G
Sbjct  242   VKRGVYKENLEI--KLKNIYLLGDGLRYTIITGSRSVVGGSTTFKSATVAVTGEGFIARG  299

Query  288   ITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIF  109
             ITFRNTAGPENHQAVALRSGADLSVFY+CGFEGYQDTLY HSQRQFY++CY+YGTVDFIF
Sbjct  300   ITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYTHSQRQFYRECYVYGTVDFIF  359

Query  108   GNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             GNAAVVFQNCMIYARKPM  Q+ TITAQGRTDPNQN
Sbjct  360   GNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQN  395



>ref|XP_009374493.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   502 bits (1293),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 264/396 (67%), Positives = 317/396 (80%), Gaps = 12/396 (3%)
 Frame = -1

Query  1176  FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFK  997
             F++  SF  F S ALS         ++ WC +TP+P+ CKY +T   +  + PK+ S FK
Sbjct  8     FVLCVSFVLFFSHALS---NILHTSIDSWCEKTPYPETCKYTMTQDEKSLSIPKQLSNFK  64

Query  996   KMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD--EKCTQ  823
             ++A ++ L+ A++A++H K L  +CRN +E+AAWADC+ LYE+TI  LNQT+D   KCT 
Sbjct  65    RLAVQVTLERALKAQSHNKWLREKCRNKKERAAWADCMSLYEETIKLLNQTIDPATKCTD  124

Query  822   FDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQT-  646
             +D  TWLSTALTNL+TCR GFVEL  S  V PL+SNN VS+LI NTL+L N+ +V   T 
Sbjct  125   YDTQTWLSTALTNLDTCRAGFVELAVSDFVFPLMSNN-VSKLISNTLSLWNSSNVSPLTN  183

Query  645   -YKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIH  469
              Y +G+P+WVS G+R+LLQ S+P   D+VVA+DGSGNYKTIK ALDAA  RSGS RFVIH
Sbjct  184   MYTEGYPSWVSPGNRKLLQ-STPT-ADVVVAQDGSGNYKTIKAALDAAAARSGSKRFVIH  241

Query  468   IKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQG  289
             +KRGVY ENL+I  KLKNI L+GDG+RYT I+GSRSVVGGSTTF SATVAVTG+GFIA+G
Sbjct  242   VKRGVYKENLEI--KLKNIYLLGDGLRYTIITGSRSVVGGSTTFKSATVAVTGEGFIARG  299

Query  288   ITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIF  109
             ITFRNTAGPENHQAVALRSGADLSVFY+CGFEGYQDTLY HSQRQFY++CY+YGTVDFIF
Sbjct  300   ITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYTHSQRQFYRECYVYGTVDFIF  359

Query  108   GNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             GNAAVVFQNCMIYARKPM  Q+ TITAQGRTDPNQN
Sbjct  360   GNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQN  395



>ref|XP_008377824.1| PREDICTED: pectinesterase 2-like [Malus domestica]
Length=518

 Score =   500 bits (1288),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 264/396 (67%), Positives = 315/396 (80%), Gaps = 12/396 (3%)
 Frame = -1

Query  1176  FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFK  997
             F++  SF  F S ALS         ++ WC +TP+P+ CKY +T   +  + PK+ S FK
Sbjct  8     FVLCVSFVLFFSPALS---NILHSSIDSWCKKTPYPETCKYTMTQDEKSLSIPKQLSNFK  64

Query  996   KMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD--EKCTQ  823
             K+A ++ L+ A++A++H K LG +CRN +E+AAWADC+ LYE+TI  LNQT+D   K T 
Sbjct  65    KLAVQVTLERALKAQSHNKWLGQKCRNKKERAAWADCMSLYEETIKLLNQTIDPATKSTD  124

Query  822   FDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQT-  646
             +D  TWLSTALTNL+TCR GFVEL  S  V PL+SNN VS+LI NTL+L N+ +V   T 
Sbjct  125   YDTQTWLSTALTNLDTCRAGFVELEVSDFVFPLMSNN-VSKLISNTLSLWNSSNVSPVTX  183

Query  645   -YKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIH  469
              Y +G+P+WVS GDR+LLQ S+P   D+VVA+DGSGNYKTIK ALDAA  R GS RFVIH
Sbjct  184   MYTEGYPSWVSPGDRKLLQ-STPTA-DVVVAQDGSGNYKTIKAALDAAAARGGSKRFVIH  241

Query  468   IKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQG  289
             +KRGVY ENL+I  KLK I L+GDG+RYT I+GSRSVVGGSTTF SATVAVTG+GFIA+G
Sbjct  242   VKRGVYKENLEI--KLKXIYLLGDGLRYTIITGSRSVVGGSTTFKSATVAVTGEGFIARG  299

Query  288   ITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIF  109
             ITFRNTAGPENHQAVALRSGADLSVFY+CGFEGYQDTLY HSQRQFY++CY+YGTVDFIF
Sbjct  300   ITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYTHSQRQFYRECYVYGTVDFIF  359

Query  108   GNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             GNAAVVFQNCMIYARKPM  Q+ TITAQGRTDPNQN
Sbjct  360   GNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQN  395



>ref|XP_008436965.1| PREDICTED: pectinesterase 2-like [Cucumis melo]
Length=519

 Score =   495 bits (1274),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 250/399 (63%), Positives = 310/399 (78%), Gaps = 9/399 (2%)
 Frame = -1

Query  1188  KIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRK  1009
             K+H  ++L S     S +L  +       ++ WCS+TP+PD CK F    +     PK  
Sbjct  4     KLHFSILLFSLFILSSTSLPFSTKTNKKAIDLWCSRTPYPDVCKNFFNDGQFD---PKNL  60

Query  1008  SEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEKC  829
              + +K A +IA++ A++ ET  K LG +CRN +E+AAWADC++LY+ TIL LN+T  + C
Sbjct  61    LDIQKTALKIAMERAIRTETLTKALGQKCRNKKERAAWADCLELYQTTILHLNKTFSDHC  120

Query  828   TQFDALTWLSTALTNLETCRTGFVELG--NSRNVLPLISNNNVSQLIGNTLALNN-NGSV  658
             + FD  TWLS+ALTNL+TCR GFV+LG  +   V P ++NNN+++LI N+LA+NN + S 
Sbjct  121   SNFDIQTWLSSALTNLDTCRAGFVDLGIKDYGVVFPFLANNNITKLISNSLAMNNCSESD  180

Query  657   PKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRF  478
                T  +GFP WV  GDRRLLQA+ P K DLVVA+DGSGNYKT++ A+DAAGKR GSGRF
Sbjct  181   EGNTSDEGFPKWVRGGDRRLLQAAEP-KADLVVAQDGSGNYKTVQAAVDAAGKRKGSGRF  239

Query  477   VIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFI  298
             VI IK+GVY EN+ I  K+KN+MLVGDG+RYT I+GSRSV GGSTTFNSATVAVTG+ FI
Sbjct  240   VIRIKKGVYKENVVI--KVKNLMLVGDGLRYTIITGSRSVGGGSTTFNSATVAVTGERFI  297

Query  297   AQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVD  118
             A+GITFRNTAGP+NHQAVALRSGADLSVF++CGFEGYQDTLYAHSQRQFY++CYIYGT+D
Sbjct  298   ARGITFRNTAGPQNHQAVALRSGADLSVFFRCGFEGYQDTLYAHSQRQFYRECYIYGTID  357

Query  117   FIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             FIFGNAAVV QNCMIYARKPM  Q+  +TAQGRTDPNQN
Sbjct  358   FIFGNAAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQN  396



>gb|AFW03484.1| pectin methylesterase 5 [Gossypium hirsutum]
Length=519

 Score =   489 bits (1260),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 259/395 (66%), Positives = 311/395 (79%), Gaps = 19/395 (5%)
 Frame = -1

Query  1146  ISVALSVNP----PAAAG----EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKM  991
             I VALS+ P    P A G    +V  WC +TP+P  C+YFL+H  ++ T  K +S+F K+
Sbjct  8     ILVALSLVPFFLFPVALGYRANDVRSWCRKTPNPQPCEYFLSHDPKN-TPIKDESQFFKI  66

Query  990   ATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFD  817
             +  +AL+ A +AE++   LGP+CRN RE AAW+DCV LYE TIL+LN+T+D      + D
Sbjct  67    SMHLALERAARAESNTHSLGPKCRNGREMAAWSDCVNLYELTILRLNKTVDSGTNLNKDD  126

Query  816   ALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ--TY  643
             A TWLSTALTNLETC+TGF+ELG    +LP++SNN VSQLI NTLALN     P Q  TY
Sbjct  127   AQTWLSTALTNLETCQTGFMELGVPDYLLPMMSNN-VSQLISNTLALNK---APYQEPTY  182

Query  642   KDGFPAWVSLGDRRLLQASSPVK-PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHI  466
             KDGFP WV  GDR+LLQ+SSP    ++VVA+DGSGNYKTIKDA+ AA KRSGSGR+VI++
Sbjct  183   KDGFPTWVKPGDRKLLQSSSPASTANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYV  242

Query  465   KRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGI  286
             K G Y EN++IG+KLKNIM+VGDG+  T I+GS+SV GGSTTFNSATVAV GDGFIA+GI
Sbjct  243   KAGTYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGI  302

Query  285   TFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFG  106
             TFRNTAGP NHQAVALRSG+DLSVFYKC FEGYQDTLY HS+RQFY++C IYGTVD+IFG
Sbjct  303   TFRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFG  362

Query  105   NAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             NAAVVFQNC IYAR P +K   T+TAQGRTDPNQN
Sbjct  363   NAAVVFQNCNIYARNPPNKTN-TVTAQGRTDPNQN  396



>ref|XP_010056337.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   488 bits (1255),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 250/394 (63%), Positives = 311/394 (79%), Gaps = 8/394 (2%)
 Frame = -1

Query  1170  VLASFSSFISVALSVNPPAAA---GEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEF  1000
             +L  F +F+ ++L ++P  +    G+   WCS+ P+P  C+YFLTH+ ++    K+KS+F
Sbjct  3     LLQKFITFVFLSLVISPSTSGFSTGDAKSWCSKMPYPQPCEYFLTHNPKNIPI-KQKSDF  61

Query  999   KKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQF  820
              K++ ++ L+ A++A ++A  LG +CRN REKA WADC++LYE TIL+LN+T+D KCTQ 
Sbjct  62    LKVSKQLVLERALRAHSNAYSLGSKCRNEREKAVWADCLELYEQTILRLNRTVDLKCTQE  121

Query  819   DALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYK  640
             D  TWLSTALTNLETCRTGFVELG S  VLPL+SNN V++LI NTLALN+    P  +Y 
Sbjct  122   DVQTWLSTALTNLETCRTGFVELGVSDYVLPLMSNN-VTKLISNTLALNHVPYKPP-SYT  179

Query  639   DGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIK  463
             +G+P WV  GDR+LLQ+SSP  K ++VVAKDGSG YKTIK+A+ AA KR G+ R+VI++K
Sbjct  180   NGYPNWVRPGDRKLLQSSSPSSKANIVVAKDGSGKYKTIKEAITAASKRFGTARYVIYVK  239

Query  462   RGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGIT  283
              G Y EN+++G+KLKNIM VGDG+  T I+GSRSV GGSTTF SATVAV GDGFIA+ IT
Sbjct  240   AGTYKENIEVGSKLKNIMFVGDGIGKTIITGSRSVGGGSTTFKSATVAVVGDGFIARDIT  299

Query  282   FRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGN  103
             FRNTAG  NHQAVALRSG+DLSVFYKC FEGYQDTLY HS+RQFY++C IYGTVDFIFGN
Sbjct  300   FRNTAGAANHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGN  359

Query  102   AAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             AAVVFQNC IY R P +K   TITAQGRTDPNQN
Sbjct  360   AAVVFQNCNIYPRNPPNKTN-TITAQGRTDPNQN  392



>ref|XP_004143735.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN50327.1| hypothetical protein Csa_5G167190 [Cucumis sativus]
Length=520

 Score =   487 bits (1254),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 247/400 (62%), Positives = 308/400 (77%), Gaps = 10/400 (3%)
 Frame = -1

Query  1188  KIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRK  1009
             K+H  ++L S     S +L  +       +  WCS+TP+PD CK+F  +       P+  
Sbjct  4     KLHFSIILFSMFILSSSSLPFSTKTNNKAIELWCSRTPYPDVCKHFFNNGEFD---PRNL  60

Query  1008  SEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL-DEK  832
              + KK A +IA++ A++ ET  K LG +CRN +E+AAWADC++LY+ TIL LN+T  D+ 
Sbjct  61    LDIKKAALKIAMERAMKTETLTKALGQKCRNKKERAAWADCLELYQTTILHLNKTFSDKN  120

Query  831   CTQFDALTWLSTALTNLETCRTGFVELG--NSRNVLPLISNNNVSQLIGNTLALNN-NGS  661
             C+ FD  TWLS+ALTNL TCR GFV+LG  +   V P + NNN+++LI N+LA+NN + S
Sbjct  121   CSNFDIQTWLSSALTNLHTCRAGFVDLGIKDYGVVFPFLENNNITKLISNSLAMNNCSES  180

Query  660   VPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGR  481
                 T  +GFP W+  GDRRLLQA+ P K DLVVA+DGSGNYKT++ A+DAAGKR GSGR
Sbjct  181   DEGNTSDEGFPKWLHGGDRRLLQAAEP-KADLVVAQDGSGNYKTVQAAVDAAGKRKGSGR  239

Query  480   FVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGF  301
             FVI +K+GVY EN+ I  K+KN+MLVGDG++YT I+GSRSV GGSTTFNSATVAVTG+ F
Sbjct  240   FVIRVKKGVYKENVVI--KVKNLMLVGDGLKYTIITGSRSVGGGSTTFNSATVAVTGERF  297

Query  300   IAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTV  121
             IA+GITFRNTAGP+NHQAVALRSGADLSVF++CGFEGYQDTLY HSQRQFY++CYIYGTV
Sbjct  298   IARGITFRNTAGPQNHQAVALRSGADLSVFFRCGFEGYQDTLYVHSQRQFYRECYIYGTV  357

Query  120   DFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             DFIFGN+AVV QNCMIYARKPM  Q+  +TAQGRTDPNQN
Sbjct  358   DFIFGNSAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQN  397



>gb|KHG19575.1| Uncharacterized protein F383_07269 [Gossypium arboreum]
Length=519

 Score =   487 bits (1253),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 257/393 (65%), Positives = 309/393 (79%), Gaps = 15/393 (4%)
 Frame = -1

Query  1146  ISVALSVNP----PAAAG----EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKM  991
             I VALS+ P    P A G    +V  WC +TP+P  C+YFL+H  +  T  K + +F K+
Sbjct  8     ILVALSLVPVFLFPVALGYRANDVRSWCRKTPNPQPCEYFLSHDPKK-TPIKDEFQFFKI  66

Query  990   ATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFD  817
             +T +AL+ A +AE++   LG +CRN REKAAW+DCV LYE TIL+LN+T+D      + D
Sbjct  67    STHLALERAARAESNTHSLGTKCRNEREKAAWSDCVNLYELTILRLNKTVDSGTNLNKDD  126

Query  816   ALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKD  637
             A TWLSTALTNLETCRTGF+ELG    +LP++SNN VSQLI NTLALN      + TYKD
Sbjct  127   AQTWLSTALTNLETCRTGFMELGVPDYLLPMMSNN-VSQLISNTLALNK-APYKEPTYKD  184

Query  636   GFPAWVSLGDRRLLQASSPVK-PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKR  460
             GFP WV  GDR+LLQ+SSP    ++VVA+DGSGNYKTIKDA+ AA KRSGSGR+VI++K 
Sbjct  185   GFPTWVKPGDRKLLQSSSPASTANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKA  244

Query  459   GVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITF  280
             G Y EN++IG+KLKNIM+VGDG+  T I+GS+SV GGSTTFNSATVAV GDGFIA+GITF
Sbjct  245   GTYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITF  304

Query  279   RNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNA  100
             RNTAGP NHQAVALRSG+DLSVFYKC FEGYQDTLY HS+RQFY++C IYGTVD+IFGNA
Sbjct  305   RNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGNA  364

Query  99    AVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             AVVFQ+C IYAR P +K   T+TAQGRTDPNQN
Sbjct  365   AVVFQDCNIYARNPPNKTN-TVTAQGRTDPNQN  396



>gb|AFW03479.1| pectin methylesterase 5 [Gossypium barbadense]
Length=519

 Score =   486 bits (1252),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 257/393 (65%), Positives = 308/393 (78%), Gaps = 15/393 (4%)
 Frame = -1

Query  1146  ISVALSVNP----PAAAG----EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKM  991
             I VALS+ P    P   G    +V  WC +TP+P  C+YFL+H  +  T  K + +F K+
Sbjct  8     ILVALSLVPVFLFPVTLGYRANDVRSWCRKTPNPQPCEYFLSHDPKK-TPIKDEFQFFKI  66

Query  990   ATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEKCT--QFD  817
             +T +AL+ A +AE++   LG +CRN REKAAW+DCV LYE TIL+LN+T+D      + D
Sbjct  67    STHLALERAARAESNTHSLGTKCRNEREKAAWSDCVNLYELTILRLNKTVDSGTNHNKDD  126

Query  816   ALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKD  637
             A TWLSTALTNLETCRTGF+ELG    +LP++SNN VSQLI NTLALN      + TYKD
Sbjct  127   AQTWLSTALTNLETCRTGFMELGVPDYLLPMMSNN-VSQLISNTLALNK-APYKEPTYKD  184

Query  636   GFPAWVSLGDRRLLQASSPVK-PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKR  460
             GFP WV  GDR+LLQ+SSP    ++VVA+DGSGNYKTIKDA+ AA KRSGSGR+VI++K 
Sbjct  185   GFPTWVKPGDRKLLQSSSPASTANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKA  244

Query  459   GVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITF  280
             G Y EN++IG+KLKNIM+VGDG+  T I+GS+SV GGSTTFNSATVAV GDGFIA+GITF
Sbjct  245   GTYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITF  304

Query  279   RNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNA  100
             RNTAGP NHQAVALRSG+DLSVFYKC FEGYQDTLY HS+RQFY++C IYGTVD+IFGNA
Sbjct  305   RNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGNA  364

Query  99    AVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             AVVFQNC IYAR P +K   T+TAQGRTDPNQN
Sbjct  365   AVVFQNCNIYARNPPNKTN-TVTAQGRTDPNQN  396



>gb|AER38244.1| PME5 [Gossypium barbadense]
Length=519

 Score =   486 bits (1251),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 256/393 (65%), Positives = 308/393 (78%), Gaps = 15/393 (4%)
 Frame = -1

Query  1146  ISVALSVNP----PAAAG----EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKM  991
             I VALS+ P    P   G    +V  WC +TP+P  C+YFL+H  +  T  K + +F K+
Sbjct  8     ILVALSLVPVFLFPVTLGYRANDVRSWCRKTPNPQPCEYFLSHDPKK-TPTKDEFQFFKI  66

Query  990   ATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFD  817
              T +AL+ A +AE++   LG +CR+ REKAAW+DCV LYE TIL+LN+T+D      + D
Sbjct  67    PTHLALERAARAESNTHSLGTKCRSEREKAAWSDCVNLYELTILRLNKTVDSGTNLNKDD  126

Query  816   ALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKD  637
             A TWLSTALTNLETCRTGF+ELG   ++LP++SNN VSQLI NTLALN      + TYKD
Sbjct  127   AQTWLSTALTNLETCRTGFMELGVPDHLLPMMSNN-VSQLISNTLALNK-APYKEPTYKD  184

Query  636   GFPAWVSLGDRRLLQASSPVK-PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKR  460
             GFP WV  GDR+LLQ+SSP    ++VVA+DGSGNYKTIKDA+ AA KRSGSGR+VI++K 
Sbjct  185   GFPTWVKPGDRKLLQSSSPASTANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKA  244

Query  459   GVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITF  280
             G Y EN++IG+KLKNIM+VGDG+  T I+GS+SV GGSTTFNSATVAV GDGFIA+GITF
Sbjct  245   GTYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITF  304

Query  279   RNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNA  100
             RNTAGP NHQAVALRSG+DLSVFYKC FEGYQDTLY HS+RQFY++C IYGTVD+IFGNA
Sbjct  305   RNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGNA  364

Query  99    AVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             AVVFQNC IYAR P +K   T+TAQGRTDPNQN
Sbjct  365   AVVFQNCNIYARNPPNKTN-TVTAQGRTDPNQN  396



>ref|XP_009628696.1| PREDICTED: pectinesterase 2 [Nicotiana tomentosiformis]
Length=549

 Score =   487 bits (1253),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 252/404 (62%), Positives = 314/404 (78%), Gaps = 9/404 (2%)
 Frame = -1

Query  1200  LEMSKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTA  1021
             + MS I+L   L   SSF   + +    AA   +  WC QTPHP  C+YFLT + ++ T 
Sbjct  28    ITMSNIYLIFPLLFVSSFFFPSTNGYSQAA---IKFWCIQTPHPQPCEYFLTQNPKYSTP  84

Query  1020  PKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL  841
               +KS+F K++ E+ALD A++A+T+A  LG +CRN REKAAWADC++LYE+TI ++  T+
Sbjct  85    INKKSDFLKVSLELALDRALRAQTNAYSLGSKCRNEREKAAWADCLELYENTIHKIKSTV  144

Query  840   --DEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNN  667
               + KCT  DA +WLSTALTNLETCR GF ELG +  V+PL+SNN VS LI NTL+LN+ 
Sbjct  145   GPNTKCTAADAQSWLSTALTNLETCRAGFEELGVTDYVMPLMSNN-VSSLISNTLSLNHG  203

Query  666   G-SVPKQTYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKRS  493
               + P  T  DGFP WV+LGDR+LLQ+SSP  + ++VVAKDGSGN+KT+K+A+ AAGKR 
Sbjct  204   YYTEPTATQVDGFPTWVALGDRKLLQSSSPASQANIVVAKDGSGNFKTVKEAVAAAGKRK  263

Query  492   GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVT  313
             GS RFVI++K G+Y+EN+D+G+KLKNIMLVGDG+  T I+GS+SV GGSTTF SATVAV 
Sbjct  264   GSARFVIYVKAGIYSENVDLGSKLKNIMLVGDGIGKTIITGSKSVGGGSTTFKSATVAVV  323

Query  312   GDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYI  133
             GDGFI +GIT RNTAGP NHQAVALRSG+DLSVFY+C FEGYQDTLY HS RQFY++C I
Sbjct  324   GDGFICRGITIRNTAGPTNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSDRQFYRECDI  383

Query  132   YGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             YGTVDFIFGNAAVV QNC I+AR P +K   T+TAQGR+DPNQN
Sbjct  384   YGTVDFIFGNAAVVLQNCNIFARDPPNKTN-TVTAQGRSDPNQN  426



>ref|XP_002511679.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF50348.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=514

 Score =   485 bits (1249),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 244/371 (66%), Positives = 299/371 (81%), Gaps = 9/371 (2%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             EV  WCS+TP+P  C+YFL+H+ ++ T    +S+F K++TE+AL  A+ A+ +   LG +
Sbjct  27    EVQSWCSKTPNPGPCEYFLSHNPKN-TPITHESDFLKISTELALQRAIHAQVNTYSLGTK  85

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGN  745
             CRN REK AWADC++LYE  +L LN T   KCT++DA TWLSTALTNLETCRTGF+ELG 
Sbjct  86    CRNEREKTAWADCLELYEYAVLWLNHTTTSKCTKYDAQTWLSTALTNLETCRTGFMELGV  145

Query  744   SRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ--TYKDGFPAWVSLGDRRLLQASSPV-K  574
             S  VLPL+SNN VS+LI NTLA+NN   VP +  TYK GFP WV  GDR+LLQ ++P  +
Sbjct  146   SDYVLPLMSNN-VSKLISNTLAINN---VPYEEPTYKGGFPTWVKPGDRKLLQTTTPASQ  201

Query  573   PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDG  394
              ++VVAKDGSGN+KTI +A+ AA KRSGSGRF+I++K GVYNEN++IG KLKN+M VGDG
Sbjct  202   ANIVVAKDGSGNFKTINEAVAAASKRSGSGRFIIYVKAGVYNENVEIGTKLKNLMFVGDG  261

Query  393   MRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSV  214
             +  T ++GS+SV GG+TTF SAT AV G+GFIA+ +TFRNTAGPENHQAVALRSGADLSV
Sbjct  262   IGKTIVTGSKSVGGGATTFRSATFAVVGEGFIARDMTFRNTAGPENHQAVALRSGADLSV  321

Query  213   FYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITI  34
             FYKC FEGYQDTLY HSQRQFY++C IYGTVDFIFGNAAVV QNC I+AR P ++   T+
Sbjct  322   FYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARNPPNRTN-TL  380

Query  33    TAQGRTDPNQN  1
             TAQGRTDPNQN
Sbjct  381   TAQGRTDPNQN  391



>ref|XP_009766156.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=525

 Score =   484 bits (1246),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 250/404 (62%), Positives = 312/404 (77%), Gaps = 9/404 (2%)
 Frame = -1

Query  1200  LEMSKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTA  1021
             + MS I+L   L   SSF   + +    AA   +  WC QTPHP  C+YFLT + ++ T 
Sbjct  4     ITMSNIYLIFPLLFVSSFFFPSTNGYSMAA---IKSWCIQTPHPQPCEYFLTQNPKYSTP  60

Query  1020  PKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL  841
               +KS+F K++ E+ALD A++A+T+A  LG +CRN REKAAWADC++LYE TI ++  T+
Sbjct  61    INKKSDFLKVSLELALDRALRAQTNAYSLGSKCRNEREKAAWADCLELYEHTIHKIKSTV  120

Query  840   DE--KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNN  667
             D   KCT  DA +WLSTALTNLETCR GF ELG +  V+PL+SNN VS LI NTL+LN+ 
Sbjct  121   DPNTKCTAADAQSWLSTALTNLETCRAGFEELGVTDYVMPLMSNN-VSSLISNTLSLNHG  179

Query  666   G-SVPKQTYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKRS  493
               + P  T  DGFP WV+ GDR+LLQ+SSP  + ++VVAKDGSGN+KT+K+A+ AAGKR 
Sbjct  180   YYTEPTATQVDGFPTWVAPGDRKLLQSSSPASQANIVVAKDGSGNFKTVKEAVAAAGKRK  239

Query  492   GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVT  313
             GS RFVI++K G+Y+EN+++G+KLKNIM VGDG+  T I+GS+SV GGSTTF SATVAV 
Sbjct  240   GSARFVIYVKAGIYSENVELGSKLKNIMFVGDGIGKTIITGSKSVGGGSTTFKSATVAVV  299

Query  312   GDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYI  133
             GDGFI +GIT RNTAGP+NHQAVALRSG+DLSVFY+C FEGYQDTLY HS RQFY++C +
Sbjct  300   GDGFICRGITIRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSDRQFYRECDV  359

Query  132   YGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             YGTVDFIFGNAAVV QNC I+AR P +K   T+TAQGRTDPNQN
Sbjct  360   YGTVDFIFGNAAVVLQNCNIFARDPPNKTN-TVTAQGRTDPNQN  402



>ref|XP_003526378.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Glycine max]
Length=528

 Score =   484 bits (1245),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 247/374 (66%), Positives = 295/374 (79%), Gaps = 7/374 (2%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYFLT--HSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGP  928
             V+ WC+QTPHP  CK+F+T    R     PK   +FK    +IA+D +V+A+ H   LG 
Sbjct  30    VDFWCNQTPHPQTCKHFVTINSHRLQDGIPKSAFQFKNFILQIAMDQSVKAQIHIMWLGS  89

Query  927   RCRNAREKAAWADCVKLYEDTILQLNQTLD--EKCTQFDALTWLSTALTNLETCRTGFVE  754
             +CR+ +EKAAW+DC  LY+DTI  LNQ L+  ++ T +D  TWLSTALTN++TC+TGF E
Sbjct  90    KCRSKQEKAAWSDCTTLYQDTINILNQALNPTKQSTSYDLQTWLSTALTNIDTCQTGFHE  149

Query  753   LGNSRNVLPLISNNNVSQLIGNTLALNNNGSV--PKQTYKDGFPAWVSLGDRRLLQASSP  580
             LG   NVL LI N NVS++I + LALNN  S   PK+TYK+G P W+   DR+LL++S P
Sbjct  150   LGVGNNVLSLIPNKNVSEIISDFLALNNASSFIPPKKTYKNGLPRWLPPNDRKLLESSPP  209

Query  579   -VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLV  403
              + PD VVAKDGSG++KTIK+AL A  KR+ + RFVI++KRG+YNEN++IGN +KNIML 
Sbjct  210   SLSPDFVVAKDGSGDFKTIKEALKAIPKRNEAKRFVIYVKRGIYNENIEIGNSMKNIMLY  269

Query  402   GDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGAD  223
             GDG R T ISGSRSV GGSTTFNSATVAVTGDGFIA+GITFRNTAGPENHQAVALR GAD
Sbjct  270   GDGTRLTIISGSRSVGGGSTTFNSATVAVTGDGFIARGITFRNTAGPENHQAVALRCGAD  329

Query  222   LSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQK  43
             LSVFY+C FEGYQDTLY HSQRQFYK+C IYGTVDFIFGNAAVVFQ+C IYAR+PM KQK
Sbjct  330   LSVFYRCAFEGYQDTLYVHSQRQFYKECNIYGTVDFIFGNAAVVFQSCNIYARRPMQKQK  389

Query  42    ITITAQGRTDPNQN  1
               ITAQGRTDPNQN
Sbjct  390   NAITAQGRTDPNQN  403



>ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   481 bits (1237),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 248/392 (63%), Positives = 309/392 (79%), Gaps = 15/392 (4%)
 Frame = -1

Query  1149  FISVALSVNPPAAAG----EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATE  982
             F+ V+L ++P   +G    +V  WCSQTP+P  C+YFL+H   H +  K+KS+F K++ +
Sbjct  5     FLLVSLLLSPIVVSGYKSEDVKSWCSQTPYPQPCEYFLSHKPDH-SPIKQKSDFLKISMQ  63

Query  981   IALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALT  808
             +AL+ A++AE++   LG +CRN  EK AW+DC+KLYE TIL+LN+T+D   KC+Q D+ T
Sbjct  64    LALERALRAESNTYSLGSKCRNELEKTAWSDCLKLYEYTILRLNKTVDPNTKCSQVDSQT  123

Query  807   WLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP--KQTYKDG  634
             WLSTALTNLETCR GFVELG S  +LPL+SNN VS+LI NTL+LN    VP  + +YK+G
Sbjct  124   WLSTALTNLETCRAGFVELGVSDYLLPLMSNN-VSKLISNTLSLNK---VPYTEPSYKEG  179

Query  633   FPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRG  457
             FP WV  GDR+LLQ+SSP  + ++VVAKDGSG+Y TI  A+ AA KRSG+GR+VI++K G
Sbjct  180   FPTWVKPGDRKLLQSSSPASQANIVVAKDGSGDYTTITAAVSAASKRSGTGRYVIYVKAG  239

Query  456   VYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFR  277
              YNEN++IG KLKNIML+GDG+  T I+GS+SV GGSTTFNSATVA  GDGFI +G+T R
Sbjct  240   TYNENIEIGAKLKNIMLLGDGIGKTIITGSKSVGGGSTTFNSATVAAVGDGFIGRGLTIR  299

Query  276   NTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAA  97
             NTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLY HS+RQFY++C IYGTVDFIFGNAA
Sbjct  300   NTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAA  359

Query  96    VVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             VV QNC IY R P +K   TITAQGRTDPNQN
Sbjct  360   VVLQNCNIYPRNPPNKTN-TITAQGRTDPNQN  390



>gb|EYU24970.1| hypothetical protein MIMGU_mgv1a022192mg [Erythranthe guttata]
Length=530

 Score =   480 bits (1236),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 252/406 (62%), Positives = 314/406 (77%), Gaps = 17/406 (4%)
 Frame = -1

Query  1179  LFLVLASFSS-FISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSR---RHFTAPKR  1012
             L + L S SS F   + +V PP+  G++N WC+QTP+P+ CK+F++ +    R + +P++
Sbjct  6     LIITLISLSSTFHLPSAAVKPPS--GDMNWWCNQTPYPEPCKHFMSQNNNNPRKYFSPQK  63

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE-  835
             KS+F+KMA ++AL+ A  A  + K LG +CRN RE+AAW+DCVKLYE TI QLN+T+D  
Sbjct  64    KSDFRKMAIQLALERATCAVGNTKALGAKCRNERERAAWSDCVKLYESTIEQLNKTVDPT  123

Query  834   -KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSV  658
               CT FD+ TWLSTALTN+ETCRTGF+EL  +  V PLISNNNVS+LI NTLAL ++G+ 
Sbjct  124   INCTDFDSQTWLSTALTNIETCRTGFLELNVTDFVFPLISNNNVSKLICNTLALGDSGNE  183

Query  657   PKQTYKD-----GFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS  493
                  K      GFP W S G+RRLLQ +  V  D+VVA+DGSG+ +TIK ALD A +RS
Sbjct  184   TNHETKGYYNKAGFPTWFSKGNRRLLQTT--VSADVVVAQDGSGDNRTIKAALDVAARRS  241

Query  492   GS-GRFVIHIKRGVYNENLDI-GNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVA  319
              + GRFVI +KRGVY+EN++I G+K+KNIM+VGDG+  T I+G+RSV GGSTTF SATV 
Sbjct  242   STAGRFVILVKRGVYSENIEIAGSKMKNIMIVGDGIDNTIITGNRSVGGGSTTFESATVI  301

Query  318   VTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDC  139
             VT +GFIA+GIT RNTAGPENHQAVALRSGADLSVFY+C FE YQDTLY HSQRQFYK+C
Sbjct  302   VTAEGFIARGITIRNTAGPENHQAVALRSGADLSVFYRCSFEAYQDTLYVHSQRQFYKEC  361

Query  138   YIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
              IYGT+DFIFGNAA V Q+C IYAR+PM KQK  +TAQGRTDPNQN
Sbjct  362   DIYGTIDFIFGNAAAVLQDCKIYARRPMVKQKNVVTAQGRTDPNQN  407



>ref|XP_004307817.1| PREDICTED: pectinesterase 2-like [Fragaria vesca subsp. vesca]
Length=459

 Score =   477 bits (1227),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 247/340 (73%), Positives = 287/340 (84%), Gaps = 9/340 (3%)
 Frame = -1

Query  1008  SEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD--E  835
             S+FKK++ +  ++ A++ ++H K LG +CR  +EKAAW+DC+KLYE++I  LN+T+D   
Sbjct  2     SDFKKISIQSTIENALKTQSHNKWLGQKCRTEKEKAAWSDCLKLYEESISLLNRTVDPNT  61

Query  834   KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP  655
             KCT+FD+ TWLSTALTNLETCR GFVELG S  VLPL+SNN VS+LI NTL++NN  S P
Sbjct  62    KCTEFDSQTWLSTALTNLETCRAGFVELGVSDFVLPLMSNN-VSKLISNTLSINNGSSAP  120

Query  654   KQT--YKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGR  481
               T  Y +GFP+WV  G RRLLQ S+P   ++VVA+DGSGNYKTIK+ALDAA KRSGS R
Sbjct  121   AVTNQYTEGFPSWVKPGVRRLLQ-STPA-ANVVVAQDGSGNYKTIKEALDAAAKRSGSQR  178

Query  480   FVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGF  301
             FVI +K GVY ENL+I  KLKNI L+GDG+R T I+GSRSVVGGSTTFNSATVAVTGDGF
Sbjct  179   FVIRVKSGVYKENLEI--KLKNIYLLGDGLRSTIITGSRSVVGGSTTFNSATVAVTGDGF  236

Query  300   IAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTV  121
             IA+GITFRNTAGP+NHQAVALRSGADLSVFY+C FEGYQDTLY HSQRQFYK+CYIYGTV
Sbjct  237   IARGITFRNTAGPQNHQAVALRSGADLSVFYRCSFEGYQDTLYTHSQRQFYKECYIYGTV  296

Query  120   DFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             DFIFGNAAVV QNCMIYARKPM  QK TITAQGRTDPNQN
Sbjct  297   DFIFGNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQN  336



>gb|KDP28780.1| hypothetical protein JCGZ_14551 [Jatropha curcas]
Length=514

 Score =   477 bits (1227),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 239/371 (64%), Positives = 297/371 (80%), Gaps = 9/371 (2%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             EV  WC +TP+P  C+YFL+H  ++    K++S+F K++ ++AL+ A+ A+ H   LG +
Sbjct  27    EVQSWCKKTPNPGPCEYFLSHEPQNIPI-KQESDFLKISKQLALERALHAQAHTYSLGKK  85

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGN  745
             CRN REKAAWADC++LYE T+L LNQT   KC+++DA TWLSTALTNLETC+TGF ELG 
Sbjct  86    CRNEREKAAWADCLELYEYTVLWLNQTTTSKCSKYDAQTWLSTALTNLETCKTGFEELGV  145

Query  744   SRNVLPLISNNNVSQLIGNTLALNNNGSVP--KQTYKDGFPAWVSLGDRRLLQASSPV-K  574
             S  +LPL+SNN VS+LI NTLALN    VP  + +YK+GFP W+  GDR+LLQ++SP  +
Sbjct  146   SDYILPLMSNN-VSKLICNTLALNK---VPYTEPSYKEGFPTWLKPGDRKLLQSTSPASQ  201

Query  573   PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDG  394
              ++VVA+DGSGNYKTI +A+ AA KRSG+GR++I++K G Y EN+ IG  LKNIM VGDG
Sbjct  202   ANIVVAQDGSGNYKTINEAVAAASKRSGTGRYIIYVKSGTYKENVQIGKSLKNIMFVGDG  261

Query  393   MRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSV  214
             +  T ++GS+SV GG+TTFNSAT AV GDGFIA+ +TFRNTAGP+NHQAVALRSGADLSV
Sbjct  262   IGKTIVTGSKSVGGGATTFNSATFAVVGDGFIARDMTFRNTAGPQNHQAVALRSGADLSV  321

Query  213   FYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITI  34
             FYKC FEGYQDTLY HSQRQFY++C IYGTVDFIFGNAAVV QNC IY R P +K   T+
Sbjct  322   FYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIYPRNPPNKTN-TL  380

Query  33    TAQGRTDPNQN  1
             TAQGRTDPNQN
Sbjct  381   TAQGRTDPNQN  391



>ref|XP_002302526.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE81799.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   476 bits (1225),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 238/371 (64%), Positives = 295/371 (80%), Gaps = 9/371 (2%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             EV  WCS+TP+P  C+YFL+H  R+ T    +S+F K++ ++ALD A+Q + +   LG +
Sbjct  27    EVMSWCSKTPNPQPCEYFLSHDHRN-TPITHESDFLKISMQLALDRAMQGKVNTYSLGSK  85

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGN  745
             CRN  EKAAW DC++LYED+IL L +T   KCT +DA TWLSTALTNLETCRTGF E G 
Sbjct  86    CRNGLEKAAWEDCLELYEDSILWLTKTTSSKCTDYDAQTWLSTALTNLETCRTGFTEFGM  145

Query  744   SRNVLPLISNNNVSQLIGNTLALNNNGSVP--KQTYKDGFPAWVSLGDRRLLQASSPV-K  574
             +  +LPL+SNN VS+LI NTLA+N    VP  + +YK+GFP+WV  GDR+LLQ+SSP  +
Sbjct  146   TDFILPLMSNN-VSKLISNTLAINK---VPYSEPSYKEGFPSWVRPGDRKLLQSSSPASQ  201

Query  573   PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDG  394
              ++VVA DGSGN KTIK+A+DAA KRSGSGR+VI++K G YNEN+++G K+KN+M VGDG
Sbjct  202   ANIVVATDGSGNVKTIKEAIDAASKRSGSGRYVIYVKAGTYNENVEVGKKVKNVMFVGDG  261

Query  393   MRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSV  214
             +  T ++GS+S  GG+TTF SAT AV GD FIA+ +TFRNTAG +NHQAVALRSG+D SV
Sbjct  262   IGKTIVTGSKSAGGGTTTFKSATFAVVGDNFIARDMTFRNTAGAKNHQAVALRSGSDFSV  321

Query  213   FYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITI  34
             FYKC FEGYQDTLY +SQRQFY++C IYGTVDFIFGNAAVVFQNC IYAR P +K  ITI
Sbjct  322   FYKCSFEGYQDTLYVYSQRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARSPPNK-IITI  380

Query  33    TAQGRTDPNQN  1
             TAQGRTDPNQN
Sbjct  381   TAQGRTDPNQN  391



>ref|XP_007052106.1| Pectinesterase 2 [Theobroma cacao]
 gb|EOX96263.1| Pectinesterase 2 [Theobroma cacao]
Length=517

 Score =   476 bits (1225),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 250/404 (62%), Positives = 310/404 (77%), Gaps = 20/404 (5%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAG----EVNRWCSQTPHPDQCKYFLTHSRRHFT  1024
             S+I + + LASF  F+        PA  G     V  WCS+TP+P  C+YFL++  ++ T
Sbjct  4     SQIFIAIFLASF--FLV-------PAVLGYGTNAVRSWCSKTPNPQPCEYFLSNDPKN-T  53

Query  1023  APKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQT  844
               K + +F K++ ++AL+ A +A++H   LGP+CRN REKAAWADC+ LYE TIL+LN+T
Sbjct  54    PIKDEPDFLKISMQLALERAERAQSHTYLLGPKCRNKREKAAWADCLNLYELTILRLNKT  113

Query  843   LDE--KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN  670
             +D   K  + DA TWLSTALTNLETCRTGF+ELG    +LP++SNN VS LI NTLALN 
Sbjct  114   VDSSIKLNKDDAQTWLSTALTNLETCRTGFIELGVPDYILPMMSNN-VSNLISNTLALNK  172

Query  669   NGSVPKQTYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKRS  493
                  + +YKDGFP WV  GDR+LLQ+SSP  + ++VVA+DGSGNYKTIKDA+ AA KRS
Sbjct  173   -APYKEPSYKDGFPTWVKPGDRKLLQSSSPASRANIVVAQDGSGNYKTIKDAISAASKRS  231

Query  492   GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVT  313
             GSGR+VI++K G Y EN++I +KLKNIMLVGDG+  T I+GS+SV  GSTTFNSATVA  
Sbjct  232   GSGRYVIYVKAGTYKENVEIRSKLKNIMLVGDGIGKTIITGSKSVGQGSTTFNSATVAAV  291

Query  312   GDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYI  133
             GDGFIA+ IT RNTAGP+NHQAV+LRSG+DLSVFY+C FEGYQDTLY HS+RQFY++C I
Sbjct  292   GDGFIARDITIRNTAGPQNHQAVSLRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDI  351

Query  132   YGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             YGTVD IFGNAAVV QNC IYAR+P +K   T+TAQ RTDPNQN
Sbjct  352   YGTVDVIFGNAAVVLQNCNIYARRPPNKTN-TVTAQSRTDPNQN  394



>ref|XP_011017474.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   473 bits (1216),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 236/371 (64%), Positives = 292/371 (79%), Gaps = 9/371 (2%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             EV  WCS+TP+P  C+YFL+H  R+ T    +S+F K++ ++ALD A+Q + +   LG +
Sbjct  27    EVMSWCSKTPNPHPCEYFLSHDHRN-TPITHESDFLKISMQLALDRAMQGKVNTYSLGSK  85

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGN  745
             CRN  EKAAW DC++LYEDTIL L QT   KCT +DA TWLSTALTNLETCRTGF + G 
Sbjct  86    CRNGLEKAAWEDCLELYEDTILWLTQTTSSKCTDYDAQTWLSTALTNLETCRTGFTDFGM  145

Query  744   SRNVLPLISNNNVSQLIGNTLALNNNGSVP--KQTYKDGFPAWVSLGDRRLLQASSPV-K  574
             +  +LPL+ NNNVS+LI NTLA+N    VP  + +YK+GFP+W+  GDR+LLQ+SSP  +
Sbjct  146   TDFILPLM-NNNVSKLISNTLAINK---VPYSEPSYKEGFPSWLRPGDRKLLQSSSPASQ  201

Query  573   PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDG  394
              ++VVA DGSGN KTIK+A+DAA KRSGSGR+VI++K G YNEN+++G K+KN+M VGDG
Sbjct  202   ANIVVATDGSGNVKTIKEAIDAASKRSGSGRYVIYVKAGTYNENVEVGKKVKNVMFVGDG  261

Query  393   MRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSV  214
             +  T ++GS+S  GG+TTF SAT A  GD FIA+ +TFRNTAG +NHQAVALRSG+D SV
Sbjct  262   IGKTIVTGSKSAGGGTTTFRSATFAAVGDNFIARDMTFRNTAGAKNHQAVALRSGSDFSV  321

Query  213   FYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITI  34
             FYKC FEGYQDTLY HSQRQFY++C IYGTVDFIFGNAAVVFQNC IY R P +K   TI
Sbjct  322   FYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVFQNCNIYPRSPPNKTN-TI  380

Query  33    TAQGRTDPNQN  1
             TAQGRTDPNQN
Sbjct  381   TAQGRTDPNQN  391



>ref|XP_010264200.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=516

 Score =   472 bits (1215),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 243/398 (61%), Positives = 306/398 (77%), Gaps = 10/398 (3%)
 Frame = -1

Query  1185  IHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKS  1006
             + L L L   S  +S   S + P     V  WCSQTP+P  C ++++H+ R  +  KR S
Sbjct  3     LPLILTLVFISFLLSPGYSDHIPP---NVKLWCSQTPYPQPCDFYMSHNPRS-SGLKRHS  58

Query  1005  EFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEK--  832
             +F +++ +IALD A++AE +   LGP+CRN +EKAAW DC++LYE+TI++LN+T++    
Sbjct  59    DFNRLSMQIALDRALRAENNNMMLGPKCRNHQEKAAWVDCLELYENTIIRLNRTVNPSAS  118

Query  831   CTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPK  652
             CT  D  TWLSTALTNLETCR GF+ELG +  VLPL+SNN VS+LI N+LA+N     P 
Sbjct  119   CTDVDFQTWLSTALTNLETCRNGFMELGVTDYVLPLMSNN-VSKLISNSLAINKPPPSP-  176

Query  651   QTYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFV  475
             Q Y +GFP+WV  GDR+LLQ SSP  + +LVVA+DGSGN+KT+ +A+ AA K+  SGRFV
Sbjct  177   QAYTEGFPSWVKPGDRKLLQTSSPTSQANLVVAQDGSGNFKTVNEAISAASKQKRSGRFV  236

Query  474   IHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIA  295
             I++K G Y ENL IGNKL NIML+GDG+  T I+GS+SV GGSTTFNSATVAV GDGFIA
Sbjct  237   IYVKAGTYKENLQIGNKLNNIMLIGDGIGKTVITGSKSVGGGSTTFNSATVAVLGDGFIA  296

Query  294   QGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDF  115
             + ITFRN+AGP N QAVALRSG+DLSVFY+CGFEGYQDTLY HS RQFY++C IYGTVDF
Sbjct  297   RDITFRNSAGPANGQAVALRSGSDLSVFYRCGFEGYQDTLYVHSNRQFYRECDIYGTVDF  356

Query  114   IFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             IFGNAAVVFQNC ++ARKP +   +T+TAQGR+DPNQN
Sbjct  357   IFGNAAVVFQNCNMFARKPKNS-IVTVTAQGRSDPNQN  393



>ref|XP_010056339.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
 gb|KCW73022.1| hypothetical protein EUGRSUZ_E01463 [Eucalyptus grandis]
Length=515

 Score =   472 bits (1214),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 241/374 (64%), Positives = 295/374 (79%), Gaps = 9/374 (2%)
 Frame = -1

Query  1113  AAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRL  934
             ++ +V  WCS+ P+P  C+YFLTH  +   + K+KS+F K++ ++AL+ A  A ++   L
Sbjct  25    SSSDVKAWCSKMPYPQPCEYFLTHDPKQ-ASIKQKSDFLKVSMQLALERAQMAHSNTHSL  83

Query  933   GPRCRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVE  754
             G +C N REKA WADC++LYE TIL+LN+T+   CT  +A TWLSTALTNLETCR GFVE
Sbjct  84    GSKCSNEREKAVWADCLQLYEHTILRLNRTIVHDCTHDEAQTWLSTALTNLETCRAGFVE  143

Query  753   LGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQT--YKDGFPAWVSLGDRRLLQASSP  580
             LG S NVLPL+SNN VS+LI NTLALN     P  T  Y   FP WV  GDR+LLQ+SS 
Sbjct  144   LGVSGNVLPLMSNN-VSKLISNTLALN---YAPYTTPNYTKKFPTWVRPGDRKLLQSSSA  199

Query  579   V-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLV  403
             V K +++VA+DGSGNYKTI +A+ AA KRSG+ R++I+IK G Y+EN+++G+KL+NIM V
Sbjct  200   VSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKAGTYSENVEVGSKLENIMFV  259

Query  402   GDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGAD  223
             GDG+  T I+GS+SV GGSTTFNSATVAV GDGFIAQ ITFRNTAG  NHQAVALRSG+D
Sbjct  260   GDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRNTAGAANHQAVALRSGSD  319

Query  222   LSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQK  43
             LSVFY+CGFEGYQDTLY HS+RQFY++C IYGTVDFIFGNAAVV QNC IYAR P +K  
Sbjct  320   LSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYARNPPNKVN  379

Query  42    ITITAQGRTDPNQN  1
              T+TAQGRTDPNQN
Sbjct  380   -TVTAQGRTDPNQN  392



>ref|XP_010056335.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   470 bits (1210),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 241/374 (64%), Positives = 296/374 (79%), Gaps = 9/374 (2%)
 Frame = -1

Query  1113  AAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRL  934
             ++ +V  WCS+ P+P  C+YFLTH  +   + K+KS+F K++ ++AL+ A  A ++   L
Sbjct  25    SSSDVKAWCSKMPYPQPCEYFLTHDPKQ-ASIKQKSDFLKVSMQLALERAQMAHSNTHSL  83

Query  933   GPRCRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVE  754
             G +C N  EKAAWADC++LYE TIL+LN+T+   CTQ +A TWLSTALTNLETC+ GFVE
Sbjct  84    GSKCSNEHEKAAWADCLQLYEYTILRLNRTIVHDCTQDEAQTWLSTALTNLETCQAGFVE  143

Query  753   LGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQT--YKDGFPAWVSLGDRRLLQASSP  580
             LG S NVLPL+SNN VS+LI NTLALN     P  T  Y   FP WV  GDR+LLQ+SS 
Sbjct  144   LGVSGNVLPLMSNN-VSKLISNTLALN---YAPYTTPNYTKKFPTWVRPGDRKLLQSSSA  199

Query  579   V-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLV  403
             V K +++VA+DGSGNYKTI +A+ AA KRSG+ R++I+IK G Y+EN+++G+KL+NIM V
Sbjct  200   VSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKAGTYSENVEVGSKLENIMFV  259

Query  402   GDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGAD  223
             GDG+  T I+GS+SV GGSTTFNSATVAV GDGFIAQ ITFRNTAG  NHQAVALRSG+D
Sbjct  260   GDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRNTAGAANHQAVALRSGSD  319

Query  222   LSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQK  43
             LSVFY+CGFEGYQDTLY HS+RQFY++C IYGTVDFIFGNAAVV QNC IYAR P +K  
Sbjct  320   LSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYARNPPNKVN  379

Query  42    ITITAQGRTDPNQN  1
              T+TAQGRTDPNQN
Sbjct  380   -TVTAQGRTDPNQN  392



>ref|XP_010056336.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   470 bits (1209),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 240/373 (64%), Positives = 292/373 (78%), Gaps = 7/373 (2%)
 Frame = -1

Query  1113  AAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAP-KRKSEFKKMATEIALDTAVQAETHAKR  937
             ++ +V  WCS+ P+P  C+YFLTH+ +   AP K+KS+F K++ ++AL+ A  A  H   
Sbjct  25    SSSDVTSWCSKMPYPQPCEYFLTHNPKQ--APIKQKSDFLKISMQLALERAQLAHDHTHS  82

Query  936   LGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFV  757
             L  +C N REK AWADC++LYE T+L+LN+T+   CTQ +A TWLSTALTNLETCR GFV
Sbjct  83    LESKCSNEREKVAWADCLQLYEHTVLRLNRTIGHDCTQDEAQTWLSTALTNLETCRAGFV  142

Query  756   ELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGFPAWVSLGDRRLLQASSPV  577
             ELG S NVLPL+SNN VS+LI NTLALN         Y   FP WV   DR+LLQ+SS V
Sbjct  143   ELGISDNVLPLMSNN-VSKLISNTLALNY-APFTTPNYTKKFPTWVRPSDRKLLQSSSAV  200

Query  576   -KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              K ++VVA+D SGNYKTI +A+ AA KR+G+ R++I+IK G YNEN+++G+KL NIM +G
Sbjct  201   SKANIVVARDSSGNYKTISEAITAASKRTGTARYIIYIKAGTYNENIEVGSKLDNIMFIG  260

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG+  T I+GS+SV GGSTTFNSATVAV GDGFIAQ ITFRNTAG  NHQAVALRSG+DL
Sbjct  261   DGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRNTAGAANHQAVALRSGSDL  320

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+CGFEGYQDTLY HS+RQFY++C IYGTVDFIFGNAAVVFQNC IYAR P +K   
Sbjct  321   SVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKVN-  379

Query  39    TITAQGRTDPNQN  1
             T+TAQGRTDPNQN
Sbjct  380   TLTAQGRTDPNQN  392



>ref|XP_010544633.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score =   469 bits (1207),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 239/370 (65%), Positives = 303/370 (82%), Gaps = 8/370 (2%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WCS+TP+P  C+YFLTH+  H    K +SEF K++ ++ALD A+ A++HA  LGP+
Sbjct  27    DVKSWCSKTPNPKPCEYFLTHNPNH-RPIKSESEFLKISMKLALDRALLAKSHAFTLGPK  85

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVEL  751
             CR++REKAAW DC+KLY+ T+ +LN+T+D   KC++ DA TWLS+ALTNLETCRTGF+EL
Sbjct  86    CRDSREKAAWEDCLKLYDYTVSKLNETVDPYVKCSKVDAQTWLSSALTNLETCRTGFIEL  145

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGFPAWVSLGDRRLLQASSPVKP  571
             G    +LPL+SNN VS+LI NTLA+N        + ++GFP WV  GDR+LLQ+S+P + 
Sbjct  146   GVPDFLLPLMSNN-VSKLISNTLAINKVPFNYTPSQENGFPEWVRPGDRKLLQSSTP-QA  203

Query  570   DLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGM  391
             ++VVAKDGSGN++TIK+A++AA +RSGSGRFVI++K+GVYNEN++I  + KNIML GDG+
Sbjct  204   NVVVAKDGSGNFRTIKEAVNAASRRSGSGRFVIYVKQGVYNENIEI--RAKNIMLRGDGI  261

Query  390   RYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVF  211
               T I+GS+SV GGSTTFNSATVAV GDGFIA+GITFRNTAGP N QAVALRSG+DLSVF
Sbjct  262   GKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITFRNTAGPNNGQAVALRSGSDLSVF  321

Query  210   YKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITIT  31
             Y+C FEGYQDTLY HS RQFY++C IYGTVDFIFGNAA VFQNC I+AR+P +K   T+T
Sbjct  322   YQCSFEGYQDTLYVHSNRQFYRECNIYGTVDFIFGNAAAVFQNCNIFARRPQNKTN-TVT  380

Query  30    AQGRTDPNQN  1
             AQGR+DPNQN
Sbjct  381   AQGRSDPNQN  390



>ref|XP_002320714.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE99029.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   469 bits (1206),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 237/388 (61%), Positives = 302/388 (78%), Gaps = 12/388 (3%)
 Frame = -1

Query  1149  FISVALSVNPPAAAG----EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATE  982
             F+S  LS   P   G    EV  WCS+TP+P  C+YFL+H+ ++ T  + +S+F K++ E
Sbjct  11    FVSFLLS---PTILGYNHDEVKSWCSKTPNPQPCEYFLSHNPKN-TPIQHESDFLKISIE  66

Query  981   IALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWL  802
             +ALD A+  + +   LG +CRN  EKAAW DC++LY++ +L LN+T   KCT++DA TWL
Sbjct  67    LALDRAMHGKVNTYSLGSKCRNGLEKAAWEDCLELYQEIVLWLNKTTGSKCTKYDAQTWL  126

Query  801   STALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGFPAW  622
             STALTNLETCRTGF E G +  +LP++SNN VS+LI NTLA+N      + ++  GFP+W
Sbjct  127   STALTNLETCRTGFAEFGMTDYILPMMSNN-VSKLISNTLAINK-APYSEPSFNGGFPSW  184

Query  621   VSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNE  445
             V  GDR+LLQ+SSP  + ++VVA+DGSGN KTIK+A+ AA KRSGSGR+VI++K G YNE
Sbjct  185   VRPGDRKLLQSSSPASQANIVVAQDGSGNVKTIKEAIVAASKRSGSGRYVIYVKAGTYNE  244

Query  444   NLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAG  265
             N+++G K+KN+M+VGDG+  T ++GS+SV GG+TTF SAT AV GD FIA+ +TFRNTAG
Sbjct  245   NVEVGQKVKNVMVVGDGIGKTIVTGSKSVGGGTTTFKSATFAVVGDNFIARDMTFRNTAG  304

Query  264   PENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQ  85
              +NHQAVALRSG+DLSVFYKC FEGYQDTLY HSQRQFY++C IYGTVDFIFGNAAVVFQ
Sbjct  305   AKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSQRQFYRECNIYGTVDFIFGNAAVVFQ  364

Query  84    NCMIYARKPMDKQKITITAQGRTDPNQN  1
             NC IYAR P +K   TITAQGRTDPNQN
Sbjct  365   NCNIYARNPPNKTN-TITAQGRTDPNQN  391



>ref|XP_010056338.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   468 bits (1205),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 239/373 (64%), Positives = 293/373 (79%), Gaps = 7/373 (2%)
 Frame = -1

Query  1113  AAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAP-KRKSEFKKMATEIALDTAVQAETHAKR  937
             ++ +V  WCS+ P+P  C+YFLTH+ +   AP K+KS+F K++ ++AL+ A  A  H   
Sbjct  25    SSSDVTSWCSKMPYPQPCEYFLTHNPKQ--APIKQKSDFLKISMQLALERAQLAHDHTHS  82

Query  936   LGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFV  757
             L  +C N REKAAWADC++LYE T+L+LN+T+  +CTQ +A TWLSTALTNLETCR GFV
Sbjct  83    LESKCSNEREKAAWADCLQLYEHTVLRLNRTIGHECTQDEAQTWLSTALTNLETCRAGFV  142

Query  756   ELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGFPAWVSLGDRRLLQASSPV  577
             ELG S NVLPL+SNN VS+LI NTLALN         Y   FP WV   DR+LLQ+SS V
Sbjct  143   ELGISDNVLPLMSNN-VSKLISNTLALNY-APFTTPNYTKKFPTWVRPSDRKLLQSSSAV  200

Query  576   -KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              K ++VVA+DGSGNYKTI +A+ AA K++G+ R++I+IK G YNEN+++G+KL NIM VG
Sbjct  201   SKANIVVARDGSGNYKTISEAITAASKQTGAARYIIYIKAGTYNENIEVGSKLDNIMFVG  260

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG+  T I+GS+SV GGSTTF SATVAV GDGF+AQ ITFRNTAG  NHQAVALRSG+DL
Sbjct  261   DGIGKTIITGSKSVGGGSTTFKSATVAVVGDGFVAQDITFRNTAGAANHQAVALRSGSDL  320

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+C FEGYQDTLY HS+RQFY++C IYGTVDFIFGNAAVVFQNC IYAR P +K   
Sbjct  321   SVFYRCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKVN-  379

Query  39    TITAQGRTDPNQN  1
             T+TAQGRTDPNQN
Sbjct  380   TLTAQGRTDPNQN  392



>ref|XP_010257625.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   468 bits (1205),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 244/405 (60%), Positives = 304/405 (75%), Gaps = 7/405 (2%)
 Frame = -1

Query  1203  NLEMSKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFT  1024
             N+    + +FL   S +SF+S  L+ +    +G  + WC +TP+PD C+  L     + +
Sbjct  3     NMVAMLVPIFLAFLSCTSFLSSTLADSSYNVSGGTDWWCQKTPYPDDCRSSLGDLDPNPS  62

Query  1023  APKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQT  844
              PK+K EF+KMA + A++ A+QAE+H K LG  CRN RE+AAW DC+KLYEDTILQLN+T
Sbjct  63    VPKQKPEFRKMALQAAMERALQAESHTKWLGQICRNDRERAAWVDCLKLYEDTILQLNRT  122

Query  843   LDE--KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN  670
             L+    CT  D  TWLSTALTNL+TC+ G VELG S  +LPL+SNN VS LI N LA+N+
Sbjct  123   LNPIANCTDSDTQTWLSTALTNLDTCKAGIVELGVSDVLLPLVSNN-VSHLISNALAIND  181

Query  669   NGSVPKQTYKDGFPAWVSLGDRRLLQASS-PVKPDLVVAKDGSGNYKTIKDALDAAGK-R  496
               S  +Q Y  GFP WVS  DR+LLQ+SS   + +LVVA+DGSG+++TIK A+ AA K R
Sbjct  182   IPS-EQQNYTGGFPTWVSAADRKLLQSSSLASRANLVVAQDGSGHFRTIKAAISAASKLR  240

Query  495   SGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAV  316
              GS RF+I++K GVY EN++IGN + NIML+GDGMR T I+GSRSV  G TTFNSATVAV
Sbjct  241   RGSRRFIIYVKAGVYRENIEIGNNMPNIMLIGDGMRRTLITGSRSVRKGYTTFNSATVAV  300

Query  315   TGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCY  136
             +G+ F+A GITFRNTAGP + QAVAL SG+DLSVFY+CGF GYQDTLY HSQRQFYK CY
Sbjct  301   SGERFVATGITFRNTAGPLS-QAVALVSGSDLSVFYRCGFIGYQDTLYVHSQRQFYKQCY  359

Query  135   IYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             IYGT+DFIFGNAAVV QNCMI AR+P+  Q   ITAQGR+DP+QN
Sbjct  360   IYGTIDFIFGNAAVVLQNCMIVARRPLHGQANVITAQGRSDPHQN  404



>emb|CDP08022.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   468 bits (1205),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 246/399 (62%), Positives = 309/399 (77%), Gaps = 14/399 (4%)
 Frame = -1

Query  1185  IHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRH-FTAP-KR  1012
             I LF+ +     F+S AL+ N P     +  WC+QTP+P  C+YFL+ S ++ +  P K 
Sbjct  7     IFLFMTV-----FVSPALARNIPPPP-SIKSWCAQTPYPQPCEYFLSQSPKYGYNYPIKG  60

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE-  835
             KS+F KM+  +AL+ AV A+ +   LG +CR+ REKAAW DC++LYE TI+++N+T+D  
Sbjct  61    KSDFFKMSLNLALERAVHAQENTNNLGSKCRDEREKAAWEDCLELYESTIVKINKTVDPY  120

Query  834   -KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSV  658
              KC   DA TWLSTALTNLETC+ GF+ELG + +++PL+SNN VS LI NTL+LN  G  
Sbjct  121   TKCNAVDAQTWLSTALTNLETCKQGFIELGVADHLVPLMSNN-VSCLISNTLSLNKVG-Y  178

Query  657   PKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRF  478
              + +YK+GFP WV+ GDR+LLQ+SSP  P+ VVA+DGSGN+KT+  A+ AA  RSG+GR+
Sbjct  179   NEPSYKEGFPTWVTPGDRKLLQSSSPT-PNAVVAQDGSGNFKTVAAAVAAAATRSGNGRY  237

Query  477   VIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFI  298
             VIH+K G Y EN++IG KLKNIMLVGDG+  T I GS SV GG+TTF SATVAV GDGFI
Sbjct  238   VIHVKAGTYKENVEIGTKLKNIMLVGDGIGKTIIMGSNSVGGGTTTFKSATVAVVGDGFI  297

Query  297   AQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVD  118
             A+GITFRNTAGP+NHQAVALRSG+DLSVFY+C FEGYQDTLY HSQRQFY +C +YGTVD
Sbjct  298   ARGITFRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYSECDVYGTVD  357

Query  117   FIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             +IFGNAAVVFQNC +Y+R P +K   TITAQGRTDPNQN
Sbjct  358   YIFGNAAVVFQNCNLYSRNPPNKIN-TITAQGRTDPNQN  395



>emb|CDP20872.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   468 bits (1203),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 245/399 (61%), Positives = 310/399 (78%), Gaps = 14/399 (4%)
 Frame = -1

Query  1185  IHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRH-FTAP-KR  1012
             I LF+ +     F+S A+S N P     V  WC+QTP+P  C+YFL+ + ++ +  P K 
Sbjct  7     IFLFMTV-----FVSPAISRNIPPPP-SVKSWCAQTPYPQPCEYFLSQNPKYGYGYPIKG  60

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE-  835
             KS+F K++  +AL+ AV A+ +   LG +C+N REKAAW DC++LYE TI+++N+T+D  
Sbjct  61    KSDFLKVSLNLALERAVHAQENTNNLGSKCQNEREKAAWEDCIELYESTIVKINKTVDPY  120

Query  834   -KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSV  658
              KC   +A TWLSTALTNLETC+ GF+ELG + +++PL+SNN VS LI NTL+LN  G  
Sbjct  121   TKCNAVEAQTWLSTALTNLETCKQGFIELGVADHLVPLMSNN-VSCLISNTLSLNKVG-Y  178

Query  657   PKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRF  478
              + +YK+GFP WV+ GDR+LLQ+SSP  P+ VVA+DGSGN+KTI  A+ AA  RSG+GR+
Sbjct  179   NEPSYKEGFPTWVTPGDRKLLQSSSPT-PNAVVAQDGSGNFKTIAAAVAAAATRSGNGRY  237

Query  477   VIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFI  298
             VIH+K G Y EN++IG KLKNIMLVGDG+  T I+GS SV GG+TTF SATVAV GDGFI
Sbjct  238   VIHVKAGTYKENVEIGTKLKNIMLVGDGIGKTIITGSNSVDGGTTTFKSATVAVVGDGFI  297

Query  297   AQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVD  118
             A+GITFRNTAGP+NHQAVALRSG+DLSVFY+C FEGYQDTLY HSQRQFY +C +YGTVD
Sbjct  298   ARGITFRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYSECDVYGTVD  357

Query  117   FIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             +IFGNAAVVFQNC +Y+R P +K   TITAQGRTDPNQN
Sbjct  358   YIFGNAAVVFQNCNLYSRNPPNKIN-TITAQGRTDPNQN  395



>ref|XP_011090444.1| PREDICTED: pectinesterase 2 [Sesamum indicum]
Length=531

 Score =   468 bits (1204),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 247/399 (62%), Positives = 306/399 (77%), Gaps = 16/399 (4%)
 Frame = -1

Query  1179  LFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEF  1000
             L L+ AS   F S A+S    AA   +  WCSQTP+P  C+YF TH+ ++    K KS+F
Sbjct  20    LTLLFASILVF-SPAVSGGSSAA---IKAWCSQTPNPQPCEYFFTHNPKYKVPIKNKSDF  75

Query  999   KKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCT  826
              K++T++ALD  +  +++   LGP+CRN REKAAWADCV+LYE TI ++N T+D   KCT
Sbjct  76    FKLSTQLALDRCMHVQSNLHLLGPKCRNEREKAAWADCVELYEHTIHKINTTVDPNTKCT  135

Query  825   QFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN----NGSV  658
               DA TWLSTALTNLETC++GFV+ G + + +  + +NNVS L+ NTLALN     NG  
Sbjct  136   PADAQTWLSTALTNLETCKSGFVDFGITDDYMFPMMSNNVSLLLSNTLALNKGPYANG--  193

Query  657   PKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRF  478
             P  +YK+GFP+WV  GDR+LLQ+S+P   ++VVA+DGSGNYKT+ +A+ AAGKRSGSGRF
Sbjct  194   PAGSYKEGFPSWVKPGDRKLLQSSTPTA-NVVVAQDGSGNYKTVSEAVAAAGKRSGSGRF  252

Query  477   VIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFI  298
             VIH+K+G Y EN++I    KNIML+GDG+  T I+GSRSV GGSTTF SATVA  GDGFI
Sbjct  253   VIHVKQGTYRENVNIA--AKNIMLLGDGIGKTIITGSRSVGGGSTTFKSATVAAVGDGFI  310

Query  297   AQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVD  118
             A+GITFRNTAG +NHQAVA RSG+DLSVFY+C FEGYQDTLY HS+RQFY++C IYGTVD
Sbjct  311   ARGITFRNTAGAQNHQAVAFRSGSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVD  370

Query  117   FIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             FIFGNAAVVFQNC IY R P +K   T+TAQGRTDPNQN
Sbjct  371   FIFGNAAVVFQNCNIYPRNPPNKTN-TLTAQGRTDPNQN  408



>ref|XP_011034009.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   465 bits (1197),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 231/369 (63%), Positives = 294/369 (80%), Gaps = 5/369 (1%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             EV  WCS+TP+P  C+YFL+H+ ++ T  + +S+F K++ E+ALD A+  + +   LG +
Sbjct  27    EVKSWCSKTPNPQPCEYFLSHNPKN-TPIQHESDFLKISIELALDRAMHDKVNTYSLGSK  85

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGN  745
             CRN  EKAAW DC++LY++ +L LN+T   KCT++DA TWLSTALTNL TCRTGF E G 
Sbjct  86    CRNGLEKAAWEDCLELYQEIVLWLNKTTGSKCTKYDAQTWLSTALTNLATCRTGFAEFGM  145

Query  744   SRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGFPAWVSLGDRRLLQASSPV-KPD  568
             +  +LPL+SNN VS+LI NTLA+N      + ++  GFP+WV  GDR+LLQ+SSP  + +
Sbjct  146   TDYILPLMSNN-VSKLISNTLAINK-APYREPSFNGGFPSWVRPGDRKLLQSSSPASQAN  203

Query  567   LVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMR  388
             +VVA+DGSGN KTIK+A+DAA KRSGSGR+VI++K G YNEN++I  K+KN+M+VGDG+ 
Sbjct  204   IVVAQDGSGNVKTIKEAIDAASKRSGSGRYVIYVKAGTYNENVEIARKVKNVMVVGDGIG  263

Query  387   YTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFY  208
              T ++GS+SV GG+TTF SAT AV GD FIA+ +TFRNTAG +NHQAVALRSG+DLSVFY
Sbjct  264   KTIVTGSKSVGGGTTTFKSATFAVVGDNFIARDMTFRNTAGAKNHQAVALRSGSDLSVFY  323

Query  207   KCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITA  28
             KC FEGYQDTLY HSQRQFY++C IYGTVDFIFGNAAVVFQNC IYAR P +K   T+TA
Sbjct  324   KCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKTN-TVTA  382

Query  27    QGRTDPNQN  1
             QGRTDPNQN
Sbjct  383   QGRTDPNQN  391



>ref|XP_010524372.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score =   464 bits (1195),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 239/373 (64%), Positives = 301/373 (81%), Gaps = 14/373 (4%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WCS+TP+P  C+YFLT+   H    K +SEF K++ ++ALD A+ A+ HA  LGP+
Sbjct  27    DVKSWCSKTPNPTPCEYFLTYDPNH-QPIKSESEFLKISVKLALDRAMLAKNHAFTLGPK  85

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVEL  751
             CR++REK AW DC+KLY+ T+ +LN+T+D   KC++ DA TWLS+ALTNLETCRTGF+EL
Sbjct  86    CRDSREKTAWEDCLKLYDYTVSKLNETIDPHVKCSKVDAQTWLSSALTNLETCRTGFIEL  145

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNN---NGSVPKQTYKDGFPAWVSLGDRRLLQASSP  580
             G    +LPL+SNN VS+LI NTLA+N    N + P +   +GFP WV  GDR+LLQ+S+P
Sbjct  146   GVPDFLLPLMSNN-VSKLISNTLAINEVPFNYTPPSE---NGFPEWVRPGDRKLLQSSTP  201

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              + + VVA+DGSGN++TIK+A+D+A KRSGSGRFVI++K+GVYNEN++I  K KNIML G
Sbjct  202   -QANAVVAQDGSGNFRTIKEAVDSASKRSGSGRFVIYVKQGVYNENIEI--KAKNIMLRG  258

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG+  T I+GS+SV GG+TTFNSATVAV GDGFIA+GITFRNTAGP N QAVALRSG+DL
Sbjct  259   DGIGKTIITGSKSVGGGATTFNSATVAVVGDGFIARGITFRNTAGPSNGQAVALRSGSDL  318

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+C FEGYQDTLY HS RQFY++C IYGTVDFIFGNAA VFQNC I+AR+P +K   
Sbjct  319   SVFYQCSFEGYQDTLYVHSNRQFYRECDIYGTVDFIFGNAAAVFQNCNIFARRPRNKTN-  377

Query  39    TITAQGRTDPNQN  1
             T+TAQGR+DPNQN
Sbjct  378   TVTAQGRSDPNQN  390



>emb|CBI24286.3| unnamed protein product [Vitis vinifera]
Length=415

 Score =   458 bits (1178),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 236/376 (63%), Positives = 297/376 (79%), Gaps = 11/376 (3%)
 Frame = -1

Query  1113  AAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRL  934
             ++ +V  WCSQTPHP  C+YFL+    H +  K+KS+F  ++ ++AL+ A+ A      L
Sbjct  20    SSDDVKPWCSQTPHPQPCEYFLSQKTDH-SLIKQKSDFLNISMQLALERAMIAHGDTFSL  78

Query  933   GPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGF  760
             G +CRN REKAAW DC++LYE TIL+LN+TLD   +CTQ DA TWLSTALTNL+TC+ GF
Sbjct  79    GSKCRNEREKAAWNDCLELYEHTILKLNKTLDSNTRCTQADAQTWLSTALTNLQTCQDGF  138

Query  759   VELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP--KQTYKDGFPAWVSLGDRRLLQAS  586
             ++LG S  VLPL+SNN VS+LI NTL++N    VP  + +YK G+P WV  GDR+LLQ+S
Sbjct  139   IDLGVSDYVLPLMSNN-VSKLISNTLSINK---VPYAEPSYKGGYPTWVKPGDRKLLQSS  194

Query  585   S-PVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIM  409
             S   + ++VV+KDGSG+Y TI  A+ AA KRSGSGR+VI++K G Y+EN+ IG+ LKNIM
Sbjct  195   SLASQANIVVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGLKNIM  254

Query  408   LVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSG  229
             L+GDG+  T ++GS+SV GGSTTFNSATVAV GDGFIA+G+TFRNTAG  NHQAVALRSG
Sbjct  255   LLGDGIGKTIVTGSKSVGGGSTTFNSATVAVVGDGFIARGMTFRNTAGASNHQAVALRSG  314

Query  228   ADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDK  49
             +DLSV+Y+C FEGYQDTLY +S+RQFY++C IYGTVDFIFGNAAVVFQNC IY R P +K
Sbjct  315   SDLSVYYQCSFEGYQDTLYTYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYVRNPPNK  374

Query  48    QKITITAQGRTDPNQN  1
                T+TAQGRTDPNQN
Sbjct  375   IN-TVTAQGRTDPNQN  389



>gb|EYU31969.1| hypothetical protein MIMGU_mgv1a005025mg [Erythranthe guttata]
Length=500

 Score =   461 bits (1185),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 243/406 (60%), Positives = 315/406 (78%), Gaps = 12/406 (3%)
 Frame = -1

Query  1200  LEMSKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRH-FT  1024
             + +++I   L+  + SS IS A+S +   AA  +  WCSQTP+P  C+YFLTH+ ++   
Sbjct  1     MAITRILATLLFVAISS-ISPAISGHSSDAA--IKSWCSQTPNPQPCEYFLTHNPKYKIP  57

Query  1023  APKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQT  844
             A  +KS+F K+++++ALD  + A+++   LGP+CRN REK+AWADC++LY+ TI  +N+T
Sbjct  58    AINKKSDFFKLSSQLALDRCMHAKSNLYSLGPKCRNEREKSAWADCIELYDSTIHAVNKT  117

Query  843   LDE--KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN  670
             +D   KCT  DA TWLS ALTNLETC++GFV+ G +  + PL+SNN VS L+ NTLALN 
Sbjct  118   VDPTTKCTPADAQTWLSAALTNLETCKSGFVDFGLTDYIFPLMSNN-VSLLLSNTLALNK  176

Query  669   NGSV---PKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGK  499
              G+         KDGFP WV+ GDR+LLQ+S+P + ++VVAKDGSGN++T+  A+ AAGK
Sbjct  177   GGAYVGGASNNNKDGFPRWVNTGDRKLLQSSNP-RANVVVAKDGSGNFRTVAAAVAAAGK  235

Query  498   RSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVA  319
             R+GSGR+VI++K+GVY+EN+DIG  LKNIML+GDG+  T I+GSRSV GGSTTF SAT +
Sbjct  236   RTGSGRYVIYVKQGVYSENVDIGKGLKNIMLLGDGIGKTIITGSRSVDGGSTTFKSATFS  295

Query  318   VTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDC  139
             V G GFIA+G+TFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLY HSQRQFY+DC
Sbjct  296   VVGSGFIARGVTFRNTAGARNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYRDC  355

Query  138   YIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
              IYGTVDFIFGNAAVV QNC I+AR P ++   T+TAQGRTDPNQN
Sbjct  356   DIYGTVDFIFGNAAVVLQNCNIFARNPPNRTN-TLTAQGRTDPNQN  400



>gb|KCW73020.1| hypothetical protein EUGRSUZ_E01454 [Eucalyptus grandis]
Length=480

 Score =   458 bits (1179),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 237/362 (65%), Positives = 288/362 (80%), Gaps = 9/362 (2%)
 Frame = -1

Query  1077  PHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAA  898
             P+P  C+YFLTH  +   + K+KS+F K++ ++AL+ A  A ++   LG +C N  EKAA
Sbjct  2     PYPQPCEYFLTHDPKQ-ASIKQKSDFLKVSMQLALERAQMAHSNTHSLGSKCSNEHEKAA  60

Query  897   WADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLIS  718
             WADC++LYE TIL+LN+T+   CTQ +A TWLSTALTNLETC+ GFVELG S NVLPL+S
Sbjct  61    WADCLQLYEYTILRLNRTIVHDCTQDEAQTWLSTALTNLETCQAGFVELGVSGNVLPLMS  120

Query  717   NNNVSQLIGNTLALNNNGSVPKQT--YKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDG  547
             NN VS+LI NTLALN     P  T  Y   FP WV  GDR+LLQ+SS V K +++VA+DG
Sbjct  121   NN-VSKLISNTLALN---YAPYTTPNYTKKFPTWVRPGDRKLLQSSSAVSKANIIVAQDG  176

Query  546   SGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgs  367
             SGNYKTI +A+ AA KRSG+ R++I+IK G Y+EN+++G+KL+NIM VGDG+  T I+GS
Sbjct  177   SGNYKTISEAITAASKRSGTARYIIYIKAGTYSENVEVGSKLENIMFVGDGIGKTIITGS  236

Query  366   rsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGY  187
             +SV GGSTTFNSATVAV GDGFIAQ ITFRNTAG  NHQAVALRSG+DLSVFY+CGFEGY
Sbjct  237   KSVGGGSTTFNSATVAVVGDGFIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGY  296

Query  186   QDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPN  7
             QDTLY HS+RQFY++C IYGTVDFIFGNAAVV QNC IYAR P +K   T+TAQGRTDPN
Sbjct  297   QDTLYVHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYARNPPNKVN-TVTAQGRTDPN  355

Query  6     QN  1
             QN
Sbjct  356   QN  357



>ref|XP_002265740.2| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=512

 Score =   458 bits (1179),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 236/376 (63%), Positives = 297/376 (79%), Gaps = 11/376 (3%)
 Frame = -1

Query  1113  AAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRL  934
             ++ +V  WCSQTPHP  C+YFL+    H +  K+KS+F  ++ ++AL+ A+ A      L
Sbjct  20    SSDDVKPWCSQTPHPQPCEYFLSQKTDH-SLIKQKSDFLNISMQLALERAMIAHGDTFSL  78

Query  933   GPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGF  760
             G +CRN REKAAW DC++LYE TIL+LN+TLD   +CTQ DA TWLSTALTNL+TC+ GF
Sbjct  79    GSKCRNEREKAAWNDCLELYEHTILKLNKTLDSNTRCTQADAQTWLSTALTNLQTCQDGF  138

Query  759   VELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP--KQTYKDGFPAWVSLGDRRLLQAS  586
             ++LG S  VLPL+SNN VS+LI NTL++N    VP  + +YK G+P WV  GDR+LLQ+S
Sbjct  139   IDLGVSDYVLPLMSNN-VSKLISNTLSINK---VPYAEPSYKGGYPTWVKPGDRKLLQSS  194

Query  585   S-PVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIM  409
             S   + ++VV+KDGSG+Y TI  A+ AA KRSGSGR+VI++K G Y+EN+ IG+ LKNIM
Sbjct  195   SLASQANIVVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGLKNIM  254

Query  408   LVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSG  229
             L+GDG+  T ++GS+SV GGSTTFNSATVAV GDGFIA+G+TFRNTAG  NHQAVALRSG
Sbjct  255   LLGDGIGKTIVTGSKSVGGGSTTFNSATVAVVGDGFIARGMTFRNTAGASNHQAVALRSG  314

Query  228   ADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDK  49
             +DLSV+Y+C FEGYQDTLY +S+RQFY++C IYGTVDFIFGNAAVVFQNC IY R P +K
Sbjct  315   SDLSVYYQCSFEGYQDTLYTYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYVRNPPNK  374

Query  48    QKITITAQGRTDPNQN  1
                T+TAQGRTDPNQN
Sbjct  375   IN-TVTAQGRTDPNQN  389



>ref|XP_010325628.1| PREDICTED: pectinesterase 2 [Solanum lycopersicum]
Length=524

 Score =   459 bits (1180),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 240/408 (59%), Positives = 301/408 (74%), Gaps = 13/408 (3%)
 Frame = -1

Query  1194  MSKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPK  1015
             M+ IHL   L   S FI  + +     A   +  WC+QTPHP  C+YFL+ + +  +   
Sbjct  1     MANIHLIFPLLFISCFIFPSTTNGYSNAI--IKAWCTQTPHPQPCEYFLSQNPKITSPIV  58

Query  1014  RKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE  835
             +KS+F K++ ++ LD A++A+ +   LGP+CRN REK AWADC++LYE++I ++  T+D 
Sbjct  59    KKSDFLKVSLDLVLDRALRAQLNTYSLGPKCRNEREKNAWADCIELYENSINKIKSTVDP  118

Query  834   --KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNN--  667
               KC+  DA TWLSTALTNLETC+ GF ELG +  V+PL+SNNNVS LI N LALN+   
Sbjct  119   NTKCSATDAQTWLSTALTNLETCKAGFEELGVTDYVMPLMSNNNVSSLISNALALNHGYY  178

Query  666   ---GSVPKQTYKDGFPAWVSLGDRRLLQASSPVKP---DLVVAKDGSGNYKTIKDALDAA  505
                      T  DGFP WVS GDR+LLQ+SS       ++VVA DGSG++KT+K+A+DAA
Sbjct  179   TEPTKSSTSTQVDGFPTWVSPGDRKLLQSSSSSTASQANVVVATDGSGDFKTVKEAVDAA  238

Query  504   GKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSAT  325
              K  GSGRFVI++K G YNEN++IG K+KN+ML+GDG+  T I+GS+SV GGSTTF SAT
Sbjct  239   AKNKGSGRFVIYVKAGTYNENVEIGEKVKNVMLIGDGIGKTIITGSKSVGGGSTTFRSAT  298

Query  324   VAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYK  145
             V  +GDGFIAQGIT RNTAGP+ HQAVALRSG+DLSVFY+C FEGYQDTLY HS RQFYK
Sbjct  299   VGASGDGFIAQGITIRNTAGPQKHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYK  358

Query  144   DCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             +C IYGTVDFIFGNAAVV QNC I+AR P +K   T+TAQGRTDPNQN
Sbjct  359   ECDIYGTVDFIFGNAAVVLQNCNIFARDPPNKIN-TVTAQGRTDPNQN  405



>ref|XP_010056340.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=508

 Score =   456 bits (1174),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 236/374 (63%), Positives = 287/374 (77%), Gaps = 9/374 (2%)
 Frame = -1

Query  1113  AAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRL  934
             ++ EV  WC + P+   C+YFL+ S +  T  K+KS+F + + ++AL+ A  A T+   L
Sbjct  18    SSSEVKSWCGKMPYSQSCEYFLSQSPKQ-TPLKQKSDFLRASMQVALERAQLAWTNTYSL  76

Query  933   GPRCRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVE  754
             GPRCRN  E+ AWADC++LY+ TIL+LN T++ +CTQ D  TWLSTALTNLETCR GFVE
Sbjct  77    GPRCRNEHERVAWADCLQLYKHTILRLNHTINRQCTQDDKQTWLSTALTNLETCRAGFVE  136

Query  753   LGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQT--YKDGFPAWVSLGDRRLLQASSP  580
             LG S NVLPL+SNN VS+LI N L+ N+   VP  T  Y + FP WV  GDR+LLQ+SS 
Sbjct  137   LGVSDNVLPLMSNN-VSELIRNILSANH---VPYVTPNYTNEFPTWVRPGDRKLLQSSSA  192

Query  579   V-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLV  403
               K ++VVA+DGSGNYKTI +A+    KRSG+ R++I+IK G YNEN+ +G  L NIM V
Sbjct  193   ASKANIVVAQDGSGNYKTISEAITTTSKRSGTTRYIIYIKAGTYNENVGVGTNLVNIMFV  252

Query  402   GDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGAD  223
             GDG+  T I+GS+SV GGSTTFNSATVA+ GDGFIAQ ITFRNTAG  NHQAVALRSG+D
Sbjct  253   GDGIGKTIITGSKSVGGGSTTFNSATVAIVGDGFIAQDITFRNTAGAANHQAVALRSGSD  312

Query  222   LSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQK  43
             LS+FY+CGFEGYQDTLY +S RQFYK+C IYGTVDFIFGNAAVV QNC IYAR P +K  
Sbjct  313   LSIFYQCGFEGYQDTLYVYSARQFYKECDIYGTVDFIFGNAAVVLQNCNIYARNPPNKVN  372

Query  42    ITITAQGRTDPNQN  1
              TITAQGRTDPNQN
Sbjct  373   -TITAQGRTDPNQN  385



>ref|NP_566038.1| putative pectinesterase/pectinesterase inhibitor 17 [Arabidopsis 
thaliana]
 sp|O22149.2|PME17_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
17; Includes: RecName: Full=Pectinesterase inhibitor 17; AltName: 
Full=Pectin methylesterase inhibitor 17; Includes: RecName: 
Full=Pectinesterase 17; Short=PE 17; AltName: Full=Pectin 
methylesterase 17; Short=AtPME17; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK32841.1|AF361829_1 At2g45220/F4L23.27 [Arabidopsis thaliana]
 gb|AAB82640.2| putative pectinesterase [Arabidopsis thaliana]
 gb|AEC10527.1| putative pectinesterase/pectinesterase inhibitor 17 [Arabidopsis 
thaliana]
Length=511

 Score =   455 bits (1171),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 238/373 (64%), Positives = 296/373 (79%), Gaps = 17/373 (5%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WCSQTP+P  C+YFLTH+  +    K +SEF K++ ++ LD A+ A+THA  LGP+
Sbjct  29    DVKAWCSQTPNPKPCEYFLTHNSNN-EPIKSESEFLKISMKLVLDRAILAKTHAFTLGPK  87

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVEL  751
             CR+ REKAAW DC+KLY+ T+ ++N+T+D   KC++ DA TWLSTALTNL+TCR GF+EL
Sbjct  88    CRDTREKAAWEDCIKLYDLTVSKINETMDPNVKCSKLDAQTWLSTALTNLDTCRAGFLEL  147

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNN---NGSVPKQTYKDGFPAWVSLGDRRLLQASSP  580
             G +  VLPL+SNN VS L+ NTLA+N    N + P+   KDGFP+WV  GDR+LLQ+S+P
Sbjct  148   GVTDIVLPLMSNN-VSNLLCNTLAINKVPFNYTPPE---KDGFPSWVKPGDRKLLQSSTP  203

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              K + VVAKDGSGN+KTIK+A+DAA   SGSGRFVI++K+GVY+ENL+I  + KN+ML G
Sbjct  204   -KDNAVVAKDGSGNFKTIKEAIDAA---SGSGRFVIYVKQGVYSENLEI--RKKNVMLRG  257

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG+  T I+GS+SV GG+TTFNSATVA  GDGFIA+GITFRNTAG  N QAVALRSG+DL
Sbjct  258   DGIGKTIITGSKSVGGGTTTFNSATVAAVGDGFIARGITFRNTAGASNEQAVALRSGSDL  317

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+C FE YQDTLY HS RQFY+DC +YGTVDFIFGNAA V QNC I+AR+P  K   
Sbjct  318   SVFYQCSFEAYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRPRSKTN-  376

Query  39    TITAQGRTDPNQN  1
             TITAQGR+DPNQN
Sbjct  377   TITAQGRSDPNQN  389



>ref|XP_006293950.1| hypothetical protein CARUB_v10022941mg, partial [Capsella rubella]
 gb|EOA26848.1| hypothetical protein CARUB_v10022941mg, partial [Capsella rubella]
Length=546

 Score =   456 bits (1174),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 243/373 (65%), Positives = 294/373 (79%), Gaps = 17/373 (5%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V +WCSQTP+P  C+YFLTH+  +    K +SEF K++ ++ALD AV A+THA  LGP+
Sbjct  64    DVEKWCSQTPNPKPCEYFLTHNSDN-KPIKSESEFLKISMKLALDRAVLAKTHASTLGPK  122

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVEL  751
             CR+ REKAAW DC+KLY+ T+  +N T+D   KC++ DA TWLSTALTNL+TCR GF+EL
Sbjct  123   CRDTREKAAWEDCIKLYDFTVSNINGTMDPNVKCSKTDAQTWLSTALTNLDTCRNGFLEL  182

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNN---NGSVPKQTYKDGFPAWVSLGDRRLLQASSP  580
             G +  VLPL+SNN VS LI NTLA+N    N + P+   KDGFP+WV  GDR+LLQ S+P
Sbjct  183   GVTDMVLPLMSNN-VSNLICNTLAINKVPFNYTAPE---KDGFPSWVKPGDRKLLQTSAP  238

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              K + VVAKDGSGN+KTIKDA++AA   SGSGRFVI++K+GVY+ENL+I  + KN+ML G
Sbjct  239   -KDNAVVAKDGSGNFKTIKDAINAA---SGSGRFVIYVKQGVYSENLEI--RKKNVMLRG  292

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG   T I+GSRSV GG+TTFNSATVA  GD FIA+GITFRNTAG  N QAVALRSG+DL
Sbjct  293   DGKGKTIITGSRSVGGGTTTFNSATVAAVGDAFIARGITFRNTAGANNAQAVALRSGSDL  352

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+C FEGYQDTLY HS RQFY+DC IYGTVDFIFGNAA V QNC I+AR+P  K   
Sbjct  353   SVFYQCSFEGYQDTLYVHSNRQFYRDCDIYGTVDFIFGNAAAVLQNCNIFARRPRSKTN-  411

Query  39    TITAQGRTDPNQN  1
             TITAQGR+DPNQN
Sbjct  412   TITAQGRSDPNQN  424



>ref|XP_002264156.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   454 bits (1169),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 235/373 (63%), Positives = 294/373 (79%), Gaps = 11/373 (3%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WCSQTP+P  C+YFL+H   H +  K+KS+F  ++ ++AL+ A+ A  +   LG +
Sbjct  24    DVKSWCSQTPYPQPCEYFLSHKPDH-SPIKQKSDFLNISMQVALEQAMTAHGNIFSLGSK  82

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD--EKCTQFDALTWLSTALTNLETCRTGFVEL  751
             CRN REKAAW DCV+LY+ TIL+LN+TLD   +CTQ DA TWLSTALTNL+TC+ GF+EL
Sbjct  83    CRNEREKAAWNDCVELYDHTILKLNKTLDPNTRCTQVDAQTWLSTALTNLQTCQDGFIEL  142

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNNNGSVP--KQTYKDGFPAWVSLGDRRLLQASS-P  580
             G S + LPLISNN VS+LI NTL++N    VP  + +YK G+P WV  GDR+LLQ+SS  
Sbjct  143   GVSDHFLPLISNN-VSKLISNTLSINK---VPYAEPSYKGGYPTWVKPGDRKLLQSSSLA  198

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              + ++VV+KDGSG+Y TI  A+ AA KRSGSGR+VI++K G Y+EN+ IG+ LKNI L+G
Sbjct  199   SQANIVVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGLKNITLLG  258

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG+  T ++GSRSV GGSTT+NSATVAV GDGFIA+G+T RNTAG  NHQAVALRSG+DL
Sbjct  259   DGIGKTIVTGSRSVGGGSTTYNSATVAVVGDGFIARGMTIRNTAGASNHQAVALRSGSDL  318

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SV+Y+C FEGYQDTLY +S RQFY++C IYGTVDFIFGNAAVVFQ C IYAR P +K   
Sbjct  319   SVYYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQKCNIYARNPPNKVN-  377

Query  39    TITAQGRTDPNQN  1
             T+TAQGRTDPNQN
Sbjct  378   TVTAQGRTDPNQN  390



>emb|CAN83663.1| hypothetical protein VITISV_017689 [Vitis vinifera]
Length=512

 Score =   454 bits (1168),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 234/373 (63%), Positives = 294/373 (79%), Gaps = 11/373 (3%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WCSQTP+P  C YFL+    H +  K+KS+F  ++ ++AL+ A+ A  +   LG +
Sbjct  23    DVKSWCSQTPNPQPCDYFLSQKTDH-SLIKQKSDFLNLSMQLALERAIIAHGNTLSLGSK  81

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD--EKCTQFDALTWLSTALTNLETCRTGFVEL  751
             CRN REKAAW DC++LYE TIL+LN+TLD   +CTQ DA TWLSTALTNL+TC+ GF+EL
Sbjct  82    CRNEREKAAWNDCLELYEHTILKLNKTLDPNTRCTQVDAQTWLSTALTNLQTCQDGFIEL  141

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNNNGSVP--KQTYKDGFPAWVSLGDRRLLQASS-P  580
             G S  +LP +SNN VS+LI NTL++N    VP  + +YK G+P WV  GDR+LLQ+SS  
Sbjct  142   GVSDYLLPSMSNN-VSKLISNTLSINK---VPYAEPSYKGGYPTWVKPGDRKLLQSSSLA  197

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              + ++VV+KDGSG+Y TI  A+ AA KRSGSGR+VI++K G Y+EN+ IG+ LKNIML+G
Sbjct  198   SQANIVVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGLKNIMLLG  257

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG+  T ++GS+SV GGSTTF SATVAV GDGFIA+G+TFRNTAG  NHQAVALRSG+DL
Sbjct  258   DGIGKTIVTGSKSVGGGSTTFKSATVAVVGDGFIARGMTFRNTAGASNHQAVALRSGSDL  317

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SV+Y+C FEGYQDTLY +S+RQFY++C IYGTVDFIFGNAAVVFQNC IYAR P +K   
Sbjct  318   SVYYQCSFEGYQDTLYTYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKIN-  376

Query  39    TITAQGRTDPNQN  1
             T+TAQGRTDPNQN
Sbjct  377   TVTAQGRTDPNQN  389



>ref|XP_002882002.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58261.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score =   454 bits (1167),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 239/373 (64%), Positives = 297/373 (80%), Gaps = 17/373 (5%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WCSQTP+P  C+YFLTH+  +    K +SEF +++ ++ALD AV A+THA  LGP+
Sbjct  29    DVKAWCSQTPNPKPCEYFLTHNSNN-KPIKSESEFLEISMKLALDRAVLAKTHAFTLGPK  87

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVEL  751
             CR+ REKAAW DC+KLY+ T+ ++N+T+D   KC++ DA TWLSTALTNL+TCR GF+EL
Sbjct  88    CRDTREKAAWEDCIKLYDLTVSKINETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFLEL  147

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNN---NGSVPKQTYKDGFPAWVSLGDRRLLQASSP  580
             G +  VLPL+SNN VS L+ NTLA+N    N + P+   KDGFP+WV  GDR+LLQ+S+P
Sbjct  148   GVTDVVLPLMSNN-VSNLLCNTLAINKVPFNYTPPE---KDGFPSWVKPGDRKLLQSSTP  203

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              K + VVAKDGSGN+KTIKDA++AA   SGSGRFVI++K+GVY+ENL+I  + KN+ML G
Sbjct  204   -KDNAVVAKDGSGNFKTIKDAINAA---SGSGRFVIYVKQGVYSENLEI--RKKNVMLRG  257

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG+  T I+GS+SV GG+TTFNSATVA  GDGFIA+GITFRNTAG  N QAVALRSG+DL
Sbjct  258   DGIGKTIITGSKSVGGGTTTFNSATVAAVGDGFIARGITFRNTAGANNAQAVALRSGSDL  317

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+C FE YQDTLY HS RQFY+DC +YGTVDFIFGNAA V QNC I+AR+P  K   
Sbjct  318   SVFYQCSFEAYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRPRSKTN-  376

Query  39    TITAQGRTDPNQN  1
             TITAQGR+DPNQN
Sbjct  377   TITAQGRSDPNQN  389



>emb|CAN78759.1| hypothetical protein VITISV_000562 [Vitis vinifera]
Length=513

 Score =   454 bits (1168),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 235/375 (63%), Positives = 297/375 (79%), Gaps = 9/375 (2%)
 Frame = -1

Query  1113  AAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRL  934
             ++ +V  WC QTP+P  C+YFL+H   H +  K+KS+F  ++ ++AL+ A+ A      L
Sbjct  21    SSDDVKSWCRQTPYPQPCEYFLSHKPDH-SPIKQKSDFLNISMQLALEHAMIAHGDTFSL  79

Query  933   GPRCRNAREKAAWADCVKLYEDTILQLNQTLD--EKCTQFDALTWLSTALTNLETCRTGF  760
             G +CRN REKAAW DC++LY+ TIL+LN+TLD   +CTQ DA TWLSTALTNL+TC+ GF
Sbjct  80    GSKCRNEREKAAWNDCLELYDHTILKLNKTLDPNTRCTQADAQTWLSTALTNLQTCQDGF  139

Query  759   VELGNSRNVLPLISNNNVSQLIGNTLALNNNG-SVPKQTYKDGFPAWVSLGDRRLLQASS  583
             +ELG S + LPL+SNN VS+LI NTL++N    SVP  TYK G+P WV  GDR+LLQ+SS
Sbjct  140   IELGVSGHFLPLMSNN-VSKLISNTLSINKVPYSVP--TYKGGYPTWVKPGDRKLLQSSS  196

Query  582   -PVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIML  406
                + ++VV+KDG+ +Y TI  A+ AA KRSGSGR+VI++K G Y+EN+ IG+ LKNIML
Sbjct  197   LASQANIVVSKDGTHDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGLKNIML  256

Query  405   VGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGA  226
             +GDG+  T ++GS+SV GGSTT+NSATVAV GDGFIA+G+TFRNTAG  NHQAVALRSG+
Sbjct  257   LGDGIGKTIVTGSKSVGGGSTTYNSATVAVVGDGFIARGMTFRNTAGASNHQAVALRSGS  316

Query  225   DLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQ  46
             DLSVFY+C FEGYQDTLY +S+RQFY++C IYGTVDFIFGNAAVVFQNC IYAR P +K 
Sbjct  317   DLSVFYQCSFEGYQDTLYTYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKI  376

Query  45    KITITAQGRTDPNQN  1
               T+TAQGRTDPNQN
Sbjct  377   N-TVTAQGRTDPNQN  390



>ref|XP_010259196.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=515

 Score =   453 bits (1165),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 236/399 (59%), Positives = 302/399 (76%), Gaps = 22/399 (6%)
 Frame = -1

Query  1185  IHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKS  1006
             +HLFL    FSS+I       PP     +  WC QTP+P  C+YF+ H + H +  K +S
Sbjct  12    VHLFLSPVVFSSYI-------PP----NIKLWCRQTPYPQHCEYFMNH-KHHSSGVKSRS  59

Query  1005  EFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEKCT  826
             +FKK+A  IAL+ A+ A ++A  LGP+CRN REK AWADC++LY++TI++LN T++    
Sbjct  60    DFKKLAVRIALEQALMATSNAMLLGPKCRNEREKVAWADCLELYDNTIIRLNDTINSNYD  119

Query  825   QFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQT  646
               D +TWLSTALTNLETCRTGFVELG +  +LPL+ NN VS+LI NTLA++   +    T
Sbjct  120   --DYMTWLSTALTNLETCRTGFVELGITDYILPLMPNN-VSELISNTLAVSKLPTGEPAT  176

Query  645   YKDGF--PAWVSLGDRRLLQ-ASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRF  478
             Y+DG   P+WV   D++LLQ AS P  + D+VVA+DG+G+++T+ +A++AA K+   GR 
Sbjct  177   YEDGSWRPSWVKADDQKLLQTASRPTSEADVVVAQDGTGDFETVNEAMNAAAKQKRRGRL  236

Query  477   VIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFI  298
             +I++K G Y EN+ IG KLKNIML+GDGM  T I+GS+SV GGSTTF+SATVAV+GDGFI
Sbjct  237   LIYVKAGTYRENVQIGKKLKNIMLIGDGMGKTIITGSKSVRGGSTTFSSATVAVSGDGFI  296

Query  297   AQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVD  118
             A+ ITF+NTAGPEN QAVALRSG+DLSVFY+CGFEGYQDTLY HS+RQFY++C IYGTVD
Sbjct  297   ARDITFQNTAGPENGQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVD  356

Query  117   FIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             FIFGNAAVVFQ C IYAR+      IT+TAQGR DPNQN
Sbjct  357   FIFGNAAVVFQKCNIYARR---HSIITVTAQGRNDPNQN  392



>ref|XP_010508199.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Camelina sativa]
Length=510

 Score =   452 bits (1163),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 240/373 (64%), Positives = 294/373 (79%), Gaps = 17/373 (5%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WCSQTP+P  C+YFLTH+  +    K +SEF K++ ++ALD A+ A+TH   LGP+
Sbjct  28    DVKAWCSQTPNPKPCEYFLTHNLDN-KPIKSESEFLKISMKLALDRAILAKTHTSTLGPK  86

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVEL  751
             CR+ REKAAW DC+KLY+ TI  +N+T+D   KC++ DA TWLSTALTNL+TCR GFV+L
Sbjct  87    CRDTREKAAWEDCIKLYDYTISNINETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFVDL  146

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNN---NGSVPKQTYKDGFPAWVSLGDRRLLQASSP  580
             G +  VLPL+SNN VS L+ NTLA+N    N + P+   KDGFP+WV  GDR+LLQ S+P
Sbjct  147   GVTDIVLPLMSNN-VSNLLCNTLAINKVPFNYTPPE---KDGFPSWVKPGDRKLLQTSTP  202

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              + + VVAKDGSGN+KTIKDA++AA   SGSGRFVI++K+GVY+ENL+I  + KN+ML G
Sbjct  203   -RDNAVVAKDGSGNFKTIKDAINAA---SGSGRFVIYVKQGVYSENLEI--RKKNVMLRG  256

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG   T I+GSRSV GG+TTFNSATVA  GDGFIA+GITFRNTAG  N QAVALRSG+DL
Sbjct  257   DGKGRTIITGSRSVGGGTTTFNSATVAAVGDGFIARGITFRNTAGANNAQAVALRSGSDL  316

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+C FEGYQDTLY HS RQFY+DC +YGTVDFIFGNAA V QNC I+AR+P  K   
Sbjct  317   SVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRPRSKTN-  375

Query  39    TITAQGRTDPNQN  1
             TITAQGR+DPNQN
Sbjct  376   TITAQGRSDPNQN  388



>ref|XP_010506460.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Camelina sativa]
Length=510

 Score =   452 bits (1163),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 240/373 (64%), Positives = 294/373 (79%), Gaps = 17/373 (5%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WCSQTP+P  C+YFLTH+  +    K +SEF K++ ++ALD A+ A+TH   LGP+
Sbjct  28    DVKAWCSQTPNPKPCEYFLTHNLDN-KPIKSESEFLKISMKLALDRAILAKTHTSTLGPK  86

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVEL  751
             CR+ REKAAW DC+KLY+ TI  +N+T+D   KC++ DA TWLSTALTNL+TCR GFV+L
Sbjct  87    CRDTREKAAWEDCIKLYDYTISNINETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFVDL  146

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNN---NGSVPKQTYKDGFPAWVSLGDRRLLQASSP  580
             G +  VLPL+SNN VS L+ NTLA+N    N + P+   KDGFP+WV  GDR+LLQ S+P
Sbjct  147   GVTDIVLPLMSNN-VSNLLCNTLAINKVPFNYTPPE---KDGFPSWVKPGDRKLLQTSTP  202

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              + + VVAKDGSGN+KTIKDA++AA   SGSGRFVI++K+GVY+ENL+I  + KN+ML G
Sbjct  203   -RDNAVVAKDGSGNFKTIKDAINAA---SGSGRFVIYVKQGVYSENLEI--RKKNVMLRG  256

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG   T I+GSRSV GG+TTFNSATVA  GDGFIA+GITFRNTAG  N QAVALRSG+DL
Sbjct  257   DGKGRTIITGSRSVGGGTTTFNSATVAAVGDGFIARGITFRNTAGANNAQAVALRSGSDL  316

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+C FEGYQDTLY HS RQFY+DC +YGTVDFIFGNAA V QNC I+AR+P  K   
Sbjct  317   SVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRPRSKTN-  375

Query  39    TITAQGRTDPNQN  1
             TITAQGR+DPNQN
Sbjct  376   TITAQGRSDPNQN  388



>ref|XP_006397702.1| hypothetical protein EUTSA_v10001409mg [Eutrema salsugineum]
 gb|ESQ39155.1| hypothetical protein EUTSA_v10001409mg [Eutrema salsugineum]
Length=511

 Score =   451 bits (1161),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 239/373 (64%), Positives = 294/373 (79%), Gaps = 17/373 (5%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WCSQTP+P  C+YFLTH+       K +SEF K++ ++ALD A+ A+TH   LGP+
Sbjct  29    DVKAWCSQTPNPKPCEYFLTHNSNQ-KPIKSESEFLKISMKLALDRAILAKTHTSTLGPK  87

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVEL  751
             CR+ REKAAW DC+KLY+ T+ ++N+T+D   KC++ DA TWLSTALTNL+TCR GF+EL
Sbjct  88    CRDTREKAAWEDCLKLYDLTVSKINETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFLEL  147

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNN---NGSVPKQTYKDGFPAWVSLGDRRLLQASSP  580
             G +  VLPLISNN VS LI NTLA+N    N + P+   KDGFP+WV  GDR+LLQ+S+P
Sbjct  148   GVTDIVLPLISNN-VSNLICNTLAINKVPFNYTPPE---KDGFPSWVKPGDRKLLQSSTP  203

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              + + VVAKDGSGN++TIKDA++AA    GSGRFVI++K+GVY+ENL+I  + KNIML G
Sbjct  204   -RDNAVVAKDGSGNFRTIKDAINAA---KGSGRFVIYVKQGVYSENLEI--RKKNIMLRG  257

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG   T I+GSRSV GG+TTFNSATVA  GDGFIA+GITFRNTAG  N QAVALRSG+DL
Sbjct  258   DGKGRTIITGSRSVGGGTTTFNSATVAAVGDGFIARGITFRNTAGANNAQAVALRSGSDL  317

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+C FEGYQDTLY HS RQFY+DC +YGTVDFIFGNAA V QNC I+AR+P  +   
Sbjct  318   SVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRPRSRTN-  376

Query  39    TITAQGRTDPNQN  1
             TITAQGR+DPNQN
Sbjct  377   TITAQGRSDPNQN  389



>ref|XP_002265599.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=512

 Score =   451 bits (1160),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 233/373 (62%), Positives = 293/373 (79%), Gaps = 11/373 (3%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WCSQTP+P  C YFL+      +  K+KS+F  ++ ++AL+ A+ A  +   LG +
Sbjct  23    DVKSWCSQTPNPQPCDYFLSQKTDQ-SLIKQKSDFLNLSMQLALERAIIAHGNTLSLGSK  81

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD--EKCTQFDALTWLSTALTNLETCRTGFVEL  751
             CRN REKAAW DC++LYE TIL+LN+TLD   +CTQ DA TWLSTALTNL+TC+ GF+EL
Sbjct  82    CRNEREKAAWNDCLELYEHTILKLNKTLDPNTRCTQVDAQTWLSTALTNLQTCQDGFIEL  141

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNNNGSVP--KQTYKDGFPAWVSLGDRRLLQASS-P  580
             G S  +LP +SNN VS+LI NTL++N    VP  + +YK G+P WV  GDR+LLQ+SS  
Sbjct  142   GVSDYLLPSMSNN-VSKLISNTLSINK---VPYAEPSYKGGYPTWVKPGDRKLLQSSSLA  197

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              + ++VV+KDGSG+Y TI  A+ AA KRSGSGR+VI++K G Y+EN+ IG+ LKNIML+G
Sbjct  198   SQANIVVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGLKNIMLLG  257

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG+  T ++GS+SV GGSTTF SATVAV GDGFIA+G+TFRNTAG  NHQAVALRSG+DL
Sbjct  258   DGIGKTIVTGSKSVGGGSTTFKSATVAVVGDGFIARGMTFRNTAGASNHQAVALRSGSDL  317

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SV+Y+C FEGYQDTLY +S+RQFY++C IYGTVDFIFGNAAVVFQNC IYAR P +K   
Sbjct  318   SVYYQCSFEGYQDTLYTYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKIN-  376

Query  39    TITAQGRTDPNQN  1
             T+TAQGRTDPNQN
Sbjct  377   TVTAQGRTDPNQN  389



>ref|XP_010518135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
isoform X1 [Camelina sativa]
 ref|XP_010518136.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
isoform X2 [Camelina sativa]
Length=510

 Score =   451 bits (1159),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 239/373 (64%), Positives = 293/373 (79%), Gaps = 17/373 (5%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WCSQTP+P  C+YFLTH+  +    K +SEF K++ ++ALD  + A+TH   LGP+
Sbjct  28    DVKAWCSQTPNPKPCEYFLTHNLDN-KPIKSESEFLKISMKLALDRTILAKTHTSTLGPK  86

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVEL  751
             CR+ REKAAW DC+KLY+ TI  +N+T+D   KC++ DA TWLSTALTNL+TCR GFV+L
Sbjct  87    CRDTREKAAWEDCIKLYDYTISNINETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFVDL  146

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNN---NGSVPKQTYKDGFPAWVSLGDRRLLQASSP  580
             G +  VLPL+SNN VS L+ NTLA+N    N + P+   KDGFP+WV  GDR+LLQ S+P
Sbjct  147   GVTDIVLPLMSNN-VSNLLCNTLAINKVPFNYTPPE---KDGFPSWVKPGDRKLLQTSTP  202

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              + + VVAKDGSGN+KTIKDA++AA   SGSGRFVI++K+GVY+ENL+I  + KN+ML G
Sbjct  203   -RDNAVVAKDGSGNFKTIKDAINAA---SGSGRFVIYVKQGVYSENLEI--RKKNVMLRG  256

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG   T I+GSRSV GG+TTFNSATVA  GDGFIA+GITFRNTAG  N QAVALRSG+DL
Sbjct  257   DGKGRTIITGSRSVGGGTTTFNSATVAAVGDGFIARGITFRNTAGANNAQAVALRSGSDL  316

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+C FEGYQDTLY HS RQFY+DC +YGTVDFIFGNAA V QNC I+AR+P  K   
Sbjct  317   SVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRPRSKTN-  375

Query  39    TITAQGRTDPNQN  1
             TITAQGR+DPNQN
Sbjct  376   TITAQGRSDPNQN  388



>ref|XP_009599511.1| PREDICTED: pectinesterase 2-like [Nicotiana tomentosiformis]
Length=522

 Score =   451 bits (1160),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 239/393 (61%), Positives = 298/393 (76%), Gaps = 10/393 (3%)
 Frame = -1

Query  1152  SFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTA--PKRKSEFKKMATEI  979
             S + V+  V P  ++  +   CSQTP P  C+YFL    R + A    +KS+F KM+ ++
Sbjct  8     SLLLVSYIVFPTVSSYSLKSRCSQTPFPQPCEYFLADHNRKYGALLINKKSDFHKMSLKL  67

Query  978   ALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTW  805
             ALD A++A  +   LG +CRN  EKAAWADCV+LY++ I+++N+T+D   K T  D  TW
Sbjct  68    ALDRALRAHENTLSLGSKCRNKHEKAAWADCVELYQNIIVKINKTIDPSIKSTADDVQTW  127

Query  804   LSTALTNLETCRTGFVELGNSRNVLP-LISNNNVSQLIGNTLALNNN--GSVPKQTYKDG  634
             LSTALTN+ETCR+GF+ELG +  V+P L+SN NVS LI NTL LN     + P   Y+DG
Sbjct  128   LSTALTNIETCRSGFIELGVTDYVMPILMSNINVSYLISNTLFLNRGYYSTEPSTNYEDG  187

Query  633   FPAWVSLGDRRLLQASSPV--KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKR  460
             FP WVS  D+ LLQ+SS +  + ++VVAKDGSGN+KT+ +A+ AA KR+GSGRFVI++  
Sbjct  188   FPNWVSPNDQTLLQSSSNLGSQANIVVAKDGSGNFKTVTEAVVAAAKRTGSGRFVIYVNV  247

Query  459   GVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITF  280
             G+YNEN++IG  LKNIMLVGDG+  T I+GS+SV GGSTTF SATVAV GDGFIAQGITF
Sbjct  248   GIYNENVEIGINLKNIMLVGDGIGKTIITGSKSVGGGSTTFKSATVAVDGDGFIAQGITF  307

Query  279   RNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNA  100
             RNTAGP+N QAVALRSG+DLSVFY+C FEGYQDTL AHSQRQFY+DC IYGTVDFIFGNA
Sbjct  308   RNTAGPKNGQAVALRSGSDLSVFYQCSFEGYQDTLCAHSQRQFYRDCDIYGTVDFIFGNA  367

Query  99    AVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             AVV QNC I+AR P  +   T+TAQGR+DPNQN
Sbjct  368   AVVLQNCNIFARNPPSRIN-TVTAQGRSDPNQN  399



>ref|XP_009133718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score =   451 bits (1159),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 236/370 (64%), Positives = 292/370 (79%), Gaps = 11/370 (3%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WCSQTP+P  C+YFLTH+       K +SEF K++ ++ALD A+ A++HA  LGP+
Sbjct  28    DVKAWCSQTPNPKPCEYFLTHNSNQ-KPIKSESEFLKISMKLALDRAILAKSHASTLGPK  86

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVEL  751
             CR+ REKAAW DC+KLY+ T+ ++N+T++   KC++ DA TWLSTALTNL+TCR GF+EL
Sbjct  87    CRDTREKAAWEDCIKLYDFTVSKINETMNPNVKCSKTDAQTWLSTALTNLDTCRAGFLEL  146

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGFPAWVSLGDRRLLQASSPVKP  571
             G +  VLPL+SNN VS LI NTLA+N          KDGFP+WV  GDR+LLQ+S+P + 
Sbjct  147   GVTDIVLPLMSNN-VSNLICNTLAINKVPFNYTPPGKDGFPSWVKPGDRKLLQSSTP-RD  204

Query  570   DLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGM  391
             + VVAKDGSGN++TIKDA++AA   SGSGRFVI++K+GVY+ENL+I  + KN+ML GDG 
Sbjct  205   NAVVAKDGSGNFRTIKDAINAA---SGSGRFVIYVKQGVYSENLEI--RKKNVMLRGDGK  259

Query  390   RYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVF  211
               T I+GSRSV GGSTTFNSATVA  GDGFIA+GITFRNTAG  N QAVALRSG+DLSVF
Sbjct  260   GRTIITGSRSVGGGSTTFNSATVAAVGDGFIARGITFRNTAGANNAQAVALRSGSDLSVF  319

Query  210   YKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITIT  31
             Y+C FEGYQDTLY HS RQFY+DC +YGTVDFIFGNAA V QNC I+AR+P  +   TIT
Sbjct  320   YQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRPRSRTN-TIT  378

Query  30    AQGRTDPNQN  1
             AQGR+DPNQN
Sbjct  379   AQGRSDPNQN  388



>ref|XP_010259034.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=517

 Score =   450 bits (1158),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 240/400 (60%), Positives = 300/400 (75%), Gaps = 13/400 (3%)
 Frame = -1

Query  1185  IHLFLVLASFSSF-ISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRK  1009
             +H FL L    S  +S + S N P     +  WCSQT +P  C+Y++ H   H +     
Sbjct  3     LHEFLTLVILISLLVSPSFSDNIPP---NIRTWCSQTSYPQSCEYYMGH-HPHSSFLSGH  58

Query  1008  SEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--  835
              + KK+A +IALD A+QAE++   LGP+CRN REKAAW DC++LY++TI +LN T++   
Sbjct  59    LDSKKLAMQIALDQAIQAESNNMLLGPKCRNEREKAAWTDCIELYKNTIARLNLTVNPGA  118

Query  834   KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP  655
             KCT  D  TWLSTALTNLETCRTGFVELG S  +LPL+SNN VS+LI N LA+N   ++P
Sbjct  119   KCTDVDLQTWLSTALTNLETCRTGFVELGVSDYILPLMSNN-VSKLISNILAINKPVALP  177

Query  654   -KQTYKDGFPAWVSLGDRRLLQASS-PVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGR  481
              +QTY +GFP WVS  DR+LLQA++   +  LVVA+DGSGN+KTI +A++AA K++  GR
Sbjct  178   NEQTYHEGFPTWVSPRDRKLLQATALASRAILVVAQDGSGNFKTINEAINAAAKQNTGGR  237

Query  480   FVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGF  301
             FVI +K G Y E+L IG+   N+MLVGDG+  T I+GS SV GGSTTFNSATVAV GDGF
Sbjct  238   FVIQVKAGTYAEHLHIGSP--NLMLVGDGIGNTVITGSMSVGGGSTTFNSATVAVVGDGF  295

Query  300   IAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTV  121
             IA+ ITFRNTAGP   QAVALRSG+DLSVFY+C FEGYQDTLY HS+RQFY++C IYGTV
Sbjct  296   IARDITFRNTAGPGKGQAVALRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECAIYGTV  355

Query  120   DFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             DFIFGNAAVV QNC I++RKP++   +T+TAQGR DPNQN
Sbjct  356   DFIFGNAAVVLQNCNIFSRKPING-VVTVTAQGRIDPNQN  394



>ref|XP_003521940.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=511

 Score =   450 bits (1157),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 247/405 (61%), Positives = 300/405 (74%), Gaps = 20/405 (5%)
 Frame = -1

Query  1194  MSKIHLFLVLAS---FSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFT  1024
             M    LFL L+     SSF+S + S N      +V  WCSQTP+P+ C+YFL+++  H  
Sbjct  1     MIAFRLFLALSLPFFLSSFVS-SYSWN------DVKLWCSQTPNPEPCEYFLSNNPTHQY  53

Query  1023  AP-KRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQ  847
              P K+KSEF K++ ++A + A+    +   LG +CRN RE AAWADCV+LYE TI +LN+
Sbjct  54    KPIKQKSEFFKLSLQLAQERALNGHANTLSLGSKCRNPRETAAWADCVELYEQTIRKLNK  113

Query  846   TLDE--KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALN  673
             TLD   K +Q D  TWLSTALTNLETC+ GF ELG    VLPL+SNN V++L+ NTLALN
Sbjct  114   TLDPSTKFSQVDTQTWLSTALTNLETCKAGFYELGVQDYVLPLMSNN-VTKLLSNTLALN  172

Query  672   NNGSVPKQTYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKR  496
                   + +YKDGFP WV  GDRRLLQASSP  K ++VVAKDGSG Y T+ +A++AA K 
Sbjct  173   K-VEYEEPSYKDGFPTWVKPGDRRLLQASSPASKANVVVAKDGSGKYTTVSEAVNAAPK-  230

Query  495   SGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAV  316
             S SGR+VI++K G+Y+E ++I  K  NIMLVGDG+  T I+ S+SV GG+TTF SATVAV
Sbjct  231   SNSGRYVIYVKGGIYDEQVEI--KANNIMLVGDGIGKTIITSSKSVGGGTTTFRSATVAV  288

Query  315   TGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCY  136
              GDGFI Q ITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLY +S RQFY++C 
Sbjct  289   VGDGFITQDITFRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECD  348

Query  135   IYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             IYGTVDFIFGNAAVVFQNC IYAR P +K   TITAQGRTDPNQN
Sbjct  349   IYGTVDFIFGNAAVVFQNCNIYARNPPNKVN-TITAQGRTDPNQN  392



>ref|XP_010672022.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=521

 Score =   449 bits (1156),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 233/374 (62%), Positives = 287/374 (77%), Gaps = 11/374 (3%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRC  922
             +N WC+QTP+P+ CKYF++H  +    PK K++FKKM  +IALD    +    K L  + 
Sbjct  28    INWWCNQTPNPNPCKYFMSHDLK----PKHKADFKKMMIQIALDRTRFSHNQTKELIHKL  83

Query  921   RN-AREKAAWADCVKLYEDTILQLNQTLD---EKCTQFDALTWLSTALTNLETCRTG-FV  757
             +N   +K AWADC+ LYE+TI +LN+TL+   +  T+FD  TWLSTALTNLETC++  F 
Sbjct  84    KNNEHDKVAWADCLTLYENTISELNKTLNPTKKYRTEFDKQTWLSTALTNLETCKSELFD  143

Query  756   ELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPK-QTYKDGFPAWVSLGDRRLLQASSP  580
             +LG+  + +P    NNVS+LI N LA++N  ++P+ QTYK GFP WV+  DR+LLQ+SS 
Sbjct  144   QLGHVLDFIPPHIYNNVSELISNGLAMHNKLAIPQTQTYKLGFPTWVTRRDRKLLQSSST  203

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNENLDIGNKLKNIMLV  403
                +LVVAKDGSGN+KTI++ALDAA KR+  SGRFVIHIK GVY E L IG  LKNIMLV
Sbjct  204   KAANLVVAKDGSGNFKTIREALDAAAKRTRSSGRFVIHIKSGVYAEYLRIGTDLKNIMLV  263

Query  402   GDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGAD  223
             GDGM  T I+G+RS  GG T F SATVAVT DGFIA+ ITFRNTAGP+N+QAVALR G+D
Sbjct  264   GDGMESTIITGNRSKGGGFTIFTSATVAVTSDGFIARDITFRNTAGPQNNQAVALRVGSD  323

Query  222   LSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQK  43
             LSVFYKCGFEGYQDTLYAHSQRQFY++C IYGT+DFIFGNAA +FQNC I+ RKP+  QK
Sbjct  324   LSVFYKCGFEGYQDTLYAHSQRQFYRECNIYGTIDFIFGNAASIFQNCNIFVRKPLSSQK  383

Query  42    ITITAQGRTDPNQN  1
               +TAQGRTDPNQN
Sbjct  384   NVVTAQGRTDPNQN  397



>gb|KHN35617.1| Pectinesterase 2 [Glycine soja]
Length=511

 Score =   448 bits (1152),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 246/405 (61%), Positives = 300/405 (74%), Gaps = 20/405 (5%)
 Frame = -1

Query  1194  MSKIHLFLVLAS---FSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFT  1024
             M    LFL L+     SSF+S + S N      +V  WCSQTP+P+ C+YFL+++  H  
Sbjct  1     MIAFRLFLTLSVPFFLSSFVS-SYSWN------DVKLWCSQTPNPEPCEYFLSNNPTHQY  53

Query  1023  AP-KRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQ  847
              P K+KS+F K++ ++A + A+    +   LG +CRN RE AAWADCV+LYE TI +LN+
Sbjct  54    KPIKQKSDFFKLSLQLAQERALNGHANTLSLGSKCRNPRETAAWADCVELYEQTIRKLNK  113

Query  846   TLDE--KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALN  673
             TLD   K +Q D  TWLSTALTNLETC+ GF ELG    VLPL+SNN V++L+ NTLALN
Sbjct  114   TLDPSTKFSQVDTQTWLSTALTNLETCKAGFYELGVQDYVLPLMSNN-VTKLLSNTLALN  172

Query  672   NNGSVPKQTYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKR  496
                   + +YKDGFP WV  GDRRLLQASSP  K ++VVAKDGSG Y T+ +A++AA K 
Sbjct  173   K-VEYEEPSYKDGFPTWVKPGDRRLLQASSPASKANVVVAKDGSGKYTTVSEAVNAAPK-  230

Query  495   SGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAV  316
             S SGR+VI++K G+Y+E ++I  K  NIMLVGDG+  T I+ S+SV GG+TTF SATVAV
Sbjct  231   SNSGRYVIYVKGGIYDEQVEI--KANNIMLVGDGIGKTIITSSKSVGGGTTTFRSATVAV  288

Query  315   TGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCY  136
              GDGFI Q ITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLY +S RQFY++C 
Sbjct  289   VGDGFITQDITFRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECD  348

Query  135   IYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             IYGTVDFIFGNAAVVFQNC IYAR P +K   TITAQGRTDPNQN
Sbjct  349   IYGTVDFIFGNAAVVFQNCNIYARNPPNKVN-TITAQGRTDPNQN  392



>ref|XP_003517029.1| PREDICTED: pectinesterase 2-like [Glycine max]
 ref|XP_003517030.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=515

 Score =   447 bits (1151),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 237/374 (63%), Positives = 293/374 (78%), Gaps = 14/374 (4%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAP-KRKSEFKKMATEIALDTAVQAETHAKRLGP  928
             EV  WC+QTP+P  C+YFL+++  +   P K+KS+F K++ ++A + A++   +   LG 
Sbjct  27    EVKLWCNQTPNPQPCEYFLSNNPTYQYKPLKQKSDFLKLSLQLAQERALKGHENTLSLGS  86

Query  927   RCRNAREKAAWADCVKLYEDTILQLNQTL--DEKCTQFDALTWLSTALTNLETCRTGFVE  754
             +CRN RE+ AWADCV+LYE TI +LNQTL  + K +Q DA TWLSTALTNLETC+ GF E
Sbjct  87    KCRNPRERVAWADCVELYEQTIRKLNQTLKPNTKLSQVDAQTWLSTALTNLETCKAGFYE  146

Query  753   LGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ--TYKDGFPAWVSLGDRRLLQASSP  580
             LG    VLPL+SNN V++L+ NTLALN    VP Q  +YK+GFP WV  GDR+LLQASSP
Sbjct  147   LGVQDYVLPLMSNN-VTKLLSNTLALNK---VPYQEPSYKEGFPTWVKPGDRKLLQASSP  202

Query  579   V-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLV  403
               + ++VVAKDGSG + T+  A++AA K S SGR+VI++K GVY+E +++  K KNIMLV
Sbjct  203   ASRANVVVAKDGSGRFTTVSAAINAAPK-SSSGRYVIYVKGGVYDEQVEV--KAKNIMLV  259

Query  402   GDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGAD  223
             GDG+  T I+GS+SV GG+TTF SATVAV GDGFIAQGITFRNTAG +NHQAVALRSG+D
Sbjct  260   GDGIGKTIITGSKSVGGGTTTFRSATVAVVGDGFIAQGITFRNTAGAKNHQAVALRSGSD  319

Query  222   LSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQK  43
             LSVFYKC FEGYQDTLY HS+RQFY++C IYGTVDFIFGNAAVV QNC I+AR P +K  
Sbjct  320   LSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGNAAVVLQNCNIFARNPPNKVN  379

Query  42    ITITAQGRTDPNQN  1
              TITAQGRTDPNQN
Sbjct  380   -TITAQGRTDPNQN  392



>gb|KEH29125.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=509

 Score =   447 bits (1151),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 234/371 (63%), Positives = 290/371 (78%), Gaps = 13/371 (4%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
              +  WCSQTP+P  C+Y+LT++  + T  K KS+F K++ EIA++ A + E +   +GP+
Sbjct  28    SIKSWCSQTPYPQPCEYYLTNNAFNQTI-KSKSDFFKVSLEIAMERAKKGEENTHAVGPK  86

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGN  745
             CR+ +EKAAWADC++LY+ T+ +L+QT   KCTQ+++ TWLSTALTNLETC+ GF +LG 
Sbjct  87    CRSPQEKAAWADCLELYDFTVQKLSQTKYTKCTQYESQTWLSTALTNLETCKNGFYDLGV  146

Query  744   SRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ--TYKDGFPAWVSLGDRRLLQASSPV-K  574
             +  VLPL+SNN V++L+ NTL+LN    VP Q  +YKDGFP WV  GDR+LLQ SS   K
Sbjct  147   TNYVLPLLSNN-VTKLLSNTLSLNK---VPYQQPSYKDGFPTWVKPGDRKLLQTSSAASK  202

Query  573   PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDG  394
              ++VVAKDGSG Y T+K A DAA   SGSGR+VI++K GVYNE ++I  K KN+MLVGDG
Sbjct  203   ANVVVAKDGSGKYTTVKAATDAA--PSGSGRYVIYVKAGVYNEQVEI--KAKNVMLVGDG  258

Query  393   MRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSV  214
             +  T I+GS+SV GG+TTF SATVA TGDGFIAQ ITFRNTAG  NHQAVA RSG+DLSV
Sbjct  259   IGKTIITGSKSVGGGTTTFRSATVAATGDGFIAQDITFRNTAGAANHQAVAFRSGSDLSV  318

Query  213   FYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITI  34
             FYKC FEGYQDTLY HS+RQFY++C IYGTVDFIFGNAAVV QNC I+AR P  K  IT+
Sbjct  319   FYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGNAAVVLQNCNIFARNPPAK-TITV  377

Query  33    TAQGRTDPNQN  1
             TAQGRTDPNQN
Sbjct  378   TAQGRTDPNQN  388



>ref|XP_003521947.1| PREDICTED: pectinesterase 2-like, partial [Glycine max]
Length=506

 Score =   446 bits (1147),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 244/400 (61%), Positives = 299/400 (75%), Gaps = 19/400 (5%)
 Frame = -1

Query  1182  HLFLVLASF--SSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAP-KR  1012
             +L L +  F  SSF+S + S N      +V  WCSQTP+P+ C+YFL+++  H   P K+
Sbjct  1     YLILCIVPFFLSSFVS-SYSWN------DVKLWCSQTPNPEPCEYFLSNNPTHQYKPIKQ  53

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE-  835
             KS+F K++ ++A + A+    +   LG +CRN RE AAWADCV+LYE TI +LN+TLD  
Sbjct  54    KSDFFKLSLQLAQERALNGHANTLSLGSKCRNPRETAAWADCVELYEQTIRKLNKTLDPS  113

Query  834   -KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSV  658
              K +Q D  TWLSTALTNLETC+ GF ELG    VLPL+SNN V++L+ NTLALN     
Sbjct  114   TKFSQVDTQTWLSTALTNLETCKAGFYELGVQDYVLPLMSNN-VTKLLSNTLALNK-VEY  171

Query  657   PKQTYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGR  481
              + +YKDGFP WV  GDRRLLQASSP  K ++VVAKDGSG Y T+ +A++AA K S SGR
Sbjct  172   EEPSYKDGFPTWVKPGDRRLLQASSPASKANVVVAKDGSGKYTTVSEAVNAAPK-SNSGR  230

Query  480   FVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGF  301
             +VI++K G+Y+E ++I  K  NIMLVGDG+  T I+ S+SV GG+TTF SATVAV GDGF
Sbjct  231   YVIYVKGGIYDEQVEI--KANNIMLVGDGIGKTIITSSKSVGGGTTTFRSATVAVVGDGF  288

Query  300   IAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTV  121
             I Q ITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLY +S RQFY++C IYGTV
Sbjct  289   ITQDITFRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECDIYGTV  348

Query  120   DFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             DFIFGNAAVVFQNC IYAR P +K   TITAQGRTDPNQN
Sbjct  349   DFIFGNAAVVFQNCNIYARNPPNKVN-TITAQGRTDPNQN  387



>ref|XP_009143104.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score =   446 bits (1147),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 237/373 (64%), Positives = 293/373 (79%), Gaps = 17/373 (5%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WCSQTP+P  C+YFLTH+       K +SEF K++ ++AL+ A+ A++H   LGP+
Sbjct  28    DVKAWCSQTPNPKPCEYFLTHNSGQ-KPIKSESEFLKISMKLALERAILAKSHTSTLGPK  86

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVEL  751
             CR+ REKAAW DC+KLY+ T+ ++N+T+D   KC++ DA TWLSTALTNL+TCR GF+EL
Sbjct  87    CRDTREKAAWEDCLKLYDVTVSKINETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFLEL  146

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNN---NGSVPKQTYKDGFPAWVSLGDRRLLQASSP  580
             G +  VLPL+SNN VS LI NTLA+N    N + P+   KDGFP+WV  GDR+LLQ+S+P
Sbjct  147   GVTDIVLPLMSNN-VSSLICNTLAINKVPFNYTPPE---KDGFPSWVKPGDRKLLQSSTP  202

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
                + VVAKDGSGN++TIKDA++AA   SGSGRFVI++K+GVY+ENL+I  + KN+ML G
Sbjct  203   -GDNAVVAKDGSGNFRTIKDAVNAA---SGSGRFVIYVKQGVYSENLEI--RKKNVMLRG  256

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG   T I+GSRSV GGSTTFNSATVA  GDGF+A+GITFRNTAG  N QAVALRSG+DL
Sbjct  257   DGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFMARGITFRNTAGASNEQAVALRSGSDL  316

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+C FEGYQDTLY HS RQFY+DC IYGTVDFIFGNAA V QNC I+AR+P  K   
Sbjct  317   SVFYQCSFEGYQDTLYVHSNRQFYRDCDIYGTVDFIFGNAAAVLQNCNIFARRPRSKTN-  375

Query  39    TITAQGRTDPNQN  1
             TITAQGR+D NQN
Sbjct  376   TITAQGRSDQNQN  388



>ref|XP_010098938.1| Pectinesterase 2 [Morus notabilis]
 gb|EXB76240.1| Pectinesterase 2 [Morus notabilis]
Length=518

 Score =   444 bits (1143),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 234/373 (63%), Positives = 286/373 (77%), Gaps = 12/373 (3%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAP-KRKSEFKKMATEIALDTAVQAETHAKRLGP  928
             EV  WC QTP+P  C+YFL+++  +   P K+KS+F K++ ++ALD A+ A      +GP
Sbjct  34    EVKSWCGQTPNPQPCEYFLSNNLEYDRTPIKQKSDFFKLSAKLALDRAMHAHDDLFSVGP  93

Query  927   RCRNAREKAAWADCVKLYEDTILQLNQTLD--EKCTQFDALTWLSTALTNLETCRTGFVE  754
             +CR+ +EKAAWADC++LYE T+L+LN+T     KCTQ D  TWLSTALTNLETCR G +E
Sbjct  94    KCRSQQEKAAWADCLELYESTVLRLNKTSKPTSKCTQDDLQTWLSTALTNLETCRAGLLE  153

Query  753   LGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGFPAWVSLGDRRLLQASSP--  580
             LG S  +LPL+SNN VS+LI N+LA+N +   P   Y +GFP WV  GDRRLLQ+SS   
Sbjct  154   LGVSDYLLPLMSNN-VSKLISNSLAINKSPYKPDNKYNNGFPTWVKPGDRRLLQSSSSPA  212

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              + ++VVAKDGSG+Y T+K A+ A     GSGRFVI++K G YNEN++I  K+KN+ML+G
Sbjct  213   SRANVVVAKDGSGDYTTVKAAVTAV---KGSGRFVIYVKAGTYNENVEI--KVKNVMLLG  267

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG+  T I+GS+SV GGSTTF SATVAV GDGFIAQ ITFRNTAG  NHQAVALRSG+D 
Sbjct  268   DGIGKTIITGSKSVGGGSTTFQSATVAVVGDGFIAQDITFRNTAGASNHQAVALRSGSDQ  327

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFYKC FEGYQDTLY HS+RQFY++C IYGTVDFIFGNAAVV QNC IYAR P +K   
Sbjct  328   SVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYARDPPNKTN-  386

Query  39    TITAQGRTDPNQN  1
             TITAQGRTD NQN
Sbjct  387   TITAQGRTDSNQN  399



>ref|XP_006347887.1| PREDICTED: pectinesterase 2-like [Solanum tuberosum]
Length=516

 Score =   444 bits (1141),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 240/403 (60%), Positives = 300/403 (74%), Gaps = 10/403 (2%)
 Frame = -1

Query  1194  MSKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPK  1015
             M+ IHL   L   S FI  + +     A   +  WC+QTPHP  C+YFL+ + +  +   
Sbjct  1     MANIHLIFPLLFMSCFIFPSTTNGYSNAV--IKAWCTQTPHPQPCEYFLSQNPKITSPII  58

Query  1014  RKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE  835
             +KS+F K++ ++ LD A++A+     LGP+CRN REK AWADCV+LYE TI ++  T+D 
Sbjct  59    KKSDFLKVSLDLVLDRALRAQMTTYSLGPKCRNEREKNAWADCVELYEHTINKIKSTVDP  118

Query  834   --KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNG-  664
               KC+  DA TWLSTALTNLETC+ GF ELG +  V+PL+SNN VS LI N LALN+   
Sbjct  119   NTKCSATDAQTWLSTALTNLETCKAGFEELGVTDYVMPLMSNN-VSSLISNALALNHGYY  177

Query  663   SVPKQTYKDGFPAWVSLGDRRLLQASSPVKP--DLVVAKDGSGNYKTIKDALDAAGKRSG  490
             +    T  DGFP WVS GDR+LLQ+SS      ++VVA DGSG++KT+K+A+DAA K  G
Sbjct  178   TESSNTQVDGFPTWVSPGDRKLLQSSSSPASQANVVVATDGSGDFKTVKEAVDAA-KNKG  236

Query  489   SGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTG  310
             SGRFVI++K G+Y+EN++IG K+KN+ML+GDG+  T I+GS+SV GGSTT  SATV V+G
Sbjct  237   SGRFVIYVKAGIYSENVEIGEKVKNVMLIGDGIGKTIITGSKSVGGGSTTLRSATVGVSG  296

Query  309   DGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIY  130
             DGFIAQGIT RNTAGP+ HQAVALRSG+DLSVFY+C FEGYQDTLY HS RQFYK+C IY
Sbjct  297   DGFIAQGITIRNTAGPQKHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYKECDIY  356

Query  129   GTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             GTVDFIFGNAAVV QNC I+AR P +K   T+TAQGRTDPNQN
Sbjct  357   GTVDFIFGNAAVVLQNCNIFARDPPNKIN-TVTAQGRTDPNQN  398



>ref|XP_007220661.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
 gb|EMJ21860.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
Length=511

 Score =   443 bits (1139),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 244/397 (61%), Positives = 296/397 (75%), Gaps = 21/397 (5%)
 Frame = -1

Query  1179  LFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAP-KRKSE  1003
             LFLVL  + S I    S N      +V  WCSQTPHP  C+ FL+H+    T P K KS+
Sbjct  9     LFLVL--YLSQIIFGYSPN------DVKTWCSQTPHPKLCEDFLSHNPT--TTPIKEKSQ  58

Query  1002  FKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KC  829
             F K++T++ALD A+ A+T+   LG + +NA EK AWADC++L++ TI +LN+T++   KC
Sbjct  59    FFKISTQLALDRAIHAQTNMHSLGSKFQNAHEKTAWADCLELFDFTIQKLNRTVNPSTKC  118

Query  828   TQFDALTWLSTALTNLETCRTGFVELGNSRN-VLPLISNNNVSQLIGNTLALNNNGSVPK  652
             TQ+D  TWLSTALTNLETCR GF +LG S N + P +SNN VS LI NTLA+N     P+
Sbjct  119   TQYDKQTWLSTALTNLETCREGFADLGVSNNYIFPSVSNN-VSNLISNTLAINKAPYTPQ  177

Query  651   QTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVI  472
               +K+GFP WV  GDR+LLQ+SSP   D+VVAKDGSGNYKTI +A+ AA KR GS R+VI
Sbjct  178   PNHKNGFPTWVKPGDRKLLQSSSPTA-DVVVAKDGSGNYKTISEAVSAASKRKGSARYVI  236

Query  471   HIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQ  292
             ++K G Y EN+ I  K KNIML GDG+  T I+GS+SV GGSTTFNSATVAV GDGFIAQ
Sbjct  237   YVKAGTYKENVQI--KSKNIMLRGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQ  294

Query  291   GITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFI  112
              ITF+NTAGP + QAVALRSG+DLSVFYKCGFEG QDTLY +S RQFY++C IYGTVDFI
Sbjct  295   DITFQNTAGPTSGQAVALRSGSDLSVFYKCGFEGNQDTLYVYSDRQFYRECDIYGTVDFI  354

Query  111   FGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             FGNAAVVFQNC IY     + +  TITAQGR+DPNQN
Sbjct  355   FGNAAVVFQNCNIYVH---NHKTNTITAQGRSDPNQN  388



>gb|KFK37315.1| hypothetical protein AALP_AA4G241100 [Arabis alpina]
Length=509

 Score =   440 bits (1132),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 243/402 (60%), Positives = 305/402 (76%), Gaps = 24/402 (6%)
 Frame = -1

Query  1188  KIHL-FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             +IH+ FL L  F     VA +V+    + +V  WCSQTP+P  C+YFLTH+  +    K 
Sbjct  4     RIHITFLFLCIF-----VAWTVSG-YKSKDVKAWCSQTPNPIPCEYFLTHNSNN-KPIKT  56

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE-  835
             +SEF K++ ++AL+ A+ A+ HA  LGP+CR+ REKAAW DC+ LY+ T+ ++N T+D  
Sbjct  57    ESEFLKLSMKLALERAILAKNHAFTLGPKCRDKREKAAWEDCLNLYDFTVSKINATMDTN  116

Query  834   -KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN---N  667
              KC++ DA TWLSTALTNL+TCR GF++LG +  VLPL+SNN VS+L+ NTLA+N    N
Sbjct  117   VKCSKTDAQTWLSTALTNLDTCRAGFLDLGVTDIVLPLMSNN-VSKLLCNTLAINKVPFN  175

Query  666   GSVPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGS  487
              + P+   KDGFP+WV  GDR+LLQ+S+P   + VVAKDGSG +KTIKDA+DAA   SGS
Sbjct  176   YTPPE---KDGFPSWVKPGDRKLLQSSTP-SDNAVVAKDGSGTFKTIKDAIDAA---SGS  228

Query  486   GRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGD  307
             GRFVI++K+GVY ENL+I  + KNIML GDG+  T I+GSRSV GG+TTFNSATVA  GD
Sbjct  229   GRFVIYVKQGVYAENLEI--RKKNIMLRGDGIGKTIITGSRSVGGGTTTFNSATVAAVGD  286

Query  306   GFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYG  127
             GFIA+GITFRNTAG  N QAVALRSG+DLSVFY+C FE YQDTLY HS RQFY++C +YG
Sbjct  287   GFIARGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEAYQDTLYVHSNRQFYRECDVYG  346

Query  126   TVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             TVDFIFGNAA V QNC I+AR+P      TITAQGR+DPNQN
Sbjct  347   TVDFIFGNAAAVLQNCNIFARRPRSSTN-TITAQGRSDPNQN  387



>ref|XP_009378667.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
 ref|XP_009339421.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=510

 Score =   440 bits (1131),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 240/395 (61%), Positives = 291/395 (74%), Gaps = 18/395 (5%)
 Frame = -1

Query  1179  LFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEF  1000
             LFLVL   S  +    S N      +V  WCSQTPHP  C+ FL+H+  +    K KS+F
Sbjct  9     LFLVLF-LSPLVIFGYSPN------DVRTWCSQTPHPQPCESFLSHNPNNIPI-KGKSQF  60

Query  999   KKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEK--CT  826
              K++T++ALD A+ A T+   LG +C+NA EKAAWADC++LY+ TI +LN+++D     T
Sbjct  61    FKISTQLALDRAILAHTNLYSLGSKCQNAHEKAAWADCLELYDYTIQKLNKSIDPTNGAT  120

Query  825   QFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQT  646
             Q DA +WLSTALTNLETCR GFV+L  S N   L+ +NNVS LI NTL++N      +  
Sbjct  121   QNDAQSWLSTALTNLETCRAGFVDLAVSNN--QLMPSNNVSNLISNTLSVNKVPYTSQPE  178

Query  645   YKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHI  466
             YK GFP WV  GDR+LL++SSP K D+VVAKDGSGNYKTI +A+ AA KR GSGR+VI++
Sbjct  179   YKQGFPTWVKPGDRKLLKSSSP-KADIVVAKDGSGNYKTINEAISAASKRKGSGRYVIYV  237

Query  465   KRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGI  286
             K G Y EN+ I  KL NIML+GDG+  T I+GS+SV GG+TTFNSATVAV GDGFIAQGI
Sbjct  238   KAGSYKENVQI--KLNNIMLLGDGIGKTIITGSKSVGGGTTTFNSATVAVVGDGFIAQGI  295

Query  285   TFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFG  106
             TF NTAGP + QAVALRSG+DLSVFYKC FEG QDTLY HS+RQFY++C IYGTVDFIFG
Sbjct  296   TFENTAGPTSGQAVALRSGSDLSVFYKCSFEGNQDTLYVHSERQFYRECDIYGTVDFIFG  355

Query  105   NAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             NAAVV QN  IY     + +  TITAQGRTDPNQN
Sbjct  356   NAAVVIQNSNIYVH---NHKTNTITAQGRTDPNQN  387



>gb|KHN42767.1| Pectinesterase 2 [Glycine soja]
Length=444

 Score =   437 bits (1124),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 224/317 (71%), Positives = 262/317 (83%), Gaps = 5/317 (2%)
 Frame = -1

Query  936  LGPRCRNAREKAAWADCVKLYEDTILQLNQTLD--EKCTQFDALTWLSTALTNLETCRTG  763
            LG +CR+ +EKAAW+DC  LY+DTI  LNQ L+  ++ T +D  TWLSTALTN++TC+TG
Sbjct  3    LGSKCRSKQEKAAWSDCTTLYQDTINILNQALNPTKQSTSYDLQTWLSTALTNIDTCQTG  62

Query  762  FVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSV--PKQTYKDGFPAWVSLGDRRLLQA  589
            F ELG   NVL LI N NVS++I + LALNN  S   PK+TYK+G P W+   DR+LL++
Sbjct  63   FHELGVGNNVLSLIPNKNVSEIISDFLALNNASSFIPPKKTYKNGLPRWLPPNDRKLLES  122

Query  588  SSP-VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNI  412
            S P + PD VVAKDGSG++KTIK+AL A  KR+ + RFVI++KRG+YNEN++IGN +KNI
Sbjct  123  SPPSLSPDFVVAKDGSGDFKTIKEALKAIPKRNEAKRFVIYVKRGIYNENIEIGNSMKNI  182

Query  411  MLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRS  232
            ML GDG R T ISGSRSV GGSTTFNSATVAVTGDGFIA+GITFRNTAGPENHQAVALR 
Sbjct  183  MLYGDGTRLTIISGSRSVGGGSTTFNSATVAVTGDGFIARGITFRNTAGPENHQAVALRC  242

Query  231  GADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMD  52
            GADLSVFY+C FEGYQDTLY HSQRQFYK+C IYGTVDFIFGNAAVVFQ+C IYAR+PM 
Sbjct  243  GADLSVFYRCAFEGYQDTLYVHSQRQFYKECNIYGTVDFIFGNAAVVFQSCNIYARRPMQ  302

Query  51   KQKITITAQGRTDPNQN  1
            KQK  ITAQGRTDPNQN
Sbjct  303  KQKNAITAQGRTDPNQN  319



>gb|KCW73025.1| hypothetical protein EUGRSUZ_E01468, partial [Eucalyptus grandis]
Length=513

 Score =   439 bits (1130),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 229/368 (62%), Positives = 280/368 (76%), Gaps = 11/368 (3%)
 Frame = -1

Query  1092  WCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNA  913
             WCS+ P+P  C++FLT + +  T  KR+S F + + ++AL++A  A+TH   LG  C + 
Sbjct  32    WCSKMPYPQPCEHFLTRNPKQ-TPLKRRSHFLRASMQVALESAQLAQTHTYSLGSGCHDE  90

Query  912   REKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNV  733
             REKAAWADC+KLYE T+  LN+T++ +CTQ D  TWLS ALTNL+TC TGFVELG S NV
Sbjct  91    REKAAWADCLKLYEHTVHHLNRTINRRCTQDDMQTWLSAALTNLQTCGTGFVELGISDNV  150

Query  732   LPLISNNNVSQLIGNTLALNNNGSVPKQT--YKDGFPAWVSLGDRRLLQASSPV--KPDL  565
             LPL+SNN VS+LI NTL+ N    VP  T  Y + FP WV LGDR+LLQ SSP+    ++
Sbjct  151   LPLMSNN-VSKLISNTLSAN---YVPYTTPNYTNEFPTWVRLGDRKLLQ-SSPMLSTANI  205

Query  564   VVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRY  385
             +VA+DGSGNYKTI +A+     RS + RF+I+IK G Y EN+++G+KL+NI  VGDG+  
Sbjct  206   MVAQDGSGNYKTINEAVTVGLMRSDTTRFIIYIKAGTYEENVEVGSKLENIAFVGDGIGK  265

Query  384   TYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYK  205
             T I+GS+S  GG TTFNSATVAV GDGFIAQ ITFRNTAG  NHQAVALRS +DLSVFY+
Sbjct  266   TIITGSKSNAGGFTTFNSATVAVDGDGFIAQDITFRNTAGSANHQAVALRSSSDLSVFYR  325

Query  204   CGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQ  25
             CGFEGYQDTL+ HS+RQFYK+C IYGT DFIFGNAAVVF NC IY R P +K   TITAQ
Sbjct  326   CGFEGYQDTLFVHSKRQFYKECDIYGTTDFIFGNAAVVFHNCNIYVRNPPNKVN-TITAQ  384

Query  24    GRTDPNQN  1
             GRTDPNQN
Sbjct  385   GRTDPNQN  392



>ref|XP_004514851.1| PREDICTED: pectinesterase 2-like [Cicer arietinum]
Length=515

 Score =   439 bits (1130),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 242/397 (61%), Positives = 297/397 (75%), Gaps = 19/397 (5%)
 Frame = -1

Query  1176  FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTH--SRRHFTAPKRKSE  1003
              LV   F+S +S   S+N      EV  WC+QTP+P+ C+YFL++  S +H    ++K++
Sbjct  10    LLVPFLFASLVS-CYSMN------EVKLWCNQTPNPEPCEYFLSNNPSYQH-KLIEQKAD  61

Query  1002  FKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KC  829
             F K++ E+A + A++   +   LG +C N REK+AWADCV+LYE TIL+LN+TLD   KC
Sbjct  62    FFKLSLELAQERALKGHANTLSLGSKCNNPREKSAWADCVELYEQTILKLNKTLDTNTKC  121

Query  828   TQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ  649
             +Q DA TWLSTALTNLETC+ GF ELG    VLPL+SNN V++L+ NTLALN      + 
Sbjct  122   SQVDAQTWLSTALTNLETCKAGFYELGVQDYVLPLMSNN-VTKLLSNTLALNK-VQYQEP  179

Query  648   TYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVI  472
              YK+GFP WV  GDR+LLQ SSP  + ++VV+KDGSG Y TI  A++AA K +  GR+VI
Sbjct  180   GYKNGFPKWVKQGDRKLLQTSSPSSQANVVVSKDGSGKYTTIGAAVNAAPKNN-KGRYVI  238

Query  471   HIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQ  292
             H+K GVYNE ++I  K  NIMLVGDG+  T I+GS+SV GG+TTF SATVAV GDGFIAQ
Sbjct  239   HVKTGVYNEQVEI--KANNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDGFIAQ  296

Query  291   GITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFI  112
              ITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLY HS RQFYK+C IYGTVDFI
Sbjct  297   DITFRNTAGANNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSDRQFYKECNIYGTVDFI  356

Query  111   FGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             FGNAA VFQNC I+AR P +K   TITAQGRTDPNQN
Sbjct  357   FGNAAAVFQNCNIFARNPPNKVN-TITAQGRTDPNQN  392



>ref|XP_006576426.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=517

 Score =   438 bits (1126),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 239/407 (59%), Positives = 302/407 (74%), Gaps = 22/407 (5%)
 Frame = -1

Query  1194  MSKIHLFLVLAS---FSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRH-F  1027
             M    LFL L      SSF+S   S N      +V  WC+QTP+P  C+YFL+++  + +
Sbjct  1     MKAFRLFLTLLIPFLLSSFVS-GYSWN------DVKLWCNQTPNPQPCEYFLSNNPTYQY  53

Query  1026  TAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQ  847
              A K+KS+F K++ ++A + A++   +   LG +CRN RE+ AWADCV+LYE TI +LN+
Sbjct  54    KALKQKSDFLKLSLQLAQERALKGHANTLSLGSKCRNPRERGAWADCVELYEQTIRKLNE  113

Query  846   TLDE----KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLA  679
             TL+     K +Q DA TWLSTALTNLETC+ GF ELG    VLPL+SNN V++L+ NTL+
Sbjct  114   TLNPDPNTKYSQVDAQTWLSTALTNLETCKAGFYELGVQDYVLPLMSNN-VTKLLSNTLS  172

Query  678   LNNNGSVPKQTYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAG  502
             LN      + +YK+GFP WV   DR+LLQ+SSP  + ++VVAKDGSG Y T+  A+++A 
Sbjct  173   LNK-VEYEEPSYKEGFPKWVKPDDRKLLQSSSPASRANVVVAKDGSGKYTTVSAAVNSAP  231

Query  501   KRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATV  322
             K S  GR+VI++K G+YNE +++  K KNIMLVGDG+  T I+GS+SV GG+TTF SATV
Sbjct  232   KNS-RGRYVIYVKGGIYNEQVEV--KSKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATV  288

Query  321   AVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKD  142
             AV GDGFIAQGITFRNTAG +NHQAVALRSG+DLSVFYKC FEGYQDTLY HS+RQFY++
Sbjct  289   AVVGDGFIAQGITFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRE  348

Query  141   CYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             C IYGTVDFIFGNAAVV QNC I+AR P +K   TITAQGRTDPNQN
Sbjct  349   CNIYGTVDFIFGNAAVVLQNCNIFARNPPNKVN-TITAQGRTDPNQN  394



>ref|XP_010058471.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=565

 Score =   439 bits (1129),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 229/368 (62%), Positives = 280/368 (76%), Gaps = 11/368 (3%)
 Frame = -1

Query  1092  WCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNA  913
             WCS+ P+P  C++FLT + +  T  KR+S F + + ++AL++A  A+TH   LG  C + 
Sbjct  32    WCSKMPYPQPCEHFLTRNPKQ-TPLKRRSHFLRASMQVALESAQLAQTHTYSLGSGCHDE  90

Query  912   REKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNV  733
             REKAAWADC+KLYE T+  LN+T++ +CTQ D  TWLS ALTNL+TC TGFVELG S NV
Sbjct  91    REKAAWADCLKLYEHTVHHLNRTINRRCTQDDMQTWLSAALTNLQTCGTGFVELGISDNV  150

Query  732   LPLISNNNVSQLIGNTLALNNNGSVPKQT--YKDGFPAWVSLGDRRLLQASSPV--KPDL  565
             LPL+SNN VS+LI NTL+ N    VP  T  Y + FP WV LGDR+LLQ SSP+    ++
Sbjct  151   LPLMSNN-VSKLISNTLSAN---YVPYTTPNYTNEFPTWVRLGDRKLLQ-SSPMLSTANI  205

Query  564   VVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRY  385
             +VA+DGSGNYKTI +A+     RS + RF+I+IK G Y EN+++G+KL+NI  VGDG+  
Sbjct  206   MVAQDGSGNYKTINEAVTVGLMRSDTTRFIIYIKAGTYEENVEVGSKLENIAFVGDGIGK  265

Query  384   TYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYK  205
             T I+GS+S  GG TTFNSATVAV GDGFIAQ ITFRNTAG  NHQAVALRS +DLSVFY+
Sbjct  266   TIITGSKSNAGGFTTFNSATVAVDGDGFIAQDITFRNTAGSANHQAVALRSSSDLSVFYR  325

Query  204   CGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQ  25
             CGFEGYQDTL+ HS+RQFYK+C IYGT DFIFGNAAVVF NC IY R P +K   TITAQ
Sbjct  326   CGFEGYQDTLFVHSKRQFYKECDIYGTTDFIFGNAAVVFHNCNIYVRNPPNKVN-TITAQ  384

Query  24    GRTDPNQN  1
             GRTDPNQN
Sbjct  385   GRTDPNQN  392



>gb|KHN47891.1| Pectinesterase 2 [Glycine soja]
Length=513

 Score =   437 bits (1124),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 232/374 (62%), Positives = 288/374 (77%), Gaps = 14/374 (4%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAP-KRKSEFKKMATEIALDTAVQAETHAKRLGP  928
             EV  WC+QTP+P  C+YFL+++  +   P K+KS+F K++ ++A + A++   +   LG 
Sbjct  27    EVKLWCNQTPNPQPCEYFLSNNPTYQYKPLKQKSDFLKLSLQLAQERALKGHENTLSLGS  86

Query  927   RCRNAREKAAWADCVKLYEDTILQLNQTL--DEKCTQFDALTWLSTALTNLETCRTGFVE  754
             +CRN RE+ AWADCV+LYE TI +LNQTL  + K +Q DA TWLSTALTNLETC+ GF E
Sbjct  87    KCRNPRERVAWADCVELYEQTIRKLNQTLKPNTKLSQVDAQTWLSTALTNLETCKAGFYE  146

Query  753   LGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ--TYKDGFPAWVSLGDRRLLQASSP  580
             LG    VLPL+SNN V++L+ NTLALN    VP Q  +YK+GFP WV  GDR+LLQASSP
Sbjct  147   LGVQDYVLPLMSNN-VTKLLSNTLALNK---VPYQEPSYKEGFPTWVKPGDRKLLQASSP  202

Query  579   V-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLV  403
               + ++VVAKDGSG + T+  A++AA K S SGR+VI++K GVY+E +++  K KNIMLV
Sbjct  203   ASRANVVVAKDGSGRFTTVSAAINAAPK-SSSGRYVIYVKGGVYDEQVEV--KAKNIMLV  259

Query  402   GDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGAD  223
             GDG+  T I+GS+SV GG+TTF SATVA  GDGFIAQ ITFRNTAG  NHQAVA RSG+D
Sbjct  260   GDGIGKTIITGSKSVGGGTTTFRSATVAAVGDGFIAQDITFRNTAGAANHQAVAFRSGSD  319

Query  222   LSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQK  43
             LSVFY+C FEG+QDTLY HS+RQFYK C IYGTVDFIFGNAA V QNC IYAR P  ++ 
Sbjct  320   LSVFYRCSFEGFQDTLYVHSERQFYKACDIYGTVDFIFGNAAAVLQNCNIYARTP-PQRT  378

Query  42    ITITAQGRTDPNQN  1
             IT+TAQGRTDPNQN
Sbjct  379   ITVTAQGRTDPNQN  392



>gb|KEH29121.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=513

 Score =   437 bits (1123),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 240/405 (59%), Positives = 298/405 (74%), Gaps = 22/405 (5%)
 Frame = -1

Query  1194  MSKIHLFLVLAS---FSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTH--SRRH  1030
             M    LF+ L      ++F+S + S+N      EV  WC+QTP+P  C YFL++  S +H
Sbjct  1     MISFRLFVTLLVPFLLATFVS-SYSMN------EVKLWCNQTPNPQPCVYFLSNNPSYKH  53

Query  1029  FTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLN  850
                 K+K +F K++ E+  + A++       LG +C N+REK+AWADCV+LYE TIL+LN
Sbjct  54    -KLIKQKVDFFKLSLELVQERALKGHAKTLSLGSKCSNSREKSAWADCVELYEQTILKLN  112

Query  849   QTLDEK--CTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLAL  676
             +TL+ K  C+Q DA TWLSTALTNLETC+ GF +LG    +LPL+SNN V++L+ NTLAL
Sbjct  113   KTLNPKTKCSQVDAQTWLSTALTNLETCKAGFYDLGVQDYILPLMSNN-VTKLLSNTLAL  171

Query  675   NNNGSVPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKR  496
             N      + +YKDGFP WV  GDR+LLQ SSP +P++VVAKDGSG Y T+  A++A  K 
Sbjct  172   NK-VQYQEPSYKDGFPTWVRPGDRKLLQTSSP-RPNVVVAKDGSGKYTTVSAAVNAIPKN  229

Query  495   SGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAV  316
             +  GR+VIH+K GVYNE ++I  K KNIMLVGDG+  T I+GS+SV GG+TTF SATVAV
Sbjct  230   N-KGRYVIHVKAGVYNEQVEI--KAKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAV  286

Query  315   TGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCY  136
              GDGFIAQ ITFRNTAG +NHQAVALRSG+DLSVFY+C FEG+QDTLY HS RQFYK C 
Sbjct  287   VGDGFIAQDITFRNTAGGKNHQAVALRSGSDLSVFYRCSFEGFQDTLYVHSDRQFYKQCN  346

Query  135   IYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             IYGTVDFIFGNAA VFQNC I+ R P +K   TITAQGRTDPNQN
Sbjct  347   IYGTVDFIFGNAAAVFQNCNIFPRNPPNKVN-TITAQGRTDPNQN  390



>ref|XP_004174049.1| PREDICTED: pectinesterase 2-like, partial [Cucumis sativus]
Length=431

 Score =   432 bits (1112),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 218/311 (70%), Positives = 261/311 (84%), Gaps = 7/311 (2%)
 Frame = -1

Query  921  RNAREKAAWADCVKLYEDTILQLNQTL-DEKCTQFDALTWLSTALTNLETCRTGFVELG-  748
            RN +E+AAWADC++LY+ TIL LN+T  D+ C+ FD  TWLS+ALTNL TCR GFV+LG 
Sbjct  1    RNKKERAAWADCLELYQTTILHLNKTFSDKNCSNFDIQTWLSSALTNLHTCRAGFVDLGI  60

Query  747  -NSRNVLPLISNNNVSQLIGNTLALNN-NGSVPKQTYKDGFPAWVSLGDRRLLQASSPVK  574
             +   V P + NNN+++LI N+LA+NN + S    T  +GFP W+  GDRRLLQA+ P K
Sbjct  61   KDYGVVFPFLENNNITKLISNSLAMNNCSESDEGNTSDEGFPKWLHGGDRRLLQAAEP-K  119

Query  573  PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDG  394
             DLVVA+DGSGNYKT++ A+DAAGKR GSGRFVI +K+GVY EN+ I  K+KN+MLVGDG
Sbjct  120  ADLVVAQDGSGNYKTVQAAVDAAGKRKGSGRFVIRVKKGVYKENVVI--KVKNLMLVGDG  177

Query  393  MRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSV  214
            ++YT I+GSRSV GGSTTFNSATVAVTG+ FIA+GITFRNTAGP+NHQAVALRSGADLSV
Sbjct  178  LKYTIITGSRSVGGGSTTFNSATVAVTGERFIARGITFRNTAGPQNHQAVALRSGADLSV  237

Query  213  FYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITI  34
            F++CGFEGYQDTLY HSQRQFY++CYIYGTVDFIFGN+AVV QNCMIYARKPM  Q+  +
Sbjct  238  FFRCGFEGYQDTLYVHSQRQFYRECYIYGTVDFIFGNSAVVLQNCMIYARKPMQGQQCVV  297

Query  33   TAQGRTDPNQN  1
            TAQGRTDPNQN
Sbjct  298  TAQGRTDPNQN  308



>ref|XP_010662407.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Vitis vinifera]
Length=524

 Score =   434 bits (1117),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 213/375 (57%), Positives = 282/375 (75%), Gaps = 9/375 (2%)
 Frame = -1

Query  1107  GEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGP  928
             G +  WC+ TPHP+ CKYF++HS + F AP  KS+F++M  ++A+D A+  +    R G 
Sbjct  29    GNIKWWCNTTPHPEPCKYFMSHSHQRF-APDHKSDFRRMLVQVAMDRALHGQRQVLRSGS  87

Query  927   RCRNAREKAAWADCVKLYEDTILQLNQTL-----DEKCTQFDALTWLSTALTNLETCRTG  763
              C N  +K A  DC+KLYEDT+ QLNQTL     ++ C+ FDA TWLSTA TNLETC+  
Sbjct  88    NCVNKWQKGALNDCLKLYEDTVYQLNQTLQGLHGNQSCSDFDAQTWLSTAFTNLETCQDS  147

Query  762   FVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGFPAWVSLGDRRLLQASS  583
               +L  +  + PL+SNN VS+LI N+LA+N+ G +   +Y+ GFP+WVS G+R+LLQ++S
Sbjct  148   AKDLNVTNFIFPLMSNN-VSELISNSLAIND-GLMEGTSYRGGFPSWVSAGERKLLQSTS  205

Query  582   -PVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIML  406
                  +LVVAKDGSG++ +I+ A++AA KR+ SGRF+I++K+G+Y EN+++G  + NI L
Sbjct  206   LATSANLVVAKDGSGDFSSIQAAINAAAKRTSSGRFIIYVKKGLYRENIEVGINVNNITL  265

Query  405   VGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGA  226
             VGDGM+ T I+GSRSV GG TT+NSAT  + G  FIA+GITF+NTAGP+N QAVALRS +
Sbjct  266   VGDGMKKTIITGSRSVRGGYTTYNSATAGIQGLRFIARGITFKNTAGPKNGQAVALRSSS  325

Query  225   DLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQ  46
             DLSVFY C F+GYQDTL  HSQRQFY++CYIYGT+DFIFGNAAVVFQ CMI+AR+P+  Q
Sbjct  326   DLSVFYHCAFQGYQDTLMVHSQRQFYRECYIYGTIDFIFGNAAVVFQQCMIFARRPLQGQ  385

Query  45    KITITAQGRTDPNQN  1
                ITAQGR DP QN
Sbjct  386   ANVITAQGRGDPYQN  400



>ref|XP_007134831.1| hypothetical protein PHAVU_010G079900g [Phaseolus vulgaris]
 gb|ESW06825.1| hypothetical protein PHAVU_010G079900g [Phaseolus vulgaris]
Length=520

 Score =   434 bits (1115),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 234/401 (58%), Positives = 296/401 (74%), Gaps = 20/401 (5%)
 Frame = -1

Query  1185  IHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAP-KRK  1009
             I L LV   FSS I+ + S        ++  WC+QTP+P  C+Y+LT     F  P K K
Sbjct  13    ITLLLVPFLFSS-IAFSYSFK------DIQSWCNQTPYPQPCEYYLT--SHTFNKPIKSK  63

Query  1008  SEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--  835
             S+F +++ ++AL+ A + + +   +GP+CRN  EK+AW DC++LY+ TI +LN+TLD   
Sbjct  64    SDFLQVSLQLALERAERGQLNTHSIGPKCRNVHEKSAWTDCIELYDYTIQRLNKTLDPYT  123

Query  834   KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP  655
             KCTQ D  TWLSTALTNLETCR G  ELG    +LPL+SNN V++L+ NTL+LN + + P
Sbjct  124   KCTQTDTQTWLSTALTNLETCRAGLYELGVQDYMLPLMSNN-VTKLLSNTLSLNKDSNYP  182

Query  654   --KQTYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSG  484
                 + ++G+P WV  GDR+LLQ+SS   + ++VVAKDGSG Y T+K A+DAA   S SG
Sbjct  183   FKPPSSQEGYPTWVKPGDRKLLQSSSAASQANVVVAKDGSGKYTTVKAAVDAA-PSSSSG  241

Query  483   RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDG  304
             R+VI++K GVYNE ++I  K KNIMLVGDG+  T I+GS+SV GGSTTF SATVA  GDG
Sbjct  242   RYVIYVKSGVYNEQVEI--KSKNIMLVGDGIGKTIITGSKSVGGGSTTFRSATVAAVGDG  299

Query  303   FIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGT  124
             FIAQ ITFRNTAG  NHQAVA RSG+DLSVFY+C FEGYQDTLY HS+RQFY++C +YGT
Sbjct  300   FIAQDITFRNTAGAANHQAVAFRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDVYGT  359

Query  123   VDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             VDFIFGNAAVV QNC IYAR P  ++ IT+TAQGRTDPNQN
Sbjct  360   VDFIFGNAAVVLQNCNIYARTP-PQRTITVTAQGRTDPNQN  399



>ref|XP_008232606.1| PREDICTED: pectinesterase 2 [Prunus mume]
Length=511

 Score =   433 bits (1113),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 240/401 (60%), Positives = 292/401 (73%), Gaps = 19/401 (5%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAP-K  1015
             ++ H  L L  + S I    S N      +V  WC+QTPHP  CK FL+H+    T P K
Sbjct  3     TRFHSTLFLVLYLSPIIFGYSPN------DVKTWCTQTPHPKLCKDFLSHNPT--TTPIK  54

Query  1014  RKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE  835
              KS+F K++T++ALD A+ A+T+   LG + +NA EK AW DC +L++ TI +LN+T++ 
Sbjct  55    EKSQFFKISTQLALDRAIHAQTNMYSLGSKFQNAHEKTAWDDCHELFDFTIQKLNKTVNP  114

Query  834   --KCTQFDALTWLSTALTNLETCRTGFVELGNSRN-VLPLISNNNVSQLIGNTLALNNNG  664
               KCTQ D+ TWLSTALTNLETCR GF +LG S N + P +SNN VS LI NTLA+N   
Sbjct  115   ITKCTQDDSQTWLSTALTNLETCREGFADLGVSNNYIFPSMSNN-VSNLISNTLAINKAP  173

Query  663   SVPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSG  484
                +  YK+GFP WV  GDR+LLQ+SS  K D+VVAKDGSGNYKTI +A+ AA KR GS 
Sbjct  174   FTSQPNYKNGFPTWVKPGDRKLLQSSS-AKADVVVAKDGSGNYKTISEAVSAASKRKGSA  232

Query  483   RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDG  304
             R+VI++K G Y EN+ I  K KNIML GDG+  T I+GS+SV GGSTTFNSATVAV GDG
Sbjct  233   RYVIYVKAGTYKENVQI--KSKNIMLRGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDG  290

Query  303   FIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGT  124
             FIAQ ITF+NTAGP + QAVALRSG+DLSVFYKCGFEG QDTLY HS RQFY++C IYGT
Sbjct  291   FIAQDITFQNTAGPTSGQAVALRSGSDLSVFYKCGFEGNQDTLYVHSDRQFYRECDIYGT  350

Query  123   VDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             VDFIFGNAAVV QNC IY     + +  T+TAQGR+DPNQN
Sbjct  351   VDFIFGNAAVVLQNCNIYVH---NHKTNTVTAQGRSDPNQN  388



>emb|CDY27388.1| BnaC04g50170D [Brassica napus]
Length=510

 Score =   433 bits (1113),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 230/373 (62%), Positives = 291/373 (78%), Gaps = 17/373 (5%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
              V  WCS+TP+P  C+YFLTH+       K  SEF K++ ++ALD A+ A++HA  LGP+
Sbjct  28    HVKAWCSKTPNPKPCEYFLTHNSDQ-KPIKSLSEFLKISMKLALDRAILAKSHASTLGPK  86

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVEL  751
             CR+ REKAAW DC+KLY+ T+ ++N+T+D   KC++ D+ TWLSTALTNL+TC+ GF+EL
Sbjct  87    CRDTREKAAWEDCLKLYDFTVSKINKTMDPDTKCSKTDSQTWLSTALTNLDTCKAGFLEL  146

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNN---NGSVPKQTYKDGFPAWVSLGDRRLLQASSP  580
             G +  +LPL+SNN VS LI NTLA+N    N + P+   KDGFP+WV  GDR+LLQ S+P
Sbjct  147   GVTDFILPLMSNN-VSDLICNTLAINKVPFNYTPPE---KDGFPSWVKPGDRKLLQNSTP  202

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              + ++VVAKDGSGN++TIK+A++AA   SGSGRFVI++K+GVY+ENL+I  +  N+ML G
Sbjct  203   -RDNVVVAKDGSGNFRTIKEAINAA---SGSGRFVIYVKQGVYSENLEI--QKDNVMLRG  256

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG   T I+GSRSV GGSTTF SATVA  GDGFIA+GITFRNTAG  N QAVALRSG+DL
Sbjct  257   DGKGRTIITGSRSVGGGSTTFKSATVAAVGDGFIARGITFRNTAGANNGQAVALRSGSDL  316

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+C FEGYQDTLY HS RQFY DC +YGTVDFIFGNAA +FQNC I+AR+P  +   
Sbjct  317   SVFYQCSFEGYQDTLYVHSNRQFYSDCDVYGTVDFIFGNAAAIFQNCNIFARRPPGRTN-  375

Query  39    TITAQGRTDPNQN  1
             TITAQGR+ P+QN
Sbjct  376   TITAQGRSYPDQN  388



>ref|XP_008343201.1| PREDICTED: pectinesterase 2 [Malus domestica]
Length=511

 Score =   432 bits (1112),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 237/396 (60%), Positives = 289/396 (73%), Gaps = 19/396 (5%)
 Frame = -1

Query  1179  LFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEF  1000
             L+LV+   S  I    S N      +V  WCSQTPHP  C+ FL+H+  +    K KS+F
Sbjct  9     LYLVIC-LSPLIIFGYSPN------DVKTWCSQTPHPHPCESFLSHNPNNIPI-KGKSQF  60

Query  999   KKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD---EKC  829
              K++T++ALD A+ A T+   LG +C+NA EKAAWADC++LY+ TI +LN+++D      
Sbjct  61    FKISTQLALDRAILAHTNLYSLGSKCQNAHEKAAWADCLELYDYTIQKLNKSIDPVTNGA  120

Query  828   TQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ  649
             TQ DA +WLSTALTNLETC  GFV+L  S N   L+ +NNVS LI NTL++N      + 
Sbjct  121   TQNDAQSWLSTALTNLETCLAGFVDLAVSNN--QLMPSNNVSNLISNTLSINKVPYTSQP  178

Query  648   TYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIH  469
              YK GFP WV  GDR+LLQ+SSP K D+VVAKDGSGNYKTI +A+ AA KR GSGR+VI+
Sbjct  179   EYKQGFPTWVKPGDRKLLQSSSP-KADIVVAKDGSGNYKTINEAISAASKRKGSGRYVIY  237

Query  468   IKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQG  289
             +K G Y EN+ I  KL NIML+GDG+  T I+GS+SV GG+TTFNSATVAV GDGFIAQG
Sbjct  238   VKAGSYKENVQI--KLNNIMLLGDGIGKTIITGSKSVGGGTTTFNSATVAVVGDGFIAQG  295

Query  288   ITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIF  109
             ITF NTAG  + QAVALRSG+DLSVFYKC FEG QDTLY HS+RQFY++C IYGTVDFIF
Sbjct  296   ITFENTAGLTSGQAVALRSGSDLSVFYKCSFEGNQDTLYVHSERQFYRECDIYGTVDFIF  355

Query  108   GNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             GNAAVV QN  IY     + +  T+TAQGRTDPNQN
Sbjct  356   GNAAVVIQNSNIYVH---NHKTNTVTAQGRTDPNQN  388



>gb|KHN47892.1| Pectinesterase 2 [Glycine soja]
Length=507

 Score =   432 bits (1112),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 238/401 (59%), Positives = 297/401 (74%), Gaps = 23/401 (6%)
 Frame = -1

Query  1179  LFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAP-KRKSE  1003
             + L+LA F  F S+A S     +  ++  WC+QTP+P  C+Y+LT+    F  P K KS+
Sbjct  1     MTLLLAPFL-FSSIASSY----SFKDIQSWCNQTPYPQPCEYYLTN--HAFNKPIKSKSD  53

Query  1002  FKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KC  829
             F K++ ++AL+ A ++E +   LGP+CRN  EKAAWADC++LYE TI +LN+T++   KC
Sbjct  54    FLKVSLQLALERAQRSELNTHALGPKCRNVHEKAAWADCLQLYEYTIQRLNKTINPNTKC  113

Query  828   TQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ  649
              + D  TWLSTALTNLETC+ GF ELG    VLPL+SNN V++L+ NTL+LN     P Q
Sbjct  114   NETDTQTWLSTALTNLETCKNGFYELGVPDYVLPLMSNN-VTKLLSNTLSLNKG---PYQ  169

Query  648   ----TYKDGFPAWVSLGDRRLLQASSPVK-PDLVVAKDGSGNYKTIKDALDAAGKRSGSG  484
                 +YK+GFP WV  GDR+LLQ+SS     ++VVAKDGSG Y T+K A+DAA K S SG
Sbjct  170   YKPPSYKEGFPTWVKPGDRKLLQSSSVASNANVVVAKDGSGKYTTVKAAVDAAPKSS-SG  228

Query  483   RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDG  304
             R+VI++K GVYNE +++  K  NIMLVGDG+  T I+GS+SV GG+TTF SATVA  GDG
Sbjct  229   RYVIYVKSGVYNEQVEV--KGNNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAAVGDG  286

Query  303   FIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGT  124
             FIAQ ITFRNTAG  NHQAVA RSG+DLSVFY+C FEG+QDTLY HS+RQFYK C IYGT
Sbjct  287   FIAQDITFRNTAGAANHQAVAFRSGSDLSVFYRCSFEGFQDTLYVHSERQFYKACDIYGT  346

Query  123   VDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             VDFIFGNAA V QNC IYAR P  ++ IT+TAQGRTDPNQN
Sbjct  347   VDFIFGNAAAVLQNCNIYARTP-PQRTITVTAQGRTDPNQN  386



>ref|XP_003517028.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=515

 Score =   432 bits (1111),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 238/401 (59%), Positives = 297/401 (74%), Gaps = 23/401 (6%)
 Frame = -1

Query  1179  LFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAP-KRKSE  1003
             + L+LA F  F S+A S     +  ++  WC+QTP+P  C+Y+LT+    F  P K KS+
Sbjct  9     MTLLLAPFL-FSSIASSY----SFKDIQSWCNQTPYPQPCEYYLTN--HAFNKPIKSKSD  61

Query  1002  FKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KC  829
             F K++ ++AL+ A ++E +   LGP+CRN  EKAAWADC++LYE TI +LN+T++   KC
Sbjct  62    FLKVSLQLALERAQRSELNTHALGPKCRNVHEKAAWADCLQLYEYTIQRLNKTINPNTKC  121

Query  828   TQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ  649
              + D  TWLSTALTNLETC+ GF ELG    VLPL+SNN V++L+ NTL+LN     P Q
Sbjct  122   NETDTQTWLSTALTNLETCKNGFYELGVPDYVLPLMSNN-VTKLLSNTLSLNKG---PYQ  177

Query  648   ----TYKDGFPAWVSLGDRRLLQASSPVK-PDLVVAKDGSGNYKTIKDALDAAGKRSGSG  484
                 +YK+GFP WV  GDR+LLQ+SS     ++VVAKDGSG Y T+K A+DAA K S SG
Sbjct  178   YKPPSYKEGFPTWVKPGDRKLLQSSSVASNANVVVAKDGSGKYTTVKAAVDAAPKSS-SG  236

Query  483   RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDG  304
             R+VI++K GVYNE +++  K  NIMLVGDG+  T I+GS+SV GG+TTF SATVA  GDG
Sbjct  237   RYVIYVKSGVYNEQVEV--KGNNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAAVGDG  294

Query  303   FIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGT  124
             FIAQ ITFRNTAG  NHQAVA RSG+DLSVFY+C FEG+QDTLY HS+RQFYK C IYGT
Sbjct  295   FIAQDITFRNTAGAANHQAVAFRSGSDLSVFYRCSFEGFQDTLYVHSERQFYKACDIYGT  354

Query  123   VDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             VDFIFGNAA V QNC IYAR P  ++ IT+TAQGRTDPNQN
Sbjct  355   VDFIFGNAAAVLQNCNIYARTP-PQRTITVTAQGRTDPNQN  394



>ref|XP_004514850.1| PREDICTED: pectinesterase 2-like [Cicer arietinum]
Length=511

 Score =   430 bits (1106),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 226/367 (62%), Positives = 281/367 (77%), Gaps = 11/367 (3%)
 Frame = -1

Query  1092  WCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNA  913
             WCS+TP+P  C+Y+L++   + T  K KS+F K++ +IA++ A   + +   LGP+CRN 
Sbjct  32    WCSKTPYPQPCEYYLSNQGYNQTI-KNKSDFFKVSLKIAIERAKMGQQNTNSLGPKCRNP  90

Query  912   REKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNV  733
             +EKAAW DC++LY  TI +LN+T+  KCTQ  + TWLSTALTNLETC+ GF +LG +  V
Sbjct  91    KEKAAWDDCIELYHYTIKKLNETIGTKCTQIQSQTWLSTALTNLETCKNGFYDLGVTNYV  150

Query  732   LPLISNNNVSQLIGNTLALNNNGSVPKQ--TYKDGFPAWVSLGDRRLLQASSPV-KPDLV  562
             LPL+SNNN+++L+ NTL+LN    VP Q   YKDGFP WV  GDR+LLQ SS   K ++V
Sbjct  151   LPLLSNNNITKLLSNTLSLN---KVPYQQPNYKDGFPTWVKPGDRKLLQTSSAASKANVV  207

Query  561   VAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYT  382
             VAKDGSG + T+ +A  +A   S SGR+VI++K GVYNE +DI  K KNIMLVGDG+  T
Sbjct  208   VAKDGSGKFTTV-NAAVSAAPSSSSGRYVIYVKSGVYNEQVDI--KAKNIMLVGDGIGKT  264

Query  381   YIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKC  202
              I+GS+SV GG+TTF SATV+  GDGF+AQ ITFRNTAG  NHQAVA RSG+DLSVFYKC
Sbjct  265   IITGSKSVGGGTTTFRSATVSAVGDGFMAQDITFRNTAGAANHQAVAFRSGSDLSVFYKC  324

Query  201   GFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQG  22
              FEGYQDTLY HS+RQFY++C IYGTVDFIFGNAAVV QNC I+AR P  K  IT+TAQG
Sbjct  325   SFEGYQDTLYVHSERQFYRECNIYGTVDFIFGNAAVVLQNCNIFARNPPQK-TITVTAQG  383

Query  21    RTDPNQN  1
             RTDPNQN
Sbjct  384   RTDPNQN  390



>sp|O04887.1|PME2_CITSI RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57669.1| pectinesterase [Citrus sinensis]
Length=510

 Score =   429 bits (1104),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 226/372 (61%), Positives = 283/372 (76%), Gaps = 15/372 (4%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             EV  WC +TP+P  C+YFLT  +   T+ K+ ++F K++ ++AL+ A  A++    LG +
Sbjct  27    EVKSWCGKTPNPQPCEYFLTQ-KTDVTSIKQDTDFYKISLQLALERATTAQSRTYTLGSK  85

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDEK--CTQFDALTWLSTALTNLETCRTGFVEL  751
             CRN REKAAW DC +LYE T+L+LNQT +    CT+ D  TWLSTALTNLETCR    +L
Sbjct  86    CRNEREKAAWEDCRELYELTVLKLNQTSNSSPGCTKVDKQTWLSTALTNLETCRASLEDL  145

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNNNGSVP--KQTYKDGFPAWVSLGDRRLLQASSPV  577
             G    VLPL+SNN V++LI NTL+LN    VP  + +YKDGFP WV  GDR+LLQ +   
Sbjct  146   GVPEYVLPLLSNN-VTKLISNTLSLNK---VPYNEPSYKDGFPTWVKPGDRKLLQTTP--  199

Query  576   KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGD  397
             + ++VVA+DGSGN KTI++A+ AA  R+G  R+VI+IK G YNEN+++  KLKNIM VGD
Sbjct  200   RANIVVAQDGSGNVKTIQEAV-AAASRAGGSRYVIYIKAGTYNENIEV--KLKNIMFVGD  256

Query  396   GMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLS  217
             G+  T I+GS+SV GG+TTF SATVAV GD FIA+ IT RNTAGP NHQAVALRSG+DLS
Sbjct  257   GIGKTIITGSKSVGGGATTFKSATVAVVGDNFIARDITIRNTAGPNNHQAVALRSGSDLS  316

Query  216   VFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKIT  37
             VFY+C FEGYQDTLY HSQRQFY++C IYGTVDFIFGNAAVV QNC I+ARKP ++   T
Sbjct  317   VFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARKPPNRTN-T  375

Query  36    ITAQGRTDPNQN  1
             +TAQGRTDPNQ+
Sbjct  376   LTAQGRTDPNQS  387



>ref|XP_009142324.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score =   429 bits (1104),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 229/373 (61%), Positives = 290/373 (78%), Gaps = 17/373 (5%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
              V  WCS+TP+P  C+YFLTH+       K  SEF K++ ++ALD A+ A++HA  LGP+
Sbjct  28    HVKAWCSKTPNPKPCEYFLTHNSDQ-KPIKSLSEFLKISMKLALDRAILAKSHASTLGPK  86

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVEL  751
             CR+ REKAAW DC+KLY+ T+ ++N+T+D   KC++ D+ TWLSTALTNL+TC+ GF+EL
Sbjct  87    CRDTREKAAWEDCLKLYDFTVSKINKTMDPDTKCSKTDSQTWLSTALTNLDTCKAGFLEL  146

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNN---NGSVPKQTYKDGFPAWVSLGDRRLLQASSP  580
             G +  +LPL+SNN VS LI NTLA+N    N + P+   KDGFP+WV  GDR+LLQ S+P
Sbjct  147   GVTDFILPLMSNN-VSDLICNTLAINKVPFNYTPPE---KDGFPSWVKPGDRKLLQNSTP  202

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              + ++VVAKDGSGN++TIK+A++AA   SGSGRFVI++K+GVY+ENL+I  +  N+ML G
Sbjct  203   -RDNVVVAKDGSGNFRTIKEAINAA---SGSGRFVIYVKQGVYSENLEI--QKDNVMLRG  256

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG   T I+GSRSV GGSTTF SATVA  GDGFIA+GITFRNTAG  N QAVALRSG+DL
Sbjct  257   DGKGRTIITGSRSVRGGSTTFKSATVAAVGDGFIARGITFRNTAGANNGQAVALRSGSDL  316

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+C FEGYQDTLY HS RQFY DC +YGTVDFIFGNAA +FQNC I+AR+P  +   
Sbjct  317   SVFYQCSFEGYQDTLYVHSNRQFYSDCNVYGTVDFIFGNAAAIFQNCNIFARRPPGRTN-  375

Query  39    TITAQGRTDPNQN  1
             TITAQGR+  +QN
Sbjct  376   TITAQGRSYQDQN  388



>gb|KDO85751.1| hypothetical protein CISIN_1g010441mg [Citrus sinensis]
Length=510

 Score =   428 bits (1101),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 225/372 (60%), Positives = 283/372 (76%), Gaps = 15/372 (4%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             EV  WC +TP+P  C+YFLT  +   T+ K+ ++F K++ ++AL+ A  A++    LG +
Sbjct  27    EVKSWCGKTPNPQPCEYFLTQ-KTDVTSIKQDTDFYKISLQLALERATTAQSRTYTLGSK  85

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDEK--CTQFDALTWLSTALTNLETCRTGFVEL  751
             CRN REKAAW DC +LYE T+L+LNQT +    CT+ D  TWLS+ALTNLETCR    +L
Sbjct  86    CRNEREKAAWEDCRELYELTVLKLNQTSNSSPGCTKVDKQTWLSSALTNLETCRASLEDL  145

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNNNGSVP--KQTYKDGFPAWVSLGDRRLLQASSPV  577
             G    VLPL+SNN V++LI NTL+LN    VP  + +YKDGFP WV  GDR+LLQ +   
Sbjct  146   GVPEYVLPLLSNN-VTKLISNTLSLNK---VPYNEPSYKDGFPTWVKPGDRKLLQTTP--  199

Query  576   KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGD  397
             + ++VVA+DGSGN KTI++A+ AA  R+G  R+VI+IK G YNEN+++  KLKNIM VGD
Sbjct  200   RANIVVAQDGSGNVKTIQEAV-AAASRAGGSRYVIYIKAGTYNENIEV--KLKNIMFVGD  256

Query  396   GMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLS  217
             G+  T I+GS+SV GG+TTF SATVAV GD FIA+ IT RNTAGP NHQAVALRSG+DLS
Sbjct  257   GIGKTIITGSKSVGGGATTFKSATVAVVGDNFIARDITIRNTAGPNNHQAVALRSGSDLS  316

Query  216   VFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKIT  37
             VFY+C FEGYQDTLY HSQRQFY++C IYGTVDFIFGNAAVV QNC I+ARKP ++   T
Sbjct  317   VFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARKPPNRTN-T  375

Query  36    ITAQGRTDPNQN  1
             +TAQGRTDPNQ+
Sbjct  376   LTAQGRTDPNQS  387



>ref|XP_006445298.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
 gb|ESR58538.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
Length=510

 Score =   428 bits (1101),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 225/372 (60%), Positives = 282/372 (76%), Gaps = 15/372 (4%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             EV  WC +TP+P  C+YFLT  +   T+ K+ ++F K++ ++AL+ A  A++    LG +
Sbjct  27    EVKSWCGKTPNPQPCEYFLTQ-KTDVTSIKQDTDFYKISLQLALERATTAQSRTYTLGSK  85

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDEK--CTQFDALTWLSTALTNLETCRTGFVEL  751
             CRN REKAAW DC +LYE T+L+LNQT +    CT+ D  TWLS+ALTNLETCR    +L
Sbjct  86    CRNEREKAAWEDCRELYELTVLKLNQTSNSSPGCTKVDKQTWLSSALTNLETCRASLEDL  145

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNNNGSVP--KQTYKDGFPAWVSLGDRRLLQASSPV  577
             G    VLPL+SNN V++LI N L+LN    VP  + +YKDGFP WV  GDR+LLQ +   
Sbjct  146   GVPEYVLPLLSNN-VTKLISNALSLNK---VPYNEPSYKDGFPTWVKPGDRKLLQTTP--  199

Query  576   KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGD  397
             + ++VVA+DGSGN KTI++A+ AA  R+G  R+VI+IK G YNEN+++  KLKNIM VGD
Sbjct  200   RANIVVAQDGSGNVKTIQEAV-AAASRAGGSRYVIYIKAGTYNENIEV--KLKNIMFVGD  256

Query  396   GMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLS  217
             G+  T I+GS+SV GG+TTF SATVAV GD FIA+ IT RNTAGP NHQAVALRSG+DLS
Sbjct  257   GIGKTIITGSKSVGGGATTFKSATVAVVGDNFIARDITIRNTAGPNNHQAVALRSGSDLS  316

Query  216   VFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKIT  37
             VFY+C FEGYQDTLY HSQRQFY++C IYGTVDFIFGNAAVV QNC I+ARKP ++   T
Sbjct  317   VFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARKPPNRTN-T  375

Query  36    ITAQGRTDPNQN  1
             +TAQGRTDPNQN
Sbjct  376   LTAQGRTDPNQN  387



>emb|CAN76835.1| hypothetical protein VITISV_043176 [Vitis vinifera]
Length=497

 Score =   427 bits (1099),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 222/344 (65%), Positives = 277/344 (81%), Gaps = 10/344 (3%)
 Frame = -1

Query  1017  KRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD  838
             K+KS+F  ++ ++AL+ A+ A      LG +CRN REKAAW DC++LYE TIL+LN+TLD
Sbjct  36    KQKSDFLNISMQLALERAMIAHGDTFSLGSKCRNEREKAAWNDCLELYEHTILKLNKTLD  95

Query  837   E--KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNG  664
                +CTQ DA TWLSTALTNL+TC+ GF++LG S  VLPL+SNN VS+LI NTL++N   
Sbjct  96    SNTRCTQADAQTWLSTALTNLQTCQDGFIDLGVSDYVLPLMSNN-VSKLISNTLSINK--  152

Query  663   SVP--KQTYKDGFPAWVSLGDRRLLQASS-PVKPDLVVAKDGSGNYKTIKDALDAAGKRS  493
              VP  + +YK G+P WV  GDR+LLQ+SS   + ++VV+KDGSG+Y TI  A+ AA KRS
Sbjct  153   -VPYAEPSYKGGYPTWVKPGDRKLLQSSSLASQANIVVSKDGSGDYTTIGAAITAASKRS  211

Query  492   GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVT  313
             GSGR+VI++K G Y+EN+ IG+ LKNIML+GDG+  T ++GS+SV GGSTTFNSATVAV 
Sbjct  212   GSGRYVIYVKAGTYSENVQIGSGLKNIMLLGDGIGKTIVTGSKSVGGGSTTFNSATVAVV  271

Query  312   GDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYI  133
             GDGFIA+G+TFRNTAG  NHQAVALRSG+DLSV+Y+C FEGYQDTLY +S+RQFY++C I
Sbjct  272   GDGFIARGMTFRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLYTYSERQFYRECDI  331

Query  132   YGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             YGTVDFIFGNAAVVFQNC IY R P +K   T+TAQGRTDPNQN
Sbjct  332   YGTVDFIFGNAAVVFQNCNIYXRNPPNKIN-TVTAQGRTDPNQN  374



>gb|KCW73024.1| hypothetical protein EUGRSUZ_E01466, partial [Eucalyptus grandis]
Length=523

 Score =   428 bits (1100),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 227/371 (61%), Positives = 278/371 (75%), Gaps = 11/371 (3%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRC  922
             V  WCS+ P+P  C++FLT + +  T  KR+S F + + ++AL++A  A TH   LG  C
Sbjct  29    VKSWCSKMPYPQPCEHFLTRNPKQ-TPLKRRSHFLRASMQVALESAQLARTHMYSLGSGC  87

Query  921   RNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGNS  742
             R+ REKAAWADC+KLYE T+  LN+T++ +CTQ D  TWLS ALTNL+TC TGFVELG S
Sbjct  88    RDEREKAAWADCLKLYEHTVHHLNRTINRQCTQDDMQTWLSAALTNLQTCGTGFVELGIS  147

Query  741   RNVLPLISNNNVSQLIGNTLALNNNGSVPKQT--YKDGFPAWVSLGDRRLLQASSPV--K  574
              NVLPL+SNN VS+LI NTL+ N    VP  T  Y + FP WV   DR+LLQ SSPV   
Sbjct  148   DNVLPLMSNN-VSKLISNTLSAN---YVPYTTLNYTNEFPTWVRPSDRKLLQ-SSPVLST  202

Query  573   PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDG  394
              +++VA+DGSGNYKTI +A+ AA  RS + RF+I+IK G Y EN+++G+KL+NI  VGDG
Sbjct  203   ANIMVAQDGSGNYKTINEAVTAALMRSDTTRFIIYIKAGTYEENVEVGSKLENIAFVGDG  262

Query  393   MRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSV  214
             +  T I+GS+S  GG TTF+SATVAV GDGFIAQ ITFRNTAG  N+QAVALRS +DLSV
Sbjct  263   IGKTIITGSKSNAGGFTTFHSATVAVDGDGFIAQDITFRNTAGSANNQAVALRSSSDLSV  322

Query  213   FYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITI  34
             FY+CGFEGYQDTL+ HS+RQFY  C IYGT DFIFGNAAVVF NC IY R   +K   TI
Sbjct  323   FYRCGFEGYQDTLFVHSKRQFYNGCDIYGTTDFIFGNAAVVFHNCNIYVRNSPNKVN-TI  381

Query  33    TAQGRTDPNQN  1
             TAQGRT+PNQN
Sbjct  382   TAQGRTNPNQN  392



>ref|NP_001275775.1| pectinesterase 2 precursor [Citrus sinensis]
 gb|AAB57671.1| pectinesterase [Citrus sinensis]
Length=510

 Score =   426 bits (1096),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 224/372 (60%), Positives = 281/372 (76%), Gaps = 15/372 (4%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             EV  WC +TP+P  C+YFLT  +   T+ K+ ++F K++ ++AL+ A  A++    LG +
Sbjct  27    EVKSWCGKTPNPQPCEYFLTQ-KTDVTSIKQDTDFYKISLQLALERATTAQSRTYTLGSK  85

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDEK--CTQFDALTWLSTALTNLETCRTGFVEL  751
             CRN REKAAW DC +LYE T+L+LNQT +    CT+ D  TWLS+ALTNLETCR    +L
Sbjct  86    CRNEREKAAWEDCRELYELTVLKLNQTSNSSPGCTKVDKQTWLSSALTNLETCRASLEDL  145

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNNNGSVP--KQTYKDGFPAWVSLGDRRLLQASSPV  577
             G    VLPL+SNN V++LI N L+LN    VP  + +YKDGFP WV  GDR+LLQ +   
Sbjct  146   GVPEYVLPLLSNN-VTKLISNALSLNK---VPYNEPSYKDGFPTWVKPGDRKLLQTTP--  199

Query  576   KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGD  397
             + ++VVA+DGSGN KTI++A+ AA  R+G  R+VI+IK G YNEN+++  KLKNIM VGD
Sbjct  200   RANIVVAQDGSGNVKTIQEAV-AAASRAGGSRYVIYIKAGTYNENIEV--KLKNIMFVGD  256

Query  396   GMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLS  217
             G+  T I+GS+SV GG+TTF SATVAV GD FIA+ IT RNTAGP NHQAVALRSG+DLS
Sbjct  257   GIGKTIITGSKSVGGGATTFKSATVAVVGDNFIARDITIRNTAGPNNHQAVALRSGSDLS  316

Query  216   VFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKIT  37
             VFY+C FEGYQDTLY HSQRQFY++C IYGTVDFIFGNAAVV QNC I+AR P ++   T
Sbjct  317   VFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARXPPNRTN-T  375

Query  36    ITAQGRTDPNQN  1
             +TAQGRTDPNQN
Sbjct  376   LTAQGRTDPNQN  387



>ref|XP_006490218.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33-like 
[Citrus sinensis]
Length=528

 Score =   427 bits (1097),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 219/388 (56%), Positives = 283/388 (73%), Gaps = 15/388 (4%)
 Frame = -1

Query  1137  ALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQ  958
             ALS  P  +A  +  WCS+TPHP+ CKYFL+ S   +T  K +S+F+K+  ++A++ A +
Sbjct  22    ALSRRP--SATNITWWCSKTPHPEPCKYFLSRSHHRYTF-KHRSDFRKIIVQVAIEQAHK  78

Query  957   AETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL-----DEKCTQFDALTWLSTA  793
             A       G  C N  +KAAW+DCVKLY +T+LQLN+TL     D  CT FDA TWLSTA
Sbjct  79    AHEQLMEFGTNCENKHQKAAWSDCVKLYANTVLQLNRTLQGLKSDRSCTDFDAQTWLSTA  138

Query  792   LTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ---TYKDGFPAW  622
             LTN+ TC++G++EL  S  + P++SNN +SQLI N+LA+N  G + K    TY +GFP+W
Sbjct  139   LTNIRTCQSGYMELNVSDFITPVMSNN-LSQLISNSLAVN--GVLLKSENVTYTNGFPSW  195

Query  621   VSLGDRRLLQASS-PVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNE  445
             +S  +R LL++SS   + +LVVA DGSGNY+TI+ A++AA  R GSGRF+IH+KRGVY E
Sbjct  196   LSGHERNLLESSSLEARANLVVATDGSGNYRTIQAAINAAAGRRGSGRFIIHVKRGVYRE  255

Query  444   NLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAG  265
             N+++G    NIMLVG+GMR T I+  RSV  GSTT++SAT  + G  F+A+ ITF+NTAG
Sbjct  256   NIEVGLNNNNIMLVGEGMRNTIITSGRSVGSGSTTYSSATAGIDGLHFMARDITFQNTAG  315

Query  264   PENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQ  85
             P   QAVALRS +DLSVFY+C F+GYQDTL  HSQRQFYK C IYGT+DFIFGNAAVVFQ
Sbjct  316   PLKGQAVALRSASDLSVFYRCAFQGYQDTLMVHSQRQFYKKCCIYGTIDFIFGNAAVVFQ  375

Query  84    NCMIYARKPMDKQKITITAQGRTDPNQN  1
             NC+I+ RKP+  Q   ITAQGR DP QN
Sbjct  376   NCIIFVRKPLKGQANVITAQGRNDPFQN  403



>ref|XP_006421696.1| hypothetical protein CICLE_v10004719mg [Citrus clementina]
 gb|ESR34936.1| hypothetical protein CICLE_v10004719mg [Citrus clementina]
Length=528

 Score =   426 bits (1096),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 222/404 (55%), Positives = 291/404 (72%), Gaps = 15/404 (4%)
 Frame = -1

Query  1185  IHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKS  1006
             I L ++  S SS    ALS  P  +A  +  WCS+TPHP+ C YFL+ S   +T  K +S
Sbjct  6     ISLLIIFISLSSIFYHALSRRP--SATNITWWCSKTPHPEPCNYFLSRSHHRYTF-KHRS  62

Query  1005  EFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL-----  841
             +F+K+  ++A++ A +A       G  C N  +KAAW+DCVKLY +T+LQLN+TL     
Sbjct  63    DFRKIIVQVAIEQAHKAHDQVMEFGTNCENKHQKAAWSDCVKLYANTVLQLNRTLQGLKS  122

Query  840   DEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGS  661
             D  CT FDA TWLSTALTN+ TC++G++EL  S  + P++SNN +SQLI N+LA+N  G 
Sbjct  123   DRSCTDFDAQTWLSTALTNIRTCQSGYMELNVSDFITPVMSNN-LSQLISNSLAVN--GV  179

Query  660   VPKQ---TYKDGFPAWVSLGDRRLLQASS-PVKPDLVVAKDGSGNYKTIKDALDAAGKRS  493
             + K+   TY +GFP+W+S  +R LL++SS   + +LVVA DGSGNY+TI+ A++AA +R 
Sbjct  180   LLKRENVTYTNGFPSWLSGHERNLLESSSLEARANLVVATDGSGNYRTIQAAINAAARRR  239

Query  492   GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVT  313
             GSGRF+IH+KRGVY EN+++G    NIMLVG+GMR T I+  +SV  GSTT++SAT  + 
Sbjct  240   GSGRFIIHVKRGVYRENIEVGLNNNNIMLVGEGMRNTIITSGQSVGSGSTTYSSATAGID  299

Query  312   GDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYI  133
             G  F+ + ITF+NTAGP   QAVALRS +DLSVFY+C F+GYQDTL  HSQRQFYK CYI
Sbjct  300   GLHFMGRDITFQNTAGPLKGQAVALRSASDLSVFYRCAFQGYQDTLMVHSQRQFYKKCYI  359

Query  132   YGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             YGT+DFIFGNAAVVFQNC+I+ RKP+  Q   ITAQGR DP QN
Sbjct  360   YGTIDFIFGNAAVVFQNCIIFVRKPLKGQANVITAQGRNDPFQN  403



>ref|XP_008234390.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 60 
[Prunus mume]
Length=528

 Score =   426 bits (1095),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 286/404 (71%), Gaps = 11/404 (3%)
 Frame = -1

Query  1188  KIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRK  1009
             K  L L +  FS     ALS      +  +  WC +TPHP+ C Y ++HSR H   PK  
Sbjct  4     KPSLLLSILIFSFIFQTALS-RSHHHSNRIRTWCQKTPHPEPCNYCMSHSR-HRLVPKHT  61

Query  1008  SEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD---  838
             SEF+KM  ++AL+ A+ A+++A + G  C+N ++KAAWADC+KL+EDT+ QLN TLD   
Sbjct  62    SEFRKMMVQVALERALNAKSYASQFGQNCQNNQQKAAWADCLKLFEDTVHQLNITLDGLG  121

Query  837   --EKCTQFD-ALTWLSTALTNLETCRTGFVELGNSRNVLPL-ISNNNVSQLIGNTLALNN  670
                 C+ FD A TWLS ALTN+ TC+ G +EL  S  + P+  SNNNVS+LI N LA+ +
Sbjct  122   TKRNCSNFDDAQTWLSAALTNIHTCQVGSMELNVSDFIAPIYTSNNNVSELISNGLAIGS  181

Query  669   NGSVPKQTYKDG-FPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS  493
                  ++ Y D  +P WVS  +RRLLQAS  +K +LVVAKDGSG+++T++ A+DAA KR 
Sbjct  182   QLLGTEENYADEEYPNWVSKHERRLLQASK-IKANLVVAKDGSGHFRTVQAAIDAAAKRK  240

Query  492   GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVT  313
              + RF+I++K+GVY EN+++ N   NIML+G  MRYT I+ SRSV GGSTT+NSAT  + 
Sbjct  241   ITSRFIIYVKKGVYRENIEVSNTNNNIMLIGASMRYTIITASRSVNGGSTTYNSATAGID  300

Query  312   GDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYI  133
             G GFIA+GITF NTAGP   QAVALRS +DLSVFY+C F+GYQDTL  HSQRQFY++CYI
Sbjct  301   GPGFIARGITFSNTAGPLKGQAVALRSASDLSVFYRCAFQGYQDTLMVHSQRQFYRECYI  360

Query  132   YGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             YGT+DFIFGNAA VFQ+C+IY R+P+  Q   ITAQ R DP QN
Sbjct  361   YGTIDFIFGNAAAVFQSCIIYVRRPLKGQVNVITAQARNDPYQN  404



>ref|XP_002322399.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06526.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=516

 Score =   425 bits (1093),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 221/400 (55%), Positives = 280/400 (70%), Gaps = 8/400 (2%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             +K  L ++  SF S  S  LS      + E++ WC++ PHP+ CKY +  +   F  P +
Sbjct  3     TKFGLSVLFISFCSLFSPTLS---SITSNEIDSWCNKIPHPEPCKYSMKQNPNPFI-PNQ  58

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE-  835
             + E +K+A E+AL +A+ A+ H +RL P  RN +EK AW  C+  Y  TI +L   LD  
Sbjct  59    EFESRKVAIELALKSALTAQNHHQRLWPTLRNEKEKNAWKHCLNFYNKTIDELILALDSN  118

Query  834   -KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGS-  661
              K T FD  TWLS A T LE C+    +LG S ++LPL+ +NNVS+LI N+LAL+N  S 
Sbjct  119   IKSTNFDTQTWLSAASTYLECCKDTINDLGVSDSMLPLMMSNNVSKLITNSLALHNKASS  178

Query  660   VPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGR  481
             V  QTY+D  P WV   DR+LLQ  SP  PDLVVA+DGSG+Y  IK AL+AA K SG+GR
Sbjct  179   VFPQTYQDDLPTWVKASDRKLLQEPSP-SPDLVVAQDGSGDYSNIKAALEAAEKSSGNGR  237

Query  480   FVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGF  301
             FVI+IK GVY E L+IG KL+NIMLVGDGM  T I+G++   GG  TF++ATV V G GF
Sbjct  238   FVIYIKSGVYKEYLEIGKKLENIMLVGDGMTKTIITGNKRSGGGVDTFHTATVGVDGHGF  297

Query  300   IAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTV  121
             IA+ ITF+NTAGP+NHQAVALRS +D SVFY+CGFEGYQDTLY HS+RQFY++C IYGT+
Sbjct  298   IARDITFQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGTI  357

Query  120   DFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             DFIFG+AAVV QNCMIY R+P+  Q   ITAQGR+ P  N
Sbjct  358   DFIFGDAAVVLQNCMIYVRRPIGSQNNVITAQGRSCPYTN  397



>ref|XP_008438193.1| PREDICTED: pectinesterase 2 [Cucumis melo]
Length=511

 Score =   424 bits (1091),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 231/374 (62%), Positives = 278/374 (74%), Gaps = 15/374 (4%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLT--HSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLG  931
             E+  WCSQTP+P  C+ FL    S +  T    KS F ++  E AL+ AV A  +A  LG
Sbjct  28    EIKNWCSQTPYPAPCEEFLKTKASTKKSTPITTKSHFFEILVETALERAVSAHKNALSLG  87

Query  930   PRCRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVEL  751
             P+CRN++EK AW DCV LY++ I +LN+T D +CT  DA TWLS ALT LETCRTGF EL
Sbjct  88    PKCRNSKEKTAWTDCVDLYDEIITRLNRTSD-RCTPADAQTWLSAALTALETCRTGFDEL  146

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNN----NGSVPKQTYKDGFPAWVSLGDRRLLQASS  583
             G S    PL +NN VS+LI + L++N      G  P     DGFP WV  GDR+LLQ+ S
Sbjct  147   GLSAFGYPLTANN-VSKLISDGLSVNKPASPEGYEPTTIMDDGFPTWVRPGDRKLLQSGS  205

Query  582   PVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLV  403
             P K ++VVA+DGSGN+KT+K+A+ AA    G GRFVI++K GVYNENLDI  K KN+M+V
Sbjct  206   P-KANVVVAQDGSGNFKTVKEAVAAA---KGGGRFVIYVKSGVYNENLDI--KAKNVMMV  259

Query  402   GDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGAD  223
             GDG+  T I+GSRSV GGSTTF SATVAV GDGFIA+ ITFRNTAG +NHQAVALRSG+D
Sbjct  260   GDGIGKTIITGSRSVGGGSTTFRSATVAVDGDGFIARDITFRNTAGAKNHQAVALRSGSD  319

Query  222   LSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQK  43
             LSVFY+CGFEGYQDTLY +++RQFYK C IYGTVDFIFGNAAVV Q+C I AR P +K  
Sbjct  320   LSVFYRCGFEGYQDTLYVYAERQFYKQCDIYGTVDFIFGNAAVVLQDCNIIARDPPNKT-  378

Query  42    ITITAQGRTDPNQN  1
             IT+TAQGR+DPNQN
Sbjct  379   ITVTAQGRSDPNQN  392



>ref|XP_010692197.1| PREDICTED: pectinesterase 2 [Beta vulgaris subsp. vulgaris]
Length=527

 Score =   424 bits (1091),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 225/403 (56%), Positives = 293/403 (73%), Gaps = 14/403 (3%)
 Frame = -1

Query  1176  FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFK  997
              +++  F+S  S+ + V     +  ++ WC+QTP+P QC+Y+L+H++      KRKS+F 
Sbjct  9     LMIVVLFTSLFSLFMHVEGYGPSKLLSYWCNQTPYPKQCEYYLSHNQNPPNI-KRKSDFL  67

Query  996   KMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD-EKCTQF  820
             KM  + A++ A +A  +   LG  C++ +EKAAW DC+ +YE +I  LN T+    CT+ 
Sbjct  68    KMMMQSAIENAGKAHKNVNSLGHNCKDEKEKAAWKDCLDVYELSIQGLNNTMTTSSCTKD  127

Query  819   DALTWLSTALTNLETCRTGFVELGNSRNVLPLISN-NNVSQLIGNTLALNNNGS----VP  655
             D  TWLS+ALT ++TC+ GF ELG + N++P++SN NNVS LI N LA+N +GS    + 
Sbjct  128   DTQTWLSSALTLMQTCQNGFRELGVTENIMPMLSNDNNVSCLISNALAINGDGSNGRRLE  187

Query  654   KQTY---KDGFPAWVSLGDRRLLQA-SSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGS  487
              Q +   K GFP WV   DR+LLQ+ SS  + DLVVA+DGSG+YKTI  A+  A ++ GS
Sbjct  188   GQDWAGTKGGFPRWVRPSDRKLLQSVSSSGRADLVVAQDGSGDYKTIGQAISDASRKGGS  247

Query  486   GRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGD  307
             GRFVI+IK+G+Y ENL+I +KLKNIML+GDG+  T I+GS+SV GGSTTF SATVAV G 
Sbjct  248   GRFVIYIKKGIYKENLEIEDKLKNIMLLGDGIGRTIITGSKSVGGGSTTFRSATVAVMGS  307

Query  306   GFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYG  127
             GF+AQGITFRNTAGP NHQAVALRS +DLSVFYKC FEGYQDTLY  S RQFY++C IYG
Sbjct  308   GFMAQGITFRNTAGPSNHQAVALRSNSDLSVFYKCSFEGYQDTLYVFSNRQFYRECDIYG  367

Query  126   TVDFIFGNAAVVFQNCMIYAR-KPMDKQKITITAQGRTDPNQN  1
             TVDFIFGNAA V QNC IYAR  P   + + ITAQGR+DPN+N
Sbjct  368   TVDFIFGNAAAVIQNCNIYARFGP--SRTVAITAQGRSDPNEN  408



>ref|XP_010058469.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=607

 Score =   427 bits (1097),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 227/371 (61%), Positives = 278/371 (75%), Gaps = 11/371 (3%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRC  922
             V  WCS+ P+P  C++FLT + +  T  KR+S F + + ++AL++A  A TH   LG  C
Sbjct  29    VKSWCSKMPYPQPCEHFLTRNPKQ-TPLKRRSHFLRASMQVALESAQLARTHMYSLGSGC  87

Query  921   RNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGNS  742
             R+ REKAAWADC+KLYE T+  LN+T++ +CTQ D  TWLS ALTNL+TC TGFVELG S
Sbjct  88    RDEREKAAWADCLKLYEHTVHHLNRTINRQCTQDDMQTWLSAALTNLQTCGTGFVELGIS  147

Query  741   RNVLPLISNNNVSQLIGNTLALNNNGSVPKQT--YKDGFPAWVSLGDRRLLQASSPV--K  574
              NVLPL+SNN VS+LI NTL+ N    VP  T  Y + FP WV   DR+LLQ SSPV   
Sbjct  148   DNVLPLMSNN-VSKLISNTLSAN---YVPYTTLNYTNEFPTWVRPSDRKLLQ-SSPVLST  202

Query  573   PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDG  394
              +++VA+DGSGNYKTI +A+ AA  RS + RF+I+IK G Y EN+++G+KL+NI  VGDG
Sbjct  203   ANIMVAQDGSGNYKTINEAVTAALMRSDTTRFIIYIKAGTYEENVEVGSKLENIAFVGDG  262

Query  393   MRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSV  214
             +  T I+GS+S  GG TTF+SATVAV GDGFIAQ ITFRNTAG  N+QAVALRS +DLSV
Sbjct  263   IGKTIITGSKSNAGGFTTFHSATVAVDGDGFIAQDITFRNTAGSANNQAVALRSSSDLSV  322

Query  213   FYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITI  34
             FY+CGFEGYQDTL+ HS+RQFY  C IYGT DFIFGNAAVVF NC IY R   +K   TI
Sbjct  323   FYRCGFEGYQDTLFVHSKRQFYNGCDIYGTTDFIFGNAAVVFHNCNIYVRNSPNKVN-TI  381

Query  33    TAQGRTDPNQN  1
             TAQGRT+PNQN
Sbjct  382   TAQGRTNPNQN  392



>ref|XP_011010930.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=516

 Score =   423 bits (1087),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 222/400 (56%), Positives = 282/400 (71%), Gaps = 8/400 (2%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             +K  L ++  SF S  S  LS        E++ WCS+TPHP+ CKY +  +  HF  P +
Sbjct  3     TKFGLSVLFISFCSLFSPTLS---SITYNEIDSWCSKTPHPEPCKYSMKQNPSHFI-PNQ  58

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL--D  838
             + E +K+A E+AL +A+ A+ H +RL P  R  +EK AW  C+  Y  TI +L   L  +
Sbjct  59    EFESRKVAIELALQSALTAQNHHQRLWPTLRIEKEKNAWKHCLNFYNKTIDELILALASN  118

Query  837   EKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGS-  661
              K T F+  TWLS A T LE+C+    +LG S ++L L+ +NNVS+LI N+LAL+N  S 
Sbjct  119   IKSTNFNTQTWLSAASTYLESCKDTINDLGVSGSMLSLMMSNNVSKLITNSLALHNKASS  178

Query  660   VPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGR  481
             V  QTY+D FP WV   DR+LLQ  SP  PDLVVA+DGSG+Y  IK AL+AA K SG+GR
Sbjct  179   VFPQTYQDDFPTWVKAADRKLLQEPSP-SPDLVVAQDGSGDYSIIKAALEAAEKSSGNGR  237

Query  480   FVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGF  301
             FVI+IK GVY E L+IG KL+NIMLVGDGM  T I+G++S+ GG  TF++ATV V G GF
Sbjct  238   FVIYIKSGVYKEYLEIGKKLENIMLVGDGMTKTIITGNKSLGGGVDTFHTATVGVDGQGF  297

Query  300   IAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTV  121
             IA+ ITF+NTAGP+NHQAVALRS +D SVFY+CGFEGYQDTLY HS+RQFY++C IYGT+
Sbjct  298   IARDITFQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGTI  357

Query  120   DFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             DFIFG+AAVV QNCMIY R+P   Q   ITAQGR+ P  N
Sbjct  358   DFIFGDAAVVLQNCMIYVRRPFGSQNNVITAQGRSCPYTN  397



>ref|XP_010058468.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=720

 Score =   429 bits (1104),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 225/370 (61%), Positives = 276/370 (75%), Gaps = 7/370 (2%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WCS  P+P  C+YFLTH  +  T  K+KS F   +T +AL+ A  A+  +  LG  
Sbjct  28    DVKSWCSTMPYPQPCEYFLTHLPQQ-TPLKQKSHFLMASTRVALERAQLAQMKSYSLGSM  86

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGN  745
             CRN REKAAW DC++LYE  +  LN+T+  +CTQ D  TWLSTALTNLETCR GFVELG 
Sbjct  87    CRNEREKAAWTDCLRLYEHIVHHLNRTIHRQCTQDDVQTWLSTALTNLETCRAGFVELGI  146

Query  744   SRNVLPLISNNNVSQLIGNTLALNNNG-SVPKQTYKDGFPAWVSLGDRRLLQA-SSPVKP  571
               NVLPL+SNN +S+LI N L+ N+   ++P   Y   FP W+  G+R+LL++ S+    
Sbjct  147   LDNVLPLMSNN-ISKLISNALSANHEPYAMPN--YTREFPTWLRPGNRKLLRSLSASSMA  203

Query  570   DLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGM  391
             ++VVA DGSGNYKTI +A+ AA +RSG  R +I+IK G Y EN+++G+KL+NI+ VGDG+
Sbjct  204   NIVVAHDGSGNYKTISEAVIAASERSGMARCIIYIKAGTYEENIEVGSKLENIVFVGDGI  263

Query  390   RYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVF  211
               T I+GSRSV  G TTFNSATVAV GDGFIAQ ITFRNTAG  N QAVALRS +DLSVF
Sbjct  264   GMTIITGSRSVGEGFTTFNSATVAVDGDGFIAQDITFRNTAGAANGQAVALRSSSDLSVF  323

Query  210   YKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITIT  31
             Y+C FEGYQDTL+ HS+RQFYK+C IYGT+DFIFGNAAVVFQNC IYAR P +K  I IT
Sbjct  324   YRCSFEGYQDTLFVHSERQFYKECDIYGTIDFIFGNAAVVFQNCNIYARNPPNKVNI-IT  382

Query  30    AQGRTDPNQN  1
             AQGRTDPNQN
Sbjct  383   AQGRTDPNQN  392



>gb|KDP22413.1| hypothetical protein JCGZ_26244 [Jatropha curcas]
Length=531

 Score =   423 bits (1087),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 207/373 (55%), Positives = 275/373 (74%), Gaps = 10/373 (3%)
 Frame = -1

Query  1092  WCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNA  913
             WC++TP+P+ C YF+   +   +A K +SEF+K+  EIAL+ ++ A+    +L P+C+N 
Sbjct  36    WCNKTPYPEPCNYFMNRRQHRHSALKHRSEFRKIMVEIALERSLTAQRKVFKLRPKCQNH  95

Query  912   REKAAWADCVKLYEDTILQLNQTLD-------EKCTQFDALTWLSTALTNLETCRTGFVE  754
             +++A WADC KL+ DTILQLN+TL        + CT FDA TWLSTALTN+ TCRTG ++
Sbjct  96    QQRAVWADCYKLHADTILQLNRTLQGLQSKKKKSCTNFDAQTWLSTALTNIGTCRTGSLD  155

Query  753   LGNSRNVLPLISNNNVSQLIGNTLALNNNG-SVPKQTYKDGFPAWVSLGDRRLLQASS-P  580
             L  S  ++P++S+N +S+LI N+LAL     +V    Y  GFP W+++ +RRLLQ+SS  
Sbjct  156   LNVSDFIMPIMSHN-LSELISNSLALTGVLLAVEDNNYTQGFPKWIAMNERRLLQSSSVA  214

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              K +LVVA+DGSGN+++I+ A++ A KR    RF+IH+KRGVY EN+++G    NI L+G
Sbjct  215   AKANLVVAQDGSGNFRSIQAAINVAAKRRYKTRFIIHVKRGVYRENIEVGVNNNNIWLIG  274

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DGMR T I+ SRSV  G TT++SAT  + G  F+A+GITF NTAGP   QAVALRS +DL
Sbjct  275   DGMRNTIITSSRSVGAGYTTYSSATAGIDGLRFVARGITFSNTAGPLKGQAVALRSASDL  334

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+C F+GYQDTL+ HSQRQFYK+CYIYGT+DFIFGNAAVVFQNC+IY RKP+  Q  
Sbjct  335   SVFYRCSFQGYQDTLFVHSQRQFYKECYIYGTIDFIFGNAAVVFQNCIIYVRKPLKGQAN  394

Query  39    TITAQGRTDPNQN  1
              ITAQGR DP QN
Sbjct  395   MITAQGRNDPYQN  407



>ref|XP_004306939.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Fragaria vesca subsp. vesca]
Length=508

 Score =   422 bits (1084),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 225/373 (60%), Positives = 282/373 (76%), Gaps = 10/373 (3%)
 Frame = -1

Query  1113  AAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRL  934
             +A ++  WCS+TP+P  C+  L+H++      K+KS+F +++T++ALD A+ A T+   L
Sbjct  23    SANDIKTWCSKTPNPKPCEELLSHNKNQIPI-KQKSQFFQISTQLALDRAMHAHTNFLSL  81

Query  933   GPRCRNAREKAAWADCVKLYEDTILQLNQTLD--EKCTQFDALTWLSTALTNLETCRTGF  760
             G +  N R KAAW DC++LY+ TI +LN T++   KCTQ D  TWLSTALTNLETCR GF
Sbjct  82    GSKFVNPRAKAAWDDCLELYDLTIQKLNTTVNPSTKCTQEDTQTWLSTALTNLETCREGF  141

Query  759   VELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGFPAWVSLGDRRLLQASSP  580
              ELG S   LP++SNN VS LI NTL++N     P    KDGFP WV+ G+RRLLQ+SSP
Sbjct  142   SELGVSDFFLPVMSNN-VSNLISNTLSINYVPYNPAPPSKDGFPTWVNPGNRRLLQSSSP  200

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
                +LVVAKDGSGNYKT+ +A+  A KRSG+ R+VI++K G Y EN+ I +K  NIML+G
Sbjct  201   TA-NLVVAKDGSGNYKTVTEAITTASKRSGTARYVIYVKAGTYKENVVITSK--NIMLMG  257

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG+  T I+GS+SV GGSTTFNSATVAVTGDGFIA+ ITF+NTAG  N+QAVALRSG+DL
Sbjct  258   DGIGKTIITGSKSVGGGSTTFNSATVAVTGDGFIARDITFQNTAGVSNNQAVALRSGSDL  317

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFYKC FEGYQDTLY +S RQFY++C IYGTVDFIFGNAAVV QNC IY     + +  
Sbjct  318   SVFYKCSFEGYQDTLYVYSDRQFYRECNIYGTVDFIFGNAAVVLQNCNIYVH---NHKTN  374

Query  39    TITAQGRTDPNQN  1
             T+TAQGR+DPNQN
Sbjct  375   TVTAQGRSDPNQN  387



>ref|XP_011010924.1| PREDICTED: pectinesterase-like isoform X1 [Populus euphratica]
Length=516

 Score =   421 bits (1083),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 220/400 (55%), Positives = 282/400 (71%), Gaps = 8/400 (2%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             +K  L ++  SF S  S  LS        E++ WCS+TPHP+ CKY +  +  HF  P +
Sbjct  3     TKFGLSVLFISFCSLFSPTLS---SITYNEIDSWCSKTPHPEPCKYSMKQNPNHFI-PNQ  58

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL--D  838
             + E +K+A E+AL +A+ A+ H +RL P  R  +EK AW  C+  Y  TI +L   L  +
Sbjct  59    EFESRKVAIELALQSALTAQNHHQRLWPTLRIEKEKNAWKHCLNFYNKTIDELILALASN  118

Query  837   EKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGS-  661
              K T F+  TWLS A T LE+C+    +LG S ++L L+ +NNVS+LI N+LAL+N  S 
Sbjct  119   IKSTNFNTQTWLSAASTYLESCKDTINDLGVSGSMLSLMMSNNVSKLITNSLALHNKASS  178

Query  660   VPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGR  481
             +  Q+Y+D FP WV   DR+LLQ  SP  PDLVVA+DGSG+Y  IK AL+AA K SG+GR
Sbjct  179   IFPQSYQDDFPTWVKSADRKLLQEPSP-SPDLVVAQDGSGDYSIIKAALEAAEKSSGNGR  237

Query  480   FVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGF  301
             FVI+IK GVY E L+IG KL+NIMLVGDGM  T I+G++S+ GG  TF++ATV V G GF
Sbjct  238   FVIYIKSGVYKEYLEIGKKLENIMLVGDGMTKTIITGNKSLGGGVDTFHTATVGVDGQGF  297

Query  300   IAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTV  121
             IA+ ITF+NTAGP+NHQAVALRS +D SVFY+CGFEGYQDTLY HS+RQFY++C IYGT+
Sbjct  298   IARDITFQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGTI  357

Query  120   DFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             DFIFG+AAVV QNCMIY R+P   Q   ITAQGR+ P  N
Sbjct  358   DFIFGDAAVVLQNCMIYVRRPFGSQNNVITAQGRSCPYTN  397



>emb|CDO97716.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   419 bits (1077),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 219/404 (54%), Positives = 285/404 (71%), Gaps = 16/404 (4%)
 Frame = -1

Query  1200  LEMSKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTA  1021
             +  S + L L+  +F +  S +L          +  WC+QTP+P  C+Y+LT + ++   
Sbjct  1     MGFSIVMLLLLFFAFPAISSYSLPT--------IKSWCAQTPYPQPCEYYLTKNPKYGIP  52

Query  1020  PKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL  841
              K KS+F K++ ++ALD + Q++T+A  LG +CRN REKAAW+DCV LYED  L+LN+T+
Sbjct  53    IKGKSDFLKLSLQLALDHSTQSKTNAISLGSKCRNEREKAAWSDCVTLYEDIPLKLNKTV  112

Query  840   DE--KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNN  667
             D   K T  D  TWLS A TNLETC+ GFV+LG S N +P + +  +  LI N LA  N 
Sbjct  113   DPSGKFTSEDVQTWLSAASTNLETCKQGFVDLGASDNAMPSLYDGVLGNLISNALA-TNK  171

Query  666   GSVPKQTYKDGFPAWVSLGDRRLLQASS-PVKPDLVVAKDGSGNYKTIKDALDAAGKRSG  490
             G       KDGFP WVS GDR+LLQ+S+   + ++VVA+DGSGNY+T+ DA+ AA KRSG
Sbjct  172   GYYGGAGNKDGFPGWVSPGDRKLLQSSAQAAQANIVVAQDGSGNYRTVNDAVAAASKRSG  231

Query  489   SGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsg-srsvvggSTTFNSATVAVT  313
             +GRFVI++K G Y+E + IG+K  NIMLVGDG+  T I+G      GGSTT++SATV +T
Sbjct  232   NGRFVIYVKAGTYSETVSIGSK--NIMLVGDGIGKTIITGRKSVGGGGSTTYSSATVGIT  289

Query  312   GDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYI  133
             GDGF+A+GITFRNTAG ++ QAVA RS +DLS +Y+C FEGYQDTLY  SQRQFY +C I
Sbjct  290   GDGFLARGITFRNTAGAKSQQAVAFRSASDLSAYYQCSFEGYQDTLYVFSQRQFYSECDI  349

Query  132   YGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             YGTVDFIFGNAAVVFQNC ++AR        T+TAQGRTDPNQN
Sbjct  350   YGTVDFIFGNAAVVFQNCSLFARN-TPTHTNTLTAQGRTDPNQN  392



>ref|XP_004133929.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN56617.1| hypothetical protein Csa_3G126810 [Cucumis sativus]
Length=509

 Score =   419 bits (1076),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 230/372 (62%), Positives = 274/372 (74%), Gaps = 13/372 (3%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRK-SEFKKMATEIALDTAVQAETHAKRLGP  928
             E+  WCSQTP+P  C+ FL         P    S F ++  E AL+ AV A  +A  LGP
Sbjct  28    EIKNWCSQTPYPAPCEEFLKTKATTKKTPITTKSHFFEILVETALERAVSAHKNALSLGP  87

Query  927   RCRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELG  748
             +CRN++EK AW DCV LY+  I +LN+T   +C+  DA TWLS ALT LETCRTGF ELG
Sbjct  88    KCRNSKEKTAWTDCVDLYDQIITRLNRT-SARCSPADAQTWLSAALTALETCRTGFEELG  146

Query  747   NSRNVLPLISNNNVSQLIGNTLALNNNGS---VPKQTYKDGFPAWVSLGDRRLLQASSPV  577
              S    PL +NN VS+LI + L++N   S       T  DGFP WVS G+R+LLQ+ SP 
Sbjct  147   LSAFGYPLTANN-VSKLISDGLSVNKPASPEGYEPTTMTDGFPTWVSPGNRKLLQSESP-  204

Query  576   KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGD  397
             K D+VVA+DGSGN+KT+KDA+ AA    G GRFVI+IK GVYNENLDI  K KN+M+VGD
Sbjct  205   KADVVVAQDGSGNFKTVKDAISAA---KGGGRFVIYIKSGVYNENLDI--KAKNVMMVGD  259

Query  396   GMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLS  217
             G+  T I+GSRSV GGSTTF SATVAV GDGFIA+ ITFRNTAG +NHQAVALRSG+DLS
Sbjct  260   GIGKTIITGSRSVGGGSTTFRSATVAVDGDGFIARDITFRNTAGAKNHQAVALRSGSDLS  319

Query  216   VFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKIT  37
             VFY+CGFEGYQDTLY +++RQFYK C IYGTVDFIFGNAAVV Q+C I AR P +K  IT
Sbjct  320   VFYRCGFEGYQDTLYVYAERQFYKQCDIYGTVDFIFGNAAVVLQDCNIIARDPPNKT-IT  378

Query  36    ITAQGRTDPNQN  1
             +TAQGR+DPNQN
Sbjct  379   LTAQGRSDPNQN  390



>ref|XP_002510939.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF51541.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=526

 Score =   419 bits (1076),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 207/375 (55%), Positives = 274/375 (73%), Gaps = 11/375 (3%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRC  922
             V  WCSQTPHP+ CKYF+ H R    A K +SEF+K+  ++AL+ A+ A+    +L P+C
Sbjct  31    VTWWCSQTPHPETCKYFIGH-RLQRVALKHRSEFRKITVQVALERALSAQKKVSKLRPKC  89

Query  921   RNAREKAAWADCVKLYEDTILQLNQTLD-------EKCTQFDALTWLSTALTNLETCRTG  763
             ++  ++A W DC KL+ DTI+QLN+TL        + CT FDA TWLSTALTN++TCRTG
Sbjct  90    QDHHQRAVWVDCHKLHSDTIVQLNRTLQGLAAKKKKSCTDFDAQTWLSTALTNIQTCRTG  149

Query  762   FVELGNSRNVLPLISNNNVSQLIGNTLALNNNG-SVPKQTYKDGFPAWVSLGDRRLLQAS  586
              ++   S  ++P++S+N +S+LI N LA+N    SV   + +  FP W S  +RRLLQA 
Sbjct  150   SLDFNVSDFIMPIVSSN-LSKLISNGLAINGVLLSVQNNSIEGLFPRWFSRKERRLLQAP  208

Query  585   SPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIML  406
             S +K +LVVA+DGSG+++T++ A++AA KR    RFVIH+K+GVY EN+++G    NI L
Sbjct  209   S-IKANLVVAQDGSGHFRTVQAAINAAAKRRYGTRFVIHVKKGVYRENIEVGINNNNIWL  267

Query  405   VGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGA  226
             VGDG+R T I+  RSV  G TT++SAT  + G  F+A+GITFRNTAGP   QAVALRS +
Sbjct  268   VGDGLRNTIITSGRSVGAGYTTYSSATAGIDGLRFVARGITFRNTAGPLKGQAVALRSAS  327

Query  225   DLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQ  46
             DLSVFY+C FEGYQDTL+ HSQRQFY++CY+YGT+DFIFGNAAVVFQNC+IY R+P+  Q
Sbjct  328   DLSVFYRCSFEGYQDTLFVHSQRQFYRECYVYGTIDFIFGNAAVVFQNCIIYVRRPLKGQ  387

Query  45    KITITAQGRTDPNQN  1
                ITAQGR DP QN
Sbjct  388   ANMITAQGRNDPFQN  402



>ref|XP_007038414.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOY22915.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=524

 Score =   417 bits (1072),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 216/401 (54%), Positives = 276/401 (69%), Gaps = 14/401 (3%)
 Frame = -1

Query  1179  LFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEF  1000
             L + L SFSS  S AL+     +   +  WCS+TPHP+ CKYF+ H    F AP+  +EF
Sbjct  6     LLIFLISFSSIFSTALA---RGSRSNITWWCSKTPHPEPCKYFMRHGSHRF-APEHMTEF  61

Query  999   KKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE-----  835
             +KM   +ALD AV AE +    G  C +  +KAAW DC+KL+++TILQLN TL       
Sbjct  62    RKMIVRVALDRAVVAEKNVLEFGQSCESRHQKAAWRDCLKLFDNTILQLNLTLQGLETGR  121

Query  834   --KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGS  661
                C+ FDA TWLSTALTN++TC  GF++   S    P I++NN+SQLI N+LA+N    
Sbjct  122   RISCSDFDAQTWLSTALTNIQTCEAGFMDFNVSDFSTP-ITSNNISQLISNSLAVNGV-F  179

Query  660   VPKQTYKDGFPAWVSLGDRRLL-QASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSG  484
             +  + + +  P W+S  DR LL  AS+ VK  LVVAKDGSGN+KT++ ALDAA KR  + 
Sbjct  180   LHMKNHTEVSPGWLSRHDRWLLASASTKVKAHLVVAKDGSGNFKTVQAALDAAAKRRRTS  239

Query  483   RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDG  304
             R +I++K+GVY EN+++ N   NIML+GDGM+ T I+ SRSV  G TT++SAT  + G G
Sbjct  240   RLIIYVKKGVYRENIEVVNTNSNIMLIGDGMKRTIITSSRSVKTGYTTYSSATAGIDGPG  299

Query  303   FIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGT  124
             FIA+ ITF NTAGP   QAVALRS +DLSVFY+C  +GYQDTL  HSQRQFY++CYIYGT
Sbjct  300   FIARDITFSNTAGPTKGQAVALRSASDLSVFYRCAIQGYQDTLMVHSQRQFYRECYIYGT  359

Query  123   VDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             +D IFGNAAVV QNC I+ARKP+  Q   ITAQGR DP QN
Sbjct  360   IDIIFGNAAVVLQNCSIFARKPLKGQANIITAQGRGDPYQN  400



>ref|XP_011010925.1| PREDICTED: pectinesterase-like isoform X2 [Populus euphratica]
Length=518

 Score =   416 bits (1069),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 220/402 (55%), Positives = 282/402 (70%), Gaps = 10/402 (2%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             +K  L ++  SF S  S  LS        E++ WCS+TPHP+ CKY +  +  HF  P +
Sbjct  3     TKFGLSVLFISFCSLFSPTLS---SITYNEIDSWCSKTPHPEPCKYSMKQNPNHFI-PNQ  58

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL--D  838
             + E +K+A E+AL +A+ A+ H +RL P  R  +EK AW  C+  Y  TI +L   L  +
Sbjct  59    EFESRKVAIELALQSALTAQNHHQRLWPTLRIEKEKNAWKHCLNFYNKTIDELILALASN  118

Query  837   EKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLI--SNNNVSQLIGNTLALNNNG  664
              K T F+  TWLS A T LE+C+    +LG S ++L L+   +NNVS+LI N+LAL+N  
Sbjct  119   IKSTNFNTQTWLSAASTYLESCKDTINDLGVSGSMLSLMIFPSNNVSKLITNSLALHNKA  178

Query  663   S-VPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGS  487
             S +  Q+Y+D FP WV   DR+LLQ  SP  PDLVVA+DGSG+Y  IK AL+AA K SG+
Sbjct  179   SSIFPQSYQDDFPTWVKSADRKLLQEPSP-SPDLVVAQDGSGDYSIIKAALEAAEKSSGN  237

Query  486   GRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGD  307
             GRFVI+IK GVY E L+IG KL+NIMLVGDGM  T I+G++S+ GG  TF++ATV V G 
Sbjct  238   GRFVIYIKSGVYKEYLEIGKKLENIMLVGDGMTKTIITGNKSLGGGVDTFHTATVGVDGQ  297

Query  306   GFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYG  127
             GFIA+ ITF+NTAGP+NHQAVALRS +D SVFY+CGFEGYQDTLY HS+RQFY++C IYG
Sbjct  298   GFIARDITFQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYG  357

Query  126   TVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             T+DFIFG+AAVV QNCMIY R+P   Q   ITAQGR+ P  N
Sbjct  358   TIDFIFGDAAVVLQNCMIYVRRPFGSQNNVITAQGRSCPYTN  399



>emb|CDX83392.1| BnaA03g21140D [Brassica napus]
Length=445

 Score =   413 bits (1062),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 218/330 (66%), Positives = 266/330 (81%), Gaps = 10/330 (3%)
 Frame = -1

Query  984  EIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDAL  811
            ++ALD A+ A++HA  LGP+CR+ REKAAW DC+KLY+ T+ ++N+T+D   KC++ DA 
Sbjct  2    KLALDRAILAKSHASTLGPKCRDTREKAAWEDCIKLYDFTVSKINETMDPNVKCSKTDAQ  61

Query  810  TWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGF  631
            TWLSTALTNL+TCR GF+ELG +  VLPL+SNN VS LI NTLA+N          KDGF
Sbjct  62   TWLSTALTNLDTCRAGFLELGVTDIVLPLMSNN-VSNLICNTLAINKVPFNYTPPGKDGF  120

Query  630  PAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVY  451
            P+WV  GDR+LLQ+S+P + + VVAKDGSGN++TIKDA++AA   SGSGRFVI++K+GVY
Sbjct  121  PSWVKPGDRKLLQSSTP-RDNAVVAKDGSGNFRTIKDAINAA---SGSGRFVIYVKQGVY  176

Query  450  NENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNT  271
            +ENL+I  + KN+ML GDG   T I+GSRSV GGSTTFNSATVA  GDGFIA+GITFRNT
Sbjct  177  SENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFIARGITFRNT  234

Query  270  AGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVV  91
            AG  N QAVALRSG+DLSVFY+C FEGYQDTLY HS RQFY+DC +YGTVDFIFGNAA V
Sbjct  235  AGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAV  294

Query  90   FQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             QNC I+AR+P  +   TITAQGR+DPNQN
Sbjct  295  LQNCNIFARRPRSRTN-TITAQGRSDPNQN  323



>emb|CDX95641.1| BnaC03g25220D [Brassica napus]
Length=445

 Score =   413 bits (1062),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 218/330 (66%), Positives = 266/330 (81%), Gaps = 10/330 (3%)
 Frame = -1

Query  984  EIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDAL  811
            ++ALD A+ A++HA  LGP+CR+ REKAAW DC+KLY+ T+ ++N+T+D   KC++ DA 
Sbjct  2    KLALDRAILAKSHASTLGPKCRDTREKAAWEDCIKLYDFTVSKINETMDPNVKCSKTDAQ  61

Query  810  TWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGF  631
            TWLSTALTNL+TCR GF+ELG +  VLPL+SNN VS LI NTLA+N          KDGF
Sbjct  62   TWLSTALTNLDTCRAGFLELGVTDIVLPLMSNN-VSNLICNTLAINKVPFNYTPPGKDGF  120

Query  630  PAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVY  451
            P+WV  GDR+LLQ+S+P + + VVAKDGSGN++TIKDA++AA   SGSGRFVI++K+GVY
Sbjct  121  PSWVKPGDRKLLQSSTP-RDNAVVAKDGSGNFRTIKDAINAA---SGSGRFVIYVKQGVY  176

Query  450  NENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNT  271
            +ENL+I  + KN+ML GDG   T I+GSRSV GGSTTFNSATVA  GDGFIA+GITFRNT
Sbjct  177  SENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFIARGITFRNT  234

Query  270  AGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVV  91
            AG  N QAVALRSG+DLSVFY+C FEGYQDTLY HS RQFY+DC +YGTVDFIFGNAA V
Sbjct  235  AGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAV  294

Query  90   FQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             QNC I+AR+P  +   TITAQGR+DPNQN
Sbjct  295  LQNCNIFARRPRSRTN-TITAQGRSDPNQN  323



>ref|XP_010035022.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Eucalyptus grandis]
Length=525

 Score =   415 bits (1067),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 207/377 (55%), Positives = 277/377 (73%), Gaps = 11/377 (3%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +++RWC  TPHP+ CKYF+ +SR H + PK +SEF+++  ++++D A   + H  + G  
Sbjct  27    DIDRWCKDTPHPEPCKYFVGNSRHHRSPPKDQSEFRQIMVDVSMDQAFNTQWHVLQFGEN  86

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD------EKCTQFDALTWLSTALTNLETCRTG  763
             C   R++  W+ C KLY +TI QLN+T++      + CT FDA TWLSTALTN+  C+ G
Sbjct  87    CTTKRQRQVWSVCTKLYYNTIWQLNRTVEGLGGAHKNCTNFDAQTWLSTALTNIRACQLG  146

Query  762   FVELGNSRNVLPLISNNNVSQLIGNTLALNNN--GSVPKQTYKDGFPAWVSLGDRRLLQA  589
             F +L  S  + P +S N +SQLI NTLA+N     +  +++Y+ GFP+WVS  DR+LLQ 
Sbjct  147   FQDLNVSDFISPALSTN-LSQLISNTLAVNRILLQNEEQESYEGGFPSWVSRHDRKLLQ-  204

Query  588   SSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGS-GRFVIHIKRGVYNENLDIGNKLKNI  412
             SS +K +LVVAKDGSGN++T++ ALDAA KRS +  RF+I++KRGVY EN+++ N   NI
Sbjct  205   SSTIKANLVVAKDGSGNFQTVQAALDAAAKRSSTTARFIIYVKRGVYRENIEVANNNNNI  264

Query  411   MLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRS  232
             +++GDG++YT I+GSRS  GG TT++SAT  + G  FIA+ ITF NTAGP+  QAVALRS
Sbjct  265   LMIGDGVKYTIITGSRSAGGGYTTYSSATAGIDGAKFIARDITFANTAGPQKGQAVALRS  324

Query  231   GADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMD  52
              +DLSVFY C F+GYQDTL+  SQRQFYK CYI+GT+DFIFGNAAVVFQNC IYARKP+ 
Sbjct  325   ASDLSVFYHCAFQGYQDTLWVLSQRQFYKSCYIFGTIDFIFGNAAVVFQNCYIYARKPLH  384

Query  51    KQKITITAQGRTDPNQN  1
              Q   ITAQGR DPNQ+
Sbjct  385   GQANVITAQGRDDPNQS  401



>emb|CDY18944.1| BnaC04g04060D [Brassica napus]
Length=442

 Score =   410 bits (1055),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 216/345 (63%), Positives = 271/345 (79%), Gaps = 16/345 (5%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +V  WC+QTP+P  C+YFLTH+       K +SEF K++ ++AL+ A+ A++H   LGP+
Sbjct  18    DVKAWCTQTPNPKPCEYFLTHNSGQ-KPIKSESEFLKISVKLALERAILAKSHTSTLGPK  76

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDALTWLSTALTNLETCRTGFVEL  751
             CR+ REKAAW DC+KLY+ T+ ++NQT+D   KC++ DA TWLSTALTNL+TCR GF+EL
Sbjct  77    CRDTREKAAWEDCLKLYDVTVSKINQTMDPNVKCSKTDAQTWLSTALTNLDTCRAGFLEL  136

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNN---NGSVPKQTYKDGFPAWVSLGDRRLLQASSP  580
             G +  VLPL+SNN VS LI NTLA+N    N + P+   KDGFP+WV  GDR+LLQ+S+P
Sbjct  137   GVTDIVLPLMSNN-VSNLICNTLAINKVPFNDTPPE---KDGFPSWVKPGDRKLLQSSTP  192

Query  579   VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
              + + VVAKDGSGN++TIKDA++AA   SGSGRFVI++K+GVY+ENL+I  + KN+ML G
Sbjct  193   -RDNAVVAKDGSGNFRTIKDAVNAA---SGSGRFVIYVKQGVYSENLEI--RKKNVMLRG  246

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG   T I+GSRSV GGSTTFNSATVA  GDGF+A+GITFRNTAG  N QAVALRSG+DL
Sbjct  247   DGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFMARGITFRNTAGASNEQAVALRSGSDL  306

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQ  85
             SVFY+C FEGYQDTLY HS RQFY+DC +YGTVDFIFGNA    Q
Sbjct  307   SVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAGAALQ  351



>ref|XP_008376203.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Malus domestica]
Length=531

 Score =   412 bits (1058),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 214/401 (53%), Positives = 282/401 (70%), Gaps = 10/401 (2%)
 Frame = -1

Query  1179  LFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEF  1000
             L  +L  FS F    ++ +    +  +  WC +TPHP+ C Y +++SR HF  PK  SEF
Sbjct  9     LLSILIFFSLFFHTTVARSHHRHSSRIRTWCKKTPHPEPCNYCMSNSRHHFR-PKHTSEF  67

Query  999   KKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE-----  835
             +KM  ++AL+ A+ A T+  + G  C+N +EKA W DC+KL+ +T+ QLN TL+      
Sbjct  68    RKMLVQVALERALSAITYTSQYGQNCQNDKEKAVWTDCLKLFHNTVSQLNXTLEGLGTKL  127

Query  834   KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPL-ISNNNVSQLIGNTLALNNN--G  664
              C+ FDA TWLS ALTN+ETCR G +EL  +  ++P+  SNNNVS+LI N+LA+ +   G
Sbjct  128   NCSNFDAQTWLSAALTNIETCRVGSLELXVTNFIMPIYTSNNNVSELISNSLAIGSQLLG  187

Query  663   SVPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSG  484
             +    T  + FP WVS  DRRLLQA++ ++ +LVVAKDGSGN+ T++ ALDAA +R    
Sbjct  188   TEESYTESEKFPNWVSKHDRRLLQAAN-IRANLVVAKDGSGNFLTVQAALDAAARRRVKS  246

Query  483   RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDG  304
             +F+I++K+GVY EN+ + N    IMLVG G+RYT I+ SRSV GG TT+NSAT  + G G
Sbjct  247   KFIIYVKKGVYTENIQVSNTNSKIMLVGAGIRYTVITSSRSVSGGYTTYNSATAGINGPG  306

Query  303   FIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGT  124
             FIA+GITFRNTAG    QAVAL S +DLSVFY+C F+GYQDTL  HSQRQFY++CYI+GT
Sbjct  307   FIARGITFRNTAGQLKGQAVALMSASDLSVFYRCAFQGYQDTLMVHSQRQFYRECYIFGT  366

Query  123   VDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             +DFIFGNAA VFQNC+IY RKP+  Q   ITAQGR DP QN
Sbjct  367   IDFIFGNAAAVFQNCIIYVRKPLWGQVNVITAQGRNDPFQN  407



>emb|CDX74715.1| BnaA05g04610D [Brassica napus]
Length=445

 Score =   408 bits (1048),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 218/333 (65%), Positives = 267/333 (80%), Gaps = 16/333 (5%)
 Frame = -1

Query  984  EIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KCTQFDAL  811
            ++AL+ A+ A++H   LGP+CR+ REKAAW DC+KLY+ T+ ++N+T+D   KC++ DA 
Sbjct  2    KLALERAILAKSHTSTLGPKCRDTREKAAWEDCLKLYDVTVSKINETMDPNVKCSKTDAQ  61

Query  810  TWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN---NGSVPKQTYK  640
            TWLSTALTNL+TCR GF+ELG +  VLPL+SNN VS LI NTLA+N    N + P+   K
Sbjct  62   TWLSTALTNLDTCRAGFLELGVTDIVLPLMSNN-VSSLICNTLAINKVPFNYTPPE---K  117

Query  639  DGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKR  460
            DGFP+WV  GDR+LLQ+S+P   + VVAKDGSGN++TIKDA++AA   SGSGRFVI++K+
Sbjct  118  DGFPSWVKPGDRKLLQSSTP-GDNAVVAKDGSGNFRTIKDAVNAA---SGSGRFVIYVKQ  173

Query  459  GVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITF  280
            GVY+ENL+I  + KN+ML GDG   T I+GSRSV GGSTTFNSATVA  GDGF+A+GITF
Sbjct  174  GVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFMARGITF  231

Query  279  RNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNA  100
            RNTAG  N QAVALRSG+DLSVFY+C FEGYQDTLY HS RQFY+DC IYGTVDFIFGNA
Sbjct  232  RNTAGASNEQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDIYGTVDFIFGNA  291

Query  99   AVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
            A V QNC I+AR+P  K   TITAQGR+D NQN
Sbjct  292  AAVLQNCNIFARRPRSKTN-TITAQGRSDQNQN  323



>ref|XP_009799202.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Nicotiana sylvestris]
Length=556

 Score =   411 bits (1057),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 217/404 (54%), Positives = 282/404 (70%), Gaps = 14/404 (3%)
 Frame = -1

Query  1179  LFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEF  1000
             +  +L SFS F+  + S+     + ++N WCS TPHP+ CKYF+         PK K EF
Sbjct  32    VLFILFSFSLFLHESYSIEE-QPSDDINWWCSTTPHPEPCKYFMADVAPERYKPKCKEEF  90

Query  999   KKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL------D  838
             + M TE+AL+ A+  ++HAK +G  CR  R+K  W DC KL +DTILQLN+TL       
Sbjct  91    RTMTTEVALEQALLVQSHAKYMGQHCRGKRKKLVWMDCDKLIDDTILQLNRTLHGIQSNS  150

Query  837   EKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSV  658
               C+ FDA TWLS +LTN+ETC +G  +L N  NVL    + NVSQLI N LA+N    V
Sbjct  151   TSCSDFDAQTWLSASLTNIETCLSGSNQL-NVSNVLHPTLSTNVSQLISNCLAINGE-LV  208

Query  657   PKQ--TYKDGFPAWVSLGDRRLLQA---SSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS  493
               Q  T  DGFP+WV+  +R+LLQ+   S   K   VVA+DGSGN+++++ A++A  K+ 
Sbjct  209   DSQNSTQVDGFPSWVTARERKLLQSKTRSLASKAIYVVAQDGSGNFRSVQAAINAVSKKV  268

Query  492   GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVT  313
              + R +I+IK+GVY EN+ IG  +  IMLVG G+RYT I+GSRS  GG TT+++ATV V 
Sbjct  269   TNQRTIIYIKKGVYRENVAIGPGISKIMLVGAGLRYTIITGSRSAAGGFTTYSTATVGVD  328

Query  312   GDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYI  133
             G+GFIA+GITFRNTAGP+N QAVALRS +DLSVFY CGFEGYQDT++  SQRQF+K C+I
Sbjct  329   GNGFIARGITFRNTAGPKNGQAVALRSASDLSVFYACGFEGYQDTIFVQSQRQFFKTCHI  388

Query  132   YGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             YGT+DFIFGNAAVVFQNC+I+ R+P+  Q   ITAQGR DP QN
Sbjct  389   YGTIDFIFGNAAVVFQNCVIFVRRPLVGQVNVITAQGRGDPFQN  432



>emb|CBI24285.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   407 bits (1046),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 213/317 (67%), Positives = 258/317 (81%), Gaps = 10/317 (3%)
 Frame = -1

Query  936  LGPRCRNAREKAAWADCVKLYEDTILQLNQTLD--EKCTQFDALTWLSTALTNLETCRTG  763
            LG +CRN REKAAW DCV+LY+ TIL+LN+TLD   +CTQ DA TWLSTALTNL+TC+ G
Sbjct  10   LGSKCRNEREKAAWNDCVELYDHTILKLNKTLDPNTRCTQVDAQTWLSTALTNLQTCQDG  69

Query  762  FVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP--KQTYKDGFPAWVSLGDRRLLQA  589
            F+ELG S + LPLISNN VS+LI NTL++N    VP  + +YK G+P WV  GDR+LLQ+
Sbjct  70   FIELGVSDHFLPLISNN-VSKLISNTLSINK---VPYAEPSYKGGYPTWVKPGDRKLLQS  125

Query  588  SS-PVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNI  412
            SS   + ++VV+KDGSG+Y TI  A+ AA KRSGSGR+VI++K G Y+EN+ IG+ LKNI
Sbjct  126  SSLASQANIVVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGLKNI  185

Query  411  MLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRS  232
             L+GDG+  T ++GSRSV GGSTT+NSATVAV GDGFIA+G+T RNTAG  NHQAVALRS
Sbjct  186  TLLGDGIGKTIVTGSRSVGGGSTTYNSATVAVVGDGFIARGMTIRNTAGASNHQAVALRS  245

Query  231  GADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMD  52
            G+DLSV+Y+C FEGYQDTLY +S RQFY++C IYGTVDFIFGNAAVVFQ C IYAR P +
Sbjct  246  GSDLSVYYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQKCNIYARNPPN  305

Query  51   KQKITITAQGRTDPNQN  1
            K   T+TAQGRTDPNQN
Sbjct  306  KVN-TVTAQGRTDPNQN  321



>ref|XP_009609130.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Nicotiana tomentosiformis]
Length=534

 Score =   410 bits (1053),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 212/379 (56%), Positives = 271/379 (72%), Gaps = 13/379 (3%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             ++N WCS TPHP+ CKY +         PK K EF+ M TE+AL+ A+Q + HAK +G  
Sbjct  34    DINWWCSTTPHPEPCKYLMADVSPQRYKPKCKQEFRTMTTEVALEQALQVQKHAKNVGQH  93

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD------EKCTQFDALTWLSTALTNLETCRTG  763
             CR  R+K  W DC KL +DTILQLN+TL         C+ FDA TWLS +LTN+ETC + 
Sbjct  94    CRGKRKKLVWMDCDKLIDDTILQLNRTLHGIQSNFTSCSDFDAQTWLSASLTNIETCLSS  153

Query  762   FVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ--TYKDGFPAWVSLGDRRLLQA  589
               +L N  NVL    + NVSQLI N LA+N    V  Q  T  DGFP+WV+  +R+LLQ+
Sbjct  154   SNQL-NVSNVLHPTLSTNVSQLISNCLAINGE-LVDSQNSTQVDGFPSWVTARERKLLQS  211

Query  588   SS---PVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLK  418
             ++     K   VVA+DGSGN+++++ A++AA K+  + R +I+IK+GVY EN+ IG  + 
Sbjct  212   TTRSLASKAIYVVAQDGSGNFRSVQAAINAASKKVANQRTIIYIKKGVYRENVAIGPGIS  271

Query  417   NIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVAL  238
             NIMLVG G+RYT I+GSRS  GG TT+++ATV V G+GFIA+GITFRNTAGP+N QAVAL
Sbjct  272   NIMLVGAGLRYTIITGSRSAAGGFTTYSTATVGVDGNGFIARGITFRNTAGPKNGQAVAL  331

Query  237   RSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKP  58
             RS +DLSVFY CGFEGYQDT++  SQRQFYK C+IYGT+DFIFGNAAVVFQNC+I+ R+P
Sbjct  332   RSASDLSVFYACGFEGYQDTIFVQSQRQFYKTCHIYGTIDFIFGNAAVVFQNCIIFVRRP  391

Query  57    MDKQKITITAQGRTDPNQN  1
             +  Q   ITAQGR DP QN
Sbjct  392   LVGQVNVITAQGRGDPFQN  410



>ref|XP_004234933.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Solanum lycopersicum]
Length=533

 Score =   410 bits (1053),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 215/381 (56%), Positives = 271/381 (71%), Gaps = 14/381 (4%)
 Frame = -1

Query  1113  AAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRL  934
             +A ++N WCS+TPHPD C +F++        PK KSEF+ M  ++A+D  +Q + HAK +
Sbjct  33    SAHDINWWCSKTPHPDPCNHFMSSGD---VQPKNKSEFRTMTVQVAMDHVIQVQNHAKNV  89

Query  933   GPRCRNAREKAAWADCVKLYEDTILQLNQTLD----EKCTQFDALTWLSTALTNLETCRT  766
               +CR  R+K  W DC KL +DTILQL+++LD       + FDA TWLS +LTN+ETC +
Sbjct  90    SQKCRGKRKKLVWMDCEKLMDDTILQLSRSLDGIKSNSSSDFDAQTWLSASLTNIETCLS  149

Query  765   GFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYK-DGFPAWVSLGDRRLLQA  589
             G  +L N  N+L    + NVSQLI N LA+N      + T +  GFP W+S  +R+LLQ 
Sbjct  150   GSNDL-NVSNILQPNLSTNVSQLISNCLAVNGEFMDAENTTQVGGFPNWLSNRERKLLQT  208

Query  588   SS----PVKPDLVVAKDGSGNYKTIKDALD-AAGKRSGSGRFVIHIKRGVYNENLDIGNK  424
             SS      K + VVAKD SG +++I+ A++ AA KR G+ R VI+IKRGVY EN+ +G  
Sbjct  209   SSIDLMATKANYVVAKDKSGRFRSIQAAINYAASKRVGNERIVIYIKRGVYKENILVGPT  268

Query  423   LKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAV  244
             +  IMLVGDG+RYT I+GSRSV  G TT+++ATV V G GFIA+GITFRNTAGP+N QAV
Sbjct  269   MGKIMLVGDGLRYTIITGSRSVAAGFTTYSTATVGVDGIGFIARGITFRNTAGPQNGQAV  328

Query  243   ALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYAR  64
             ALRS +DLSVFY CGFEGYQDTL+  SQRQFYK CYIYGT+DFIFGNAAVVFQNCMIY R
Sbjct  329   ALRSASDLSVFYACGFEGYQDTLFVQSQRQFYKSCYIYGTIDFIFGNAAVVFQNCMIYVR  388

Query  63    KPMDKQKITITAQGRTDPNQN  1
             KP+  Q   ITAQGR DP QN
Sbjct  389   KPLWGQVNVITAQGRNDPFQN  409



>ref|XP_006367817.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59-like 
[Solanum tuberosum]
Length=533

 Score =   408 bits (1048),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 211/378 (56%), Positives = 269/378 (71%), Gaps = 14/378 (4%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             ++N WCS+TPHPD C +F++        PK  SEF+ M  ++A+D  +Q ++HAK +   
Sbjct  36    DINWWCSKTPHPDPCNHFMSSGD---IKPKNNSEFRTMTVQVAMDHVIQVQSHAKNVSQN  92

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD----EKCTQFDALTWLSTALTNLETCRTGFV  757
             CR  R+K  W DC KL +DTILQL+++LD       + FDA TWLS +LTN+ETC +G +
Sbjct  93    CRGKRKKLVWMDCEKLMDDTILQLSRSLDGIKSNSSSDFDAQTWLSASLTNIETCLSGSI  152

Query  756   ELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYK-DGFPAWVSLGDRRLLQASS-  583
             +L N  N+L    + NVSQLI N LA+N      + T +  GFP W++  +R+LLQ SS 
Sbjct  153   DL-NVSNILQPNLSTNVSQLISNCLAVNGEFMDAENTTQVGGFPNWLTNTERKLLQTSSI  211

Query  582   ---PVKPDLVVAKDGSGNYKTIKDALD-AAGKRSGSGRFVIHIKRGVYNENLDIGNKLKN  415
                  K + VVAKD SG +++I+ A++ AA KR G+ R VI+IKRGVY EN+ +G  +  
Sbjct  212   DLMATKANYVVAKDKSGRFRSIQTAINYAASKRVGNERIVIYIKRGVYKENILVGPTMGK  271

Query  414   IMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALR  235
             IMLVGDG+RYT I+GSRSV  G TT+++ATV V G GF+A+GITFRNTAGP+N QAVALR
Sbjct  272   IMLVGDGLRYTIITGSRSVAAGFTTYSTATVGVDGIGFVARGITFRNTAGPQNGQAVALR  331

Query  234   SGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPM  55
             S +DLSVFY CGFEGYQDTL+  SQRQFYK CYIYGT+DFIFGNAAVVFQNCMIY RKP+
Sbjct  332   SASDLSVFYACGFEGYQDTLFVQSQRQFYKSCYIYGTIDFIFGNAAVVFQNCMIYVRKPL  391

Query  54    DKQKITITAQGRTDPNQN  1
               Q   ITAQGR DP QN
Sbjct  392   WGQVNVITAQGRNDPFQN  409



>ref|XP_007220716.1| hypothetical protein PRUPE_ppa022308mg [Prunus persica]
 gb|EMJ21915.1| hypothetical protein PRUPE_ppa022308mg [Prunus persica]
Length=479

 Score =   405 bits (1040),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 204/357 (57%), Positives = 265/357 (74%), Gaps = 9/357 (3%)
 Frame = -1

Query  1050  LTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYE  871
             ++HSR H   PK  SEF+KM  ++AL+ A+ A+++A + G  C+N ++KAAWADC+KL+E
Sbjct  1     MSHSR-HRLVPKHTSEFRKMMVQVALERALNAKSYASQFGQNCQNNQQKAAWADCLKLFE  59

Query  870   DTILQLNQTLD-----EKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPL-ISNNN  709
             DT+ QLN TL+       C+ FDA TWLS ALTN+ TC+ G +EL  S  + P+  SNNN
Sbjct  60    DTVHQLNITLEGLGTKRNCSNFDAQTWLSAALTNIHTCQVGSMELNVSDFIAPIYTSNNN  119

Query  708   VSQLIGNTLALNNNGSVPKQTYKDG-FPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYK  532
             VS+LI N LA+ +     ++ Y D  +P WVS  +RRLLQAS  +K +LVVAKDGSG+++
Sbjct  120   VSELISNGLAIGSQLLGTEENYADEEYPNWVSKHERRLLQASK-IKANLVVAKDGSGHFR  178

Query  531   TIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvg  352
             T++ A+DAA KR  + RF+IH+K+GVY EN+++ N   NIML+G  MRYT I+ SRSV G
Sbjct  179   TVQAAIDAAAKRKITSRFIIHVKKGVYRENIEVSNTNNNIMLIGASMRYTIITASRSVNG  238

Query  351   gSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLY  172
             GSTT+NSAT  + G GFIA+GITF NTAGP   QAVALRS +DLSVFY+C F+GYQDTL 
Sbjct  239   GSTTYNSATAGIDGPGFIARGITFSNTAGPLKGQAVALRSASDLSVFYRCAFQGYQDTLM  298

Query  171   AHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
              HSQRQFY++CYIYGT+DFIFGNAA VFQ+C+IY R+P+  Q   ITAQ R DP QN
Sbjct  299   VHSQRQFYRECYIYGTIDFIFGNAAAVFQSCIIYVRRPLKGQVNVITAQARNDPYQN  355



>ref|XP_010277646.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=521

 Score =   405 bits (1041),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 219/405 (54%), Positives = 281/405 (69%), Gaps = 21/405 (5%)
 Frame = -1

Query  1182  HLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSE  1003
             H  L     S  +S++LS + P     +  WCSQTP+P  C+ ++ H  R  +  K  S+
Sbjct  4     HQLLTFVLISVLVSLSLSDDIPP---NIKTWCSQTPYPQYCEDYMAHDSRS-SGLKSHSD  59

Query  1002  FKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE--KC  829
             FKK+A +I LD A+QA+++ +   P+  N REKAAWADC +LY++TI +LN T++    C
Sbjct  60    FKKLAMQITLDQAIQAKSNNRLHEPKFSNGREKAAWADCTELYQNTIARLNLTVNPCAMC  119

Query  828   TQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ  649
             T +D  TWLSTALTNLETCRT  +ELG S N+  L+SNN VS LI N LA+N     PK+
Sbjct  120   TDYDVQTWLSTALTNLETCRTSVMELGVSDNIFSLVSNN-VSNLIINALAINK--PPPKE  176

Query  648   -TYKDGFPAWVSLGDRRLLQ---ASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSG-  484
              T+ DGFP W S  DR+LLQ    S   K DLVVA+DGSGN+KT+ +A++   K + SG 
Sbjct  177   ETFDDGFPTWASPRDRKLLQMERTSLAWKADLVVAQDGSGNFKTVSEAINEVAKWNPSGV  236

Query  483   ----RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAV  316
                 R V+H+K G+Y E++ +     N+M  GDG+  T I+GS SV GG+TTFNSAT+AV
Sbjct  237   GPGRRHVVHMKAGIYQEHMQV--YTPNMMFTGDGIGKTVITGSMSVGGGATTFNSATIAV  294

Query  315   TGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCY  136
              GDGFIA+ ITF+NTAGP+NHQAVALRSG+D SVFY+C FEGYQDTLY HS RQFYK C 
Sbjct  295   MGDGFIARDITFQNTAGPQNHQAVALRSGSDASVFYRCSFEGYQDTLYVHSNRQFYKQCD  354

Query  135   IYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             IYGTVDFIFGNAA V Q+C IYARKP+    + +TAQGR + NQ+
Sbjct  355   IYGTVDFIFGNAAAVLQDCNIYARKPI-AGTVVVTAQGRLNANQS  398



>ref|XP_011010932.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Populus euphratica]
Length=524

 Score =   404 bits (1037),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 212/404 (52%), Positives = 277/404 (69%), Gaps = 13/404 (3%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             +KI L   L  FSS  S A S    +    +  WC+QTPHP  CKYF++HS  HF A K 
Sbjct  3     TKIRLLATLIVFSSIFSFAAS---KSTKSNITWWCNQTPHPSTCKYFMSHSHHHF-ALKH  58

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE-  835
             +SEF+ M+ ++AL  A+ A+    +LG    + +++  W DC+KL+ +TILQLN+TL   
Sbjct  59    RSEFRLMSVKLALKKALIAQRQVSQLGQNYEHQQQRVVWTDCLKLHSNTILQLNRTLRGI  118

Query  834   -----KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN  670
                  +CT  DA TWLSTALTN++TCRTG ++L  S   +P +S N +S+LI NTLA+N 
Sbjct  119   RKKRLRCTDLDAQTWLSTALTNIQTCRTGSLDLNVSDFTMPAMSKN-LSELISNTLAING  177

Query  669   NGSVPKQTYKDGFPAWVSLGDRRLLQASS-PVKPDLVVAKDGSGNYKTIKDALDAAGKRS  493
                    T ++ FP W S  +RRLLQ++S     +LVVAKDGSG +++++ A++AA KR 
Sbjct  178   VLLQDNNTVQE-FPRWFSRPNRRLLQSASITAMANLVVAKDGSGKFRSVQAAINAASKRR  236

Query  492   GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVT  313
                R +IH+KRGVY EN+ +G    NI LVGDGMR T I+ SRSV GG TT++SAT  + 
Sbjct  237   YKTRLIIHVKRGVYKENIAVGVNNNNIWLVGDGMRNTIITSSRSVGGGYTTYSSATAGID  296

Query  312   GDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYI  133
             G  F+A+GITF NTAGP   QAVALRS +DLSVFY+C F+GYQDTL+ HSQRQFY++CYI
Sbjct  297   GLRFVARGITFSNTAGPLKGQAVALRSASDLSVFYRCSFQGYQDTLFVHSQRQFYRECYI  356

Query  132   YGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             YGT+DFIFGNAAVVFQN +I  R+P+  Q   ITAQGR DP QN
Sbjct  357   YGTIDFIFGNAAVVFQNSIILVRRPLKGQANMITAQGRNDPFQN  400



>ref|XP_006401969.1| hypothetical protein EUTSA_v10013189mg [Eutrema salsugineum]
 gb|ESQ43422.1| hypothetical protein EUTSA_v10013189mg [Eutrema salsugineum]
Length=542

 Score =   402 bits (1032),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 209/387 (54%), Positives = 267/387 (69%), Gaps = 23/387 (6%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGP  928
              +++WC++TP+PD CK YF  H+   F  P++ SEF+ +  E A+D A+ A     + G 
Sbjct  35    SIDQWCNKTPYPDPCKHYFKNHN--GFRLPRQLSEFRVLLVEAAMDRAISARDKLTQFGK  92

Query  927   RCRNAREKAAWADCVKLYEDTILQLNQTLD---------EKCTQFDALTWLSTALTNLET  775
              C + R++A   DC+ LY DT+LQLN TL          ++CT FDA TWLSTALTN ET
Sbjct  93    NCTDCRKQAVLTDCIDLYGDTVLQLNWTLQGLSPKAHAGKRCTDFDAQTWLSTALTNTET  152

Query  774   CRTGFVELGNSRNVLPLISNNNVSQLIGNTLALN-------NNGSVPKQTYKDGFPAWVS  616
             CR G  +L  S    P++SN  +S LI N LA+N       NNGS     Y+ GFPAW+S
Sbjct  153   CRRGSSDLNVSDFTTPIVSNTKISNLISNCLAVNGALLTAANNGSA--TAYRKGFPAWIS  210

Query  615   LGDRRLLQASSP--VKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNEN  442
               +RRLLQ  S   VK +LVVA+DG G+++T++ A++ AG+R    RFVI++KRG+Y EN
Sbjct  211   GKERRLLQLQSARGVKANLVVARDGRGHFRTVQAAINWAGRRRVKSRFVIYVKRGIYQEN  270

Query  441   LDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGP  262
             +++     NIMLVGDGMRYT I+G RSV GG TT++SAT  + G  FIA+GITFRNTAGP
Sbjct  271   INVRLNNDNIMLVGDGMRYTIITGGRSVKGGYTTYSSATAGIEGLHFIAKGITFRNTAGP  330

Query  261   ENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQN  82
                QAVALRS +DLS+FY+C  EGYQDTL  HSQRQFY++CYIYGTVDFIFGNAAVVFQN
Sbjct  331   AKGQAVALRSSSDLSIFYRCAIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAAVVFQN  390

Query  81    CMIYARKPMDKQKITITAQGRTDPNQN  1
             C+I  R+P+  Q   ITAQGR DP QN
Sbjct  391   CLILPRRPLKGQANVITAQGRADPFQN  417



>ref|XP_009627971.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Nicotiana tomentosiformis]
Length=530

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 208/380 (55%), Positives = 269/380 (71%), Gaps = 14/380 (4%)
 Frame = -1

Query  1110  AGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLG  931
             + ++N WCS+TPHP+ CKYF++        P+ KSEF+ M  ++ALD  +Q + HAK + 
Sbjct  31    SNDINWWCSKTPHPEPCKYFMSGDS---FKPQNKSEFRTMTVQVALDHVIQVQAHAKNVS  87

Query  930   PRCRNAREKAAWADCVKLYEDTILQLNQTLD----EKCTQFDALTWLSTALTNLETCRTG  763
               CR  R++  W DC KL +DT+LQLN++LD       + FDA TWLS ++TN+ETC +G
Sbjct  88    QYCRGKRKQLVWMDCDKLMDDTVLQLNRSLDGIKSNSSSDFDAQTWLSASMTNIETCLSG  147

Query  762   FVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYK-DGFPAWVSLGDRRLLQAS  586
               +L N  N+L    + NVSQLI N LA+N      + T +  GFP W++  +R LL +S
Sbjct  148   SNDL-NVSNILQPNLSTNVSQLISNCLAMNGEFVDWENTTQVGGFPNWLTASERVLLHSS  206

Query  585   S----PVKPDLVVAKDGSGNYKTIKDALD-AAGKRSGSGRFVIHIKRGVYNENLDIGNKL  421
             S      K + VVAKD SG++++I+ A++ A  +R G+ R VI+IKRGVY EN+ IG  +
Sbjct  207   SIDLMATKANYVVAKDRSGHFRSIQSAINYATSRRVGNQRIVIYIKRGVYRENILIGPTM  266

Query  420   KNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVA  241
               IMLVGDG+RYT I+GSRSV  G TT+++AT+ V G GFIA+GITFRNTAGP+N QAVA
Sbjct  267   GKIMLVGDGLRYTVITGSRSVAAGYTTYSTATLGVDGIGFIARGITFRNTAGPQNGQAVA  326

Query  240   LRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARK  61
             LRS +DLSVFY CGFEGYQDTL+  SQRQFYK CYIYGT+DFIFGNAAVVFQNCMIY R+
Sbjct  327   LRSASDLSVFYGCGFEGYQDTLFVQSQRQFYKSCYIYGTIDFIFGNAAVVFQNCMIYVRR  386

Query  60    PMDKQKITITAQGRTDPNQN  1
             P+  Q   ITAQGR DP QN
Sbjct  387   PLWGQVNVITAQGRNDPFQN  406



>ref|XP_010062172.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Eucalyptus grandis]
Length=543

 Score =   400 bits (1027),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 211/413 (51%), Positives = 282/413 (68%), Gaps = 18/413 (4%)
 Frame = -1

Query  1185  IHLF-LVLASFSSFISVALSVNPP------AAAGEVNRWCSQTPHPDQCKYFLTHSR-RH  1030
             IHL  L+   F+S      S   P      A  G+++ WC  TPHP  CKYF++H+R  H
Sbjct  7     IHLLVLIFIFFASTPFTTSSAQTPDDSNTNAPTGDIDWWCDTTPHPQPCKYFVSHARGNH  66

Query  1029  FTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLN  850
             +     +S F+K+A ++A   A  A      L     N R+++ W DC+KL+++T+LQLN
Sbjct  67    YNTSMPRSGFRKIAVDVATQHAFNAYKQILHLRSDLVNHRQRSVWVDCLKLHDNTLLQLN  126

Query  849   QTL------DEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGN  688
             +TL      ++ CT FD  TWLSTALTN+ETCR G  +L  S +++   S+ N+SQL+ N
Sbjct  127   RTLQGLLGLNQTCTDFDIQTWLSTALTNIETCRLGSQDLNVSDSIMMPTSSANLSQLLSN  186

Query  687   TLALNNN--GSVPKQTYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDA  517
             +LA+N    GS   +T  + FP+W +  +R+LLQ++S V + +LVVAKDGSGN++T+++A
Sbjct  187   SLAINEGLLGSDQPRTEYEEFPSWFTNHERKLLQSTSLVTRANLVVAKDGSGNFRTVQEA  246

Query  516   LDAAGKRSG-SGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTT  340
             + AA KRS  + RF+I++K+GVY EN+++G    NIMLVGD MR T I+ SRSV  G TT
Sbjct  247   IAAAAKRSSMNSRFIIYVKKGVYRENIEVGINNNNIMLVGDSMRNTVITSSRSVGRGFTT  306

Query  339   FNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQ  160
             ++SAT  + G  FIA+ ITF NTAGP   QAVALRS +DLSVFY+C  +GYQDTL+ HSQ
Sbjct  307   YSSATAGIDGLRFIARDITFSNTAGPLRGQAVALRSASDLSVFYRCAIQGYQDTLFVHSQ  366

Query  159   RQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             RQFY+ CYIYGTVDFIFGNAAVVFQNCMIYAR+P+  Q   ITAQGR DP QN
Sbjct  367   RQFYRQCYIYGTVDFIFGNAAVVFQNCMIYARRPLKGQANIITAQGRNDPFQN  419



>ref|XP_008354203.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Malus domestica]
Length=534

 Score =   399 bits (1025),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 208/376 (55%), Positives = 270/376 (72%), Gaps = 10/376 (3%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
              +  WC +TPHP+ C Y L++S   F  PK  SEF+KM  ++AL+ A+ A T+  + G  
Sbjct  37    RIRTWCRKTPHPESCNYCLSNSIHRF-PPKHTSEFRKMLVQVALERALDAITYTFQYGQN  95

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD-----EKCTQFDALTWLSTALTNLETCRTGF  760
             CRN  EK+AWADC+ L+E+T+ QLN TL+      KC+ FDA TWLS ALTN+ TCR G 
Sbjct  96    CRNNNEKSAWADCLXLFENTVNQLNVTLEGLGNKRKCSNFDAQTWLSAALTNIHTCRVGS  155

Query  759   VELGNSRNVLPLI-SNNNVSQLIGNTLALNNNGSVPKQTYKDG--FPAWVSLGDRRLLQA  589
             +EL  +  + P+  S+NNVS+LI N+LA+ +     +++Y +   FP WVS  DRRLLQA
Sbjct  156   LELNVTDFITPIYRSSNNVSELISNSLAIGSQLLGTEESYNESEKFPNWVSKHDRRLLQA  215

Query  588   SSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIM  409
             S+ ++ +LVVAKDGSG + T++ ALDAA +R    +F+I++K+GVY EN+ + N    IM
Sbjct  216   SN-IRANLVVAKDGSGXFSTVQAALDAAARRRVKSKFIIYVKKGVYXENIQVSNTNSKIM  274

Query  408   LVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSG  229
             LVG G+RYT I+ SRSV  G TT+NSAT  + G GFIA+GITF NTAGP   QAVALRS 
Sbjct  275   LVGAGIRYTIITSSRSVSEGYTTYNSATAGINGXGFIARGITFSNTAGPLKGQAVALRSA  334

Query  228   ADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDK  49
             +DLSVFY+C F+GYQDTL  +SQRQFY++CYI+GT+DFIFGNAA VFQNCMIY RKP+  
Sbjct  335   SDLSVFYRCAFQGYQDTLMVYSQRQFYRECYIFGTIDFIFGNAAAVFQNCMIYVRKPLWG  394

Query  48    QKITITAQGRTDPNQN  1
             Q   ITAQGR DP QN
Sbjct  395   QVNVITAQGRNDPFQN  410



>ref|XP_011101124.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Sesamum indicum]
Length=527

 Score =   398 bits (1023),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 215/412 (52%), Positives = 279/412 (68%), Gaps = 21/412 (5%)
 Frame = -1

Query  1200  LEMSKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTA  1021
             + +  IH+F    SF  F S+   V        ++ WCS TPHP  C YF+         
Sbjct  1     MSIITIHIFF-FVSFLCFYSLLADVE--TTNNGIDWWCSTTPHPAPCTYFMAQ-----LT  52

Query  1020  PKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL  841
             PK + EF+ M  + ALD AV A T A  +G RCR+ R+     DC  L E+TILQLN TL
Sbjct  53    PKSREEFRTMTIQAALDRAVHAHTQANNVGSRCRSKRKTIVNRDCNNLIENTILQLNTTL  112

Query  840   -----DEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLA-  679
                  +   T FDA TWLSTALTN+E CR+G ++L  ++   P++S N VS+LI N+LA 
Sbjct  113   QSIQTNASFTNFDAQTWLSTALTNIEICRSGSLDLNVTKFSSPILSGN-VSELISNSLAT  171

Query  678   ----LNNNGSVPKQTYKDGFPAWVSLGDRRLLQ-ASSPVKPDLVVAKDGSGNYKTIKDAL  514
                 L+N+ S    + ++G+PAWVS  DR LLQ      + +++VAKDGSG++++I+ A+
Sbjct  172   NGGLLDNSSSSYHSSDENGYPAWVSGRDRELLQDLELASRANVIVAKDGSGHFRSIQAAI  231

Query  513   D-AAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTF  337
             + A  +R G+GR V+++KRGVY EN+ I   +  +MLVGDG+RYT I+GSRSV  G TT+
Sbjct  232   NYATARRVGNGRVVVYVKRGVYRENILISRTMNKVMLVGDGLRYTVITGSRSVSTGFTTY  291

Query  336   NSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQR  157
             +SATV + G GFIA+GITFRNTAGP+  QAVALRS +DLSVFY CGFEGYQDTL+ H+QR
Sbjct  292   SSATVGIDGIGFIARGITFRNTAGPQKGQAVALRSASDLSVFYACGFEGYQDTLFVHAQR  351

Query  156   QFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             QFYK CYIYGT+DFIFGNAAVVFQNC+IY R+P+  Q   ITAQGR DP QN
Sbjct  352   QFYKACYIYGTIDFIFGNAAVVFQNCIIYVRRPLVGQANVITAQGRGDPFQN  403



>ref|XP_009773839.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
isoform X1 [Nicotiana sylvestris]
Length=530

 Score =   396 bits (1017),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 205/380 (54%), Positives = 268/380 (71%), Gaps = 14/380 (4%)
 Frame = -1

Query  1110  AGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLG  931
             + ++N WCS+TPHP+ CKYF++        P+ KSEF+ M  ++ALD  +Q + HAK + 
Sbjct  31    SNDINWWCSKTPHPEPCKYFMSGDS---FKPQNKSEFRTMTVQVALDHVIQVQAHAKNVS  87

Query  930   PRCRNAREKAAWADCVKLYEDTILQLNQTLD----EKCTQFDALTWLSTALTNLETCRTG  763
               CR  R++  W DC KL +DT+LQLN++LD       + FDA TWLS ++TN+ETC +G
Sbjct  88    QHCRGKRKQLVWMDCDKLMDDTVLQLNRSLDGIKSNSSSDFDAQTWLSASMTNIETCLSG  147

Query  762   FVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYK-DGFPAWVSLGDRRLLQAS  586
               +L N  N+L    + NVSQLI N LA+N      + T +  GFP W++  +R LL +S
Sbjct  148   SNDL-NVSNILQPNLSTNVSQLISNCLAMNGEFVDWENTTQVGGFPNWLTASERVLLHSS  206

Query  585   S----PVKPDLVVAKDGSGNYKTIKDALD-AAGKRSGSGRFVIHIKRGVYNENLDIGNKL  421
             S      + + VVAKD SG++++I+ A++ A  +R G+ R VI+IKRGVY EN+ IG  +
Sbjct  207   SIDLMATRANYVVAKDRSGHFRSIQAAINYATSRRVGNQRIVIYIKRGVYRENILIGPTM  266

Query  420   KNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVA  241
               IMLVG G+RYT I+GSRSV  G TT+++AT+ V G GFIA+G+TFRNTAGP+N QAVA
Sbjct  267   GKIMLVGAGLRYTVITGSRSVAAGYTTYSTATLGVDGIGFIARGMTFRNTAGPQNGQAVA  326

Query  240   LRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARK  61
             LRS +DLSVFY CGFEGYQDTL+  SQRQFYK CYIYGT+DFIFGNAAVVFQNCMIY R+
Sbjct  327   LRSASDLSVFYGCGFEGYQDTLFVQSQRQFYKSCYIYGTIDFIFGNAAVVFQNCMIYVRR  386

Query  60    PMDKQKITITAQGRTDPNQN  1
             P+  Q   ITAQGR DP QN
Sbjct  387   PLWGQVNVITAQGRNDPFQN  406



>ref|XP_009107418.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
isoform X1 [Brassica rapa]
 emb|CDY00479.1| BnaA10g07940D [Brassica napus]
Length=545

 Score =   396 bits (1018),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 218/424 (51%), Positives = 280/424 (66%), Gaps = 26/424 (6%)
 Frame = -1

Query  1206  LNLEMSKIH---LFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCK-YFLTHS  1039
             +++ M +I+   L+L+   F       +S +  +  G +++WC+QTP+PD CK YF  H+
Sbjct  1     MHVMMHRIYFLSLYLISLLFLCLHPFTISADDNSTTG-IDKWCNQTPYPDPCKCYFKNHN  59

Query  1038  RRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTIL  859
                F  P + SEF+ M  E  +D A+ A     R    C + R++A +ADC+ LYEDTI+
Sbjct  60    --GFRLPTQLSEFRLMLVEATMDRAISARDELARSSGNCTDCRKQAVFADCINLYEDTIV  117

Query  858   QLNQTL---------DEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNV  706
             QL +TL          +KCT FDA TWLSTALTN+ETCR G  +L  S  + P++SN  +
Sbjct  118   QLTRTLAGVAPKAGAGKKCTDFDAQTWLSTALTNIETCRRGSSDLNVSDFITPIVSNTKI  177

Query  705   SQLIGNTLALNN------NGSVPKQTYKDGFPAWVSLGDRRLLQASSP--VKPDLVVAKD  550
             S LI N LA+N       N S      KD FP WVS  +RRLLQ  S   V+ ++VVAKD
Sbjct  178   SNLISNCLAVNGALLPTGNNSTTTADGKD-FPTWVSGKERRLLQLQSARAVRANIVVAKD  236

Query  549   GSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIs  373
             GSG   T++ A+D AG+R   S RFVI++KRG+Y EN+++     NIMLVGDGMR T I+
Sbjct  237   GSGQVTTVQAAIDVAGRRKLMSKRFVIYVKRGIYQENINVRLNNDNIMLVGDGMRSTIIT  296

Query  372   gsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFE  193
             G RSV GG TT+NSAT  + G  FIA+G+TFRNTAGP   QAVALRS +DLS+FYKC  E
Sbjct  297   GGRSVKGGYTTYNSATAGIEGLHFIAKGLTFRNTAGPAKGQAVALRSSSDLSIFYKCSIE  356

Query  192   GYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTD  13
             GYQDTL  HSQRQFY++CYIYGT+DFIFGNAAVVFQNC+I  R+P+  Q   ITAQGR D
Sbjct  357   GYQDTLMVHSQRQFYRECYIYGTIDFIFGNAAVVFQNCIILPRRPLHGQSNVITAQGRAD  416

Query  12    PNQN  1
             P QN
Sbjct  417   PFQN  420



>ref|XP_009773841.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
isoform X2 [Nicotiana sylvestris]
Length=530

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 205/380 (54%), Positives = 268/380 (71%), Gaps = 14/380 (4%)
 Frame = -1

Query  1110  AGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLG  931
             + ++N WCS+TPHP+ CKYF++        P+ KSEF+ M  ++ALD  +Q + HAK + 
Sbjct  31    SNDINWWCSKTPHPEPCKYFMSGDS---FKPQNKSEFRTMTVQVALDHVIQVQAHAKNVS  87

Query  930   PRCRNAREKAAWADCVKLYEDTILQLNQTLD----EKCTQFDALTWLSTALTNLETCRTG  763
               CR  R++  W DC KL +DT+LQLN++LD       + FDA TWLS ++TN+ETC +G
Sbjct  88    QHCRGKRKQLVWMDCDKLMDDTVLQLNRSLDGIKSNSSSDFDAQTWLSASMTNIETCLSG  147

Query  762   FVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYK-DGFPAWVSLGDRRLLQAS  586
               +L N  N+L    + NVSQLI N LA+N      + T +  GFP W++  +R LL +S
Sbjct  148   SNDL-NVSNILQPNLSTNVSQLISNCLAMNGEFVDWENTTQVGGFPNWLTASERVLLHSS  206

Query  585   S----PVKPDLVVAKDGSGNYKTIKDALD-AAGKRSGSGRFVIHIKRGVYNENLDIGNKL  421
             S      + + VVAKD SG++++I+ A++ A  +R G+ R VI+IKRGVY EN+ IG  +
Sbjct  207   SIDLMATRANYVVAKDRSGHFRSIQAAINYATSRRVGNQRIVIYIKRGVYRENILIGPTM  266

Query  420   KNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVA  241
               IMLVG G+RYT I+GSRSV  G TT+++AT+ V G GFIA+G+TFRNTAGP+N QAVA
Sbjct  267   GKIMLVGAGLRYTVITGSRSVAAGYTTYSTATLGVDGIGFIARGMTFRNTAGPQNGQAVA  326

Query  240   LRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARK  61
             LRS +DLSVFY CGFEGYQDTL+  SQRQFYK CYIYGT+DFIFGNAAVVFQNCMIY R+
Sbjct  327   LRSASDLSVFYGCGFEGYQDTLFVQSQRQFYKSCYIYGTIDFIFGNAAVVFQNCMIYVRR  386

Query  60    PMDKQKITITAQGRTDPNQN  1
             P+  Q   ITAQGR DP QN
Sbjct  387   PLWGQVNVITAQGRNDPFQN  406



>ref|XP_010532250.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Tarenaya hassleriana]
Length=539

 Score =   395 bits (1016),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 214/416 (51%), Positives = 279/416 (67%), Gaps = 22/416 (5%)
 Frame = -1

Query  1194  MSKIHLFLVLASFSSFISVALSV----NPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHF  1027
             M  +  F +L S      ++L+V    NP  +  ++ RWC +TP+P+ CK + T+   + 
Sbjct  1     MITLTPFSLLFSLYPLTVLSLAVEAAGNPTNSGNDIARWCDKTPYPEPCKCYFTND--NT  58

Query  1026  TAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCR-NAREKAAWADCVKLYEDTILQLN  850
             + PK  SEF++M  + A+D AV   +   R G  C  ++R +A W+DC++LY+DT+LQLN
Sbjct  59    SVPKHLSEFRQMLVKSAMDRAVTVRSDIARFGMNCTGDSRRRAVWSDCLELYDDTVLQLN  118

Query  849   QTLDE----KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTL  682
             +T        CT FDA TWLSTALTN+ETCR+G  +L  S  + P++   N+SQLI NTL
Sbjct  119   RTRTGVSGGSCTDFDASTWLSTALTNIETCRSGSSDLKISDFITPIMCKTNLSQLISNTL  178

Query  681   ALN---------NNGSVPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKT  529
             A+N            S       + FP WVS  DRRLLQ SS    +LVVAKDGSG+++T
Sbjct  179   AINAALIHADVTTCNSSKNAGAGEHFPIWVSGKDRRLLQ-SSIRGANLVVAKDGSGHFRT  237

Query  528   IKDALDAAGKRS-GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvg  352
             ++ A++AAG+R   S RFVI++KRGVY EN+ + N   N+MLVGDGM+YT I+ SRSV G
Sbjct  238   VQAAIEAAGRRKVTSARFVIYVKRGVYKENILVRNNNDNVMLVGDGMKYTIITASRSVKG  297

Query  351   gSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLY  172
             G TT+NSAT  + G  FIA+GITFRNTAGPE  QAVALRS +DL++FYKC  EGYQDTL 
Sbjct  298   GYTTYNSATAGIEGLHFIAKGITFRNTAGPEKGQAVALRSASDLAIFYKCSVEGYQDTLM  357

Query  171   AHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQ  4
              HSQRQF++DC I GTVDFIFGNAA VFQNC+I  R+P+  Q   ITAQGR DP Q
Sbjct  358   VHSQRQFFRDCSISGTVDFIFGNAAAVFQNCLILPRRPLHGQANVITAQGRADPFQ  413



>ref|XP_006281620.1| hypothetical protein CARUB_v10027747mg [Capsella rubella]
 gb|EOA14518.1| hypothetical protein CARUB_v10027747mg [Capsella rubella]
Length=538

 Score =   395 bits (1016),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 212/385 (55%), Positives = 262/385 (68%), Gaps = 27/385 (7%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             V+RWC +TP+PD CK YF  H+   F  P + SEF+ M  E A+D AV A       G  
Sbjct  38    VDRWCDKTPYPDPCKSYFKNHN--GFRQPTQLSEFRVMLVEAAMDRAVSARDELTNSGRN  95

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTL---------DEKCTQFDALTWLSTALTNLETC  772
             C + +++A   DC+ LY DTI+QLN+TL         +++C+ FDA TWLSTALTN ETC
Sbjct  96    CTDCKKQAVLTDCIDLYGDTIMQLNRTLQGVSPNAVAEKRCSDFDAQTWLSTALTNTETC  155

Query  771   RTGFVELGNSRNVLPLISNNNVSQLIGNTLALN-------NNGSVPKQTYKDGFPAWVSL  613
             R G  +   S  + P++SN  +S LI N LA+N       NNG+    T   GFP WVS 
Sbjct  156   RRGSSDFNVSDFITPIVSNTKISNLISNCLAINGALLPAGNNGT----TTNAGFPTWVSG  211

Query  612   GDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKR-SGSGRFVIHIKRGVYNENLD  436
              DRRLL+    V+ +LVVAKDGSG + T++ A+D AG+R S SGRFVI++KRG+Y EN++
Sbjct  212   KDRRLLRT---VRANLVVAKDGSGQFTTVQAAIDVAGRRKSMSGRFVIYVKRGIYQENIN  268

Query  435   IGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPEN  256
             +     NIMLVGDGMR T I+G RSV GG TT+NSAT  + G  FIA+GI FRNTAGP  
Sbjct  269   VRLYNDNIMLVGDGMRSTIITGGRSVKGGYTTYNSATAGIEGLHFIAKGIAFRNTAGPAK  328

Query  255   HQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCM  76
              QAVALRS +DLS+FYKC  EGYQDTL  HSQRQFY++CYIYGTVDFIFGNAA VFQNC+
Sbjct  329   GQAVALRSSSDLSIFYKCSIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAASVFQNCL  388

Query  75    IYARKPMDKQKITITAQGRTDPNQN  1
             I  R+P+  Q   ITAQGR DP QN
Sbjct  389   ILPRRPLKGQANVITAQGRADPFQN  413



>ref|XP_010442652.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Camelina sativa]
Length=535

 Score =   394 bits (1013),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 210/383 (55%), Positives = 259/383 (68%), Gaps = 26/383 (7%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             ++RWC +TP+PD CK YF  H+   F  P + SEF+ M  E A+D AV A       G  
Sbjct  38    IDRWCDKTPYPDPCKCYFKKHN--GFRQPTQLSEFRVMLVEAAMDRAVSARDELTNSGRN  95

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD-------EKCTQFDALTWLSTALTNLETCRT  766
             C + +++A   DC+ LY DTI+QLN+TL        E+CT FDA TWLSTALTN+ETCR 
Sbjct  96    CTDCKKQAVLTDCIDLYGDTIMQLNRTLQGVSQKATERCTDFDAQTWLSTALTNIETCRR  155

Query  765   GFVELGNSRNVLPLISNNNVSQLIGNTLALN-------NNGSVPKQTYKDGFPAWVSLGD  607
             G  +   S  + P++SN  +S LI N LA+N       NNG+         FP WVS  D
Sbjct  156   GSSDFNVSDFITPIVSNTKISNLISNCLAVNGALLPAVNNGTTTAD-----FPTWVSTKD  210

Query  606   RRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKR-SGSGRFVIHIKRGVYNENLDIG  430
             RRLL+    V+ +LVVAKDGSG + T++ A+D AG+R S S RFVI++KRG+Y EN+++ 
Sbjct  211   RRLLRT---VRANLVVAKDGSGQFNTVQAAIDVAGRRRSMSKRFVIYVKRGIYQENINVR  267

Query  429   NKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQ  250
                 NIMLVGDGMR T I+G RSV GG TT+NSAT  + G  FIA+GI FRNTAGP   Q
Sbjct  268   LNNDNIMLVGDGMRSTIITGGRSVQGGYTTYNSATAGIEGLHFIAKGIAFRNTAGPAKGQ  327

Query  249   AVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIY  70
             AVALRS +DLS+FYKC  EGYQDTL  HSQRQFY++CYIYGTVDFIFGNAA VFQNC+I 
Sbjct  328   AVALRSSSDLSIFYKCSIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAAAVFQNCLIL  387

Query  69    ARKPMDKQKITITAQGRTDPNQN  1
              R+P+  Q   ITAQGR DP QN
Sbjct  388   PRRPLKGQANVITAQGRADPFQN  410



>ref|XP_010550793.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Tarenaya hassleriana]
Length=528

 Score =   394 bits (1011),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 206/398 (52%), Positives = 272/398 (68%), Gaps = 22/398 (6%)
 Frame = -1

Query  1134  LSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRR-HFTAPKRKSEFKKMATEIALDTAVQ  958
             L+  P      +  WC +TPHP+ CKY+   S R H   P+ +SEF++   E+ALD A  
Sbjct  8     LTPRPAHLLTSLAWWCDKTPHPEPCKYYFKKSPRPHKPPPRFRSEFRRRLVELALDHAET  67

Query  957   AETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL---------DEKCTQFDALTW  805
              ++   R GP C N R +AAW+DCVKLY+DT++QLN+TL         D +CT FDA TW
Sbjct  68    TQSQTVRFGPSCTNKRSRAAWSDCVKLYDDTVVQLNRTLRGLDSTAPADVRCTDFDAQTW  127

Query  804   LSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ-------T  646
             LSTA TN++TCR G  +L  S  VLP ISN N+S LI N LA+N  G++ KQ        
Sbjct  128   LSTAQTNIDTCRLGSEDLNVSDFVLPAISNKNLSDLISNCLAVN--GALMKQHSNRTTAN  185

Query  645   YKDGFPAWVSLGDRRLLQASSPVKP--DLVVAKDGSGNYKTIKDALD-AAGKRSGSGRFV  475
             Y++ FP+W+S  +RRLL ++S  +   +LVVA+DGSG++++I+ A++ AA +RS + RFV
Sbjct  186   YREHFPSWISRHERRLLLSTSMARAMANLVVARDGSGHFRSIQAAINVAARRRSMAKRFV  245

Query  474   IHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIA  295
             I+IK+GVY EN+++GN   N+MLVGDG R T ++  RSV  G TT+NSAT    G   IA
Sbjct  246   IYIKKGVYRENIEVGNDNDNVMLVGDGARTTIVTSGRSVRNGYTTYNSATGGFGGLRVIA  305

Query  294   QGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDF  115
             + +TF NTAGP   QAVA+RS +DL+VFY+ G  GYQDTLY HSQRQF+++CYI GT+DF
Sbjct  306   KDMTFINTAGPLRGQAVAVRSSSDLAVFYRVGIHGYQDTLYIHSQRQFFRECYISGTIDF  365

Query  114   IFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             IFGNAAVVFQNCMI  R+P+  Q   ITAQ R DP QN
Sbjct  366   IFGNAAVVFQNCMILVRRPLRGQANVITAQARGDPFQN  403



>ref|XP_002865863.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42122.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=539

 Score =   394 bits (1012),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 209/386 (54%), Positives = 263/386 (68%), Gaps = 25/386 (6%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGP  928
             +++RWC +TP+PD CK YF  H+   F  P + SEF+ M  E A+D A+ A T     G 
Sbjct  36    DIDRWCDKTPYPDPCKCYFKNHN--GFRQPTQISEFRVMLVEAAMDRAISARTELTNSGR  93

Query  927   RCRNAREKAAWADCVKLYEDTILQLNQTLD---------EKCTQFDALTWLSTALTNLET  775
                + +++A   DC+ LY DTI+QLN+TL          ++CT FDA TWLSTALTN ET
Sbjct  94    NYTDIKKQAVLTDCIDLYRDTIMQLNRTLQGVSPKAGAAKRCTDFDAQTWLSTALTNTET  153

Query  774   CRTGFVELGNSRNVLPLISNNNVSQLIGNTLALN-------NNGSVPKQTYKDGFPAWVS  616
             CR G  +   S  + P++SN  +S LI N LA+N       NNG+      + GFP WVS
Sbjct  154   CRLGSSDFNVSDFITPIVSNTKISHLISNCLAVNEALLTAGNNGNTTAN--QKGFPTWVS  211

Query  615   LGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNENL  439
               DRRLL+    V+ +LVVAKDGSG++ T++ A+D AG+R   SGRFVI++KRG+Y EN+
Sbjct  212   DKDRRLLRV---VRANLVVAKDGSGHFNTVQAAIDVAGRRKVTSGRFVIYVKRGIYQENI  268

Query  438   DIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPE  259
             ++     +IMLVGDGMR T I+G RSV GG TT+NSAT  + G  FIA+GITFRNTAGP 
Sbjct  269   NVRLNNDDIMLVGDGMRSTIITGGRSVKGGYTTYNSATAGIEGLHFIAKGITFRNTAGPA  328

Query  258   NHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNC  79
               QAVALRS +DLS+FYKC  EGYQDTL  HSQRQFY++CYIYGTVDFIFGNAA VFQNC
Sbjct  329   KGQAVALRSSSDLSIFYKCSIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAAAVFQNC  388

Query  78    MIYARKPMDKQKITITAQGRTDPNQN  1
             +I  R+P+  Q   ITAQGR DP QN
Sbjct  389   IILPRRPLKGQANVITAQGRADPFQN  414



>ref|XP_004240801.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Solanum lycopersicum]
Length=531

 Score =   392 bits (1008),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 205/379 (54%), Positives = 266/379 (70%), Gaps = 12/379 (3%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFT-APKRKSEFKKMATEIALDTAVQAETHAKRLGP  928
             ++N WCS TPHP+ CKYF+  +    T  PK K++F+ M TE+AL+ A+  + H+K +G 
Sbjct  30    DINWWCSTTPHPEPCKYFMADTTLQRTYKPKCKADFRTMTTEVALEQALLVQNHSKSMGQ  89

Query  927   RCRNAREKAAWADCVKLYEDTILQLNQTL------DEKCTQFDALTWLSTALTNLETCRT  766
                  R+K  W DC KL +DTI QLN+TL         CT FDA TWLS +LTN+ETC +
Sbjct  90    HFGGKRKKLVWMDCDKLIDDTIHQLNRTLHGIGSNSTSCTAFDAQTWLSASLTNIETCLS  149

Query  765   GFVELGNSRNVLPLISNNNVSQLIGNTLALNNN-GSVPKQTYKDGFPAWVSLGDRRLLQA  589
             G  +L N  NVL    + NVSQLI N+LA+N    +    T   GFP+WV+  +R+LLQ+
Sbjct  150   GSNQL-NVSNVLHPTLSANVSQLISNSLAINGELVNSLNSTEIGGFPSWVTSRERKLLQS  208

Query  588   SS---PVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLK  418
             S+     +   VVA+DGSGN+++I+ A++A   +    R +I+IK+GVY EN+ IG  + 
Sbjct  209   STRSLASQAIYVVAQDGSGNFRSIQAAINATANKVSDERTIIYIKKGVYRENVGIGPSMT  268

Query  417   NIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVAL  238
             NIMLVG G+RYT I+GSRS  GG TT+++ATV V G GFIA+GITFRNTAGP+  QAVAL
Sbjct  269   NIMLVGAGLRYTIITGSRSAAGGFTTYSTATVGVDGSGFIARGITFRNTAGPKKGQAVAL  328

Query  237   RSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKP  58
             RS +DLSVFY CGFEGYQDT++  SQRQFYK C++YGT+DFIFGNAAVVFQNC+IY R+P
Sbjct  329   RSASDLSVFYACGFEGYQDTIFVQSQRQFYKTCHVYGTIDFIFGNAAVVFQNCVIYVRRP  388

Query  57    MDKQKITITAQGRTDPNQN  1
             +  Q   ITAQGR DP QN
Sbjct  389   LVGQVNVITAQGRGDPFQN  407



>ref|XP_010443361.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
isoform X2 [Camelina sativa]
Length=535

 Score =   392 bits (1007),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 209/383 (55%), Positives = 259/383 (68%), Gaps = 26/383 (7%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             ++RWC +TP+PD CK YF  H+   F  P + SEF+ M  E A+D AV A       G  
Sbjct  38    IDRWCGKTPYPDPCKCYFKNHN--GFRQPTQLSEFRVMLVEAAMDRAVSARDELTNSGRN  95

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD-------EKCTQFDALTWLSTALTNLETCRT  766
             C + +++A   DC+ LY DTI+QLN+TL        E+CT FDA TWLSTALTN+ETCR 
Sbjct  96    CTDCKKQAVLTDCIDLYGDTIMQLNRTLQGVSPKATERCTDFDAQTWLSTALTNIETCRR  155

Query  765   GFVELGNSRNVLPLISNNNVSQLIGNTLALN-------NNGSVPKQTYKDGFPAWVSLGD  607
             G  +   S  + P++SN  +S LI N LA+N       NNG+         FP WVS  D
Sbjct  156   GSSDFNVSDFITPIVSNTKISNLISNCLAVNGALLPAVNNGTTTAY-----FPTWVSGKD  210

Query  606   RRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKR-SGSGRFVIHIKRGVYNENLDIG  430
             RRLL+    V+ ++VVAKDGSG + T++ A+D AG+R S S RFVI++KRG+Y EN+++ 
Sbjct  211   RRLLRT---VRANIVVAKDGSGQFNTVQAAIDVAGRRRSMSKRFVIYVKRGIYQENINVR  267

Query  429   NKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQ  250
                 NIMLVGDGMR T I+G RSV GG TT+NSAT  + G  FIA+GI FRNTAGP   Q
Sbjct  268   LNNDNIMLVGDGMRSTIITGGRSVQGGYTTYNSATAGIEGLHFIAKGIAFRNTAGPAKGQ  327

Query  249   AVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIY  70
             AVALRS +DLS+FYKC  EGYQDTL  HSQRQFY++CYIYGTVDFIFGNAA VFQNC+I 
Sbjct  328   AVALRSSSDLSIFYKCSIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAAAVFQNCLIL  387

Query  69    ARKPMDKQKITITAQGRTDPNQN  1
              R+P+  Q   ITAQGR DP QN
Sbjct  388   PRRPLKGQANVITAQGRADPFQN  410



>ref|XP_006401970.1| hypothetical protein EUTSA_v10013190mg [Eutrema salsugineum]
 gb|ESQ43423.1| hypothetical protein EUTSA_v10013190mg [Eutrema salsugineum]
Length=542

 Score =   392 bits (1006),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 209/387 (54%), Positives = 262/387 (68%), Gaps = 24/387 (6%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             ++ WC++T +PD CK YF  H+   F  P + SEF+ M  E A+D A+ A       G  
Sbjct  35    IDWWCNKTSYPDPCKCYFKNHN--GFGLPTQLSEFRVMLVEAAMDRAISARDELTNSGRN  92

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD---------EKCTQFDALTWLSTALTNLETC  772
             C +  ++A  ADC+ LY DT+LQLN+TL+         ++CT FDA TWLSTALTN ETC
Sbjct  93    CTDCHKQAILADCIDLYGDTVLQLNRTLEGVSPKTDSGKRCTDFDAQTWLSTALTNTETC  152

Query  771   RTGFVELGNSRNVLPLISNNNVSQLIGNTLALN-------NNGSVPKQTYKDGFPAWVSL  613
             R G  +   S  + P++SN  +S LI N LA+N       NNG+      + GFP WVS 
Sbjct  153   RRGSSDFNVSDFITPIVSNTKISHLISNCLAVNGALLTTGNNGTTGSD--QKGFPTWVSG  210

Query  612   GDRRLLQ--ASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNEN  442
              DR+LLQ   +  V+ +LVVAKDGSG + T++ A+D AG+R   SGRFVI++KRG+Y EN
Sbjct  211   KDRKLLQLQPTRTVRANLVVAKDGSGQFTTVQAAIDVAGRRKVTSGRFVIYVKRGIYQEN  270

Query  441   LDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGP  262
             +++     NIMLVGDGMR T I+G RSV GG TT+NSAT  + G  FIA+G+TFRNTAGP
Sbjct  271   INVRLNNDNIMLVGDGMRSTIITGGRSVKGGYTTYNSATAGIEGLHFIAKGLTFRNTAGP  330

Query  261   ENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQN  82
                QAVALRS +DLS+FYKC  EGYQDTL  HSQRQFY+DCYIYGTVDFIFGNAA VFQN
Sbjct  331   AKGQAVALRSSSDLSIFYKCSIEGYQDTLMVHSQRQFYRDCYIYGTVDFIFGNAAAVFQN  390

Query  81    CMIYARKPMDKQKITITAQGRTDPNQN  1
             C+I  R+P+  Q   ITAQGR DP QN
Sbjct  391   CLILPRRPLKGQANVITAQGRADPFQN  417



>ref|NP_190324.1| Probable pectinesterase/pectinesterase inhibitor 33 [Arabidopsis 
thaliana]
 sp|Q9STY3.1|PME33_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
33; Includes: RecName: Full=Pectinesterase inhibitor 33; AltName: 
Full=Pectin methylesterase inhibitor 33; Includes: RecName: 
Full=Pectinesterase 33; Short=PE 33; AltName: Full=Pectin 
methylesterase 33; Short=AtPME33; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB51212.1| pectinesterase-like protein [Arabidopsis thaliana]
 gb|AEE78277.1| Probable pectinesterase/pectinesterase inhibitor 33 [Arabidopsis 
thaliana]
Length=594

 Score =   393 bits (1010),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 204/397 (51%), Positives = 272/397 (69%), Gaps = 23/397 (6%)
 Frame = -1

Query  1128  VNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRH---FTAPKRKSEFKKMATEIALDTAVQ  958
             +N  + +G++  WC++TPH + C Y+   S ++      P+ +SEF +M  ++ALD AV 
Sbjct  75    INNGSVSGDMTWWCNKTPHAETCNYYFRKSSQNNINLRPPRFRSEFLRMLVKVALDQAVI  134

Query  957   AETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL---------DEKCTQFDALTW  805
               +   + GP C N + KAAW+DCV L+++T+ QLN+TL         D KCT FDA TW
Sbjct  135   THSQTVKFGPSCTNNQRKAAWSDCVNLFQNTVAQLNRTLKGLNPAASSDVKCTDFDAQTW  194

Query  804   LSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ-------T  646
             LSTA TN+ETCR+G  +L  S  V+P+ISN N+S LIGN LA+N  G + KQ        
Sbjct  195   LSTAQTNIETCRSGSEDLNVSDFVMPVISNKNLSDLIGNCLAVN--GVLMKQHDHTTTAN  252

Query  645   YKDGFPAWVSLGDRRLLQASSPVK--PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVI  472
             +K+ FP+WVS  +RRLL ++S  K  P LVVA+D SG++++I+ A++ A +R    RFVI
Sbjct  253   HKEYFPSWVSRHERRLLVSASLAKSSPHLVVAQDRSGHFRSIQAAINFAARRRFKSRFVI  312

Query  471   HIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQ  292
             ++K+GVY EN+D+GN   NIMLVGDG R T I+  RSV  G TT+NSAT    G  F+A+
Sbjct  313   YVKKGVYRENIDVGNDNHNIMLVGDGERKTIITSGRSVQHGYTTYNSATGGFGGQRFVAK  372

Query  291   GITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFI  112
              +TF NTAGP   QAVA+RS +DLSVFY+ G  G+QDTLY HSQRQF+++CYI GT+DFI
Sbjct  373   DMTFINTAGPLRGQAVAVRSSSDLSVFYRVGIHGFQDTLYIHSQRQFFRECYISGTIDFI  432

Query  111   FGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             FGNAAVVFQNCMI  R+P+  Q   ITAQGR DP QN
Sbjct  433   FGNAAVVFQNCMILVRRPLHGQANIITAQGRGDPFQN  469



>ref|NP_199962.1| putative pectinesterase/pectinesterase inhibitor 59 [Arabidopsis 
thaliana]
 sp|Q9FHN5.1|PME59_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
59; Includes: RecName: Full=Pectinesterase inhibitor 59; AltName: 
Full=Pectin methylesterase inhibitor 59; Includes: RecName: 
Full=Pectinesterase 59; Short=PE 59; AltName: Full=Pectin 
methylesterase 59; Short=AtPME59; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08665.1| pectinesterase [Arabidopsis thaliana]
 gb|AED96090.1| putative pectinesterase/pectinesterase inhibitor 59 [Arabidopsis 
thaliana]
Length=536

 Score =   390 bits (1002),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 207/382 (54%), Positives = 261/382 (68%), Gaps = 25/382 (7%)
 Frame = -1

Query  1092  WCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRN  916
             WC +TP+PD CK YF  H+   F  P + SEF+ M  E A+D A+ A       G  C +
Sbjct  37    WCDKTPYPDPCKCYFKNHN--GFQQPTQLSEFRVMLVEAAMDRAISARAELTNSGKNCTD  94

Query  915   AREKAAWADCVKLYEDTILQLNQTLD---------EKCTQFDALTWLSTALTNLETCRTG  763
             ++++A  ADC+ LY DTI+QLN+TL          + CT FDA TWLSTALTN ETCR G
Sbjct  95    SKKQAVLADCIDLYGDTIMQLNRTLHGVSPKAGAAKSCTDFDAQTWLSTALTNTETCRRG  154

Query  762   FVELGNSRNVLPLISNNNVSQLIGNTLALN-------NNGSVPKQTYKDGFPAWVSLGDR  604
               +L  +  + P++SN  +S LI N LA+N       N G+      + GFP W+S  D+
Sbjct  155   SSDLNVTDFITPIVSNTKISHLISNCLAVNGALLTAGNKGNTTAN--QKGFPTWLSRKDK  212

Query  603   RLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNENLDIGN  427
             RLL+A   V+ +LVVAKDGSG++ T++ A+D AG+R   SGRFVI++KRG+Y EN+++  
Sbjct  213   RLLRA---VRANLVVAKDGSGHFNTVQAAIDVAGRRKVTSGRFVIYVKRGIYQENINVRL  269

Query  426   KLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQA  247
                +IMLVGDGMR T I+G RSV GG TT+NSAT  + G  FIA+GITFRNTAGP   QA
Sbjct  270   NNDDIMLVGDGMRSTIITGGRSVQGGYTTYNSATAGIEGLHFIAKGITFRNTAGPAKGQA  329

Query  246   VALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYA  67
             VALRS +DLS+FYKC  EGYQDTL  HSQRQFY++CYIYGTVDFIFGNAA VFQNC+I  
Sbjct  330   VALRSSSDLSIFYKCSIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAAAVFQNCLILP  389

Query  66    RKPMDKQKITITAQGRTDPNQN  1
             R+P+  Q   ITAQGR DP QN
Sbjct  390   RRPLKGQANVITAQGRADPFQN  411



>ref|XP_010443353.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
isoform X1 [Camelina sativa]
Length=535

 Score =   390 bits (1002),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 208/383 (54%), Positives = 259/383 (68%), Gaps = 26/383 (7%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             ++RWC +TP+PD CK YF  H+   F  P + SEF+ M  E A+D AV A       G  
Sbjct  38    IDRWCGKTPYPDPCKCYFKNHN--GFRQPTQLSEFRVMLVEAAMDRAVSARDELTNSGRN  95

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD-------EKCTQFDALTWLSTALTNLETCRT  766
             C + +++A   DC+ LY DTI+QLN+TL        E+CT FDA TWLSTALTN+ETCR 
Sbjct  96    CTDCKKQAVLTDCIDLYGDTIMQLNRTLQGVSPKATERCTDFDAQTWLSTALTNIETCRR  155

Query  765   GFVELGNSRNVLPLISNNNVSQLIGNTLALN-------NNGSVPKQTYKDGFPAWVSLGD  607
             G  +   S  + P++SN  +S LI N LA+N       NNG+         FP WVS  D
Sbjct  156   GSSDFNVSDFITPIVSNTKISNLISNCLAVNGALLPAVNNGTTTAY-----FPTWVSGKD  210

Query  606   RRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKR-SGSGRFVIHIKRGVYNENLDIG  430
             RRLL+    V+ ++VVAKDGSG + T++ A+D AG+R S S RFVI++KRG+Y EN+++ 
Sbjct  211   RRLLRT---VRANIVVAKDGSGQFNTVQAAIDVAGRRRSMSKRFVIYVKRGIYQENINVR  267

Query  429   NKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQ  250
                 NIMLVGDGMR T I+G RSV GG TT+NSAT  + G  FIA+GI F+NTAGP   Q
Sbjct  268   LNNDNIMLVGDGMRSTIITGGRSVQGGYTTYNSATAGIEGLHFIAKGIAFQNTAGPAKGQ  327

Query  249   AVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIY  70
             AVALRS +DLS+FYKC  EGYQDTL  HSQRQFY++CYIYGTVDFIFGNAA VFQNC+I 
Sbjct  328   AVALRSSSDLSIFYKCSIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAAAVFQNCLIL  387

Query  69    ARKPMDKQKITITAQGRTDPNQN  1
              R+P+  Q   ITAQGR DP QN
Sbjct  388   PRRPLKGQANVITAQGRADPFQN  410



>ref|XP_002875838.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52097.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=594

 Score =   392 bits (1006),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 203/397 (51%), Positives = 271/397 (68%), Gaps = 23/397 (6%)
 Frame = -1

Query  1128  VNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRH---FTAPKRKSEFKKMATEIALDTAVQ  958
             +N  + +G++  WC++TPH + C Y+   S ++      P+ +SEF +M   IALD AV 
Sbjct  75    INNGSVSGDMTWWCNKTPHAETCNYYFRKSSQNNINIRPPRFRSEFLRMLVRIALDQAVI  134

Query  957   AETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL---------DEKCTQFDALTW  805
               +   + GP C N + KAAW+DCVKL+++T+ QLN+TL         D KCT FDA TW
Sbjct  135   THSQTVKFGPSCTNNQRKAAWSDCVKLFQNTVTQLNRTLKGLNPAAKDDVKCTDFDAQTW  194

Query  804   LSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ-------T  646
             LSTA TN+ETCR+G  +L  S  V+P ISN N+S LIGN LA+N  G + KQ        
Sbjct  195   LSTAQTNIETCRSGSEDLNVSDFVMPAISNKNLSDLIGNCLAVN--GVLMKQHNHTTAAN  252

Query  645   YKDGFPAWVSLGDRRLLQASSPVK--PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVI  472
             +K+ FP+WVS  +R+LL +++  K  P LVVA+D SG++++I+ A++ A +R    RFVI
Sbjct  253   HKEYFPSWVSRHERKLLVSATLAKSMPHLVVAQDRSGHFRSIQAAINFAARRRFKSRFVI  312

Query  471   HIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQ  292
             ++K+GVY EN+D+GN   NIMLVGDG R T I+  RSV  G TT+NSAT    G  F+A+
Sbjct  313   YVKKGVYRENIDVGNDNHNIMLVGDGERKTIITSGRSVQHGYTTYNSATAGFGGQRFVAK  372

Query  291   GITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFI  112
              +TF NTAGP   QAVA+RS +DL+VFY+ G  G+QDTLY HSQRQF+++CYI GT+DFI
Sbjct  373   DMTFINTAGPLRGQAVAVRSSSDLAVFYRVGIHGFQDTLYIHSQRQFFRECYISGTIDFI  432

Query  111   FGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             FGNAAVVFQNCMI  R+P+  Q   ITAQGR DP QN
Sbjct  433   FGNAAVVFQNCMILVRRPLHGQANIITAQGRGDPFQN  469



>ref|XP_008343734.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Malus domestica]
Length=406

 Score =   385 bits (989),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 202/383 (53%), Positives = 266/383 (69%), Gaps = 10/383 (3%)
 Frame = -1

Query  1155  SSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIA  976
             S F    L          +  WC +TPHP+ C Y L++S   F  PK  SEF+KM  ++A
Sbjct  20    SLFFHTTLXRXHHRHXSRIRTWCRKTPHPESCNYCLSNSIHRF-PPKHTSEFRKMLVQVA  78

Query  975   LDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD-----EKCTQFDAL  811
             L+ A+ A T+  + G  CRN  EK+AWADC++L+E+T+ QLN TL+      KC+ FDA 
Sbjct  79    LERALDAITYTFQYGQNCRNNNEKSAWADCLRLFENTVNQLNVTLEGLGNKRKCSNFDAQ  138

Query  810   TWLSTALTNLETCRTGFVELGNSRNVLPLI-SNNNVSQLIGNTLALNNNGSVPKQTYKDG  634
             TWLS ALTN+ TCR G +EL  +  + P+  S+NNVS+LI N+LA+ +     +++Y + 
Sbjct  139   TWLSAALTNIHTCRVGSLELNVTDFITPIYRSSNNVSELISNSLAIGSQLLGTEESYNES  198

Query  633   --FPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKR  460
               FP WVS  DRRLLQAS+ ++ +LVVAKDGSGN+ T++ ALDAA +R    +F+I++K+
Sbjct  199   EKFPNWVSKHDRRLLQASN-IRANLVVAKDGSGNFSTVQAALDAAARRRVKSKFIIYVKK  257

Query  459   GVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITF  280
             GVY EN+ + N    IMLVG G+RYT I+ SRSV  G TT+NSAT  + G GFIA+GITF
Sbjct  258   GVYXENIQVSNTNSKIMLVGAGIRYTIITSSRSVSEGYTTYNSATAGINGXGFIARGITF  317

Query  279   RNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNA  100
              NTAGP   QAVALRS +DLSVFY+C F+GYQDTL  +SQRQFY++CYI+GT+DFIFGNA
Sbjct  318   SNTAGPLKGQAVALRSASDLSVFYRCAFQGYQDTLMVYSQRQFYRECYIFGTIDFIFGNA  377

Query  99    AVVFQNCMIYARKPMDKQKITIT  31
             A VFQNCMIY  KP+  Q   +T
Sbjct  378   AAVFQNCMIYVXKPLWDQYDMVT  400



>ref|XP_006404388.1| hypothetical protein EUTSA_v10010228mg [Eutrema salsugineum]
 gb|ESQ45841.1| hypothetical protein EUTSA_v10010228mg [Eutrema salsugineum]
Length=592

 Score =   391 bits (1005),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 203/392 (52%), Positives = 270/392 (69%), Gaps = 23/392 (6%)
 Frame = -1

Query  1116  AAAGEVNRWCSQTPHPDQCKYFLTHSRRHFT---APKRKSEFKKMATEIALDTAVQAETH  946
             + +G++  WC++TPH + C Y+  +S  H+     P+ +SEF +M   IALD AV     
Sbjct  79    SVSGDMTWWCNKTPHAETCNYYFRNSP-HYNINRPPRLRSEFLRMLVRIALDQAVITHAQ  137

Query  945   AKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL---------DEKCTQFDALTWLSTA  793
               + GP C N + KAAW+DCVKL+++T+ QLN+TL         D KCT FDA TWLSTA
Sbjct  138   TVKFGPSCTNNQRKAAWSDCVKLFQNTVAQLNRTLKGLNPTASNDVKCTDFDAQTWLSTA  197

Query  792   LTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ------TYKDGF  631
              TN+ETCR+G  +L  S  V+P ISN N+S LIGN LA+N  G + KQ       +K+ F
Sbjct  198   QTNIETCRSGSEDLNVSDFVMPAISNKNLSDLIGNCLAVN--GVLMKQHNHTTANHKELF  255

Query  630   PAWVSLGDRRLLQASSPVK--PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRG  457
             P+WV+  +RRLL ++S  +  P LVV++D SG++++I+ A++ AG+R    RF+I+IK+G
Sbjct  256   PSWVTRHERRLLVSASLARSIPHLVVSQDRSGHFRSIQAAINIAGRRRIKSRFIIYIKKG  315

Query  456   VYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFR  277
             VY EN+++GN   NIMLVGDG R T I+  RSV  G TT+NSAT    G  F+A+ +TF 
Sbjct  316   VYRENIEVGNDNHNIMLVGDGERKTIITSGRSVQRGYTTYNSATAGFGGQRFVAKDMTFI  375

Query  276   NTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAA  97
             NTAGP   QAVA+RS +DL+VFY+ G  GYQDTLY HSQRQF+++CYI GT+DFIFGNAA
Sbjct  376   NTAGPLRGQAVAVRSSSDLAVFYRVGIHGYQDTLYIHSQRQFFRECYISGTIDFIFGNAA  435

Query  96    VVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             VVFQNCMI  R+P+  Q   ITAQGR DP QN
Sbjct  436   VVFQNCMILVRRPLRGQANVITAQGRGDPFQN  467



>ref|XP_010482485.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Camelina sativa]
Length=535

 Score =   389 bits (1000),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 208/383 (54%), Positives = 258/383 (67%), Gaps = 26/383 (7%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             ++RWC +TP+PD CK YF  H+   F  P + SEF+ M  + A+D AV A       G  
Sbjct  38    IDRWCDKTPYPDPCKCYFKNHN--GFRQPTQLSEFRVMLVQAAIDRAVSARDELTNSGQN  95

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD-------EKCTQFDALTWLSTALTNLETCRT  766
             C + +++A   DC+ LY DTI+QLN+TL        E+CT FDA TWLSTALTN ETCR 
Sbjct  96    CTDCKKQAVLTDCIDLYGDTIMQLNRTLQGVSPKAIERCTDFDAQTWLSTALTNTETCRR  155

Query  765   GFVELGNSRNVLPLISNNNVSQLIGNTLALN-------NNGSVPKQTYKDGFPAWVSLGD  607
             G  +   S  + P++SN  +S LI N LA+N       NNG+         FP WVS  D
Sbjct  156   GSTDFNVSDFITPIVSNTKISNLISNCLAVNGALLPAVNNGTTTAD-----FPTWVSGKD  210

Query  606   RRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKR-SGSGRFVIHIKRGVYNENLDIG  430
             RRLL+    V+ +LVVAKDGSG + T++ A+D AG+R S S RFVI++KRG+Y EN+++ 
Sbjct  211   RRLLRT---VRANLVVAKDGSGQFNTVQAAIDVAGRRRSMSKRFVIYVKRGIYQENINVR  267

Query  429   NKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQ  250
                 NIMLVGDGMR T I+G RSV GG TT+NSAT  + G  FIA+GI F+NTAGP   Q
Sbjct  268   LNNDNIMLVGDGMRSTIITGGRSVQGGYTTYNSATAGIEGLHFIAKGIAFQNTAGPAKGQ  327

Query  249   AVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIY  70
             AVALRS +DLS+FYKC  EGYQDTL  HSQRQFY++CYIYGTVDFIFGNAA VFQNC+I 
Sbjct  328   AVALRSSSDLSIFYKCSIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAAAVFQNCLIL  387

Query  69    ARKPMDKQKITITAQGRTDPNQN  1
              R+P+  Q   ITAQGR DP QN
Sbjct  388   PRRPLKGQANVITAQGRADPFQN  410



>ref|XP_006290793.1| hypothetical protein CARUB_v10016896mg [Capsella rubella]
 gb|EOA23691.1| hypothetical protein CARUB_v10016896mg [Capsella rubella]
Length=593

 Score =   391 bits (1005),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 205/394 (52%), Positives = 269/394 (68%), Gaps = 21/394 (5%)
 Frame = -1

Query  1125  NPPAAAGEVNRWCSQTPHPDQCKY-FLTHSRRHFTAPKR-KSEFKKMATEIALDTAVQAE  952
             N  + +G +  WC +TPH + C Y F+  S+ +   P R +SEF +M  +IALD AV   
Sbjct  77    NNGSVSGNMTWWCDKTPHAETCNYYFMKSSQNNINRPPRFRSEFLRMLVKIALDQAVITH  136

Query  951   THAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL---------DEKCTQFDALTWLS  799
             +   + GP C N + KAAW+DCV L+++T+ QLN+TL         D KCT FDA TWLS
Sbjct  137   SQTVKFGPSCTNNQRKAAWSDCVNLFQNTVAQLNRTLKGLNPAAPNDVKCTDFDAQTWLS  196

Query  798   TALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ------TYKD  637
             TA TN+ETCR+G  +L  S  V+P ISN N+S LIGN LA+N  G + KQ       +K+
Sbjct  197   TAQTNIETCRSGSEDLNVSDFVMPAISNKNLSDLIGNCLAVN--GVLMKQHNHTTANHKE  254

Query  636   GFPAWVSLGDRRLLQASSPVK--PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIK  463
              FP+WVS  +RRLL ++S  K  P LVV++D SG++++I+ A++ A +R    RFVI++K
Sbjct  255   YFPSWVSRHERRLLVSASLAKSRPHLVVSRDRSGHFRSIQAAINFAARRRFKSRFVIYVK  314

Query  462   RGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGIT  283
             +GVY EN+D+GN   NIMLVGDG R T ++  RSV  G TT+NSAT    G  F+A+ +T
Sbjct  315   KGVYRENIDVGNDNHNIMLVGDGERKTIVTSGRSVQHGYTTYNSATAGFGGQRFVAKDMT  374

Query  282   FRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGN  103
             F NTAGP   QAVA+RS +DLSVFY+ G  G+QDTLY HSQRQF+++CYI GT+DFIFGN
Sbjct  375   FINTAGPLRGQAVAVRSSSDLSVFYRVGIHGFQDTLYIHSQRQFFRECYISGTIDFIFGN  434

Query  102   AAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             AAVVFQNCMI  R+P+  Q   ITAQGR DP QN
Sbjct  435   AAVVFQNCMILVRRPLHGQANIITAQGRGDPFQN  468



>ref|XP_006357927.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33-like 
[Solanum tuberosum]
Length=534

 Score =   389 bits (1000),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 208/383 (54%), Positives = 271/383 (71%), Gaps = 12/383 (3%)
 Frame = -1

Query  1116  AAAGEVNRWCSQTPHPDQCKYFLTHSRRHFT-APKRKSEFKKMATEIALDTAVQAETHAK  940
             + + ++N WCS TPHP+ CKYF++ +    T  PK K++F+ M TE+AL+ A+  + H+K
Sbjct  29    STSDDINWWCSTTPHPEPCKYFMSDATLQRTYKPKCKADFRIMTTEVALEQALLVQNHSK  88

Query  939   RLGPRCRNAREKAAWADCVKLYEDTILQLNQTL------DEKCTQFDALTWLSTALTNLE  778
              +G   R  R+K  W DC KL +DTI QLN+TL         CT+FDA TWLS +LTN+E
Sbjct  89    NIGQHFRGKRKKLVWMDCDKLIDDTIHQLNRTLHGIGSNSTSCTEFDAQTWLSASLTNIE  148

Query  777   TCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNN-GSVPKQTYKDGFPAWVSLGDRR  601
             TC +G  +L N  NVL    + NVSQLI N+LA+N    +    T   GFP WV+  +R+
Sbjct  149   TCLSGSNQL-NVSNVLHPTLSANVSQLISNSLAINGELVNSQNSTEIGGFPNWVTSRERK  207

Query  600   LLQASS---PVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIG  430
             LLQ+S+     K   VVA+DGSGN+++I+ A++AA  +    R +I+IK+GVY EN+ IG
Sbjct  208   LLQSSTRSLASKAIYVVAQDGSGNFRSIQAAVNAAANKVSDERTIIYIKKGVYRENVAIG  267

Query  429   NKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQ  250
               +  IMLVG G+RYT I+GSRS  GG TT+++ATV V G GFIA+GITFRNTAGP+N Q
Sbjct  268   PSMSKIMLVGAGLRYTIITGSRSAAGGFTTYSTATVGVDGSGFIARGITFRNTAGPKNGQ  327

Query  249   AVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIY  70
             AVALRS +DLSVFY CGFEGYQDT++  SQRQFYK C++YGT+DFIFGNAAVVFQNC+IY
Sbjct  328   AVALRSASDLSVFYACGFEGYQDTIFVQSQRQFYKTCHVYGTIDFIFGNAAVVFQNCVIY  387

Query  69    ARKPMDKQKITITAQGRTDPNQN  1
              R+P+  Q   ITAQGR DP QN
Sbjct  388   VRRPLVGQVNVITAQGRGDPFQN  410



>emb|CDY00480.1| BnaA10g07930D [Brassica napus]
Length=540

 Score =   389 bits (1000),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 207/386 (54%), Positives = 259/386 (67%), Gaps = 22/386 (6%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYFLTHSRRH--FTAPKRKSEFKKMATEIALDTAVQAETHAKRLGP  928
             ++ WC QTP+PD C ++    RRH  +  P   SEF+ M  E A+D A+ A+   K  G 
Sbjct  33    IDTWCDQTPYPDPCNHYF---RRHNGYRVPTHLSEFRVMLVEAAMDRAISAQDKLKMSGL  89

Query  927   RCRNAREKAAWADCVKLYEDTILQLNQTLD--------EKCTQFDALTWLSTALTNLETC  772
              C + R++A   DC+ LY DT+LQLN+TL         E CT  DA TWLSTALTN ETC
Sbjct  90    NCTDCRKQAILTDCIDLYGDTVLQLNRTLQGLSPKAAGEPCTDVDAQTWLSTALTNTETC  149

Query  771   RTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN------NGSVPKQTYKDGFPAWVSLG  610
             R G  +L  S    P++SN  +S LI N LA+N       N           FPAWVS  
Sbjct  150   RRGSSDLNVSDFTTPIVSNTKISHLISNCLAVNGALLTTGNNDTTTTDDPKVFPAWVSRK  209

Query  609   DRRLL--QASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNENL  439
             +RRLL  Q++  V  ++VVAKDGSG +KT++ A+D AG+R   SGRFVI++KRG+Y EN+
Sbjct  210   ERRLLKLQSAPTVPANVVVAKDGSGRFKTVQAAIDLAGRRKVTSGRFVIYVKRGIYQENI  269

Query  438   DIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPE  259
             ++     NIMLVGDGMRYT I+G RSV GG TT++SAT  + G  FIA+GITFRNTAGP 
Sbjct  270   NVRLNNDNIMLVGDGMRYTIITGGRSVKGGYTTYSSATAGIEGLHFIAKGITFRNTAGPA  329

Query  258   NHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNC  79
               QAVALRS +DLS+FY+C  EGYQDTL  HSQRQFY++CYI+GT+DFIFGNAAVVFQNC
Sbjct  330   KGQAVALRSSSDLSIFYRCAMEGYQDTLMVHSQRQFYRECYIFGTIDFIFGNAAVVFQNC  389

Query  78    MIYARKPMDKQKITITAQGRTDPNQN  1
             +I  R+P+  Q   ITAQGR DP QN
Sbjct  390   IILPRRPLHGQSNVITAQGRADPFQN  415



>ref|XP_009374495.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Pyrus x bretschneideri]
Length=480

 Score =   387 bits (994),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 195/352 (55%), Positives = 255/352 (72%), Gaps = 9/352 (3%)
 Frame = -1

Query  1032  HFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQL  853
             H   PK  SEF+KM  E+AL+ A+   T+  + G  C+N  EKAAWADC+KL+++T+ QL
Sbjct  6     HRFRPKHISEFRKMLVEVALERALDVITYTSQYGQNCQNDNEKAAWADCLKLFDNTVNQL  65

Query  852   NQTLD-----EKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLI-SNNNVSQLIG  691
             N TL+      KC+ FDA TWLS ALTN+ TCR G +EL  +  + P+  S+NNVS+LI 
Sbjct  66    NVTLEGLGNKRKCSNFDAQTWLSAALTNIHTCRVGSLELNVTDFITPIYRSSNNVSELIS  125

Query  690   NTLALNNNGSVPKQTYKDG--FPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDA  517
             N+LA+ +     +++Y +   FP WVS  DRRLLQAS+ ++ +L+VAKDGSG++ T++ A
Sbjct  126   NSLAIGSQLLGTEESYNESEKFPNWVSKHDRRLLQASN-IRANLLVAKDGSGHFSTVQAA  184

Query  516   LDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTF  337
             LD A +R    +F+I++K+GVY EN+ + N    IMLVG G+RYT I+ SRSV  G TT+
Sbjct  185   LDEAARRRVKSKFIIYVKKGVYTENIQVSNINSKIMLVGAGIRYTIITSSRSVSEGYTTY  244

Query  336   NSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQR  157
             NSAT  + G GF+A+GI+F NTAGP   QAVALRS +DLSVFY+C F+GYQDTL  HSQR
Sbjct  245   NSATAGINGQGFVARGISFINTAGPLKGQAVALRSASDLSVFYRCAFQGYQDTLMVHSQR  304

Query  156   QFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             QFY++CYI+GT+DFIFGNAA VFQNCMIY RKP+  Q   ITAQGR DP QN
Sbjct  305   QFYRECYIFGTIDFIFGNAAAVFQNCMIYVRKPLWGQVNVITAQGRNDPFQN  356



>ref|XP_009107408.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 60 
[Brassica rapa]
Length=540

 Score =   389 bits (999),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 207/386 (54%), Positives = 259/386 (67%), Gaps = 22/386 (6%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYFLTHSRRH--FTAPKRKSEFKKMATEIALDTAVQAETHAKRLGP  928
             ++ WC QTP+PD C ++    RRH  +  P   SEF+ M  E A+D A+ A+   K  G 
Sbjct  33    IDTWCDQTPYPDPCNHYF---RRHNGYRLPTHLSEFRVMLVEAAMDRAISAQDKLKMSGL  89

Query  927   RCRNAREKAAWADCVKLYEDTILQLNQTLD--------EKCTQFDALTWLSTALTNLETC  772
              C + R++A   DC+ LY DT+LQLN+TL         E CT  DA TWLSTALTN ETC
Sbjct  90    NCTDCRKQAILTDCIDLYGDTVLQLNRTLQGLSPKAAGEPCTDVDAQTWLSTALTNTETC  149

Query  771   RTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN------NGSVPKQTYKDGFPAWVSLG  610
             R G  +L  S    P++SN  +S LI N LA+N       N           FPAWVS  
Sbjct  150   RRGSSDLNVSDFTTPIVSNTKISHLISNCLAVNGALLTTGNNDTTTTDDPKVFPAWVSRK  209

Query  609   DRRLL--QASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNENL  439
             +RRLL  Q++  V  ++VVAKDGSG +KT++ A+D AG+R   SGRFVI++KRG+Y EN+
Sbjct  210   ERRLLKLQSAPTVPANVVVAKDGSGRFKTVQAAIDLAGRRKVTSGRFVIYVKRGIYQENI  269

Query  438   DIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPE  259
             ++     NIMLVGDGMRYT I+G RSV GG TT++SAT  + G  FIA+GITFRNTAGP 
Sbjct  270   NVRLNNDNIMLVGDGMRYTIITGGRSVKGGYTTYSSATAGIEGLHFIAKGITFRNTAGPA  329

Query  258   NHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNC  79
               QAVALRS +DLS+FY+C  EGYQDTL  HSQRQFY++CYI+GT+DFIFGNAAVVFQNC
Sbjct  330   KGQAVALRSSSDLSIFYRCAMEGYQDTLMVHSQRQFYRECYIFGTIDFIFGNAAVVFQNC  389

Query  78    MIYARKPMDKQKITITAQGRTDPNQN  1
             +I  R+P+  Q   ITAQGR DP QN
Sbjct  390   IILPRRPLHGQSNVITAQGRADPFQN  415



>ref|XP_009149919.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Brassica rapa]
Length=594

 Score =   391 bits (1004),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 201/395 (51%), Positives = 270/395 (68%), Gaps = 21/395 (5%)
 Frame = -1

Query  1128  VNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFT--APKRKSEFKKMATEIALDTAVQA  955
             +N  + +G++  WC++TPH + C Y+   S  +     P+ +SEF ++  ++ALD AV  
Sbjct  77    INNDSISGDMTWWCNKTPHAETCNYYFQRSPHNNINRPPRFRSEFLRLLVQVALDQAVIT  136

Query  954   ETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL---------DEKCTQFDALTWL  802
                  + GP C N + KAAW+DCVKL+E+T+ QLN TL         D KC+ FDA TWL
Sbjct  137   HAQTVKFGPSCTNNQRKAAWSDCVKLFENTVAQLNLTLKGLNPAASSDVKCSNFDAQTWL  196

Query  801   STALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ------TYK  640
             STA TN+ETCR+G  +L  S  V+P ISN N+S LIGN LA+N  G + KQ       +K
Sbjct  197   STAQTNIETCRSGSEDLKVSDFVMPAISNKNLSDLIGNCLAVN--GVLMKQHNHTTANHK  254

Query  639   DGFPAWVSLGDRRLLQASSPVK--PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHI  466
             + FP+WVS  +RRLL ++S  K  P LVV++D SG++++I+ A++ AG+R    RF+I++
Sbjct  255   EYFPSWVSRHERRLLVSASLAKSRPHLVVSQDRSGHFRSIQSAINFAGRRRIKSRFIIYV  314

Query  465   KRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGI  286
             K+GVY EN+++GN   NIMLVGDG R T I+  RSV  G TT+NSAT    G  F+A+ +
Sbjct  315   KKGVYRENIEVGNDNHNIMLVGDGARKTIITSGRSVKNGYTTYNSATAGFGGQRFVAKDM  374

Query  285   TFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFG  106
             TF NTAGP   QAV++RS +DLSVFY+ G  G+QDTLY HSQRQF+++CYI GT+DFIFG
Sbjct  375   TFINTAGPLRGQAVSVRSSSDLSVFYRVGIHGFQDTLYIHSQRQFFRECYISGTIDFIFG  434

Query  105   NAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             NAAVVFQNCMI  R+P+  Q   ITAQGR DP QN
Sbjct  435   NAAVVFQNCMILVRRPLRGQANVITAQGRGDPFQN  469



>ref|XP_009340595.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Pyrus x bretschneideri]
Length=480

 Score =   387 bits (993),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 202/358 (56%), Positives = 264/358 (74%), Gaps = 10/358 (3%)
 Frame = -1

Query  1050  LTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYE  871
             +++SR HF  PK  SEF+KM  ++AL+ A+ A T+  + G  C+N +EKAAWADC+KL+ 
Sbjct  1     MSNSRHHFR-PKHTSEFRKMLVQVALERALSAITYTSQYGQNCQNDKEKAAWADCLKLFH  59

Query  870   DTILQLNQTLDE-----KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPL-ISNNN  709
             +T+ QLN TL+       C+ FDA TWLS ALTN+ETCR G +EL  +  + P+  SNNN
Sbjct  60    NTVSQLNVTLEGLGTKLNCSNFDAQTWLSAALTNIETCRVGSLELNVTNFITPIYTSNNN  119

Query  708   VSQLIGNTLALNNNGSVPKQTYKDG--FPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNY  535
             VS+LI N+LA+ +     ++++ +   FP WVS  DRRLLQ S+ ++ +LVVAKDGSGN+
Sbjct  120   VSELISNSLAIGSQLLGTEESFNESEKFPNWVSKHDRRLLQ-SANIRANLVVAKDGSGNF  178

Query  534   KTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvv  355
             +T++ ALDAA +R    +F+I++K+GVY EN+ + N    IMLVG G+RYT I+ SRSV 
Sbjct  179   RTVQAALDAAARRRVRSKFIIYVKKGVYTENIQVSNTNSKIMLVGAGIRYTVITSSRSVS  238

Query  354   ggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTL  175
             GG TT+NSAT  + G GFIA+GITFRNTAGP   QAVAL S +DLSVFY+C F+GYQDTL
Sbjct  239   GGYTTYNSATAGINGPGFIARGITFRNTAGPLKGQAVALMSASDLSVFYRCAFQGYQDTL  298

Query  174   YAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
               HSQRQFY++CYI+GT+DFIFGNAA VFQNC+IY RKP+  Q   ITAQGR DP QN
Sbjct  299   MVHSQRQFYRECYIFGTIDFIFGNAAAVFQNCIIYVRKPLWGQVNVITAQGRNDPFQN  356



>ref|XP_010442655.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 60 
[Camelina sativa]
Length=540

 Score =   388 bits (997),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 203/384 (53%), Positives = 261/384 (68%), Gaps = 20/384 (5%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             ++ WC QTP+P  CK YF+ HS   F  P + SEF+ +  E A+D AV A          
Sbjct  35    IDPWCDQTPYPYPCKRYFIKHS--GFEQPTQISEFRVLLVEAAMDRAVSARNKLTNSSKN  92

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD---------EKCTQFDALTWLSTALTNLETC  772
             C + +++A  +DC+ LY DT++QLN+T           ++CT FDA TWLSTALTN ETC
Sbjct  93    CTDCKKQAVLSDCLDLYGDTVMQLNRTFQGVSSKTSVGKRCTDFDAQTWLSTALTNTETC  152

Query  771   RTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN------NGSVPKQTYKDGFPAWVSLG  610
             R G  +L  +  V P++SN  +S LI N LA+N              T K GFP WVS  
Sbjct  153   RRGSSDLNVTDFVTPIVSNTKISHLISNCLAINGALLTAGKNESTTGTDKRGFPTWVSRK  212

Query  609   DRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNENLDI  433
             +RRLLQ+ S V+ ++VVAKDGSG++KT++ A+D AG+R   SGRFVI++KRG+Y EN+D+
Sbjct  213   ERRLLQSQS-VRANIVVAKDGSGHFKTVQAAIDLAGRRKVTSGRFVIYVKRGIYQENIDV  271

Query  432   GNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENH  253
                  N+ML+GDGMRYT I+G RSV GG TT++SAT  + G  FIA+GI FRNTAGP   
Sbjct  272   RLSNDNVMLIGDGMRYTIITGGRSVKGGYTTYSSATAGIEGLHFIAKGIAFRNTAGPAKG  331

Query  252   QAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMI  73
             QAVALRS +DLS+F++C  EGYQDTL  HSQRQFY++CYIYGTVDFIFGNAAVV QNC+I
Sbjct  332   QAVALRSSSDLSIFFRCSIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAAVVLQNCII  391

Query  72    YARKPMDKQKITITAQGRTDPNQN  1
               R+P+  Q   ITAQGR+D  QN
Sbjct  392   LPRRPLKGQANVITAQGRSDLFQN  415



>ref|XP_011029954.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Populus euphratica]
Length=533

 Score =   388 bits (996),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 211/405 (52%), Positives = 279/405 (69%), Gaps = 13/405 (3%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             +K+ LF  L  FSS +S A S +  A    +  WC+ TPHP  C Y ++HS  HF+   R
Sbjct  9     TKVRLFATLIFFSSMLSFAASKSTEA---NITWWCNHTPHPSTCMYHMSHSHHHFSLKHR  65

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD--  838
              S+F+ M+ ++AL +A+ A+    +    C N  +KA W+DC+KL+ +TILQLN+TL   
Sbjct  66    -SQFRIMSIQLALQSALIAQCQVSQFEQNCENQNQKAVWSDCLKLHSNTILQLNRTLIGL  124

Query  837   EK----CTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN  670
             EK    CT  DA TWLSTALTN++TCRTG ++L  +   +P  S N +S+LI NTLA+N 
Sbjct  125   EKKRPPCTDLDAQTWLSTALTNIQTCRTGSLDLKVTDFTMPAASKN-LSELISNTLAING  183

Query  669   NGSVPKQTYKDG-FPAWVSLGDRRLLQASS-PVKPDLVVAKDGSGNYKTIKDALDAAGKR  496
                  +     G FP+W S  +RRLLQ++S   K +LVV+K+G GN++TI+ A+DAA KR
Sbjct  184   VSLATEDNNTQGYFPSWFSGQNRRLLQSTSIAAKANLVVSKNGFGNFRTIQAAIDAASKR  243

Query  495   SGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAV  316
                 RF+I++KRGVY EN+++     NI LVGDG+R T I+ SRSV  G TT++SAT  +
Sbjct  244   MSRTRFIIYVKRGVYRENIEVRVNSNNIWLVGDGLRRTIITSSRSVGAGYTTYSSATAGI  303

Query  315   TGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCY  136
              G  F+A+GITF NTAGP   QAVALRS +DLSVFY+C F+GYQDTL+ HSQRQFY++CY
Sbjct  304   DGLRFVARGITFVNTAGPLKGQAVALRSASDLSVFYRCSFQGYQDTLFVHSQRQFYRECY  363

Query  135   IYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             I+GT+DFIFGNAAVVFQN +IY RKP+  Q   ITAQGR DP QN
Sbjct  364   IFGTIDFIFGNAAVVFQNSIIYVRKPLKGQANMITAQGRNDPFQN  408



>ref|XP_009402517.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=527

 Score =   387 bits (994),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 207/411 (50%), Positives = 281/411 (68%), Gaps = 21/411 (5%)
 Frame = -1

Query  1197  EMSKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAP  1018
             ++  + +F+VL   +S  S  LS +    + +++ WCS  PHP+ C+Y+L ++  H   P
Sbjct  3     KLPALLVFVVL--LTSLPSRCLSFH---DSDDIDYWCSNMPHPEPCRYYLGNNP-HVEIP  56

Query  1017  KRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD  838
             K  ++F +++  +A D  V+A++  KR GP CR ARE+ AW DC KLY++T+LQLN+TLD
Sbjct  57    KDTAQFYQVSLRLAFDLTVRAQSQLKRRGPACRQARERTAWLDCWKLYDNTVLQLNRTLD  116

Query  837   EK---CTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN-  670
                  CT FD+ TWLS ALTNL+TC TGF + G S  ++  ++  NVS LI N LA+N  
Sbjct  117   APHGACTAFDSQTWLSAALTNLQTCLTGFNDTGTSSEIIEPVTRYNVSDLISNCLAINRP  176

Query  669   -----NGSVPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAA  505
                    +V   T +    +W+ + +RRLLQ S+    DLVVAKDGSGN++TIK+ALDAA
Sbjct  177   AAAAAATNVSTTTDRGRVSSWMMIANRRLLQLSA--SADLVVAKDGSGNFRTIKEALDAA  234

Query  504   GKRSGSGR---FVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFN  334
               R  SGR   FVI++K GVYNE + + + L N++++GDG+  T I+G+RSV  G TT +
Sbjct  235   AARMQSGRLSKFVIYVKAGVYNEYVQVTSSLSNLVMLGDGIGKTIITGNRSVASGYTTLS  294

Query  333   SATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQ  154
             SAT +V GDGF A GITFRNT GP   QAVAL S +DLSV+Y+C  EGYQDTL+ +SQRQ
Sbjct  295   SATFSVFGDGFKASGITFRNTFGP-GSQAVALLSASDLSVYYRCSIEGYQDTLFVYSQRQ  353

Query  153   FYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             FY++C I+GT+DFIFGNAAVV Q C IYAR+P   +   ITAQGR+DPNQN
Sbjct  354   FYRECDIHGTIDFIFGNAAVVLQRCNIYARRPRHGESNVITAQGRSDPNQN  404



>emb|CDX99055.1| BnaA06g17460D [Brassica napus]
Length=594

 Score =   389 bits (999),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 200/395 (51%), Positives = 270/395 (68%), Gaps = 21/395 (5%)
 Frame = -1

Query  1128  VNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFT--APKRKSEFKKMATEIALDTAVQA  955
             +N  + +G++  WC++TPH + C Y+   S  +     P+ +SEF ++  ++ALD AV  
Sbjct  77    INNDSISGDMTWWCNKTPHAETCNYYFQRSPHNNINRPPRFRSEFLRLLVQVALDQAVIT  136

Query  954   ETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL---------DEKCTQFDALTWL  802
                  + GP C N + KAAW+DCVKL+E+T+ QLN TL         D KC+ FDA TWL
Sbjct  137   HAQTVKFGPSCTNNQRKAAWSDCVKLFENTVAQLNLTLKGLNPGASSDVKCSNFDAQTWL  196

Query  801   STALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ------TYK  640
             STA TN+ETCR+G  +L  S  V+P ISN N+S LIGN LA+N  G + KQ       ++
Sbjct  197   STAQTNIETCRSGSEDLKVSDFVMPAISNKNLSDLIGNCLAVN--GVLMKQHNHTTANHE  254

Query  639   DGFPAWVSLGDRRLLQASSPVK--PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHI  466
             + FP+WVS  +RRLL ++S  K  P LVV++D SG++++I+ A++ AG+R    RF+I++
Sbjct  255   EYFPSWVSRHERRLLVSASLAKSRPHLVVSQDRSGHFRSIQSAINFAGRRRIKSRFIIYV  314

Query  465   KRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGI  286
             K+GVY EN+++GN   NIMLVGDG R T I+  RSV  G TT+NSAT    G  F+A+ +
Sbjct  315   KKGVYRENIEVGNDNHNIMLVGDGARKTIITSGRSVKNGYTTYNSATAGFGGQRFVAKDM  374

Query  285   TFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFG  106
             TF NTAGP   QAV++RS +DLSVFY+ G  G+QDTLY HSQRQF+++CYI GT+DFIFG
Sbjct  375   TFINTAGPLRGQAVSVRSSSDLSVFYRVGIHGFQDTLYIHSQRQFFRECYISGTIDFIFG  434

Query  105   NAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             NAAVVFQNCMI  R+P+  Q   ITAQGR DP QN
Sbjct  435   NAAVVFQNCMILVRRPLRGQANVITAQGRGDPFQN  469



>ref|XP_010426182.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Camelina sativa]
Length=592

 Score =   389 bits (998),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 203/394 (52%), Positives = 267/394 (68%), Gaps = 21/394 (5%)
 Frame = -1

Query  1125  NPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFT--APKRKSEFKKMATEIALDTAVQAE  952
             N  + +G++  WC +TPH + C Y+   S  +     P+ +SEF +M  +IALD AV   
Sbjct  76    NNGSVSGDMTWWCDKTPHAETCNYYFKKSSHNNINRPPRFRSEFLRMLVKIALDQAVITH  135

Query  951   THAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL---------DEKCTQFDALTWLS  799
             +   + GP C N + KAAW+DCV L+++T+ QLN+TL         D KCT FDA TWLS
Sbjct  136   SQTVKFGPSCTNNQRKAAWSDCVNLFQNTVAQLNRTLKGLNPAATNDVKCTDFDAQTWLS  195

Query  798   TALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ------TYKD  637
             TA TN+ETCR+G  +L  S  V+P ISN N+S LIGN LA+N  G + KQ       +K+
Sbjct  196   TAQTNIETCRSGSEDLNVSDFVMPAISNKNLSDLIGNCLAVN--GVLMKQHNQTTANHKE  253

Query  636   GFPAWVSLGDRRLLQASSPVK--PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIK  463
              FP+WVS  +RRL+ ++S  K  P LVV+ D SG++++I+ A++ A +R    RFVI++K
Sbjct  254   FFPSWVSRHERRLIVSASLAKRRPHLVVSLDRSGHFRSIQAAINFAARRRYKSRFVIYVK  313

Query  462   RGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGIT  283
             +GVY EN+D+GN   NIMLVGDG R T I+  RSV  G TT+NSAT    G  F+A+ +T
Sbjct  314   KGVYRENIDVGNDNHNIMLVGDGERKTVITSGRSVQHGYTTYNSATAGFGGQRFVAKDMT  373

Query  282   FRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGN  103
             F NTAGP   QAVA+RS +DLSVFY+ G  G+QDTLY HSQRQF+++CYI GT+DFIFGN
Sbjct  374   FINTAGPLRGQAVAVRSSSDLSVFYRVGIHGFQDTLYIHSQRQFFRECYISGTIDFIFGN  433

Query  102   AAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             AAVVFQNCMI  R+P+  Q   ITAQGR DP QN
Sbjct  434   AAVVFQNCMILVRRPLHGQANIITAQGRGDPFQN  467



>ref|XP_010503340.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Camelina sativa]
Length=592

 Score =   389 bits (998),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 202/394 (51%), Positives = 269/394 (68%), Gaps = 21/394 (5%)
 Frame = -1

Query  1125  NPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFT--APKRKSEFKKMATEIALDTAVQAE  952
             N  + +G++  WC++TPH + C Y+   S ++     P+ +SEF +M  +IALD AV   
Sbjct  76    NNGSVSGDMTWWCNKTPHAETCNYYFRKSSQNNINRPPRFRSEFLRMLVKIALDQAVITH  135

Query  951   THAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL---------DEKCTQFDALTWLS  799
             +   + GP C N + KAAW+DCV L+++T+ QLN+TL         D KCT FDA TWLS
Sbjct  136   SQTVKFGPSCTNNQRKAAWSDCVHLFQNTVAQLNRTLKGLNPAALNDVKCTDFDAQTWLS  195

Query  798   TALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ------TYKD  637
             TA TN+ETCR+G  +L  S  V+P ISN N+S LIGN LA+N  G + KQ       +K+
Sbjct  196   TAQTNIETCRSGSEDLNVSDFVMPAISNKNLSDLIGNCLAVN--GVLMKQHNHTTANHKE  253

Query  636   GFPAWVSLGDRRLLQASSPVK--PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIK  463
              FP+WVS  +RRL+ ++S  K  P LVV+ D SG++++I+ A++ A +R    RFVI++K
Sbjct  254   YFPSWVSRHERRLIVSASLAKSRPHLVVSLDRSGHFRSIQAAINFAARRRYKSRFVIYVK  313

Query  462   RGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGIT  283
             +GVY EN+D+GN   NIMLVGDG R T ++  RSV  G TT+NSAT    G  F+A+ +T
Sbjct  314   KGVYRENIDVGNDNHNIMLVGDGERKTIVTSGRSVQHGYTTYNSATAGFGGQRFVAKDMT  373

Query  282   FRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGN  103
             F NTAGP   QAVA+RS +DLSVFY+ G  G+QDTLY HSQRQF+++CYI GT+DFIFGN
Sbjct  374   FINTAGPLRGQAVAVRSSSDLSVFYRVGIHGFQDTLYIHSQRQFFRECYISGTIDFIFGN  433

Query  102   AAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             AAVVFQNCMI  R+P+  Q   ITAQGR DP QN
Sbjct  434   AAVVFQNCMIVVRRPLHGQANIITAQGRGDPFQN  467



>ref|XP_010443373.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 60 
[Camelina sativa]
Length=540

 Score =   387 bits (993),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 205/384 (53%), Positives = 261/384 (68%), Gaps = 20/384 (5%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             ++ WC QTP+P  CK YF+ HS   F  P + SEF+ +  E A+D AV A          
Sbjct  35    IDPWCDQTPYPYPCKRYFIKHS--GFRQPTQLSEFRVLLVEAAMDRAVSARNKLANSSNN  92

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD---------EKCTQFDALTWLSTALTNLETC  772
             C + +++A  +DC+ LY DT++QLN+TL          ++CT FDA TWLSTALTN ETC
Sbjct  93    CTDCKKQAVLSDCLDLYGDTVMQLNRTLQGVSSKTGVGKRCTDFDAQTWLSTALTNTETC  152

Query  771   RTGFVELGNSRNVLPLISNNNVSQLIGNTLALN----NNGSVPKQTYKD--GFPAWVSLG  610
             R G  +L  +  + P++SN  +S LI N LA+N      G     T  D  GFP WVS  
Sbjct  153   RRGSSDLNVTDFITPIVSNTKISHLISNCLAINGALLTAGKNESTTGTDSMGFPTWVSGK  212

Query  609   DRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNENLDI  433
             +RRLLQ  S V+ ++VVAKDGSG++KTI+ A+D AG+R   SGRFVI++KRG+Y EN+D+
Sbjct  213   ERRLLQLQS-VRANIVVAKDGSGHFKTIQAAIDLAGRRKVTSGRFVIYVKRGIYQENIDV  271

Query  432   GNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENH  253
                  N+ML+GDGMRYT I+G RS  GG TT++SAT  + G  FIA+GI FRNTAGP   
Sbjct  272   RLNNDNVMLIGDGMRYTIITGGRSFKGGYTTYSSATAGIEGLHFIAKGIAFRNTAGPAKG  331

Query  252   QAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMI  73
             QAVALRS +DLS+FY+C  EGYQDTL  HSQRQFY++CYIYGTVDFIFGNAAVV QNC+I
Sbjct  332   QAVALRSSSDLSIFYRCSIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAAVVLQNCII  391

Query  72    YARKPMDKQKITITAQGRTDPNQN  1
               R+P+  Q   ITAQGR+D  QN
Sbjct  392   LPRRPLKGQANVITAQGRSDLFQN  415



>gb|KFK34037.1| hypothetical protein AALP_AA5G093700 [Arabis alpina]
Length=589

 Score =   388 bits (997),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 201/393 (51%), Positives = 267/393 (68%), Gaps = 20/393 (5%)
 Frame = -1

Query  1128  VNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAET  949
             +N  + +G++  WC++TPH + C Y+   S  H   P+ +SEF +M  +IALD AV    
Sbjct  75    INNGSVSGDMTWWCNKTPHAETCNYYFQQSP-HNRPPRFRSEFLRMLVKIALDQAVITHA  133

Query  948   HAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL---------DEKCTQFDALTWLST  796
                + GP C N + KAAW+DCV L+++T+ QLN+TL         D KC+ FDA TWLST
Sbjct  134   QTVKFGPSCTNNQRKAAWSDCVNLFQNTVAQLNRTLKGLNPSASDDVKCSDFDAQTWLST  193

Query  795   ALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ------TYKDG  634
             A TN+ETCR+G  +L  +  V+P I+N N+S LIGN LA+N  G + KQ       +K+ 
Sbjct  194   AQTNIETCRSGSEDLNVADFVMPAIANKNLSDLIGNCLAVN--GVLMKQHNHTTANHKEY  251

Query  633   FPAWVSLGDRRLLQASSPVKP--DLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKR  460
             FP+WVS  +RRLL ++S  K    LVVA+D SG++++I+ A++ A +R    RFVI++++
Sbjct  252   FPSWVSRHERRLLISASLAKSRSHLVVAQDRSGHFRSIQAAINFAARRRIKSRFVIYVRK  311

Query  459   GVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITF  280
             GVY EN+D+GN   NIMLVGDG R T I+  RSV  G TT+NSAT    G  F+A+ +TF
Sbjct  312   GVYRENIDVGNDNHNIMLVGDGERKTIITSGRSVQHGYTTYNSATAGFGGQRFVAKDMTF  371

Query  279   RNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNA  100
              N AGP   QAVA+RS +DLSVFY+ G  G+QDTLY HSQRQF+++CYI GT+DFIFGNA
Sbjct  372   INMAGPLRGQAVAVRSSSDLSVFYRVGIHGFQDTLYIHSQRQFFRECYISGTIDFIFGNA  431

Query  99    AVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             AVVFQNCMI  RKP+  Q   ITAQGR DP QN
Sbjct  432   AVVFQNCMILVRKPLRGQANVITAQGRGDPFQN  464



>ref|NP_199963.1| putative pectinesterase/pectinesterase inhibitor 60 [Arabidopsis 
thaliana]
 sp|Q9FHN4.1|PME60_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
60; Includes: RecName: Full=Pectinesterase inhibitor 60; AltName: 
Full=Pectin methylesterase inhibitor 60; Includes: RecName: 
Full=Pectinesterase 60; Short=PE 60; AltName: Full=Pectin 
methylesterase 60; Short=AtPME60; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08666.1| pectinesterase [Arabidopsis thaliana]
 gb|AED96091.1| putative pectinesterase/pectinesterase inhibitor 60 [Arabidopsis 
thaliana]
Length=540

 Score =   386 bits (992),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 209/383 (55%), Positives = 261/383 (68%), Gaps = 21/383 (5%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             ++ WC +TP+P  CK YF+ HS   F  P + SEF+ +  E A+D AV A          
Sbjct  38    IDGWCDKTPYPYPCKRYFIKHS--GFRLPTQISEFRVLLVEAAMDRAVSAWDKLTNSSKN  95

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD-------EKCTQFDALTWLSTALTNLETCRT  766
             C + +++A  ADC+ LY DT++QLN+TL         +CT FDA TWLSTALTN ETCR 
Sbjct  96    CTDFKKQAVLADCINLYGDTVMQLNRTLQGVSSKTGRRCTDFDAQTWLSTALTNTETCRR  155

Query  765   GFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKD-------GFPAWVSLGD  607
             G  +L  S    P++SN  +S LI N LA+N  G++      D       GFP WVS  +
Sbjct  156   GSSDLNVSDFTTPIVSNTKISHLISNCLAVN--GALLTAGKNDSTTGDSKGFPTWVSRKE  213

Query  606   RRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNENLDIG  430
             RRLLQ  S V+ +LVVAKDGSG++KT++ A+D AG+R   SGRFVI++KRG+Y ENL++ 
Sbjct  214   RRLLQLQS-VRANLVVAKDGSGHFKTVQAAIDVAGRRKVTSGRFVIYVKRGIYQENLNVR  272

Query  429   NKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQ  250
                 NIMLVGDGMRYT I+G RSV GG TT++SAT  + G  FIA+GI F+NTAGP   Q
Sbjct  273   LNNDNIMLVGDGMRYTIITGGRSVKGGYTTYSSATAGIEGLHFIAKGIAFQNTAGPAKGQ  332

Query  249   AVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIY  70
             AVALRS +DLS+FY+C  EGYQDTL  HSQRQFY++CYIYGTVDFIFGNAAVVFQNC+I 
Sbjct  333   AVALRSSSDLSIFYRCSIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAAVVFQNCIIL  392

Query  69    ARKPMDKQKITITAQGRTDPNQN  1
              R P+  Q   ITAQGRTD  QN
Sbjct  393   PRLPLKGQANVITAQGRTDLFQN  415



>emb|CDY55029.1| BnaC03g75510D [Brassica napus]
Length=585

 Score =   387 bits (995),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 199/395 (50%), Positives = 269/395 (68%), Gaps = 21/395 (5%)
 Frame = -1

Query  1128  VNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFT--APKRKSEFKKMATEIALDTAVQA  955
             +N  + +G++  WC++TPH + C Y+   S  +     P+ +SEF ++  ++ALD AV  
Sbjct  68    INNGSISGDMTWWCNKTPHAETCNYYFQRSPHNNINRPPRFRSEFLRLLVQVALDQAVIT  127

Query  954   ETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL---------DEKCTQFDALTWL  802
                  + GP C N + KAAW+DCVKL+E+T+ QLN TL         D KC+ FDA TWL
Sbjct  128   HAQTVKFGPSCTNNQRKAAWSDCVKLFENTVAQLNLTLKGLNPGASSDVKCSNFDAQTWL  187

Query  801   STALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ------TYK  640
             STA TN+ETCR+G  +L  S  V+P ISN N+S  IGN LA+N  G + KQ       ++
Sbjct  188   STAQTNIETCRSGSEDLKVSDFVMPAISNKNLSDFIGNCLAVN--GVLMKQHNHTTANHE  245

Query  639   DGFPAWVSLGDRRLLQASSPVK--PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHI  466
             + FP+WVS  +RRLL ++S  K  P LVV++D SG++++I+ A++ AG+R    RF+I++
Sbjct  246   EYFPSWVSRHERRLLVSASLAKSRPHLVVSQDRSGHFRSIQSAINFAGRRRIKSRFIIYV  305

Query  465   KRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGI  286
             K+GVY EN+++GN   NIMLVGDG R T I+  RSV  G TT+NSAT    G  F+A+ +
Sbjct  306   KKGVYRENIEVGNDNHNIMLVGDGARKTIITSGRSVKNGYTTYNSATAGFGGQRFVAKDM  365

Query  285   TFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFG  106
             TF NTAGP   QAV++RS +DLSVFY+ G  G+QDTLY HSQRQF+++CYI GT+DFIFG
Sbjct  366   TFINTAGPLRGQAVSVRSSSDLSVFYRVGIHGFQDTLYIHSQRQFFRECYISGTIDFIFG  425

Query  105   NAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             NAAVVFQNCMI  R+P+  Q   ITAQGR DP QN
Sbjct  426   NAAVVFQNCMILVRRPLRGQANVITAQGRGDPFQN  460



>emb|CDX99914.1| BnaC09g27910D [Brassica napus]
Length=540

 Score =   385 bits (988),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 205/387 (53%), Positives = 260/387 (67%), Gaps = 24/387 (6%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYFLTHSRRH--FTAPKRKSEFKKMATEIALDTAVQAETHAKRLGP  928
             ++ WC QTP+PD C ++    RRH  +  P   SEF+ M  E A+D A+ A+   K  G 
Sbjct  33    IDTWCDQTPYPDPCNHYF---RRHNGYRLPTHLSEFRAMLVEAAMDRAISAQDKLKMSGL  89

Query  927   RCRNAREKAAWADCVKLYEDTILQLNQTLD--------EKCTQFDALTWLSTALTNLETC  772
              C + R++A   DC+ LY DT+LQLN+TL         E CT  DA TWLSTALTN ETC
Sbjct  90    NCTDCRKQAILTDCIDLYGDTVLQLNRTLQGLSPKAAGEPCTDVDAQTWLSTALTNTETC  149

Query  771   RTGFVELGNSRNVLPLISNNNVSQLIGNTLALN-------NNGSVPKQTYKDGFPAWVSL  613
             R G  +L  S    P++SN  +S LI N LA+N       NN +      K  FPAWVS 
Sbjct  150   RRGSSDLNVSDFTTPIVSNTKISHLISNCLAVNGALLTTGNNDTTITDDPKV-FPAWVSR  208

Query  612   GDRRLL--QASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNEN  442
              +RRLL  Q++  V  ++VVAKDGSG+ KT++ A++ AG+R   SG FVI++KRG+Y EN
Sbjct  209   KERRLLKFQSARTVPANVVVAKDGSGHVKTVQAAIELAGRRKVTSGLFVIYVKRGIYQEN  268

Query  441   LDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGP  262
             +++     N+MLVGDGMRYT I+G RSV  G TT++SAT  + G  FIA+GITFRNTAGP
Sbjct  269   INVRLNNDNLMLVGDGMRYTIITGGRSVKEGYTTYSSATAGIEGLHFIAKGITFRNTAGP  328

Query  261   ENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQN  82
                QAVALRS +DLS+FY+C  EGYQDTL  HSQRQFY++CYI+GT+DFIFGNAAVVFQN
Sbjct  329   AKGQAVALRSSSDLSIFYRCAMEGYQDTLMVHSQRQFYRECYIFGTIDFIFGNAAVVFQN  388

Query  81    CMIYARKPMDKQKITITAQGRTDPNQN  1
             C+I  R+P+  Q   ITAQGR DP QN
Sbjct  389   CIILPRRPLHGQSNVITAQGRADPFQN  415



>ref|XP_009150639.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Brassica rapa]
Length=593

 Score =   386 bits (992),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 203/388 (52%), Positives = 268/388 (69%), Gaps = 21/388 (5%)
 Frame = -1

Query  1107  GEVNRWCSQTPHPDQCKYFLTHS-RRHFTAPKR-KSEFKKMATEIALDTAVQAETHAKRL  934
             G++  WC++TPH   C Y+   S  R+ + P R +SEF +M   +ALD AV A     +L
Sbjct  83    GDMTWWCNKTPHAKTCTYYFQKSPDRNISRPPRFRSEFLRMLVHVALDQAVIAHAQTVKL  142

Query  933   GPRCRNAREKAAWADCVKLYEDTILQLNQTL---------DEKCTQFDALTWLSTALTNL  781
             G  C N ++K AW+DCV L+E+T+ QLNQT          D KC+ FDA TWLSTA TN+
Sbjct  143   GQSCTNNQQKGAWSDCVTLFENTVTQLNQTFNGLNPGASSDVKCSDFDAQTWLSTAQTNI  202

Query  780   ETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ------TYKDGFPAWV  619
             +TCR+G  +L  S  V+P ISN N+S LIGN LA+N  G + KQ       +K+ FP+WV
Sbjct  203   QTCRSGAEDLKVSNFVMPAISNKNLSDLIGNCLAVN--GVLMKQHNHKTANHKEYFPSWV  260

Query  618   SLGDRRLLQASSPVK--PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNE  445
             S  +RRLL ++S  K  P LVVA+D SG++++I+ A++ AG+R    RFVI++K+GVY E
Sbjct  261   SRHERRLLVSASLAKSRPHLVVAQDRSGHFRSIQAAINFAGRRRIKSRFVIYVKKGVYRE  320

Query  444   NLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAG  265
             N+++GN   NIMLVGDG R T I+ +RSV GG TT+NSAT    G  F+A+ +TF NTAG
Sbjct  321   NIEVGNDNHNIMLVGDGERKTIITSARSVKGGYTTYNSATAGFGGQRFVAKDMTFINTAG  380

Query  264   PENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQ  85
             P   QAV++RS +DLSVFY+ G  G+QDTL+ HSQRQF+++CYI GT+DFIFGNAAVVFQ
Sbjct  381   PLRGQAVSVRSSSDLSVFYRVGIHGFQDTLFIHSQRQFFRECYISGTIDFIFGNAAVVFQ  440

Query  84    NCMIYARKPMDKQKITITAQGRTDPNQN  1
             NCMI  R+P+  Q   ITAQGR DP QN
Sbjct  441   NCMILVRRPLHGQANVITAQGRGDPFQN  468



>ref|XP_009385345.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   383 bits (983),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/371 (54%), Positives = 261/371 (70%), Gaps = 9/371 (2%)
 Frame = -1

Query  1089  CSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAR  910
             CSQTP+P  C   ++     F   + +S F+ +  +  LD  + A  HA  +     +  
Sbjct  30    CSQTPYPQVCSSMVS-GVPLFAQSETQSGFRDLLLQTTLDRTLLAHKHASAMNLAPLDEP  88

Query  909   EKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGNS-RNV  733
              KAAWADC++L+EDTI  LN++L    +  DA TWLS A+ N +TC+ GF ELG S    
Sbjct  89    AKAAWADCLELFEDTIGHLNRSLGHSSSAEDAQTWLSAAMANQQTCKNGFAELGTSFLFT  148

Query  732   LPLISNNNVSQLIGNTLALNN---NGSVP--KQTYKDGFPAWVSLGDRRLLQASSP-VKP  571
               L   NN+S+ + N+LA+NN    G  P  ++    GFP WV   DR+LLQ+SS  +K 
Sbjct  149   SSLFMANNISESLSNSLAVNNAMPRGKAPGNRRLLSQGFPGWVKAADRKLLQSSSSTIKA  208

Query  570   DLVVAKDGSGNYKTIKDALDAAGK-RSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDG  394
             +LVVAKDGSG+YKTI +A+ A+ K RSG+ RFVI +K G+YNEN+ I N +KNIM++GDG
Sbjct  209   NLVVAKDGSGDYKTISEAVAASAKLRSGTSRFVILVKSGIYNENVVITNSMKNIMMIGDG  268

Query  393   MRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSV  214
             M  T ++GS++V  GSTTF SAT AV+G GFIA+ +TF+NTAGP+ HQAVALRSG+DLSV
Sbjct  269   MDATVVTGSKNVQDGSTTFRSATFAVSGGGFIARDMTFQNTAGPQKHQAVALRSGSDLSV  328

Query  213   FYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITI  34
             FY+C F+GYQDTLY +SQRQFY++C IYGTVDFIFG+A VVFQ+C IY RKPM  Q+ T+
Sbjct  329   FYRCSFKGYQDTLYVYSQRQFYRNCDIYGTVDFIFGDAVVVFQSCNIYVRKPMSGQQNTV  388

Query  33    TAQGRTDPNQN  1
             TAQGRTD N+N
Sbjct  389   TAQGRTDHNEN  399



>ref|XP_009400700.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=525

 Score =   382 bits (982),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 201/375 (54%), Positives = 256/375 (68%), Gaps = 13/375 (3%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             ++  WCS TPHP+ C+Y+L  +  H T PK K +F K++  +ALD  ++A++H KR GP 
Sbjct  34    DIEFWCSNTPHPEPCRYYLARNPYHGT-PKDKDQFYKLSLRLALDLTLRAQSHLKRRGPA  92

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDEK----CTQFDALTWLSTALTNLETCRTGFV  757
             CR + EK AW DC KLY +T+LQLN+TL       CT FD+ TWLS ALTN++TC  GF 
Sbjct  93    CRRSPEKTAWLDCWKLYANTVLQLNRTLAPPPGAGCTAFDSQTWLSAALTNIQTCPKGFR  152

Query  756   ELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGFPAWVSLGDRRLLQASSPV  577
             E   S  ++  +   NVS L+ N LA+N   +     Y+  F +W   G+RRLLQ S+  
Sbjct  153   ETRTSSELIGPVVRYNVSDLVSNCLAINRPAAA--DAYRGRFSSWTMFGNRRLLQLSTAA  210

Query  576   KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGR---FVIHIKRGVYNENLDIGNKLKNIML  406
               DLVVAKDGSGN++TIK+ALDAA KR    R   FVI I  GVYNE L + + L N+++
Sbjct  211   --DLVVAKDGSGNFRTIKEALDAASKRMQGRRGSKFVIRITAGVYNEYLQVVSSLSNLVM  268

Query  405   VGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGA  226
             VGDG+  T I+GSRSV  G TT + AT +V GDGF+A GITFRNT GP   QAVAL S +
Sbjct  269   VGDGIGKTIITGSRSVANGYTTLSCATFSVFGDGFVASGITFRNTFGP-GSQAVALLSAS  327

Query  225   DLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQ  46
             D SVFY+C  EGYQDTL+ ++QRQFY++C IYGT+DFIFGNAA V Q C IYAR+P   +
Sbjct  328   DRSVFYRCSIEGYQDTLFVYTQRQFYRECDIYGTIDFIFGNAAAVLQRCNIYARRPRHGE  387

Query  45    KITITAQGRTDPNQN  1
                ITAQGR+DPNQN
Sbjct  388   SNVITAQGRSDPNQN  402



>ref|XP_010672014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Beta vulgaris subsp. vulgaris]
Length=535

 Score =   383 bits (983),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 205/413 (50%), Positives = 269/413 (65%), Gaps = 24/413 (6%)
 Frame = -1

Query  1179  LFLVLASFSSFISVALSV------NPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAP  1018
             L LV  S   F S+A ++      +  A   ++++WC   PHP  CKYF+  +   F  P
Sbjct  4     LNLVFFSLILFTSIACTLSESQEYDEEAPPDDISKWCDGVPHPKACKYFMARTPGVFE-P  62

Query  1017  KRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL-  841
             K K++F++M  E+ALD A+ A+ H    G +C    E+AAWADC++LY  TI+QLN TL 
Sbjct  63    KEKADFRRMLVEVALDRAMAAQGHLWMWGQKCETHSERAAWADCIRLYSHTIIQLNYTLY  122

Query  840   ----DEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALN  673
                 +   T FDA TWLS++LTNLETC +G  ++  +  + P ++ N VS LI N LA+N
Sbjct  123   GLTSNSSFTDFDAQTWLSSSLTNLETCMSGSQDMNVTSFIWPHVAYN-VSDLISNGLAVN  181

Query  672   NN------GSVPKQTYKDGFPAWVSLGDRRLLQASSPV---KPDLVVAKDGSGNYKTIKD  520
                      S    T K  +P+WVS  +R+LLQ S  +   +   VVAKDGS  Y+T++ 
Sbjct  182   EGLIEEFINSTSLNTTK--YPSWVSHDERKLLQVSRKLAASRAAFVVAKDGSSPYRTVQS  239

Query  519   ALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTT  340
             A+DAA +    GR VIH++RGVY EN+ +G    +IMLVGDGMRYT ++ SRS   G TT
Sbjct  240   AIDAAARSRIRGRKVIHVRRGVYRENIYVGPYNNDIMLVGDGMRYTIVTSSRSARSGYTT  299

Query  339   FNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQ  160
             ++SAT  + G  F+A+ ITF+N AG +  QAVALRS +DLSVFY+C F GYQDTL+ HSQ
Sbjct  300   YSSATAGIDGLRFMARDITFQNAAGAQMGQAVALRSSSDLSVFYRCAFLGYQDTLFVHSQ  359

Query  159   RQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             RQFYK CYI+GT+D IFGNAAVVFQNCMIYAR P+  Q   ITAQGR DPNQN
Sbjct  360   RQFYKMCYIFGTIDIIFGNAAVVFQNCMIYARLPVFGQANVITAQGRVDPNQN  412



>ref|XP_006838619.1| hypothetical protein AMTR_s00002p00230630 [Amborella trichopoda]
 gb|ERN01188.1| hypothetical protein AMTR_s00002p00230630 [Amborella trichopoda]
Length=520

 Score =   382 bits (980),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 207/404 (51%), Positives = 268/404 (66%), Gaps = 20/404 (5%)
 Frame = -1

Query  1182  HLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSE  1003
             HL L L + +      +S+        V RWC +TPHP+ C   +  S     +PK K+ 
Sbjct  4     HLVLWLLTIA-----MVSITVEGTMANVKRWCIRTPHPESCTQLMGQS----PSPKSKAN  54

Query  1002  FKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEKC-T  826
                M  + A+D A+QA+    +    C N  E+ AW+DC +LY+ TI+ LN+TL     T
Sbjct  55    LHHMVVKAAMDRALQAQADNLKHSKSCTNKLERVAWSDCFELYKATIVHLNRTLRSPTRT  114

Query  825   QFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSV--PK  652
             + D  TWLS +LTNLETC  GF++L + +  +P     NVSQLI N LA+N   S   PK
Sbjct  115   ELDTQTWLSASLTNLETCTNGFIDL-DVQAQIPAKLAKNVSQLICNALAINKPPSSNGPK  173

Query  651   -----QTYKDGFPAWVSLGDRRLLQASS-PVKPDLVVAKDGSGNYKTIKDALDAAGKR-S  493
                  +   D FP WVS+GD+R LQA +   + +L VA DGSGNYKTI++AL  A  + S
Sbjct  174   TRLNGRFLHDRFPGWVSVGDQRFLQAKTLASQANLKVAADGSGNYKTIREALRVASNQIS  233

Query  492   GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVT  313
             G+ RF+IH+K GVYNEN+ I N +KN+M VGDG   T I+ SRSV GGSTTF+SAT AV+
Sbjct  234   GTQRFIIHVKAGVYNENVQITNSMKNLMFVGDGKGNTIITASRSVRGGSTTFSSATFAVS  293

Query  312   GDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYI  133
             GD F+A+ +TFRNTAGPENHQAVALR  +D + FY+C  +GYQDTL+A + RQFY++C I
Sbjct  294   GDRFMARDMTFRNTAGPENHQAVALRVSSDFAAFYRCSIDGYQDTLHADTLRQFYRECDI  353

Query  132   YGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             YGTVDFIFGNA  VFQNC I+ R+PM +QK TITAQGR+DPNQN
Sbjct  354   YGTVDFIFGNAIAVFQNCNIFVRRPMSQQKNTITAQGRSDPNQN  397



>emb|CDX83016.1| BnaA01g20160D [Brassica napus]
Length=593

 Score =   383 bits (984),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 202/388 (52%), Positives = 267/388 (69%), Gaps = 21/388 (5%)
 Frame = -1

Query  1107  GEVNRWCSQTPHPDQCKYFLTHSR-RHFTAPKR-KSEFKKMATEIALDTAVQAETHAKRL  934
             G++  WC++TPH   C Y+   S  R+ + P R +SEF +M   +ALD AV A     +L
Sbjct  83    GDMTWWCNKTPHAKTCTYYFQKSSDRNISRPPRFRSEFLRMLVHVALDQAVIAHAQTVKL  142

Query  933   GPRCRNAREKAAWADCVKLYEDTILQLNQTL---------DEKCTQFDALTWLSTALTNL  781
             G  C N ++K AW+DCV L+E+T+ QLNQT          D KC+ FDA TWLSTA TN+
Sbjct  143   GQSCTNNQQKGAWSDCVTLFENTVTQLNQTFNGLNPGASSDVKCSDFDAQTWLSTAQTNI  202

Query  780   ETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQ------TYKDGFPAWV  619
             ETC +G  +L  S  V+P ISN N+S LIGN LA+N  G + KQ       +K+ FP+WV
Sbjct  203   ETCLSGAEDLKVSNFVMPAISNKNLSDLIGNCLAVN--GVLMKQHNHKTANHKEYFPSWV  260

Query  618   SLGDRRLLQASSPVK--PDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNE  445
             S  +RRLL ++S  K  P LVVA+D SG++++I+ A++ AG+R    RFVI++K+GVY E
Sbjct  261   SRHERRLLVSASLAKSRPHLVVAQDRSGHFRSIQAAINFAGRRRIKSRFVIYVKKGVYRE  320

Query  444   NLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAG  265
             N+++GN   NIMLVG+G R T I+ +RSV GG TT+NSAT    G  F+A+ +TF NTAG
Sbjct  321   NIEVGNDNHNIMLVGEGERKTIITSARSVKGGYTTYNSATAGFGGQRFVAKDMTFINTAG  380

Query  264   PENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQ  85
             P   QAV++RS +DLSVFY+ G  G+QDTL+ HSQRQF+++CYI GT+DFIFGNAAVVFQ
Sbjct  381   PLRGQAVSVRSSSDLSVFYRVGIHGFQDTLFIHSQRQFFRECYISGTIDFIFGNAAVVFQ  440

Query  84    NCMIYARKPMDKQKITITAQGRTDPNQN  1
             NCMI  R+P+  Q   ITAQGR DP QN
Sbjct  441   NCMILVRRPLHGQANVITAQGRGDPFQN  468



>ref|XP_010058445.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=445

 Score =   377 bits (969),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 200/385 (52%), Positives = 271/385 (70%), Gaps = 8/385 (2%)
 Frame = -1

Query  1149  FISVALS-VNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIAL  973
             F+ + LS +    +  +V  WC++TP+P  CK+FLTH+    T   +KS+F K   ++AL
Sbjct  12    FVPLVLSQIASGYSFSDVESWCNETPYPQSCKHFLTHNPNQ-TPLNQKSDFLKALIQVAL  70

Query  972   DTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTA  793
             +    A  +    G RC N REK AWADC++LYE  +L LN+++D +CT  DA  WLS A
Sbjct  71    ERTQLARINMYLSGSRCHNKREKVAWADCLQLYEHAVLSLNRSIDHQCTPDDAQIWLSAA  130

Query  792   LTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSV-PKQTYKDGFPAWVS  616
             LT+L+TCRTGF+ELG    +LP + N+ +S+LI + L+ N    V P  T  + FP WV 
Sbjct  131   LTDLDTCRTGFIELGLPDKMLPSMCND-ISKLISDALSTNYVPYVMPNHT--NEFPTWVR  187

Query  615   LGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENL  439
              GDR+LL +SS   + +++VA+DGSGN+KTI +A+ AA KRSG+ R++I+IK G + E +
Sbjct  188   PGDRKLLHSSSVASRANILVAQDGSGNFKTIGEAVTAASKRSGTARYIIYIKAGTFEEKV  247

Query  438   DIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPE  259
             ++G +L NIM VGDG+  T I+G+RSV GG +T +SATVA+TG GFIAQ ITFRNTAG  
Sbjct  248   ELGLELTNIMFVGDGIGKTIITGNRSVGGGFSTLSSATVAITGVGFIAQDITFRNTAGAA  307

Query  258   NHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNC  79
             N QA+AL + ++ SVFY+CGFEGYQDTL AH+ RQFYK+C IYGT+DFIFG+AA VFQNC
Sbjct  308   NGQAIALHTSSETSVFYRCGFEGYQDTLNAHAGRQFYKECNIYGTIDFIFGDAAAVFQNC  367

Query  78    MIYARKPMDKQKITITAQGRTDPNQ  4
              +YAR    K   TIT QGR++ NQ
Sbjct  368   NVYARNSPSKIN-TITTQGRSEKNQ  391



>gb|AES69711.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=526

 Score =   380 bits (977),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 202/399 (51%), Positives = 274/399 (69%), Gaps = 11/399 (3%)
 Frame = -1

Query  1176  FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFK  997
             + VL   SS  S+  S   P+++  ++ WC+ TPHP  CK++ T    HF   K + EF+
Sbjct  8     WFVLFFLSSIFSIVSSRKGPSSS-NIDWWCNLTPHPKPCKHYTTQMNNHFKI-KHRIEFR  65

Query  996   KMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD------E  835
             +M  ++AL+ A+  +  A     +  ++  K    DC+KLYE+TI  LN+TL+      +
Sbjct  66    EMLVQLALNQALTMQKEAHENSQQQNSSVHKTVHGDCLKLYENTIFHLNRTLEGLNNASK  125

Query  834   KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP  655
              C+  DA TWL+T+LTN+ETC++G +EL N+++    I   NV+++I N LA+N +    
Sbjct  126   NCSPNDAQTWLTTSLTNIETCKSGALEL-NAQD-FNFIMQANVTEMIRNILAINMHFLNH  183

Query  654   KQTYKDG-FPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRF  478
             K   ++G  P W S+ +R+LLQ+ SP+K +LVVAKDGSG YKT++ AL+AA KR    R+
Sbjct  184   KTEIEEGSLPNWFSVHERKLLQSKSPMKFNLVVAKDGSGQYKTVQAALNAAAKRKYKTRY  243

Query  477   VIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFI  298
             VIH+K+GVY EN+++     NIMLVGDGM+ T I+ SRSV GG TT++SAT  + G  FI
Sbjct  244   VIHVKKGVYKENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGFTTYSSATAGIDGLHFI  303

Query  297   AQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVD  118
             A+ ITF+NTAGP   QAVALRS +DLSVFY+C   GYQDTL AH+QRQFY+ C+IYGTVD
Sbjct  304   ARDITFQNTAGPHKGQAVALRSASDLSVFYRCTISGYQDTLMAHAQRQFYRQCFIYGTVD  363

Query  117   FIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             FIFGNAAVVFQNC I+ARKP+D Q   ITAQGR DP QN
Sbjct  364   FIFGNAAVVFQNCNIFARKPLDGQANMITAQGRGDPFQN  402



>ref|XP_009374496.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Pyrus x bretschneideri]
Length=480

 Score =   378 bits (971),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 200/358 (56%), Positives = 260/358 (73%), Gaps = 10/358 (3%)
 Frame = -1

Query  1050  LTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYE  871
             +++SR HF  PK  SEF+KM  ++AL+ A+ A T+  + G  C+N +EKAAWADC+KL+ 
Sbjct  1     MSNSRHHFR-PKHTSEFRKMLVQVALERALSAITYTSQYGQNCQNDKEKAAWADCLKLFH  59

Query  870   DTILQLNQTLDE-----KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPL-ISNNN  709
             +T+ QLN TL+       C+ FDA TWLS ALTN+ETCR G +EL  +  + P+  SNNN
Sbjct  60    NTVSQLNVTLEGLGTKLNCSNFDAQTWLSAALTNIETCRVGSLELNVTNFITPIYTSNNN  119

Query  708   VSQLIGNTLALNNN--GSVPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNY  535
             VS+LI N+LA+ +   G+       + FP WVS  DRRLLQ ++ ++ +LVVAKDGSGN+
Sbjct  120   VSELISNSLAIGSQLLGTEESHNESEKFPNWVSKHDRRLLQNAN-IRANLVVAKDGSGNF  178

Query  534   KTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvv  355
             +T++ ALDAA +R    +F+I++K+GVY EN+ + N    IMLVG G+RYT I+ SRSV 
Sbjct  179   RTVQAALDAAARRRVQSKFIIYVKKGVYTENIQVSNTNSKIMLVGAGIRYTVITSSRSVS  238

Query  354   ggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTL  175
             GG TT+NSAT  + G GFIA+GITFRNTAGP   QAVAL S +DLSVFY+C F+GYQDT 
Sbjct  239   GGYTTYNSATAGINGPGFIARGITFRNTAGPLKGQAVALMSASDLSVFYRCAFQGYQDTH  298

Query  174   YAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
                SQRQFY++CYI+GT+DFIFGNAA VFQNC+IY RKP+  Q   ITAQGR DP QN
Sbjct  299   MVPSQRQFYRECYIFGTIDFIFGNAAAVFQNCIIYVRKPLWGQVNVITAQGRNDPFQN  356



>ref|XP_003599460.1| Pectinesterase [Medicago truncatula]
Length=528

 Score =   380 bits (975),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 201/401 (50%), Positives = 272/401 (68%), Gaps = 13/401 (3%)
 Frame = -1

Query  1176  FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFK  997
             + VL   SS  S+  S   P+++  ++ WC+ TPHP  CK++ T    HF   K + EF+
Sbjct  8     WFVLFFLSSIFSIVSSRKGPSSS-NIDWWCNLTPHPKPCKHYTTQMNNHFKI-KHRIEFR  65

Query  996   KMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD------E  835
             +M  ++AL+ A+  +  A     +  ++  K    DC+KLYE+TI  LN+TL+      +
Sbjct  66    EMLVQLALNQALTMQKEAHENSQQQNSSVHKTVHGDCLKLYENTIFHLNRTLEGLNNASK  125

Query  834   KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN---NG  664
              C+  DA TWL+T+LTN+ETC++G +EL N+++    I   NV+++I N LA+N    N 
Sbjct  126   NCSPNDAQTWLTTSLTNIETCKSGALEL-NAQD-FNFIMQANVTEMIRNILAINMHFLNH  183

Query  663   SVPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSG  484
                 +  +   P W S+ +R+LLQ+ SP+K +LVVAKDGSG YKT++ AL+AA KR    
Sbjct  184   KTETEIEEGSLPNWFSVHERKLLQSKSPMKFNLVVAKDGSGQYKTVQAALNAAAKRKYKT  243

Query  483   RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDG  304
             R+VIH+K+GVY EN+++     NIMLVGDGM+ T I+ SRSV GG TT++SAT  + G  
Sbjct  244   RYVIHVKKGVYKENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGFTTYSSATAGIDGLH  303

Query  303   FIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGT  124
             FIA+ ITF+NTAGP   QAVALRS +DLSVFY+C   GYQDTL AH+QRQFY+ C+IYGT
Sbjct  304   FIARDITFQNTAGPHKGQAVALRSASDLSVFYRCTISGYQDTLMAHAQRQFYRQCFIYGT  363

Query  123   VDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             VDFIFGNAAVVFQNC I+ARKP+D Q   ITAQGR DP QN
Sbjct  364   VDFIFGNAAVVFQNCNIFARKPLDGQANMITAQGRGDPFQN  404



>ref|XP_009107426.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
isoform X2 [Brassica rapa]
Length=534

 Score =   380 bits (975),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 207/424 (49%), Positives = 268/424 (63%), Gaps = 37/424 (9%)
 Frame = -1

Query  1206  LNLEMSKIH---LFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCK-YFLTHS  1039
             +++ M +I+   L+L+   F       +S +  +  G +++WC+QTP+PD CK YF  H+
Sbjct  1     MHVMMHRIYFLSLYLISLLFLCLHPFTISADDNSTTG-IDKWCNQTPYPDPCKCYFKNHN  59

Query  1038  RRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTIL  859
                F  P + SEF+ M  E  +D A+ A     R    C + R++A +ADC+ LYEDTI+
Sbjct  60    --GFRLPTQLSEFRLMLVEATMDRAISARDELARSSGNCTDCRKQAVFADCINLYEDTIV  117

Query  858   QLNQTL---------DEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNV  706
             QL +TL          +KCT FDA TWLSTALTN+ETCR G  +L  S  + P++SN  +
Sbjct  118   QLTRTLAGVAPKAGAGKKCTDFDAQTWLSTALTNIETCRRGSSDLNVSDFITPIVSNTKI  177

Query  705   SQLIGNTLALNN------NGSVPKQTYKDGFPAWVSLGDRRLLQASSP--VKPDLVVAKD  550
             S LI N LA+N       N S      KD FP WVS  +RRLLQ  S   V+ ++VVAKD
Sbjct  178   SNLISNCLAVNGALLPTGNNSTTTADGKD-FPTWVSGKERRLLQLQSARAVRANIVVAKD  236

Query  549   GSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIs  373
             GSG   T++ A+D AG+R   S RFVI++KRG+Y EN+++     NIMLVGDGMR T I 
Sbjct  237   GSGQVTTVQAAIDVAGRRKLMSKRFVIYVKRGIYQENINVRLNNDNIMLVGDGMRSTII-  295

Query  372   gsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFE  193
                       T   +   + G  FIA+G+TFRNTAGP   QAVALRS +DLS+FYKC  E
Sbjct  296   ----------TGGRSVKGIEGLHFIAKGLTFRNTAGPAKGQAVALRSSSDLSIFYKCSIE  345

Query  192   GYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTD  13
             GYQDTL  HSQRQFY++CYIYGT+DFIFGNAAVVFQNC+I  R+P+  Q   ITAQGR D
Sbjct  346   GYQDTLMVHSQRQFYRECYIYGTIDFIFGNAAVVFQNCIILPRRPLHGQSNVITAQGRAD  405

Query  12    PNQN  1
             P QN
Sbjct  406   PFQN  409



>ref|XP_002318284.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE96504.2| pectinesterase family protein [Populus trichocarpa]
Length=533

 Score =   379 bits (974),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 208/405 (51%), Positives = 277/405 (68%), Gaps = 13/405 (3%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             +K+ LF  L  FSS +S A S +  A    +  WC+ TPHP  C Y ++HS  HF+   R
Sbjct  9     AKVRLFATLMFFSSMLSFAASKSTEA---NITWWCNHTPHPSTCMYHMSHSHHHFSLKHR  65

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD--  838
              S+F+ M+ ++AL++A+ A+    +    C N  ++A W+DC+KL+ +TILQLN+TL   
Sbjct  66    -SQFRIMSIQLALESALIAQGQVSQFEQNCENQNQRAVWSDCLKLHSNTILQLNRTLIGL  124

Query  837   EK----CTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNN  670
             EK    CT  DA TWLSTALTN++TCRTG ++L  +   +P  S N +S+LI NTLA+N 
Sbjct  125   EKKRLPCTDLDAQTWLSTALTNIQTCRTGSLDLNVTDFTMPAASKN-LSELISNTLAING  183

Query  669   NGSVPKQTYKDG-FPAWVSLGDRRLLQASS-PVKPDLVVAKDGSGNYKTIKDALDAAGKR  496
                  +     G FP+W S  +RRLLQ++S   K +LVV+K G GN++TI+ A+DAA KR
Sbjct  184   VSLATEDNNTQGYFPSWFSGQNRRLLQSTSIAAKANLVVSKSGLGNFRTIQAAIDAASKR  243

Query  495   SGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAV  316
                 RF+I++KRGVY EN+ +     NI LVGDG+R T I+ SRSV  G TT++SAT  +
Sbjct  244   IFRTRFIIYVKRGVYRENIVVRVNSNNIWLVGDGLRDTIITSSRSVGAGYTTYSSATAGI  303

Query  315   TGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCY  136
              G  F+A+GITF NTAGP   QAVALRS +DLSVFY+C  +GYQDTL+ HSQRQFY++CY
Sbjct  304   DGLRFVARGITFINTAGPLKGQAVALRSASDLSVFYRCSIQGYQDTLFVHSQRQFYRECY  363

Query  135   IYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             I+GT+DFIFGNAAVVFQN +IY R+P+  Q   ITAQGR DP QN
Sbjct  364   IFGTIDFIFGNAAVVFQNSIIYVRRPLKGQANMITAQGRNDPFQN  408



>ref|XP_003540571.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33-like 
[Glycine max]
 gb|KHN32446.1| Putative pectinesterase/pectinesterase inhibitor 33 [Glycine 
soja]
Length=531

 Score =   379 bits (973),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 198/395 (50%), Positives = 271/395 (69%), Gaps = 12/395 (3%)
 Frame = -1

Query  1155  SSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIA  976
             SS  S+A S    +    ++ WC+QTP+P+ CKY++ HS  H+   K KSEF+ +   +A
Sbjct  15    SSVFSIASSRRRHSNNSNIDWWCNQTPYPETCKYYVKHSHYHYKL-KHKSEFRTILVHLA  73

Query  975   LDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD-----EKCTQFDAL  811
             L+ AV     A+ LG      ++K+ + DC+KLY++T+  LN+TL+       C+ FDA 
Sbjct  74    LERAVIMRRKARELGRNGVTKKQKSVFRDCLKLYDNTVFHLNRTLEGLHVKRSCSPFDAQ  133

Query  810   TWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTY----  643
             TWLSTA TN+ETC+ G +ELG   +++P     N++++I N L +N      K+ +    
Sbjct  134   TWLSTARTNIETCQNGALELGVRDSMVP-TERCNLTEIISNGLFVNWAFLKYKEAHYTAD  192

Query  642   -KDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHI  466
              +DGFP W S+ +R+LLQ+SS ++  LVVAKDGSG++++I+ A++AA +R    RF+IH+
Sbjct  193   AEDGFPRWFSMHERKLLQSSSSIRAHLVVAKDGSGHFRSIQAAINAAARRRFKSRFIIHV  252

Query  465   KRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGI  286
             KRGVY EN+++     N+MLVGDGMR T I+  RSV  G TT++SAT  + G  FIA+ I
Sbjct  253   KRGVYRENIEVDKTNDNVMLVGDGMRNTIITSGRSVRAGYTTYSSATAGIDGLHFIARDI  312

Query  285   TFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFG  106
             TFRNTAGP   QAVALRS +DLSVFY+C  EGYQDTL  H+QRQFY+ CYIYGTVDFIFG
Sbjct  313   TFRNTAGPLKGQAVALRSASDLSVFYRCAIEGYQDTLMVHAQRQFYRGCYIYGTVDFIFG  372

Query  105   NAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             NAAVVFQNC+I  R+P++ Q   ITAQGR DP QN
Sbjct  373   NAAVVFQNCVILVRRPLNGQANMITAQGRDDPFQN  407



>ref|XP_010271268.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   378 bits (971),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 200/399 (50%), Positives = 271/399 (68%), Gaps = 20/399 (5%)
 Frame = -1

Query  1149  FISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALD  970
             F+ ++L++       E    CSQTP+P+ C+ F++ ++   T  + +  F++ A    +D
Sbjct  13    FVCISLALVIGVVNSETISSCSQTPYPEICESFISSNKPLATLEETQFSFRESALSFTMD  72

Query  969   TAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEK--CTQFDALTWLST  796
              A++A      +     + + K AWADCV+LY DT+ QLN+T+  K   +  DA TWLS 
Sbjct  73    QALRAHGLISAMDLSSFDDKAKVAWADCVELYADTVTQLNRTMGSKNPLSWSDAQTWLSA  132

Query  795   ALTNLETCRTGFVELG--NSRNVLPLISNNNVSQLIGNTLALNNNGSVP-----------  655
             A+TN +TC+ GF EL   +  +  P + +N  S+++ N+LA+N   +             
Sbjct  133   AITNEQTCQNGFTELNLPSYLSSFPFMLSN-FSKMVSNSLAINKAAASSVASLMGKQGGN  191

Query  654   KQTYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRF  478
             ++   DGFP WVS  DR+LLQ+SS   + D+VVA DGSGNY+TI  A+ A+ KRSG  RF
Sbjct  192   RRLLSDGFPTWVSAADRKLLQSSSAASQADVVVAADGSGNYRTISQAVAASSKRSGK-RF  250

Query  477   VIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFI  298
             VI++KRGVY EN++I  K  NIML+GDG+  T ++GS++V  GSTTF SATVAVTG GFI
Sbjct  251   VIYVKRGVYKENVEI--KASNIMLIGDGIDATIVTGSKNVQDGSTTFRSATVAVTGGGFI  308

Query  297   AQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVD  118
             A+ +TF+NTAGP+ HQAVALRSG+DLSVFY+C F+GYQDTLY +SQRQFY+DC IYGTVD
Sbjct  309   ARDMTFQNTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVD  368

Query  117   FIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             FIFG+A  V QNC IY RKPM  QK T+TAQGR DPN+N
Sbjct  369   FIFGDAVAVLQNCNIYVRKPMSGQKNTVTAQGRKDPNEN  407



>ref|XP_010482487.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 60 
[Camelina sativa]
Length=537

 Score =   378 bits (971),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 201/383 (52%), Positives = 262/383 (68%), Gaps = 21/383 (5%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             ++ WC QTP+P  CK YF+ HS   F  P + SEF+ +  E A+  AV A    K     
Sbjct  35    IDPWCDQTPYPYPCKRYFIKHS--GFRQPTQLSEFRVLLVEAAMARAVSARN--KLTNSS  90

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD---------EKCTQFDALTWLSTALTNLETC  772
               + +++A  +DC++L+ DT++QLN+TL          ++CT FDA TWLSTALTN ETC
Sbjct  91    KTDGKKQAVLSDCLELFGDTVMQLNRTLQGVSSKTSVGKRCTDFDAQTWLSTALTNTETC  150

Query  771   RTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYK-----DGFPAWVSLGD  607
             R G  +L  +  V P++SN  +S LI N LA+N      ++         GFP WVS  +
Sbjct  151   RRGSTDLNVTDFVTPIVSNTKISHLISNCLAINGALLTARKNESATGDSRGFPTWVSGKE  210

Query  606   RRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNENLDIG  430
             RRLLQ+ S V+ ++VVAKDGSG++KT++ A+D AG+R   SGRFVI++KRG+Y EN+D+ 
Sbjct  211   RRLLQSQS-VRANIVVAKDGSGHFKTVQAAIDLAGRRKVTSGRFVIYVKRGIYQENIDVR  269

Query  429   NKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQ  250
                 N+ML+GDGMRYT I+G RSV GG TT++SAT  + G  FIA+GI FRNTAGP   Q
Sbjct  270   FNNDNVMLIGDGMRYTIITGGRSVKGGYTTYSSATAGIEGLHFIAKGIAFRNTAGPAKGQ  329

Query  249   AVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIY  70
             AVALRS +DLS+FY+C  EGYQDTL  HSQRQFY++CYIYGTVDFIFGNAAVV QNC+I 
Sbjct  330   AVALRSSSDLSIFYRCSIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAAVVLQNCIIL  389

Query  69    ARKPMDKQKITITAQGRTDPNQN  1
              R+P+  Q   ITAQGR+D  QN
Sbjct  390   PRRPLKGQANVITAQGRSDLFQN  412



>gb|KEH22545.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=527

 Score =   377 bits (968),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 204/400 (51%), Positives = 274/400 (69%), Gaps = 12/400 (3%)
 Frame = -1

Query  1176  FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFK  997
               +L   SS  S+A S   P+++  ++ WC+ TPHP  CK++ T    HF   K + EF+
Sbjct  8     LFMLFFLSSIFSIASSRKGPSSS-NIDWWCNLTPHPKPCKHYTTQMNNHFKI-KHRVEFR  65

Query  996   KMATEIALDTAVQAETHAKRLGPRCRNAR-EKAAWADCVKLYEDTILQLNQTLD------  838
             +M  ++AL+ A+  +  A+    + +N+   K   ADC KL+E+TI  LN TL+      
Sbjct  66    EMLVKLALNQALTMQKEAQDNSQQQQNSSVHKTVHADCFKLFENTIFHLNHTLEGLNNAS  125

Query  837   EKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNG-S  661
             + C+  D  TWL+T+LTN+ETC++G +EL N+++    I   NV ++I N LA+N +   
Sbjct  126   KNCSPNDVQTWLTTSLTNIETCKSGALEL-NAQD-FNFIMQTNVIEMIRNILAINMHFLK  183

Query  660   VPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGR  481
               K+T +  FP W S+ +R+LLQ+ SPVK ++VVAKDGSG YKT++ AL+AA KR    R
Sbjct  184   HNKETEEGSFPNWFSMHERKLLQSKSPVKYNIVVAKDGSGQYKTVQAALNAAAKRKYKTR  243

Query  480   FVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGF  301
             FVIH+K+GVY EN+++     NIMLVGDGM+ T I+ SRSV GG TT++SAT  + G  F
Sbjct  244   FVIHVKKGVYKENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGFTTYSSATAGIDGLHF  303

Query  300   IAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTV  121
             IA+ ITF+NTAGP   QAVALRS +DLSVFY+C   GYQDTL AH+QRQFY+ C+IYGTV
Sbjct  304   IARDITFQNTAGPHKGQAVALRSASDLSVFYRCAISGYQDTLMAHAQRQFYRQCFIYGTV  363

Query  120   DFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             DFIFGNAAVVFQNC I+ARKP+D Q   ITAQGR DP QN
Sbjct  364   DFIFGNAAVVFQNCNIFARKPLDGQANMITAQGRGDPFQN  403



>ref|XP_010266280.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   376 bits (965),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 212/417 (51%), Positives = 280/417 (67%), Gaps = 29/417 (7%)
 Frame = -1

Query  1194  MSKIHLFLVLASFS-SFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAP  1018
             M K+ L   + S S ++ ++   VN  A +      CSQTP+P+ C+ F+T S+   T  
Sbjct  1     MDKLALLGFVMSVSLAYFAIIGVVNADAISS-----CSQTPYPEICESFIT-SKPLVTLD  54

Query  1017  KRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD  838
             + +  F++ A  + LD A +A      +     + + K AWADCV+LY DT+ QLN+++ 
Sbjct  55    ETQFNFRETALTVTLDQAQRAHGLISAMDLGSFDDKSKMAWADCVELYADTVSQLNRSMA  114

Query  837   EK--CTQFDALTWLSTALTNLETCRTGFVELGNSRNV--LPLISNNNVSQLIGNTLALNN  670
              K      DA TWLS A+TN +TCR GF+EL +S  +   P +  N +S+++ N+LA+N 
Sbjct  115   SKNPLIWSDAQTWLSAAITNEQTCRNGFIELSSSSQLSSFPFMLTN-LSKMVSNSLAINK  173

Query  669   -------------NGSVPKQTYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYK  532
                           G+  ++   DGFP WVS  DR+LLQ+S    + D+VVA DGSGNYK
Sbjct  174   AAASTSSASLFGKQGANNRRLLSDGFPTWVSAADRKLLQSSGAASQADVVVAADGSGNYK  233

Query  531   TIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvg  352
             TI +A+ A+ KRSGS RFVI++KRGVY EN++I  K  NIML+GDG+  T ++GSR+V  
Sbjct  234   TISEAVAASSKRSGS-RFVIYVKRGVYKENVEI--KASNIMLIGDGIDATIVTGSRNVQD  290

Query  351   gSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLY  172
             GSTTF SATVAVTG GFIA+ +TF NTAGP+ HQAVALRSG+DLSVFY+C  +GYQDTLY
Sbjct  291   GSTTFRSATVAVTGGGFIARDMTFENTAGPQKHQAVALRSGSDLSVFYRCSLKGYQDTLY  350

Query  171   AHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
              +SQRQFY+DC IYGTVDFIFG+A  V QNC IY RKPM  QK T+TAQGRTDPN+N
Sbjct  351   VYSQRQFYRDCDIYGTVDFIFGDAVAVIQNCNIYVRKPMSGQKNTVTAQGRTDPNEN  407



>ref|XP_004499656.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33-like 
[Cicer arietinum]
Length=524

 Score =   375 bits (964),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 203/399 (51%), Positives = 270/399 (68%), Gaps = 13/399 (3%)
 Frame = -1

Query  1176  FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFK  997
             F +L   SS  S+  S   P+++  ++ WC+QTPHP  CK++ T    HF   K KSEF+
Sbjct  8     FFILLLLSSIFSIVSSRKGPSSS-NIDWWCNQTPHPKPCKHYTTQMNNHFKI-KHKSEFR  65

Query  996   KMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD------E  835
              M  ++AL  A+  +  ++    +  ++  +    DC+KL+ +TI  LN+T +      +
Sbjct  66    GMLVQLALKQALIMQKESQ--NSQQNSSVHQTVHDDCLKLFRNTIFHLNRTFEGLNNASK  123

Query  834   KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVP  655
              C+  DA TWL+T+LTN+ETC+ G  EL N+++    I   NV ++I N+LA+N      
Sbjct  124   NCSPDDAQTWLTTSLTNIETCKNGAFEL-NAKD-FNFIVQTNVIEMIRNSLAINMYFMKH  181

Query  654   KQTYKDGF-PAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRF  478
              +  K+GF P W S  +R+LL A+S VK +LVVAKDGSGN+KT++ ALDA+ KR    RF
Sbjct  182   NRETKEGFYPNWFSRHERKLLNANSIVKANLVVAKDGSGNFKTVQAALDASAKRKYKTRF  241

Query  477   VIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFI  298
             VIHIK+GVY EN+++     NIMLVGDGM+ T I+ SRSV GG TT++SAT  + G  FI
Sbjct  242   VIHIKKGVYRENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGYTTYSSATAGIDGLHFI  301

Query  297   AQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVD  118
             A+ ITF+NTAGP+  QAVALRS +DLSVFY+C   GYQDTL AH+QRQFY+ CYIYGTVD
Sbjct  302   ARDITFQNTAGPQKGQAVALRSASDLSVFYRCAISGYQDTLMAHAQRQFYRQCYIYGTVD  361

Query  117   FIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             FIFGNAAVVFQNC I+ RKP+D Q   ITAQGR DP QN
Sbjct  362   FIFGNAAVVFQNCNIFVRKPLDGQANMITAQGRGDPFQN  400



>ref|XP_009132604.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Brassica rapa]
Length=527

 Score =   375 bits (963),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 198/383 (52%), Positives = 256/383 (67%), Gaps = 24/383 (6%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             +++WC +TP+PD CK YF+  +R  F  P + S+F+ M  E A+  A+ A          
Sbjct  28    IDQWCYKTPYPDPCKRYFI--NRNDFRPPTQLSDFRVMLVEAAMHRAISARDALASSSLN  85

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLD-----EKCTQFDALTWLSTALTNLETCRTGF  760
             C + +++A + DC+ LY DTI+QLN+TL        CT FDA TWLSTALTN ETCR G 
Sbjct  86    CTDGQKQAVFGDCIDLYGDTIMQLNRTLKCMSPKASCTDFDAQTWLSTALTNTETCRHGT  145

Query  759   VELGNSRNVLPLISNNNVSQLIGNTLALN-------NNGSVPKQTYKDGFPAWVSLGDRR  601
              +   S  + P++S   +S L+ N LA+N       NNG+      +  FP WVS  +RR
Sbjct  146   TDFNVSDFITPIVSKTEISNLMSNCLAVNGALLTAANNGN------RKDFPTWVSGKERR  199

Query  600   LLQASS--PVKPDLVVAKDGSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNENLDIG  430
             LLQ+ S   V+ +LVVAKDGSG+  T++ A+D AG+R   SGRF+I++KRGVY EN+++ 
Sbjct  200   LLQSQSERAVRANLVVAKDGSGHVTTVQAAIDVAGRRKVTSGRFIIYVKRGVYEENINVR  259

Query  429   NKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQ  250
                 NIMLVGDGMR T I+G R V  G TT+NSAT  + G  FIA+G+TFRNTAGP   Q
Sbjct  260   RNNDNIMLVGDGMRSTIITGYRRVKDGYTTYNSATAGIEGLHFIAKGLTFRNTAGPAKGQ  319

Query  249   AVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIY  70
             AVALRS +DLS+FY+C  EGYQDTL  HSQRQFY++CYIYGTVDFIFGNAA VFQNC+I 
Sbjct  320   AVALRSSSDLSIFYQCSIEGYQDTLLVHSQRQFYRECYIYGTVDFIFGNAAAVFQNCLIL  379

Query  69    ARKPMDKQKITITAQGRTDPNQN  1
              R+P++ Q   ITAQ R  P QN
Sbjct  380   PRRPLEGQANVITAQARAYPFQN  402



>ref|XP_003598225.1| Pectinesterase [Medicago truncatula]
 gb|AES68476.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=527

 Score =   375 bits (963),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 204/400 (51%), Positives = 275/400 (69%), Gaps = 12/400 (3%)
 Frame = -1

Query  1176  FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFK  997
               +L   SS  S+A S   P+++  ++ WC+ TPHP  CK++ T    HF   K + EF+
Sbjct  8     LFMLFFLSSIFSIASSRKGPSSS-NIDWWCNLTPHPKPCKHYTTQMNNHFKI-KHRVEFR  65

Query  996   KMATEIALDTAVQAETHAKRLGPRCRNA-REKAAWADCVKLYEDTILQLNQTLD------  838
             +M  ++AL  A+  +  A+    + +N+   K    DC+KL+E+TI  LN+TL+      
Sbjct  66    EMLVQLALKQALTMQKEAQENSQQQQNSFVHKTVHGDCLKLFENTIFHLNRTLEGLNNAS  125

Query  837   EKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNG-S  661
             + C+  DA TWL+T+LTN+ETC++G +EL N+++    I   NV+++I N LA+N +   
Sbjct  126   KNCSPNDAQTWLTTSLTNIETCKSGALEL-NAQD-FDFIMQTNVTEMIRNILAINMHFLK  183

Query  660   VPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGR  481
               K+T +  FP W S+ +R+LLQ+  PVK +LVVAKDGSG YKT++ AL+AA KR    R
Sbjct  184   HSKETEEGSFPNWFSVHERKLLQSKGPVKYNLVVAKDGSGQYKTVQAALNAAAKRKYKTR  243

Query  480   FVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGF  301
             FVIH+K+GVY EN+++     NIMLVGDGM+ T I+ SRSV GG TT++SAT  + G  F
Sbjct  244   FVIHVKKGVYRENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGFTTYSSATAGIDGLHF  303

Query  300   IAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTV  121
             IA+ ITF+NTAGP   QAVALRS +DLSVFY+C   GYQDTL AH+QRQFY+ C+IYGTV
Sbjct  304   IARDITFQNTAGPHKGQAVALRSASDLSVFYRCAISGYQDTLMAHAQRQFYRQCFIYGTV  363

Query  120   DFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             DFIFGNAAVVFQNC I+ARKP+D Q   ITAQGR DP QN
Sbjct  364   DFIFGNAAVVFQNCNIFARKPLDGQANMITAQGRGDPFQN  403



>ref|XP_008775930.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   374 bits (961),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 209/407 (51%), Positives = 280/407 (69%), Gaps = 24/407 (6%)
 Frame = -1

Query  1194  MSKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPK  1015
             M+K+       S    ISVA S NP  +       C +TPHP  C   ++ S       K
Sbjct  1     MAKLITHFFALSLIMVISVATS-NPILS-------CQETPHPHVCSSVISTSPLA-AQTK  51

Query  1014  RKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDE  835
              +S F+ +A + A+D A +A      +     + + KAAWADC++L +DTI +LN+++  
Sbjct  52    TQSGFRNLALQAAMDRAARALELVSAMDVSSLDGQAKAAWADCLELCQDTIGKLNRSMSS  111

Query  834   KCTQFDALTWLSTALTNLETCRTGFVELGNS--RNVLPLISNNNVSQLIGNTLALNN---  670
                  D+ TWLS A+ N +TCR GF+ELG+S   + LP  S N +S+L+ N+LA+N    
Sbjct  112   PSYD-DSQTWLSAAMANHQTCRNGFIELGSSFPLDSLPFTSYN-ISELLSNSLAINKAMA  169

Query  669   ---NGSVPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGK  499
                +G + ++   DGFP W+S  DR+LLQ+SS +  DLVVAKDGSG+Y TI  A+ AA K
Sbjct  170   PAKSGGI-RRLLSDGFPNWLSAADRKLLQSSS-INADLVVAKDGSGDYDTISAAIAAATK  227

Query  498   RS-GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATV  322
             +S G+ RFVIH+K GVYNEN  +G  +KN+M++GDG+  T ++GS++V  GSTTF+SAT 
Sbjct  228   QSSGTSRFVIHVKAGVYNEN--VGTSIKNLMIIGDGIDATVVTGSKNVQDGSTTFSSATF  285

Query  321   AVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKD  142
             AVTGDGFIA+G+TF+NTAGP+ +QAVA RS +DLS +Y+C FEGYQDTLY +SQRQFY+D
Sbjct  286   AVTGDGFIARGMTFQNTAGPQKNQAVAFRSSSDLSAYYQCSFEGYQDTLYVYSQRQFYRD  345

Query  141   CYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             C IYGTVDFIFG+AAVVFQNC +Y RKPM  QK T+TAQGRTDPN+N
Sbjct  346   CNIYGTVDFIFGDAAVVFQNCDMYVRKPMSGQKNTVTAQGRTDPNEN  392



>gb|KGN56178.1| hypothetical protein Csa_3G088980 [Cucumis sativus]
Length=529

 Score =   374 bits (961),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 208/415 (50%), Positives = 275/415 (66%), Gaps = 30/415 (7%)
 Frame = -1

Query  1191  SKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKR  1012
             S   +  +  +F + +S  +S NP      + +WC  TPHP  C   ++  +     P+ 
Sbjct  3     SHYKILFISITFFTLLSNNVSANP------IIKWCKTTPHPRVCVSLMSPIK---PPPQN  53

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL---  841
             + EF++MA +  L+ A +A  +  R GP C+ +R++ AW DC KLY D +LQLN+TL   
Sbjct  54    RREFRQMAIQTTLEKAAEARAYTARFGPTCKTSRQRTAWTDCFKLYNDVVLQLNRTLHCV  113

Query  840   --DE-----KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTL  682
               DE      CT FDA TWLS+ALT+++ C +G  +L  +  + P I   NVS++I N L
Sbjct  114   VTDEAIHRRSCTDFDAQTWLSSALTDIDLCNSGAADLNVTDFITP-IKCLNVSKMISNCL  172

Query  681   ALNNNGSVPKQ--TYKDG----FPAWVSLGDRRLLQASSP--VKPDLVVAKDGSGNYKTI  526
             A+N  G + ++   Y DG    FP WVS GDR+LL+ S P  V+ +LVVAKDGSG ++ +
Sbjct  173   AING-GFLEEEGVKYDDGRNGSFPMWVSEGDRKLLE-SRPGRVRANLVVAKDGSGTFRRV  230

Query  525   KDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggS  346
             + A+DAA +R G GRF+I++KRGVY EN+++GN   NIMLVGDGMR+T I+  RSV  G 
Sbjct  231   QAAIDAAARRRGRGRFIIYVKRGVYRENIEVGNDNGNIMLVGDGMRFTVITSGRSVAAGF  290

Query  345   TTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAH  166
             TTF+SAT  + G GFIA+ I F NTAGP   QAVALRS +DLSVF++C FEGYQDTL   
Sbjct  291   TTFSSATAGIQGPGFIARDIRFVNTAGPRMGQAVALRSSSDLSVFHRCSFEGYQDTLMVL  350

Query  165   SQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             SQRQFYK CY+YGT+DFIFGNAAVV QNCMIY R+P+  Q   ITAQGR DP QN
Sbjct  351   SQRQFYKQCYVYGTIDFIFGNAAVVLQNCMIYVRRPLKGQVNVITAQGREDPFQN  405



>ref|XP_003523880.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33-like 
[Glycine max]
Length=531

 Score =   374 bits (960),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 199/385 (52%), Positives = 262/385 (68%), Gaps = 15/385 (4%)
 Frame = -1

Query  1122  PPAAAGEVNRWCSQTPHPDQCKYFL-THSRRHFTAPKRKSEFKKMATEIALDTAVQAETH  946
             PPA++  ++ WC+ TPHP+QCK  L T  + H    K K+ F++M  + AL+ A+  +  
Sbjct  27    PPASSSNIDWWCNLTPHPEQCKQHLSTQMKSHHFQIKHKTIFREMLLQNALNQALIMQKE  86

Query  945   AKRLGPR-CRNAREKAAWADCVKLYEDTILQLNQTLD-----EKCTQFDALTWLSTALTN  784
             A             +    DC+KLY  TI  LN+TL+       C+  DA TWLST+LTN
Sbjct  87    ANDNDQNNMLTKNHRTVHGDCLKLYGKTIFHLNRTLECFHGKHNCSSVDAQTWLSTSLTN  146

Query  783   LETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALN----NNGSVPKQTYKDGFPAWVS  616
             ++TC+ G VELG     +P   NNNVS++I N+LA+N     +    ++  +D FP+W S
Sbjct  147   IQTCQDGTVELGVEDFKVP---NNNVSEMIRNSLAINMDFMKHHDHMEEKPEDAFPSWFS  203

Query  615   LGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLD  436
               +R+LLQ+SS +K  +VVAKDGSGN+KT++DAL+AA KR    RFVIH+K+GVY EN++
Sbjct  204   KHERKLLQSSS-IKAHVVVAKDGSGNFKTVQDALNAAAKRKVKTRFVIHVKKGVYRENIE  262

Query  435   IGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPEN  256
             +     NIMLVGDG+R T I+ +RSV  G TT++SAT  + G  FIA+ ITF+NTAG   
Sbjct  263   VSVHNDNIMLVGDGLRNTIITSARSVQDGYTTYSSATAGIDGLHFIARDITFQNTAGVHK  322

Query  255   HQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCM  76
              QAVALRS +DLSVFY+C F GYQDTL AH+QRQFY+ CYIYGTVDFIFGNAAVVFQNC 
Sbjct  323   GQAVALRSASDLSVFYRCAFMGYQDTLMAHAQRQFYRQCYIYGTVDFIFGNAAVVFQNCY  382

Query  75    IYARKPMDKQKITITAQGRTDPNQN  1
             I+AR+P++ Q   ITAQGR DP QN
Sbjct  383   IFARRPLEGQANMITAQGRGDPFQN  407



>ref|XP_010271267.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   374 bits (959),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 199/403 (49%), Positives = 267/403 (66%), Gaps = 22/403 (5%)
 Frame = -1

Query  1155  SSFISVALSVNPPAAAGEVNRWCSQTPHPDQCK-YFLTHSRRHF-TAPKRKSEFKKMATE  982
             S F+++ L +       +    C QTP+P+ C+ YF+++S +   T  + +   +  A  
Sbjct  6     SGFVTIFLVLVIEGVISDTISSCGQTPYPEICESYFMSYSNKPLATLDETQFSLRDAALG  65

Query  981   IALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEK--CTQFDALT  808
               LD A +A      +     + + K AWADCV+LY DT+ QLN+ +  K   +  DA T
Sbjct  66    STLDQAQRAYGLISAMDVSSFDEKAKMAWADCVELYSDTVTQLNRAMGSKNPLSWSDAQT  125

Query  807   WLSTALTNLETCRTGFVELGNSRNV--LPLISNNNVSQLIGNTLALNNNGSVP-------  655
             WLS A+TN +TC+ GFVELG S  +   P + +N  S+++ N+LA+N             
Sbjct  126   WLSAAITNQQTCQNGFVELGKSSYLSSFPFMLSN-FSKMVSNSLAINKEADSSAASLLGK  184

Query  654   ----KQTYKDGFPAWVSLGDRRLLQA-SSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSG  490
                 ++   DGFP WVS  DR+LLQ+ S+  + D+VVA DGSGNYKTI +A+ A+ KRSG
Sbjct  185   QGGNRRLLSDGFPTWVSAADRKLLQSPSAASQADVVVAADGSGNYKTISEAVAASSKRSG  244

Query  489   SGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTG  310
               RFVI++K+GVY EN++I  K  NIML+GDG+  T ++ S++   GSTTF +ATV VTG
Sbjct  245   K-RFVIYVKKGVYKENVEI--KASNIMLIGDGIDATIVTDSKNAQDGSTTFRTATVGVTG  301

Query  309   DGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIY  130
             DGF+A+ +TF NTAGP+ HQAVALRSG+DLSVFY C F+GYQDTLY +SQRQFY+DC IY
Sbjct  302   DGFMARDMTFENTAGPQKHQAVALRSGSDLSVFYSCSFKGYQDTLYVYSQRQFYRDCDIY  361

Query  129   GTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             GTVDFIFG+A  V QNC IY RKPM  QK T+TAQGRTDPN+N
Sbjct  362   GTVDFIFGDAVAVLQNCNIYVRKPMSGQKNTVTAQGRTDPNEN  404



>ref|XP_003598229.1| Pectinesterase [Medicago truncatula]
 gb|AES68480.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=527

 Score =   374 bits (959),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 203/400 (51%), Positives = 273/400 (68%), Gaps = 12/400 (3%)
 Frame = -1

Query  1176  FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFK  997
               +L   SS  S+A S   P+++ +++ WC+ TPHP  CK++ T    HF   K + EF+
Sbjct  8     LFMLVFVSSIFSIASSRKGPSSS-KIDWWCNLTPHPKPCKHYTTQMNNHFKI-KHRVEFR  65

Query  996   KMATEIALDTAVQAETHAKRLGPRCRNAR-EKAAWADCVKLYEDTILQLNQTLD------  838
             +M  ++AL  A+  +  A+    + +N+   K    DC+KL E+TI  LN+TL+      
Sbjct  66    EMLVQLALKQALTMQKEAQDNSQQQQNSSVHKTVHGDCLKLVENTIFHLNRTLEGLNNAS  125

Query  837   EKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNG-S  661
             + C+  D  TWL+T+LTN+ETC++G +EL N+++    I   NV ++I N LA+N +   
Sbjct  126   KNCSPNDVQTWLTTSLTNIETCKSGALEL-NAQD-FNFIMQTNVIEMIRNILAINMHFLK  183

Query  660   VPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGR  481
               K+T +  FP W S+ +R+LLQ+  PVK +LVVAKDGSG YKT++ AL+AA KR    R
Sbjct  184   HNKETEEGSFPNWFSVHERKLLQSKGPVKYNLVVAKDGSGQYKTVQAALNAAAKRKYKTR  243

Query  480   FVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGF  301
             FVIH+K+GVY EN+++     NIMLVGDGM+ T I+ SRSV GG TT++SAT  + G  F
Sbjct  244   FVIHVKKGVYRENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGFTTYSSATAGIDGLHF  303

Query  300   IAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTV  121
             IA+ ITF+NTAGP   QAVALRS +DLSVFY+C   GYQDTL AH+QRQFY+ C+IYGTV
Sbjct  304   IARDITFQNTAGPHKGQAVALRSASDLSVFYRCAISGYQDTLMAHAQRQFYRQCFIYGTV  363

Query  120   DFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             DFIFGNAAVVFQNC I+ARKP+D Q   ITAQGR DP QN
Sbjct  364   DFIFGNAAVVFQNCNIFARKPLDGQANMITAQGRGDPFQN  403



>ref|XP_003598230.1| Pectinesterase [Medicago truncatula]
 gb|AES68481.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=527

 Score =   373 bits (958),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 204/400 (51%), Positives = 274/400 (69%), Gaps = 12/400 (3%)
 Frame = -1

Query  1176  FLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFK  997
               +L   SS  S A S   P+++  ++ WC+ TPHP  CK++ T    HF   K + EF+
Sbjct  8     LFMLFFLSSIFSTASSRKGPSSS-NIDWWCNLTPHPKPCKHYTTQMNNHFKI-KHRVEFR  65

Query  996   KMATEIALDTAVQAETHAKRLGPRCRNAR-EKAAWADCVKLYEDTILQLNQTLD------  838
             +M  ++AL  A+  +  A+    + +N+   K    DC+KL+E+TI  LN+TL+      
Sbjct  66    EMLVQLALKQALTMQKEAQANSQQQQNSLVHKTVHGDCLKLFENTIFHLNRTLEGLNNAS  125

Query  837   EKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNG-S  661
             + C+  DA TWL+T+LTN+ETC++G +EL N+++    I   NV+++I N LA+N +   
Sbjct  126   KNCSPNDAQTWLTTSLTNIETCKSGALEL-NAQD-FDFIMQTNVTEMIRNILAINMHFLK  183

Query  660   VPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGR  481
               K+T +  F  W S+ +R+LLQ+ SPVK +LVVAKDGSG YKT++ AL+AA KR    R
Sbjct  184   HSKETEEGSFSNWFSVHERKLLQSKSPVKYNLVVAKDGSGQYKTVQAALNAAAKRKYKTR  243

Query  480   FVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGF  301
             FVIH+K+GVY EN+++     NIMLVGDGM+ T I+ SRSV GG TT++SAT  + G  F
Sbjct  244   FVIHVKKGVYRENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGYTTYSSATAGIDGLHF  303

Query  300   IAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTV  121
             IA+ ITF+NTAGP   QAVALRS +DLSVFY+C   GYQDTL AH+QRQFY+ C+IYGTV
Sbjct  304   IARDITFQNTAGPHKGQAVALRSASDLSVFYRCAISGYQDTLMAHAQRQFYRQCFIYGTV  363

Query  120   DFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             DFIFGNAAVVFQNC I+ARKP+D Q   ITAQGR DP QN
Sbjct  364   DFIFGNAAVVFQNCNIFARKPLDGQANMITAQGRGDPFQN  403



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   373 bits (957),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 202/373 (54%), Positives = 256/373 (69%), Gaps = 18/373 (5%)
 Frame = -1

Query  1089  CSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAR  910
             CSQ P+P  C   +  S   F   K +S F  +A + A D AV+    A  +     +  
Sbjct  28    CSQNPNPHVCSS-MVGSSPLFAQAKTQSGFLHLALQAAKDRAVRVHELASAMDVSSLDKG  86

Query  909   EKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVL  730
              KAAW DC++L EDTI +LN+++       DA TWLS A+ N +TCR GF+ELG+S    
Sbjct  87    AKAAWVDCLELCEDTIGKLNRSMSSSSYD-DAQTWLSAAMANQQTCRNGFIELGSS---F  142

Query  729   PL----ISNNNVSQLIGNTLALNNNGSVPK-----QTYKDGFPAWVSLGDRRLLQASSPV  577
             P      ++ N+S+ + N+LA+N   +  K     +    GFP W+S  DR+LL  SS +
Sbjct  143   PFGSSPFTSYNISESLSNSLAINKATTAAKSGGNRRLLSGGFPNWLSAADRKLLH-SSTI  201

Query  576   KPDLVVAKDGSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
               DLVVAKDGSGNYKTI +A+ AA K+S G  RFVIH+K GVYNEN+     +KN+M+VG
Sbjct  202   NADLVVAKDGSGNYKTISEAIAAATKQSNGRSRFVIHVKAGVYNENVQ--TPMKNLMIVG  259

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DGM  T ++GSR+V  GSTTF SAT AVTGDGFIA+ +TF+NTAGP  HQAVALRSG+DL
Sbjct  260   DGMNATVVTGSRNVQDGSTTFRSATFAVTGDGFIARDMTFQNTAGPHKHQAVALRSGSDL  319

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             SVFY+C FEGYQDTLY +SQRQFY++C +YGTVDFIFG+AAVV QNC +Y RKPM  QK 
Sbjct  320   SVFYRCSFEGYQDTLYIYSQRQFYRNCDVYGTVDFIFGDAAVVLQNCSMYVRKPMSGQKN  379

Query  39    TITAQGRTDPNQN  1
             T+TAQGRTDPN+N
Sbjct  380   TVTAQGRTDPNEN  392



>ref|XP_010271372.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   373 bits (957),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 205/404 (51%), Positives = 267/404 (66%), Gaps = 21/404 (5%)
 Frame = -1

Query  1161  SFSSFISVALSVNPPAAAGEVNRW-CSQTPHPDQCKYFLTHSRRHFTA-PKRKSEFKKMA  988
             +F   +SV L+       G+ N   CSQTP+P+ C+YF++      T   K +  F+  A
Sbjct  5     AFGLLLSVCLAFVVGVVNGDANTISCSQTPYPEICEYFMSSKHDLVTLDEKTQFSFRDAA  64

Query  987   TEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEK--CTQFDA  814
               + +D A +A      +     + + K AWADCV+LY DT+ QLN++L  K   +  D+
Sbjct  65    LSVTMDQAQRAHGLISAMDLSSFDEKVKMAWADCVELYADTVSQLNRSLGSKNPLSWSDS  124

Query  813   LTWLSTALTNLETCRTGFVELGNSRNVLPLISN-NNVSQLIGNTLALNNNGSVP------  655
              TWLS ALTN +TCR GF++L  S  +  L S  +N S+++ N+LA+N   +        
Sbjct  125   QTWLSAALTNEQTCRNGFMDLNLSHRLSSLPSMLSNFSKMVSNSLAINKAAASSSASLLG  184

Query  654   -----KQTYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSGNYKTIKDALDAAGKRS  493
                  ++   DGFPAWVS  DR+LLQ+S    + D+VVA DGSGNYKTI +A+ AA    
Sbjct  185   RQGGNRRLLSDGFPAWVSAADRKLLQSSGAASQADVVVAADGSGNYKTISEAVAAA--SG  242

Query  492   GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVT  313
             G  RF+I++KRGVY EN++I  +  NIML+GDG+  T +S SR+V  GSTTF SATVAV+
Sbjct  243   GGSRFIIYVKRGVYKENVEI--RASNIMLIGDGIDATIVSSSRNVQQGSTTFRSATVAVS  300

Query  312   GDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYI  133
             G GFIA+ +TF N+AGP+NHQAVALRSG+DLSV Y C F+GYQDTLY HSQRQFY+DC I
Sbjct  301   GGGFIARDMTFENSAGPQNHQAVALRSGSDLSVLYGCSFKGYQDTLYVHSQRQFYRDCDI  360

Query  132   YGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             YGT DFI GNAA VFQNC IY RKP+  QK T+TAQ RTDPNQN
Sbjct  361   YGTQDFICGNAAAVFQNCNIYVRKPLSGQKNTVTAQARTDPNQN  404



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   372 bits (956),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 208/411 (51%), Positives = 279/411 (68%), Gaps = 31/411 (8%)
 Frame = -1

Query  1194  MSKI--HLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTA  1021
             M+K+  H F    +FS F++  ++ + P         C QTP+P  C   ++ S   F  
Sbjct  1     MAKLLAHFF----AFSLFMAFRIATSEPILIS-----CRQTPYPHVCSSMVSSSPL-FAQ  50

Query  1020  PKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL  841
              K +S F+ +A + A+D A++A   A  +     + R KAAWADC++L EDTI +LN+++
Sbjct  51    AKTQSGFRHLALQAAIDRAIRAHELASTMDVSSLDERVKAAWADCLELCEDTIGKLNRSM  110

Query  840   DEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNN----NVSQLIGNTLALN  673
                    DA TWLS A+ N +TCR GF+EL +S    PL S+     N+S+ + N LA+N
Sbjct  111   SSSSYD-DAQTWLSAAMANQQTCRNGFLELDSS---FPLGSSPFMSYNISESLSNLLAIN  166

Query  672   NNGSVP------KQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALD  511
                + P      ++   DGFP W+S  DR+LL+ SS +  DLVVAKDGSG+YKTI +A+ 
Sbjct  167   M-ATTPAMSGGNRRLLSDGFPNWLSATDRKLLR-SSTINADLVVAKDGSGDYKTISEAIA  224

Query  510   AAGKRS-GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFN  334
             AA K+S G  RFVIH+K GVY+EN  +   +KN+M++GDGM  T ++GS++V  GSTTF 
Sbjct  225   AAMKQSSGKSRFVIHVKTGVYDEN--VQTSMKNLMIIGDGMDATVVTGSKNVKDGSTTFR  282

Query  333   SATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQ  154
             SAT AVTGDGFIA+ +TF NTAGP+  QAVALRSG+DLSVFY+C F+GYQDTLY +SQRQ
Sbjct  283   SATFAVTGDGFIARDMTFENTAGPQKQQAVALRSGSDLSVFYQCSFKGYQDTLYVYSQRQ  342

Query  153   FYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             FY++C IYGTVDFIFG+AAVV QNC ++ RKPM  QK T+TAQGRTDPN+N
Sbjct  343   FYRNCDIYGTVDFIFGDAAVVLQNCNMHVRKPMSGQKNTVTAQGRTDPNEN  393



>ref|XP_010930858.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=472

 Score =   371 bits (952),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 198/343 (58%), Positives = 252/343 (73%), Gaps = 11/343 (3%)
 Frame = -1

Query  1011  KSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD--  838
             +S    ++ ++ALD AVQA   A RLG    +  E+AAW++C++LYE T+ QLN TL   
Sbjct  12    ESHIHHVSIKVALDHAVQARARAIRLGLMYLDKNEQAAWSNCIELYEATVHQLNLTLKLQ  71

Query  837   --EKCTQFDALTWLSTALTNLETCRTGFVELGNS-RNVLPLISNNNVSQLIGNTLALNNN  667
                  + FD  +WL  ALTNL+TCRT F E+  S   + PL+++  VS+LI N+LA+   
Sbjct  72    PLHPNSHFDEFSWLGAALTNLDTCRTSFAEVNVSGSGIEPLLTH--VSELISNSLAITRV  129

Query  666   GSVPKQTYKDGFPAWVSLGDRRLLQASS-PVKPDLVVAKDGSGNYKTIKDALDAAGKRSG  490
             G   + +Y    P WV   DR+LL+ S   VK DLVVAKDG+G++ +I  A+D A K SG
Sbjct  130   GH-QEDSYNRRLPDWVLPKDRKLLEVSEREVKADLVVAKDGTGDFSSISKAVDEASKGSG  188

Query  489   SGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTG  310
             + RFVI++K+GVY E +++G  ++N+MLVGDG+  T I+GSRS  GGSTT+NSAT AVTG
Sbjct  189   NKRFVIYVKKGVYKEYVNVG--MRNLMLVGDGIGKTVITGSRSAGGGSTTYNSATFAVTG  246

Query  309   DGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIY  130
             + FIA+GITFRNTAGP  HQAVALRS +DLSVFY+C F+GYQDTLYAHS RQFY++C IY
Sbjct  247   ERFIARGITFRNTAGPAKHQAVALRSSSDLSVFYQCSFQGYQDTLYAHSLRQFYRECKIY  306

Query  129   GTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             GTVDFIFGNAAVVFQNC IY R+PM +QK TITAQGRTDPNQN
Sbjct  307   GTVDFIFGNAAVVFQNCNIYVRRPMSQQKNTITAQGRTDPNQN  349



>ref|XP_002322402.2| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06529.2| putative pectin methylesterase family protein [Populus trichocarpa]
Length=478

 Score =   370 bits (951),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 193/357 (54%), Positives = 256/357 (72%), Gaps = 10/357 (3%)
 Frame = -1

Query  1050  LTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYE  871
             ++HS  HF A K +S+F+ M+ ++AL+ A+ A+    +LG  C +  +K  WADC+KL+ 
Sbjct  1     MSHSHHHF-ALKHRSKFRLMSVQLALEKALIAQRQVSQLGQNCEHQHQKVVWADCLKLHS  59

Query  870   DTILQLNQTL------DEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNN  709
             +TILQLN+TL        +CT  DA TWLSTALTN++TCRTG ++L  S   +P +S N 
Sbjct  60    NTILQLNRTLIGIRKKRLRCTDVDAQTWLSTALTNIQTCRTGSLDLNVSDFTMPAMSRN-  118

Query  708   VSQLIGNTLALNNNGSVPKQTYKDGFPAWVSLGDRRLLQASS-PVKPDLVVAKDGSGNYK  532
             +S+LI NTLA+N        T ++ FP+W S  +RRLLQ++S     +LVVAKDGSG ++
Sbjct  119   LSELISNTLAINGVLLEDNNTAQE-FPSWFSRRNRRLLQSASITAMANLVVAKDGSGKFR  177

Query  531   TIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvg  352
             +I+ A++AA KR    R +IH+KRGVY EN+++G    NI LVGDGMR T I+ SRSV G
Sbjct  178   SIQAAINAASKRRYKTRLIIHVKRGVYKENIEVGANNNNIWLVGDGMRNTIITSSRSVGG  237

Query  351   gSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLY  172
             G TT++SAT  + G  F+A+GITF NTAGP   QAVALRS +DLSV+Y+C F+GYQDTL+
Sbjct  238   GYTTYSSATAGIDGLRFVARGITFSNTAGPLKGQAVALRSASDLSVYYRCSFQGYQDTLF  297

Query  171   AHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
              HSQRQFY++CYIYGT+DFIFGNAAVVFQN +I  R+P+  Q   ITAQGR DP QN
Sbjct  298   VHSQRQFYRECYIYGTIDFIFGNAAVVFQNSIILVRRPLKGQANMITAQGRNDPFQN  354



>ref|XP_008452338.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Cucumis melo]
Length=533

 Score =   372 bits (955),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 210/415 (51%), Positives = 276/415 (67%), Gaps = 30/415 (7%)
 Frame = -1

Query  1188  KIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRK  1009
             KI LF+ +    + +S  +S N P     + +WC  TPHP  C  F++  +     P+ +
Sbjct  6     KIILFISITLLFTILSNNVSANNP-----IIKWCKTTPHPKVCISFMSPIK---PPPQNR  57

Query  1008  SEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL----  841
              EF+++A +  L+ A +A+ +  R GP C+  R++ AW DC KLY D + QLN+TL    
Sbjct  58    EEFRQVAIQTTLEKADEAKAYTARFGPTCKTTRQRTAWTDCFKLYNDVVFQLNRTLQCLV  117

Query  840   -DEK------CTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTL  682
              DE       CT FDA TWLS+ALT+++ C +G  +L  +  + P I   NVS++I N L
Sbjct  118   TDETIHRRPTCTDFDAQTWLSSALTDIDLCNSGAADLNVTDFIAP-IKCLNVSKMISNCL  176

Query  681   ALNNNGSVPKQ--TYKDG----FPAWVSLGDRRLLQASSP--VKPDLVVAKDGSGNYKTI  526
             A+N  G + ++   Y DG    FP WVS GDR+LL+ S P  V+ +LVVAKDGSG ++ +
Sbjct  177   AING-GFLEEEGVKYDDGGNGSFPMWVSEGDRKLLE-SRPRRVRANLVVAKDGSGKFRRV  234

Query  525   KDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggS  346
             + A+DAA +R G GRFVI++KRGVY EN+++GN   NIMLVGDGMR+T I+  RSV  G 
Sbjct  235   QAAIDAAARRRGRGRFVIYVKRGVYRENIEVGNDNGNIMLVGDGMRFTVITSGRSVAAGF  294

Query  345   TTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAH  166
             TTF+SAT  + G GFIA+ I F NTAGP   QAVALRS +DLSVF++C FEGYQDTL   
Sbjct  295   TTFSSATAGIQGPGFIARDIRFVNTAGPRMGQAVALRSSSDLSVFHRCSFEGYQDTLMVL  354

Query  165   SQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             SQRQFYK CYIYGT+DFIFGNAAVV QNC+IY R+P+  Q   ITAQGR DP QN
Sbjct  355   SQRQFYKQCYIYGTIDFIFGNAAVVLQNCLIYVRRPLKGQVNVITAQGREDPFQN  409



>emb|CDP05321.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   369 bits (948),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 190/338 (56%), Positives = 250/338 (74%), Gaps = 9/338 (3%)
 Frame = -1

Query  993  MATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD----EKCT  826
            M   +AL+    A  HAK L   CR+ R+KA W DC KL  +T+LQLN+T++     + +
Sbjct  1    MTVRVALEQVHSARKHAKNLRRECRSKRKKAVWRDCNKLLSNTVLQLNRTIEGFLANQTS  60

Query  825  QFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQT  646
              DA TWLSTALTNLE CR+G ++L  +  + P++++N +S LI N LA+N    +  Q 
Sbjct  61   DVDAQTWLSTALTNLEICRSGSLDLNVTELISPILTSN-MSHLISNCLAVNGV-LMEHQD  118

Query  645  YKDGFPAWVSLGDRRLLQASSPVK--PDLVVAKDGSGNYKTIKDALD-AAGKRSGSGRFV  475
            YKDGFP WV+ G+R+LLQ+S  +    + VVA DGSG++++I+ A++ AA +R G+ R V
Sbjct  119  YKDGFPGWVTAGERKLLQSSVTLSRTANAVVAMDGSGHFRSIQAAINYAASRRVGNARVV  178

Query  474  IHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIA  295
            I++KRGVY EN+ I + +  + L+GDG+RYT I+GSRSV GG TT++SAT+ V G GF+A
Sbjct  179  IYVKRGVYRENIAISSTMNKVTLIGDGLRYTIITGSRSVAGGYTTYSSATLGVDGIGFMA  238

Query  294  QGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDF  115
            +GITFRNTAGP+  QAVALRS +DLSVFY CGFEGYQDTL+ H+QRQFYK+CYIYGT+DF
Sbjct  239  RGITFRNTAGPQRGQAVALRSASDLSVFYACGFEGYQDTLFVHAQRQFYKNCYIYGTIDF  298

Query  114  IFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
            IFGNAAVVFQNC+IY RKP+  Q   ITAQGR DP QN
Sbjct  299  IFGNAAVVFQNCIIYVRKPLWGQVNVITAQGRADPFQN  336



>ref|XP_004516727.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33-like 
[Cicer arietinum]
Length=539

 Score =   371 bits (952),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 196/383 (51%), Positives = 261/383 (68%), Gaps = 20/383 (5%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYFLTHSRRHFTAPK---RKSEFKKMATEIALDTAVQAETHAKRLG  931
             ++ WC+QTPHP+ CK++   +  H+   K    KS+F+++   +AL+ AV     A+ LG
Sbjct  37    IDWWCNQTPHPEACKFYTKQT--HYNDNKNIKHKSKFREILIHLALERAVIMRNIARDLG  94

Query  930   PR--CRNAREKAAWADCVKLYEDTILQLNQT-----LDEKCTQFDALTWLSTALTNLETC  772
                     ++K+   DC+KLY++T+  LN+T     + + C+ FDA TWLSTA TN+ETC
Sbjct  95    QNNWLTTKKKKSVSRDCLKLYDNTVFHLNRTFHNLHIKKTCSSFDAQTWLSTAYTNIETC  154

Query  771   RTGFVELGNSRNVLPLISNNNVSQLIGNTLALN------NNGSVPKQTYKDGFPAWVSLG  610
             R G +EL     VLP++  N ++++I N L +N       N        K+ FP W+S  
Sbjct  155   RNGALELNIPDFVLPIMKKN-MTEIISNGLFVNWEFVKHENVHHTDDDIKEAFPRWLSTR  213

Query  609   DRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIG  430
             +RRLL++SS +K  LVVAKDGSG++K+I+ A++AAGKR    RFVI +KRGVY EN+ IG
Sbjct  214   ERRLLESSS-LKAHLVVAKDGSGHFKSIQSAINAAGKRRVKTRFVIRVKRGVYRENILIG  272

Query  429   NKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQ  250
                 NIMLVGDGMR+T I+  R+V  G TT++SAT  + G  FIA+ ITF NTAGP   Q
Sbjct  273   KMNDNIMLVGDGMRFTIITSDRNVQAGFTTYSSATAGIDGLHFIARDITFENTAGPRRGQ  332

Query  249   AVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIY  70
             AVALRS +DLSVFY+C F+GYQDTL  H+QRQFY++CYIYGTVDFIFGNAAVVFQNCMI 
Sbjct  333   AVALRSASDLSVFYRCAFKGYQDTLMVHAQRQFYRECYIYGTVDFIFGNAAVVFQNCMIL  392

Query  69    ARKPMDKQKITITAQGRTDPNQN  1
              R+P++ Q   ITAQGR DP QN
Sbjct  393   VRRPLNGQANMITAQGRDDPFQN  415



>ref|XP_007148706.1| hypothetical protein PHAVU_005G007800g [Phaseolus vulgaris]
 gb|ESW20700.1| hypothetical protein PHAVU_005G007800g [Phaseolus vulgaris]
Length=535

 Score =   370 bits (951),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 198/404 (49%), Positives = 270/404 (67%), Gaps = 15/404 (4%)
 Frame = -1

Query  1173  LVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSR---RHFTAPKRKSE  1003
               L   SSF S+A S   PA++  ++ WC+ TPHP+ CKY++T ++    HFT  K ++ 
Sbjct  10    FTLLFMSSFFSLASSRRGPASSSNIDWWCNLTPHPEPCKYYITTNQTKSHHFTLIKHRTI  69

Query  1002  FKKMATEIALDTAVQAETHA-KRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD----  838
             F+ M  E AL+ A+  +  A +           +    DC+KLY  TI  LN+TL+    
Sbjct  70    FRGMLAEHALNQALIMQKEALESEQSNMPTKNHRTVHGDCLKLYGKTIFHLNRTLECFHG  129

Query  837   -EKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALN----  673
              + C+  DA TWLSTALTN++TC+ G VELG      P  + NNV++++ N+LA+N    
Sbjct  130   NQNCSSVDAQTWLSTALTNIQTCQDGTVELGVEDFKAP-NNKNNVTEMLRNSLAINMDFM  188

Query  672   NNGSVPKQTYKDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS  493
              +    ++  ++ FP+W S  +R+LLQ S+ +K   VVAKDGSGN+++++DAL+AA KR 
Sbjct  189   KHDHQAQKADEEAFPSWFSKPERKLLQ-SATIKAHAVVAKDGSGNFRSVQDALNAAAKRK  247

Query  492   GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVT  313
                RFVIH+K+GVY EN+++     NIMLVGDG+  T I+ SRSV  G TT++SAT  + 
Sbjct  248   VKTRFVIHVKKGVYKENIEVAVHNDNIMLVGDGISNTIITSSRSVQQGYTTYSSATAGID  307

Query  312   GDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYI  133
             G  FIA+ +TF+NTAG +  QAVALRS +DLSVFY+C   G+QDTL AH+QRQFY+ CYI
Sbjct  308   GLHFIARDMTFQNTAGAQKGQAVALRSASDLSVFYRCAVMGFQDTLMAHAQRQFYRQCYI  367

Query  132   YGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             YGT+DFIFGNAAVVFQNC IYARKP++ Q   ITAQGR DP QN
Sbjct  368   YGTIDFIFGNAAVVFQNCYIYARKPLEGQANMITAQGRGDPFQN  411



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   369 bits (947),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 208/420 (50%), Positives = 273/420 (65%), Gaps = 33/420 (8%)
 Frame = -1

Query  1194  MSKIHLFLVLASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCK-YFLTHSRRHFTA-  1021
             M K+ L  V  S +  I V   VN    +      CSQTP+P+ C+ YF+++S +     
Sbjct  1     MDKLVLGFVCISLALVIGV---VNSETISSS----CSQTPYPEICESYFMSYSNKPLATL  53

Query  1020  --PKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQ  847
                + +  F++ A    +D A++A      +     + + K AWADCV+LY DTI QLN+
Sbjct  54    DDHETQFSFREAALSFTMDQALRAHGLISAMDLSSFDDKAKVAWADCVELYADTITQLNR  113

Query  846   TLDEKCTQF---DALTWLSTALTNLETCRTGFVELGNSR---NVLPLISNNNVSQLIGNT  685
             T+          DA TWLS A+TN +TC+ GF EL  S    N  P + +N  S++I N+
Sbjct  114   TMGSNKNPLRWSDAQTWLSAAITNQQTCQNGFTELNLSSYLSNSFPFMLSN-FSKMISNS  172

Query  684   LALNNNGSVP-----------KQTYKDGFPAWVSLGDRRLLQASSPV-KPDLVVAKDGSG  541
             LA+N   +             ++   DGFP WVS  DR+LLQ+SS   + D+VVA DGSG
Sbjct  173   LAINKAAASSVASLMGKQGGNRRLLSDGFPTWVSAADRKLLQSSSAASQADVVVAADGSG  232

Query  540   NYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrs  361
             NY+TI  A+ A+ KRSG  RFVI++KRGVY EN++I  K  NIML+GDG+  T ++GS++
Sbjct  233   NYRTISQAVAASSKRSGK-RFVIYVKRGVYKENVEI--KASNIMLIGDGIDATIVTGSKN  289

Query  360   vvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQD  181
             V  GSTTF SATVAVT D F+A+ +TF NTAGP+ HQAVALRSG+DLSVFY+C F+GYQD
Sbjct  290   VQDGSTTFRSATVAVTRDRFMARDMTFENTAGPQKHQAVALRSGSDLSVFYRCSFKGYQD  349

Query  180   TLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             TLY +SQRQFY+DC IYGTVDFIFG+A  V QNC IY RKPM  Q+ T+TAQGRTDPN+N
Sbjct  350   TLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKPMSGQRNTLTAQGRTDPNEN  409



>gb|KEH29375.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=539

 Score =   366 bits (940),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 186/381 (49%), Positives = 260/381 (68%), Gaps = 15/381 (4%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYFLTHSRR-HFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             ++ WC+QTPHP+ CKY+   +   H  + K K++F+++   +AL+ AV     A   G  
Sbjct  36    IDWWCNQTPHPETCKYYTKQTHYYHNKSIKHKTKFREILIHLALERAVVMRNMAHNFGQN  95

Query  924   CR-NAREKAAWADCVKLYEDTILQLNQTL-----DEKCTQFDALTWLSTALTNLETCRTG  763
                  ++K+   DC+KL+++T+  LN+T       + C+ FDA TWLSTA TN+ETCR G
Sbjct  96    SWITQKKKSVSRDCLKLFDNTVFHLNRTFLDLHKKKSCSSFDAQTWLSTAYTNIETCRNG  155

Query  762   FVELGNSRNVLPLISNNNVSQLIGNTLALN-----NNGSV--PKQTYKDGFPAWVSLGDR  604
              +EL   + ++P++  N ++Q+I N L +N      +G V       ++GFP W S+ +R
Sbjct  156   ALELNIPKFIVPIMKVN-MTQIISNGLFVNWEFVKRDGRVRYTNDVTEEGFPRWFSVRER  214

Query  603   RLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNK  424
             +LL++S  +K  ++VAKDGSG++K ++DA++AAG+R    RFVI +K+GVY EN+ +G  
Sbjct  215   KLLESSRAIKAHIIVAKDGSGHFKRVQDAINAAGRRRFKTRFVIRVKKGVYRENIVVGKM  274

Query  423   LKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAV  244
               NIMLVGDG R T I+ +R+V  G TT++SAT  + G  FIA+ ITF NTAGP   QAV
Sbjct  275   NDNIMLVGDGSRNTVITSNRNVQAGFTTYSSATAGIDGLHFIARDITFENTAGPRRGQAV  334

Query  243   ALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYAR  64
             ALRS +DLSVFY+C F+GYQDTL  H+QRQFY++CYIYGTVDFIFGNAAVVFQNCMI  R
Sbjct  335   ALRSASDLSVFYRCSFKGYQDTLMVHAQRQFYRECYIYGTVDFIFGNAAVVFQNCMILVR  394

Query  63    KPMDKQKITITAQGRTDPNQN  1
             +P++ Q   ITAQGR DP QN
Sbjct  395   RPLNGQANMITAQGRDDPFQN  415



>ref|XP_002527782.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF34592.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=529

 Score =   366 bits (939),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 191/380 (50%), Positives = 263/380 (69%), Gaps = 20/380 (5%)
 Frame = -1

Query  1089  CSQTPHPDQCKYFL-THSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNA  913
             C++TP+P+ C YF+ T+  +          F+  +  + ++ A++A      +  +  + 
Sbjct  30    CARTPYPEVCNYFIETNLLQTQYQTGTTFSFRDQSLLVTMNQAIKAHQMVSSMNFKSFDK  89

Query  912   REKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVELGNSRN-  736
             + K AW DC++LYEDT+  LN++L       D+ TWLS A+ N +TC+ GF++L  S + 
Sbjct  90    KAKLAWDDCMELYEDTVDHLNRSL-SSTIPIDSQTWLSAAIANQQTCQNGFIDLNLSYDD  148

Query  735   ---VLPLISNNNVSQLIGNTLALNNNGSVPKQTYK---------DGFPAWVSLGDRRLLQ  592
                 +P++ +N +S L+ N+LA+N   SVP  T +         DGFP+WVS  DRRLLQ
Sbjct  149   HLESMPIMLSN-LSMLLSNSLAVNKV-SVPHNTKQVNGRRLLIFDGFPSWVSATDRRLLQ  206

Query  591   ASSPVKP--DLVVAKDGSGNYKTIKDALDAAGK-RSGSGRFVIHIKRGVYNENLDIGNKL  421
             +SS V P  D+VVA+DGSGNYKTI +A+ AA K RSGS R VI++K+G+Y EN++I   +
Sbjct  207   SSSGVAPKADIVVAQDGSGNYKTITEAVAAAVKQRSGSKRLVIYVKKGIYKENIEIKKSM  266

Query  420   KNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVA  241
             KN+M VGDG+  T ++GS++   GSTTF SAT AV+G GFIA+G+TF NTAGP+ HQAVA
Sbjct  267   KNLMFVGDGIDATIVTGSKNAKDGSTTFRSATFAVSGQGFIAKGMTFENTAGPQKHQAVA  326

Query  240   LRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARK  61
             LRSG+D SVFY C F+GYQDTLY +SQRQFY+DC IYGT+DFIFG+A  V QNC IY R+
Sbjct  327   LRSGSDFSVFYGCSFKGYQDTLYVYSQRQFYRDCDIYGTIDFIFGDAVAVLQNCNIYVRR  386

Query  60    PMDKQKITITAQGRTDPNQN  1
             PM+ QK T+TAQGR DPN+N
Sbjct  387   PMNGQKNTVTAQGRKDPNEN  406



>ref|XP_006282103.1| hypothetical protein CARUB_v10028350mg [Capsella rubella]
 gb|EOA15001.1| hypothetical protein CARUB_v10028350mg [Capsella rubella]
Length=541

 Score =   365 bits (937),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 196/386 (51%), Positives = 257/386 (67%), Gaps = 24/386 (6%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCK-YFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
             ++ WC +TP+P  CK YF  H    F  P + SEF+ +  E A+D A+ A          
Sbjct  36    IDPWCDKTPYPYPCKRYFTKHF--GFRQPTQISEFRVLLVEAAMDRAISARDKLANSSKN  93

Query  924   CR-NAREKAAWADCVKLYEDTILQLNQTLD---------EKCTQFDALTWLSTALTNLET  775
             C  + +++A  ADC+ LY DT++QLN+TL          ++CT FDA TWLSTALTN ET
Sbjct  94    CTIDCKKQAVLADCLDLYGDTVMQLNRTLQGVSSKPGLGKRCTDFDAQTWLSTALTNTET  153

Query  774   CRTGFVELGNSRNVLPLISNNNVSQLIGNTLALN-------NNGSVPKQTYKDGFPAWVS  616
             C  G  +L  +  + P++SN  +S LI N LA+N        N S+   +   G P W S
Sbjct  154   CLRGSSDLNVTDFITPIVSNTKISHLISNCLAINGALLTAGKNESITGDS--KGSPTWFS  211

Query  615   LGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRS-GSGRFVIHIKRGVYNENL  439
               +RRLLQ+ S V+ ++VVAKDGSG++KT++ A+D AG+R   SGR+VI++KRG+Y EN+
Sbjct  212   GKERRLLQSHS-VRANVVVAKDGSGHFKTVQAAIDLAGRRKVMSGRYVIYVKRGIYQENI  270

Query  438   DIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPE  259
             ++     N+MLVGDGMRYT I+  RSV GG TT++SAT  + G  FIA+GI FRNTAGP 
Sbjct  271   NVRLNNDNVMLVGDGMRYTIITSGRSVKGGYTTYSSATAGIEGLHFIAKGIAFRNTAGPA  330

Query  258   NHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNC  79
               QAVALRS +DLS+FY+C  EGYQDTL  HSQRQFY++CYIYGTVDFIFGNAAVV QNC
Sbjct  331   KGQAVALRSSSDLSIFYRCSIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAAVVLQNC  390

Query  78    MIYARKPMDKQKITITAQGRTDPNQN  1
             +I  R+P+  Q    TAQGR+D  QN
Sbjct  391   IILPRRPLKGQSNVTTAQGRSDLFQN  416



>ref|XP_010271269.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   364 bits (934),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 196/379 (52%), Positives = 259/379 (68%), Gaps = 21/379 (6%)
 Frame = -1

Query  1089  CSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAR  910
             CS TP+P+ C+ F+  S+   T  + +  F+  A    LD A +A      +     + +
Sbjct  34    CSLTPYPEICESFM-GSKPLATLDETQFSFRDAALGSTLDQAQRAYGLISAMDVSSFDEK  92

Query  909   EKAAWADCVKLYEDTILQLNQTLDEK--CTQFDALTWLSTALTNLETCRTGFVELGNSRN  736
              + AW DCV+LY DT+ QLN+ L  K   +  DA TWLS A+TN +TC+ GF+ELG S  
Sbjct  93    ARIAWDDCVELYADTVTQLNRALGSKNPLSWSDAQTWLSAAITNQQTCQNGFIELGKSSY  152

Query  735   V--LPLISNNNVSQLIGNTLALNNNGSVP-----------KQTYKDGFPAWVSLGDRRLL  595
             +   P + +N  S+++ N+LA+N   +             ++   DGFP WVS  DR+LL
Sbjct  153   LSSFPFMLSN-FSKMVSNSLAINKEAASSAASLLGKQGGNRRLLSDGFPTWVSAADRKLL  211

Query  594   QA-SSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLK  418
             Q+ S+  + D+VVA DGSGNYKTI  A+ A+ KRSG  RFVI++KRGVY EN++I     
Sbjct  212   QSPSAASQADVVVAADGSGNYKTISQAVAASPKRSGK-RFVIYVKRGVYRENVEI--TAS  268

Query  417   NIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVAL  238
             NIML+GDG+  T ++GS++V  GSTTF +ATVAVTGDGFIA+ +TF NTAGP+ HQAV+L
Sbjct  269   NIMLIGDGIDATTVTGSKNVQDGSTTFRTATVAVTGDGFIARDMTFENTAGPQKHQAVSL  328

Query  237   RSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKP  58
             RSG+DLSVFY+C F+GYQDTLY +SQRQFY+DC IYGTVDFIFG+A  V QNC IY RKP
Sbjct  329   RSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKP  388

Query  57    MDKQKITITAQGRTDPNQN  1
             M  Q+ T+TAQGRTDPN+N
Sbjct  389   MSGQQNTVTAQGRTDPNEN  407



>ref|XP_003537030.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 60-like 
[Glycine max]
 ref|XP_006582811.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 60-like 
[Glycine max]
Length=531

 Score =   363 bits (931),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 195/379 (51%), Positives = 256/379 (68%), Gaps = 17/379 (4%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYF-LTHSRRHFTAPKRKSEFKKMATEIALDTAV--QAETHAKRLG  931
             ++ WC+ TPHP  CK++ +T  + H    K K+ F++M  + AL+ A+  Q E H     
Sbjct  34    IDWWCNLTPHPVPCKHYTITQMKSHHFQIKHKTVFREMLLQHALNQALIMQKEAHESHQN  93

Query  930   PRCRNAREKAAWADCVKLYEDTILQLNQTLD-----EKCTQFDALTWLSTALTNLETCRT  766
                     +    DC+KLY  TI  LN+TL+     + C+  DA TWLST+LTN++TC+ 
Sbjct  94    SMA-TKNHRTVNEDCLKLYGKTIFHLNRTLECFHGKQNCSSVDAQTWLSTSLTNIQTCQD  152

Query  765   GFVELGNSRNVLPLISNNNVSQLIGNTLALN----NNGSVPKQTYKDGFPAWVSLGDRRL  598
             G VEL      +P   NNNVS++I N+LA+N    N+    ++   D FP W S  +R+L
Sbjct  153   GTVELAVEDFEVP---NNNVSEMIRNSLAINMDFMNHHHHMEEKPGDAFPRWFSKHERKL  209

Query  597   LQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLK  418
             LQ SS +K  +VVAKDGSGN+KT++DAL+AA KR    RFVIH+K+GVY EN+++     
Sbjct  210   LQ-SSMIKARIVVAKDGSGNFKTVQDALNAAAKRKEKTRFVIHVKKGVYRENIEVALHND  268

Query  417   NIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVAL  238
             NIMLVGDG+R T I+ +RSV  G TT++SAT  + G  FIA+ ITF+N+AG    QAVAL
Sbjct  269   NIMLVGDGLRNTIITSARSVQDGYTTYSSATAGIDGLHFIARDITFQNSAGVHKGQAVAL  328

Query  237   RSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKP  58
             RS +DLSVFY+CG  GYQDTL AH+QRQFY+ CYIYGTVDFIFGNAAVVFQNC I+AR+P
Sbjct  329   RSASDLSVFYRCGIMGYQDTLMAHAQRQFYRQCYIYGTVDFIFGNAAVVFQNCYIFARRP  388

Query  57    MDKQKITITAQGRTDPNQN  1
             ++ Q   ITAQGR DP QN
Sbjct  389   LEGQANMITAQGRGDPFQN  407



>ref|XP_010271266.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=532

 Score =   362 bits (930),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 192/399 (48%), Positives = 262/399 (66%), Gaps = 23/399 (6%)
 Frame = -1

Query  1146  ISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDT  967
             +S++L++       E   +CSQTP+P+ C+ F+  SR   T  +    F++    + LD 
Sbjct  18    VSISLALVIGVVNSETTSFCSQTPYPETCESFMARSRPLVTLTQF--SFRETTLNLTLDQ  75

Query  966   AVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL---DEKCTQFDALTWLST  796
             A++A      +       R K AWADCV+LY DTI QLN+T+         ++A TWLS 
Sbjct  76    ALRAHGLISAMELSSFGERAKVAWADCVELYADTITQLNRTVLVTQNPLAWWNAQTWLSA  135

Query  795   ALTNLETCRTGFVELGNSRNV--LPLISNNNVSQLIGNTLALNNNGSVP-----------  655
             A+ N +TC+ GF++L  S  +   P + +N  S+++ N+LA+N    +            
Sbjct  136   AIANEQTCQNGFLDLNMSSYLSSFPYMLSN-FSKMVSNSLAINKASVLSAASLLGKQGGN  194

Query  654   KQTYKDGFPAWVSLGDRRLLQA-SSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRF  478
             ++   DGFP WVS  DR+LLQ+  + ++ D+VVA DGSGNYKTI  A+ AA    GS RF
Sbjct  195   RRLLSDGFPTWVSAADRKLLQSPGAALRADVVVAADGSGNYKTISQAV-AAAPGGGSKRF  253

Query  477   VIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFI  298
             VI++KRGVY E ++I  K  NIML+GDG+  T ++GS+S+    T+F SATV +TG+GFI
Sbjct  254   VIYVKRGVYKETVEI--KAPNIMLIGDGIDVTVVTGSKSIQDAGTSFRSATVGITGNGFI  311

Query  297   AQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVD  118
             A+ +TF NTAGP+ HQAVALRSG+DLSVFY+C F+GYQDTLY HS RQFY++C IYGTVD
Sbjct  312   ARDMTFENTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVHSNRQFYRNCDIYGTVD  371

Query  117   FIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             FI+G+A  V QNC IY RKPM  QK T+TAQGRTDPN+N
Sbjct  372   FIWGDAVAVLQNCNIYVRKPMSGQKNTVTAQGRTDPNEN  410



>ref|XP_003533518.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33-like 
[Glycine max]
Length=534

 Score =   362 bits (930),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 193/397 (49%), Positives = 265/397 (67%), Gaps = 14/397 (4%)
 Frame = -1

Query  1155  SSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIA  976
             SS  S+A S    +    ++ WC+QTP+P+ C+Y++ HS       K KSEF+ +   +A
Sbjct  16    SSVFSIASSRRRHSNNSNIDWWCNQTPYPEPCRYYIKHSHYQHKQLKHKSEFRTILVHLA  75

Query  975   LDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD-----EKCTQFDAL  811
             L+ AV     A+ LG      ++K+ + DC+KLY++T+  LN+TL+       C+ FDA 
Sbjct  76    LERAVIMRRKARELGGNGVTKKQKSVFRDCLKLYDNTVFHLNRTLEGLHVKTSCSPFDAQ  135

Query  810   TWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALN------NNGSVPKQ  649
             TWLSTA TN+ETC+   +ELG   +++P     N++++I N L +N              
Sbjct  136   TWLSTARTNIETCQNWALELGIRDSMVP-AERCNLTEIISNGLFVNWAFLKYREAHYTAD  194

Query  648   TYKDG-FPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVI  472
               +D  FP W S+ +R+LLQ+SS ++  LVVAKDGSG++++++ A++AA +R    RF+I
Sbjct  195   AEEDALFPRWFSMHERKLLQSSS-IRAHLVVAKDGSGHFRSVQAAINAAARRRLKSRFII  253

Query  471   HIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQ  292
             H+KRGVY EN+++     N+MLVGDGMR T I+ +RSV  G TT++SAT  + G  FIA+
Sbjct  254   HVKRGVYRENIEVDKTNDNVMLVGDGMRNTIITSARSVQAGYTTYSSATAGIDGLHFIAR  313

Query  291   GITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFI  112
              ITFRNTAGP   QAVALRS +DLSVFY+C  EGYQDTL  H+QRQFY+ CYIYGTVDFI
Sbjct  314   DITFRNTAGPLRGQAVALRSASDLSVFYRCAIEGYQDTLMVHAQRQFYRGCYIYGTVDFI  373

Query  111   FGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             FGNAAVVFQNC+I  RKP++ Q   ITAQGR DP QN
Sbjct  374   FGNAAVVFQNCVILVRKPLNGQANMITAQGRDDPFQN  410



>ref|XP_010919483.1| PREDICTED: pectinesterase 2-like [Elaeis guineensis]
Length=522

 Score =   362 bits (929),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 194/374 (52%), Positives = 251/374 (67%), Gaps = 11/374 (3%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRC  922
             V  WC  TPHP  C+Y+L + +     PK + +F K+  ++  D   +A +H   LG RC
Sbjct  30    VEWWCHNTPHPGACRYYLAYPKPP-EQPKDEDQFFKLHLQVTYDLTARAVSHLGSLGRRC  88

Query  921   RNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDAL---TWLSTALTNLETCRTGFVEL  751
                 EK AW DC KLY +T+LQLN+TL    + F AL   TWLS +LTNLETCR GF +L
Sbjct  89    GTKPEKKAWVDCWKLYGNTVLQLNRTLHHPKSTFTALDSQTWLSASLTNLETCRKGFSDL  148

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGFPAWVSLGDRRLLQASSPVKP  571
             G S  ++  + + N+S LI N LA+N   +  K T     P++ +  +R+LLQ SS  +P
Sbjct  149   GASTEIIHPVMHYNLSDLISNCLAINQPNATTKSTATLDAPSFTTTANRKLLQLSS--RP  206

Query  570   DLVVAKDGSGNYKTIKDALDAA----GKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLV  403
             + +VA+DGSGN++TI+ ALDAA       +  GR VI +K GVYNE+L + + L ++ +V
Sbjct  207   NFIVAQDGSGNFRTIQGALDAATALRSSTTSGGRIVIQVKAGVYNEHLQVLSSLSDLTMV  266

Query  402   GDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGAD  223
             GDG   T I+GSRSV  G TTF+SAT +V GDGFIA+ ITFRNT GP + QAVAL SG+D
Sbjct  267   GDGKGKTIITGSRSVASGFTTFSSATFSVFGDGFIARDITFRNTFGPGS-QAVALLSGSD  325

Query  222   LSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQK  43
              SVFY+C  EGYQDTL   +QRQFY++C IYGTVDFIFGNAAVV QNC I+AR+P   + 
Sbjct  326   RSVFYRCSIEGYQDTLCVFTQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARRPRQGEA  385

Query  42    ITITAQGRTDPNQN  1
               ITAQGRTDPNQN
Sbjct  386   NVITAQGRTDPNQN  399



>ref|XP_007131333.1| hypothetical protein PHAVU_011G005000g [Phaseolus vulgaris]
 gb|ESW03327.1| hypothetical protein PHAVU_011G005000g [Phaseolus vulgaris]
Length=530

 Score =   362 bits (928),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 191/377 (51%), Positives = 255/377 (68%), Gaps = 12/377 (3%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRC  922
             ++ WCSQTP+PD CKY++     H    K KSEF+ +   +AL+ A+     A+  G + 
Sbjct  32    IDWWCSQTPYPDPCKYYMKQQSHHHHKLKHKSEFRAILIHLALNRAMIMRRKAREFGHKG  91

Query  921   RNAREKAAWADCVKLYEDTILQLNQTLD-----EKCTQFDALTWLSTALTNLETCRTGFV  757
                ++K+ + DC+KLY++T+  LN+T++     + C+ FDA TWLSTA TN+ETC+ G +
Sbjct  92    ITKKQKSVFRDCLKLYDNTVFHLNRTIEGLHQKKSCSPFDAQTWLSTARTNIETCQNGAL  151

Query  756   ELGNSRNVLPLISNNNVSQLIGNTLALNNNG-SVPKQTYKDG----FPAWVSLGDRRLLQ  592
             ELG    + P     NV+++I N L +N       K  Y +     FP+W S  +R+LLQ
Sbjct  152   ELGVQDFMAP-TERCNVTEIISNGLFVNWAFLKYEKVHYTEDAEAEFPSWFSTHERKLLQ  210

Query  591   ASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNI  412
             +SS V+  LVVAKDGSG++K+++ A++AA KR    RF+IH+K GVY EN+++     NI
Sbjct  211   SSS-VRAHLVVAKDGSGHFKSVQAAINAAAKRRLKSRFIIHVKSGVYRENIEVDKTNDNI  269

Query  411   MLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRS  232
             ML GDGMR T I+  RSV  G TT++SAT  + G  FIA+ ITFRNTAGP   QAVALRS
Sbjct  270   MLFGDGMRNTIITSGRSVNAGFTTYSSATAGIDGLHFIARDITFRNTAGPLKGQAVALRS  329

Query  231   GADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMD  52
              +DLSVFY+C  EGYQDTL  H+QRQFY+ CYIYGTVDFIFGNAAVVFQNC+I  R+P++
Sbjct  330   ASDLSVFYRCAIEGYQDTLMVHAQRQFYRGCYIYGTVDFIFGNAAVVFQNCVILVRRPLN  389

Query  51    KQKITITAQGRTDPNQN  1
              Q   ITAQGR DP QN
Sbjct  390   GQANMITAQGRDDPFQN  406



>emb|CDX99916.1| BnaC09g27890D [Brassica napus]
Length=486

 Score =   359 bits (921),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 196/352 (56%), Positives = 241/352 (68%), Gaps = 25/352 (7%)
 Frame = -1

Query  993  MATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL---------  841
            M  E  +D A+ A     R    C + R++A +ADC+ LYEDTI+QL +TL         
Sbjct  1    MLVEATMDRAISARDELTRSSGNCTDCRKQAVFADCINLYEDTIVQLTRTLAGVAPKAGA  60

Query  840  DEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALN----  673
             +KCT FDA TWLSTALTN+ETCR G  +L  S  + P++SN  +S LI N LALN    
Sbjct  61   GKKCTDFDAQTWLSTALTNIETCRRGSSDLNVSDFITPIVSNTKISNLISNCLALNGALL  120

Query  672  ---NNGSVPKQTYKDG--FPAWVSLGDRRLLQASSP--VKPDLVVAKDGSGNYKTIKDAL  514
               NNG+    T  DG  FP WVS  +R LLQ  S   V+ ++VVAKDGSG   T++ A+
Sbjct  121  PIGNNGT----TTADGKDFPMWVSGKERGLLQLQSARAVRANIVVAKDGSGQVTTVQAAI  176

Query  513  DAAGKRS-GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTF  337
            D AG+R   S RFVI++KRG+Y EN+++     NIMLVGDGMR T I+G+RSV GG TT+
Sbjct  177  DVAGRRKVMSKRFVIYVKRGIYQENINVRLNNDNIMLVGDGMRSTIITGARSVKGGYTTY  236

Query  336  NSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQR  157
            NSAT  + G  FIA+G+TFRNTAGP   QAVALRS +DLS+FYKC  EGYQDTL  HSQR
Sbjct  237  NSATAGIEGLHFIAKGLTFRNTAGPAKGQAVALRSSSDLSIFYKCSIEGYQDTLMVHSQR  296

Query  156  QFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
            QFY++CYIYGT+DFIFGNAAVVFQNC+I  R+P+  Q   ITAQGR DP QN
Sbjct  297  QFYRECYIYGTIDFIFGNAAVVFQNCIILPRRPLHGQSNVITAQGRADPFQN  348



>ref|XP_004503381.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Cicer arietinum]
Length=546

 Score =   360 bits (925),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/394 (46%), Positives = 254/394 (64%), Gaps = 37/394 (9%)
 Frame = -1

Query  1089  CSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAE--THAKRLGPRCRN  916
             C+QTP+P  C +++  +  +  +    S F  MA ++ ++ A++A        L    ++
Sbjct  36    CNQTPYPHVCNHYIGTTTTNTLSTLDSSSFHDMALKVTMEQAIEAHKLVSTMELNNNFKD  95

Query  915   AREKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVE--LGNS  742
              R K+AW DC++LYEDTI QL ++++      D LTW S ++TN +TC+ GF++  L + 
Sbjct  96    KRAKSAWEDCLELYEDTIYQLKRSINSNNIN-DKLTWQSASITNHQTCQNGFIDFNLPSQ  154

Query  741   RNVLPLISNNNVSQLIGNTLALNN---------------------------NGSVPKQTY  643
              N  P + +N  S+L+ N+L++ N                           NG   ++  
Sbjct  155   LNYFPSMLSN-FSKLLSNSLSITNTIASSSHSLSSTSTSSSSSSSSSTNKQNGG--RRLL  211

Query  642   KDGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIK  463
              DGFP WVS  DR+LLQ +  ++ D+VVA+DGSGNYKTI + + AA K  G GR V+++K
Sbjct  212   SDGFPNWVSFSDRKLLQET--IEADIVVAQDGSGNYKTISEGVAAAAKLRGKGRVVVYVK  269

Query  462   RGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGIT  283
             RGVY EN+D+   +KN+M+VGDGM  T I+ + +   G TTF SAT  + GDGFIA+ +T
Sbjct  270   RGVYKENVDVKKTVKNLMIVGDGMDSTIITSNHNAQHGYTTFRSATFGIMGDGFIAKDMT  329

Query  282   FRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGN  103
             F NTAGP+NHQAVALRSGAD SVFY+C F+GYQDTLY ++QRQFY+DC IYGTVDFIFGN
Sbjct  330   FENTAGPQNHQAVALRSGADYSVFYRCAFKGYQDTLYVYAQRQFYRDCNIYGTVDFIFGN  389

Query  102   AAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             A  V QNC I+ RKPM  Q+ T+TAQ RTDPN+N
Sbjct  390   AVTVLQNCNIFVRKPMGNQQNTVTAQARTDPNEN  423



>ref|XP_010933723.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=522

 Score =   359 bits (922),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 193/374 (52%), Positives = 252/374 (67%), Gaps = 10/374 (3%)
 Frame = -1

Query  1104  EVNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPR  925
              ++ WC++TPHP+ C+Y LTH +     P  K +F K+  ++  D   +A++H  +LG R
Sbjct  30    HMDWWCNKTPHPEACRYHLTHPKSPH-QPMGKHQFYKLHLQVTYDLIGRAQSHLAQLGRR  88

Query  924   CRNAREKAAWADCVKLYEDTILQLNQTLDE---KCTQFDALTWLSTALTNLETCRTGFVE  754
             C  A E+ AW DC KLY DT  QLN+TL      CT  D  TWLS +LTNLE CR GF +
Sbjct  89    CSTAPERKAWLDCRKLYGDTYFQLNRTLHPPKPNCTALDYQTWLSASLTNLEACRRGFND  148

Query  753   LGNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGFPAWVSLGDRRLLQASSPVK  574
             LG S  ++  + + NVS LI N LA+N+  +    +      ++ S+G+R+LLQ S+  +
Sbjct  149   LGVSPEIIHPVMHYNVSDLISNCLAINHPNATTNSSAAVDVRSFTSVGNRKLLQLSA--Q  206

Query  573   PDLVVAKDGSGNYKTIKDALDAA---GKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLV  403
             P+ VVAK GSGN++TI+ ALDAA     R   GR VI +K GVY+E+L++ N L ++ +V
Sbjct  207   PNFVVAKHGSGNFRTIQAALDAALVLRSRRKRGRIVIRVKAGVYDEHLEVVNSLTDLTMV  266

Query  402   GDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGAD  223
             GDG   T I+G RSV  GSTTF+S T +V GDGFIA GITFRNT GP + QAVAL SG+D
Sbjct  267   GDGKGKTIITGRRSVATGSTTFSSPTFSVFGDGFIASGITFRNTYGPGS-QAVALLSGSD  325

Query  222   LSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQK  43
              S FY+C  EGYQDTL   +QRQFY++C IYGT+DFIFGNAAVV QNC I+AR+P   + 
Sbjct  326   RSTFYRCSIEGYQDTLCVFTQRQFYRECDIYGTIDFIFGNAAVVLQNCNIFARRPRRGEV  385

Query  42    ITITAQGRTDPNQN  1
               ITAQGRTDPNQN
Sbjct  386   NVITAQGRTDPNQN  399



>ref|XP_008812365.1| PREDICTED: pectinesterase [Phoenix dactylifera]
Length=521

 Score =   359 bits (921),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 196/373 (53%), Positives = 253/373 (68%), Gaps = 10/373 (3%)
 Frame = -1

Query  1101  VNRWCSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRC  922
             +  WC  TPHP  C+Y+L HS+     PK + +F K+  ++  D   +AE H  RLG RC
Sbjct  30    IEWWCRSTPHPHACRYYLAHSKSP-EQPKDEHQFYKLHLQLTYDLTARAEGHLGRLGRRC  88

Query  921   RNAREKAAWADCVKLYEDTILQLNQTLDEKCTQFDAL---TWLSTALTNLETCRTGFVEL  751
             R A E  AW DC KL+ +T+LQLN+TL  +   F AL   TWLS +LTNLETCR GF +L
Sbjct  89    RTAPESKAWFDCWKLFGNTVLQLNRTLHPQKPTFTALDFQTWLSASLTNLETCRKGFADL  148

Query  750   GNSRNVLPLISNNNVSQLIGNTLALNNNGSVPKQTYKDGFPAWVSLGDRRLLQASSPVKP  571
             G S  ++  + + N+S LI N LA+N        T     P++ S+ +R+LLQ S+  +P
Sbjct  149   GASAEIIHPVMHYNISDLISNCLAINQPNGTTNTTAAVDVPSFTSVANRKLLQLSA--RP  206

Query  570   DLVVAKDGSGNYKTIKDALDAAG---KRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVG  400
             + +VAKDGSGN++TI+ ALDAA     R+ SG+ VI +K GVY E+L + + L ++ +VG
Sbjct  207   NFIVAKDGSGNFRTIQAALDAAAALRSRTQSGKIVIRVKAGVYVEHLQVVSSLSDLTMVG  266

Query  399   DGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADL  220
             DG   T I+GSRSV  GSTTF+S T +V GDGFIA  ITFRNT GP + QAVAL SG+D 
Sbjct  267   DGKGKTIITGSRSVATGSTTFSSPTFSVFGDGFIASDITFRNTFGPGS-QAVALLSGSDR  325

Query  219   SVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKI  40
             S+FY+C FEGYQDTL   +QRQFY++C IYGTVDFIFGN AVV QNC I+AR+P   +  
Sbjct  326   SIFYRCSFEGYQDTLCVFTQRQFYRECDIYGTVDFIFGNGAVVLQNCNIFARRPRPGESN  385

Query  39    TITAQGRTDPNQN  1
              ITAQGRTDPNQN
Sbjct  386   VITAQGRTDPNQN  398



>gb|EYU43523.1| hypothetical protein MIMGU_mgv1a026199mg [Erythranthe guttata]
Length=484

 Score =   357 bits (916),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 189/356 (53%), Positives = 247/356 (69%), Gaps = 17/356 (5%)
 Frame = -1

Query  1020  PKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL  841
             PK + +F+ M    +L+ A+ A+T A   G  CR+ R+   + DC KL ++TILQL  TL
Sbjct  6     PKTREDFRTMTIVASLERAIDAQTRANISGSGCRSKRKAIVYRDCSKLMDNTILQLTSTL  65

Query  840   DE-----KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLAL  676
             +        T FDA TWLSTALTN+E CR+G  +L  ++   P++S N VS+LI N LA 
Sbjct  66    NNIQTNATFTVFDAQTWLSTALTNIEICRSGSRDLNVTKFTSPILSGN-VSELISNCLAT  124

Query  675   NN--------NGSVPKQTYKDGFPAWVSLGDRRLLQ-ASSPVKPDLVVAKDGS-GNYKTI  526
             N         N S      + GFP WVS GDR+LLQ  +   K ++VV++DGS G+++++
Sbjct  125   NGALLLDGGGNSSAAAGGGRRGFPGWVSGGDRKLLQDMALAAKANVVVSQDGSAGSFRSV  184

Query  525   KDALD-AAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvgg  349
             + A+D A  +R G+GR V+++KRGVY EN+ +   +  +MLVGDG+RYT I+GSRSV  G
Sbjct  185   QAAIDYATARRVGNGRVVVYVKRGVYRENILVSRTMNKVMLVGDGLRYTVITGSRSVAAG  244

Query  348   STTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYA  169
              TT++SAT  + G GFIA+GITFRNTAGP+  QAVALRS +DLSVFY C FEGYQDTL+ 
Sbjct  245   FTTYSSATFGIDGIGFIARGITFRNTAGPQKGQAVALRSASDLSVFYACAFEGYQDTLFV  304

Query  168   HSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             H+QRQFYK CYIYGT+DFIFGNAAVVFQNC+IY RKP+  Q   +TAQGR DP QN
Sbjct  305   HAQRQFYKSCYIYGTIDFIFGNAAVVFQNCIIYVRKPLVGQANVVTAQGRGDPFQN  360



>gb|KFK26750.1| hypothetical protein AALP_AA8G288600 [Arabis alpina]
Length=473

 Score =   355 bits (910),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 192/350 (55%), Positives = 237/350 (68%), Gaps = 21/350 (6%)
 Frame = -1

Query  993  MATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD--------  838
            M  E A+D A+ A     R    C ++R++A   DC+ LY DTILQL +TL         
Sbjct  1    MLVEAAMDRAISARDELTRSVRNCTDSRKQAVLTDCIDLYGDTILQLTRTLQGVSPKAGA  60

Query  837  -EKCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIGNTLALN----  673
             ++CT FDA TWLSTALTN ETCR G  +L  S  + P++SN  +S  I N LA+N    
Sbjct  61   GKRCTDFDAQTWLSTALTNTETCRRGSSDLNVSDFITPIVSNTKISNSISNCLAVNGALL  120

Query  672  ---NNGSVPKQTYKDGFPAWVSLGDRRLLQASSP--VKPDLVVAKDGSGNYKTIKDALDA  508
               NNG+      ++ FP WVS  +RRLLQ  S   V+ ++VVAKDGSG + T++ A+D 
Sbjct  121  PTGNNGTTTAD--QESFPTWVSGKERRLLQLQSARAVRANVVVAKDGSGQFITVQAAIDL  178

Query  507  AGKRS-GSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNS  331
            AG+R   SGRFVI++KRG+Y EN+++     +IMLVGDGMR T I+G RSV GG TT+NS
Sbjct  179  AGRRKVTSGRFVIYVKRGIYQENINVRLNNDDIMLVGDGMRSTIITGGRSVKGGYTTYNS  238

Query  330  ATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQF  151
            AT  + G  FIA+G+TFRNTAGP   QAVALRS +DLS+FYKC  EGYQDTL  HSQRQF
Sbjct  239  ATAGIEGLHFIAKGLTFRNTAGPAKGQAVALRSSSDLSIFYKCSIEGYQDTLMVHSQRQF  298

Query  150  YKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
            Y+DCYIYGTVDFIFGNAA VFQNC+I  R P+  Q   ITAQGR DP QN
Sbjct  299  YRDCYIYGTVDFIFGNAAAVFQNCLILPRLPLKGQANVITAQGRADPFQN  348



>ref|XP_004160315.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59-like 
[Cucumis sativus]
Length=486

 Score =   354 bits (909),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 195/358 (54%), Positives = 251/358 (70%), Gaps = 21/358 (6%)
 Frame = -1

Query  1020  PKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTL  841
             P+ + EF++MA +  L+ A +A  +  R GP C+ +R++ AW DC KLY D +LQLN+TL
Sbjct  8     PQNRREFRQMAIQTTLEKAAEARAYTARFGPTCKTSRQRTAWTDCFKLYNDVVLQLNRTL  67

Query  840   -----DE-----KCTQFDALTWLSTALTNLETCRTGFVELGNSRNVLPLISNNNVSQLIG  691
                  DE      CT FDA TWLS+ALT+++ C +G  +L  +  + P I   NVS++I 
Sbjct  68    HCVVTDEAIHRRSCTDFDAQTWLSSALTDIDLCNSGAADLNVTDFITP-IKCLNVSKMIS  126

Query  690   NTLALNNNGSVPKQ--TYKDG----FPAWVSLGDRRLLQASSP--VKPDLVVAKDGSGNY  535
             N LA+N  G + ++   Y DG    FP WVS GDR+LL+ S P  V+ +LVVAKDGSG +
Sbjct  127   NCLAING-GFLEEEGVKYDDGRNGSFPMWVSEGDRKLLE-SRPGRVRANLVVAKDGSGTF  184

Query  534   KTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvv  355
             + ++ A+DAA +R G GRF+I++KRGVY EN+++GN   NIMLVGDGMR+T I+  RSV 
Sbjct  185   RRVQAAIDAAARRRGRGRFIIYVKRGVYRENIEVGNDNGNIMLVGDGMRFTVITSGRSVA  244

Query  354   ggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTL  175
              G TTF+SAT  + G GFIA+ I F NTAGP   QAVALRS +DLSVF++C FEGYQDTL
Sbjct  245   AGFTTFSSATAGIQGPGFIARDIRFVNTAGPRMGQAVALRSSSDLSVFHRCSFEGYQDTL  304

Query  174   YAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
                SQRQFYK CY+YGT+DFIFGNAAVV QNCMIY R+P+  Q   ITAQGR DP QN
Sbjct  305   MVLSQRQFYKQCYVYGTIDFIFGNAAVVLQNCMIYVRRPLKGQVNVITAQGREDPFQN  362



>ref|XP_006826911.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
 gb|ERM94148.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
Length=515

 Score =   354 bits (909),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 195/378 (52%), Positives = 249/378 (66%), Gaps = 31/378 (8%)
 Frame = -1

Query  1089  CSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNAR  910
             CSQTP+P+ C  FL        +    S F+ +A   A+D   QA+           ++R
Sbjct  32    CSQTPYPEACNSFLPT-----VSQDTVSGFRNVAIMAAMD---QAQATLSWCPRGSMSSR  83

Query  909   EKAAWADCVKLYEDTILQLNQTL-DEKCTQFDALTWLSTALTNLETCRTGFVELGNSRNV  733
              +AAWADC++L EDT+ +LN+TL        D LTWLS A+TN +TCRTGF E       
Sbjct  84    AQAAWADCLELTEDTVSKLNKTLVSSNLASSDTLTWLSAAITNDDTCRTGFSET------  137

Query  732   LPLISNNNVSQLIGNTLALNNN---------GSVPKQ---TYKDGFPAWVSLGDRRLLQA  589
              P + + ++S+L+ N+LA+  +         G   ++       GFP WV  GDRRLLQA
Sbjct  138   -PWLKSTDLSKLLSNSLAVEKSFAARLDGLSGHTNRKLLSVQSRGFPEWVVAGDRRLLQA  196

Query  588   SSPVKPDLVVAKDGSGNYKTIKDALDAAGK--RSGSGRFVIHIKRGVYNENLDIGNKLKN  415
             S+  K +LVVAKDGSG + TI  A+ A+ K  ++ + RFVI++K G Y EN++I   +KN
Sbjct  197   STG-KANLVVAKDGSGGFATISAAITASEKQRKTSTSRFVIYVKEGTYKENIEIKKSMKN  255

Query  414   IMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALR  235
             +M VGDG+  T I+GSR+V  GSTTF SAT AV  DGFIA+ +TF NTAGP+ HQAVA R
Sbjct  256   LMFVGDGIDKTIITGSRNVQDGSTTFRSATFAVAADGFIAKDLTFENTAGPQKHQAVAFR  315

Query  234   SGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPM  55
             SG+DLSV Y+C F+GYQDTLY +SQRQFY++C IYGTVDFIFGNAA V QNC IY RKPM
Sbjct  316   SGSDLSVLYRCSFKGYQDTLYTYSQRQFYRECDIYGTVDFIFGNAAAVLQNCNIYVRKPM  375

Query  54    DKQKITITAQGRTDPNQN  1
               QK TITAQGRTDPNQN
Sbjct  376   SSQKNTITAQGRTDPNQN  393



>ref|XP_006580436.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=521

 Score =   353 bits (907),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 182/378 (48%), Positives = 252/378 (67%), Gaps = 18/378 (5%)
 Frame = -1

Query  1089  CSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLG-PRCRNA  913
             C++TP+P  C +++  +    T     S F  +A  + ++ A+ A     ++     ++ 
Sbjct  25    CNETPYPRVCMHYIETTNTLSTLDASSSSFHDLALRVTMEQAIVAHKLVSKMDLNNFKDK  84

Query  912   REKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVE--LGNSR  739
             R K+AW DC++LYEDT+ QL ++++      D LTW S ++ N +TC+ GF E  L +  
Sbjct  85    RAKSAWEDCLELYEDTLYQLKRSMNSNKLN-DRLTWQSASIANHQTCQNGFTEFNLPSHL  143

Query  738   NVLPLISNNNVSQLIGNTLALNNN------GSVPKQT------YKDGFPAWVSLGDRRLL  595
             N  P + +N  S+L+ N+L+++         S  KQ+        DGFP W+S  DRRLL
Sbjct  144   NYFPSMLSN-FSKLLSNSLSISKTMMMTLTTSSTKQSGGRRLLLSDGFPYWLSHSDRRLL  202

Query  594   QASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKN  415
             Q ++P K D+VVA+DGSGNYKTI + + AA K SG GR V+H+K GVY +++DI   +KN
Sbjct  203   QETTP-KADVVVAQDGSGNYKTISEGVAAAAKLSGKGRVVVHVKAGVYKDSIDIKRTVKN  261

Query  414   IMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALR  235
             +M++GDGM  T ++G+ +   GSTTF SAT AV+GDGFIA+ ITF NTAGP+ HQAVALR
Sbjct  262   LMIIGDGMGATIVTGNLNAQDGSTTFRSATFAVSGDGFIARDITFENTAGPQQHQAVALR  321

Query  234   SGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPM  55
             SGAD SVFY+C F GYQDTLY ++ RQFY+DC IYGT+DFIFG+A  V QNC IY RKPM
Sbjct  322   SGADHSVFYRCSFMGYQDTLYVYANRQFYRDCDIYGTIDFIFGDAVTVLQNCNIYVRKPM  381

Query  54    DKQKITITAQGRTDPNQN  1
               Q+ T+TAQ RTDPN+N
Sbjct  382   SNQQNTVTAQARTDPNEN  399



>gb|KHN21591.1| Putative pectinesterase/pectinesterase inhibitor 6 [Glycine soja]
Length=521

 Score =   353 bits (906),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 182/378 (48%), Positives = 252/378 (67%), Gaps = 18/378 (5%)
 Frame = -1

Query  1089  CSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLG-PRCRNA  913
             C++TP+P  C +++  +    T     S F  +A  + ++ A+ A     ++     ++ 
Sbjct  25    CNETPYPRVCMHYIETTNTLSTLDASSSSFHDLALRVTMEQAIVAHKLVSKMDLNNFKDK  84

Query  912   REKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVE--LGNSR  739
             R K+AW DC++LYEDT+ QL ++++      D LTW S ++ N +TC+ GF E  L +  
Sbjct  85    RAKSAWEDCLELYEDTLYQLKRSMNSNKLN-DRLTWQSASIANHQTCQNGFTEFNLPSHL  143

Query  738   NVLPLISNNNVSQLIGNTLALNNN------GSVPKQT------YKDGFPAWVSLGDRRLL  595
             N  P + +N  S+L+ N+L+++         S  KQ+        DGFP W+S  DRRLL
Sbjct  144   NYFPSMLSN-FSKLLSNSLSISKTMMMTLTTSSTKQSGGRRLLLSDGFPYWLSHSDRRLL  202

Query  594   QASSPVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNENLDIGNKLKN  415
             Q ++P K D+VVA+DGSGNYKTI + + AA K SG GR V+H+K GVY +++DI   +KN
Sbjct  203   QETTP-KADVVVAQDGSGNYKTISEGVAAAAKLSGKGRVVVHVKAGVYKDSIDIKRTVKN  261

Query  414   IMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGPENHQAVALR  235
             +M++GDGM  T ++G+ +   GSTTF SAT AV+GDGFIA+ ITF NTAGP+ HQAVALR
Sbjct  262   LMIIGDGMGATIVTGNLNAQDGSTTFRSATFAVSGDGFIARDITFENTAGPQQHQAVALR  321

Query  234   SGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQNCMIYARKPM  55
             SGAD SVFY+C F GYQDTLY ++ RQFY+DC IYGT+DFIFG+A  V QNC IY RKPM
Sbjct  322   SGADHSVFYRCSFMGYQDTLYVYANRQFYRDCDIYGTIDFIFGDAVTVLQNCNIYVRKPM  381

Query  54    DKQKITITAQGRTDPNQN  1
               Q+ T+TAQ RTDPN+N
Sbjct  382   SNQQNTVTAQARTDPNEN  399



>gb|KEH21379.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=541

 Score =   353 bits (907),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 183/387 (47%), Positives = 255/387 (66%), Gaps = 28/387 (7%)
 Frame = -1

Query  1089  CSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLG-PRCRNA  913
             C+QTP+P  C +++  +    +     S F  +  ++ LD A++A      +     ++ 
Sbjct  36    CNQTPYPHVCNHYIGTTTNKLSTLDSSSSFHDIVLKVTLDQAIEAHKLVSTMELNNFKDK  95

Query  912   REKAAWADCVKLYEDTILQLNQTLDEKCTQFDALTWLSTALTNLETCRTGFVE--LGNSR  739
               K+AW DC++LYEDTI QL ++++      D LTW S ++TN +TC+ GF++  L +  
Sbjct  96    HAKSAWEDCLELYEDTIYQLKRSINSNNLN-DKLTWQSASITNHQTCQNGFIDFNLPSHL  154

Query  738   NVLPLISNNNVSQLIGNTLALNN-----------------NGSVPKQTYKDGFPAWVSLG  610
             N  P + +N  ++L+ N+L+++N                 NG   ++   DGFP W+S  
Sbjct  155   NYFPSMLSN-FTKLLSNSLSISNTLTSSQSSSSSSSSTKQNGG--RRLLSDGFPYWLSGS  211

Query  609   DRRLLQAS--SPVKP--DLVVAKDGSGNYKTIKDALDAAGKRSGSGRFVIHIKRGVYNEN  442
             DR+LLQA+  S + P  D+VVA+DGSGNYKTI + + AA K SG GR VIH+K G+Y EN
Sbjct  212   DRKLLQATPGSGIGPRADIVVAQDGSGNYKTISEGVAAAAKLSGKGRVVIHLKAGIYKEN  271

Query  441   LDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGITFRNTAGP  262
             +DI   +KN+M+ GDGM  T ++G+ + + GSTTF SAT  V GDGFIA+ +TF NTAGP
Sbjct  272   VDIKKTVKNLMIFGDGMDSTIVTGNHNAIDGSTTFRSATFGVMGDGFIAKDMTFENTAGP  331

Query  261   ENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGNAAVVFQN  82
             + HQAVALRSGAD SVFY+C F+G+QDTLY ++ RQFY+DC IYGT+DFIFGNA  V QN
Sbjct  332   QKHQAVALRSGADHSVFYRCAFKGFQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQN  391

Query  81    CMIYARKPMDKQKITITAQGRTDPNQN  1
             C I+ RKPM  QK T+TAQGRTDPN+N
Sbjct  392   CNIFVRKPMSNQKNTVTAQGRTDPNEN  418



>gb|KDP38089.1| hypothetical protein JCGZ_04732 [Jatropha curcas]
Length=543

 Score =   352 bits (903),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 196/394 (50%), Positives = 262/394 (66%), Gaps = 35/394 (9%)
 Frame = -1

Query  1089  CSQTPHPDQCKYFLTHSRRHFTAPKRKSEFKKMATEIALDTAVQAETHAKRLGPRCRNA-  913
             CSQTP+P+ C +F+  +       +    F+  +  + ++ A++A  H   L     ++ 
Sbjct  31    CSQTPYPEICNHFMNTNILETEKDQTPFTFRDQSLLVTMNHAIKA--HQMILSLEMNDSF  88

Query  912   --REKAAWADCVKLYEDTILQLNQTLDEKCTQ----FDALTWLSTALTNLETCRTGFVEL  751
               + K A ADCV+LYEDTI  LN++L    +      D+ TWLS A TNL+TC+ GF E 
Sbjct  89    DEKAKLARADCVELYEDTIDHLNRSLFVSSSNNNNPVDSQTWLSAANTNLQTCQNGFTEF  148

Query  750   GNSRNVLP--LISN--NNVSQLIGNTLALN-------------------NNGSVPKQTYK  640
               + N L   L+ +  +N S+L+ N+LA+N                   + G   K  + 
Sbjct  149   NLTSNYLESLLLPDMLSNFSKLLSNSLAINKENYYISPLYNSKTVHPGSSGGGGRKLLHD  208

Query  639   DGFPAWVSLGDRRLLQASSPVKPDLVVAKDGSGNYKTIKDALDA-AGKRSGSGRFVIHIK  463
             D FP WVS+ DR+LLQ SSP + D+VVA+DGSGNYKTI +A+ A A +RSG+ RFVI++K
Sbjct  209   DEFPWWVSVTDRKLLQ-SSP-EADIVVAQDGSGNYKTIGEAVAASATRRSGNKRFVIYVK  266

Query  462   RGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDGFIAQGIT  283
             +GVY E ++I N + N+ML+GDG+  T ++G+++   GSTTF SAT AV+G+GFIA+ IT
Sbjct  267   KGVYKEYVEIKNSMNNLMLIGDGIDATIVTGNKNNQDGSTTFRSATFAVSGEGFIAKDIT  326

Query  282   FRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGTVDFIFGN  103
             F NTAGP+ HQAVALRSG+D SVFY C F+GYQDTLY +SQRQFY+DC IYGTVDFIFGN
Sbjct  327   FENTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGN  386

Query  102   AAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             A VVFQNC IY RKPM  QK T+TAQ RTDPN+N
Sbjct  387   AVVVFQNCNIYVRKPMSGQKNTVTAQARTDPNEN  420



>gb|KHG13344.1| Uncharacterized protein F383_18528 [Gossypium arboreum]
Length=522

 Score =   350 bits (898),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 196/405 (48%), Positives = 262/405 (65%), Gaps = 24/405 (6%)
 Frame = -1

Query  1167  LASFSSFISVALSVNPPAAAGEVNRWCSQTPHPDQCKYFLTHSRRHFTAP----KRKSEF  1000
             L +    IS   +  P   A      C+QTP+PD C +F+ +     T+     + +  F
Sbjct  4     LLAIPFLISYFFTCVPLGNAAATITSCTQTPYPDVCNHFMGNGVNVATSSLALDQTRYSF  63

Query  999   KKMATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLDEKCTQF  820
             + +A ++ L+ AVQA      +     N R K AW DC++LY+DTI  LNQ+     +  
Sbjct  64    RDLAIQVTLNQAVQAHHLVSTMDLTSFNERAKLAWNDCLELYQDTISHLNQS-KSTNSPL  122

Query  819   DALTWLSTALTNLETCRTGFVE--LGNSRNVLPLISNNNVSQLIGNTLALNN-------N  667
             DA TWLS A+TN +TC+ GF++  L +    LPL+  N  S+LI N+LA+N        N
Sbjct  123   DAQTWLSAAITNHQTCQNGFIDFNLASHLQTLPLMLTN-FSKLISNSLAINKPTVSVTAN  181

Query  666   GSVPKQTYKDGFPAWVSLGDRRLLQ-ASSPVKPDLVVAKDGSGNYKTIKDALDA--AGKR  496
                 ++   +GFP W+S  DR+LLQ  S+P+  D+VVA+DGSGN+KTI +A+ A  +GKR
Sbjct  182   QVGNRRLLVNGFPTWLSGADRKLLQKTSAPLNADIVVAQDGSGNFKTISEAVAAIESGKR  241

Query  495   SGSGRFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAV  316
             +     VIH+K GVYNEN+DI    KNIML+GDG+  T I+G+++    +T   +AT AV
Sbjct  242   T-----VIHVKAGVYNENVDIQRSAKNIMLIGDGIGATVITGNKNAQTTTTF-RTATFAV  295

Query  315   TGDGFIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCY  136
              GDGFIA+ ITF NTAGP+ HQAVALRSG+D SVFY+C F+GYQDTLY +SQRQFY+DC 
Sbjct  296   VGDGFIARDITFENTAGPQKHQAVALRSGSDFSVFYRCSFKGYQDTLYVYSQRQFYRDCD  355

Query  135   IYGTVDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
             IYGTVDFIFG+A  VFQNC IY R+PM  Q  T+TAQ RTDPN+N
Sbjct  356   IYGTVDFIFGDAIAVFQNCNIYIRRPMSGQMNTVTAQARTDPNEN  400



>ref|XP_008781656.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=460

 Score =   348 bits (892),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 185/341 (54%), Positives = 248/341 (73%), Gaps = 14/341 (4%)
 Frame = -1

Query  993  MATEIALDTAVQAETHAKRLGPRCRNAREKAAWADCVKLYEDTILQLNQTLD----EKCT  826
            M+ ++ALD AVQA   A  LG    +  E++AW+DC++LYE T+ QL+ TL        +
Sbjct  1    MSIQVALDHAVQARARAIGLGLMNLDKHEQSAWSDCIELYEATVQQLDLTLRLNPLNPRS  60

Query  825  QFDALTWLSTALTNLETCRTGFVELGNSRNVL-PLISNNNVSQLIGNTLA---LNNNGSV  658
              D  +WLS ALTNL TCRT F E+  S + + PL++N  VS+LI N+LA   L+   + 
Sbjct  61   HSDECSWLSAALTNLNTCRTSFSEVNVSVSTIEPLLTN--VSKLISNSLAIIRLSRRHAH  118

Query  657  PKQTYKDGFPAWVSLGDRRLLQASS--PVKPDLVVAKDGSGNYKTIKDALDAAGKRSGSG  484
               ++  GFP W+   DR+LL+ S    ++ DLVVAKDG+G++ ++  A+D A K  G+ 
Sbjct  119  GPGSHNRGFPDWLLAEDRKLLEVSEREEMEADLVVAKDGTGDFTSVGKAVDEASKGGGNK  178

Query  483  RFVIHIKRGVYNENLDIGNKLKNIMLVGDGMRYTYIsgsrsvvggSTTFNSATVAVTGDG  304
            R VI++K+GVY EN+++  +++N+MLVGDG+  + I+GS+S  GGSTT+NSA  AVTG+ 
Sbjct  179  RIVIYVKKGVYEENVNV--EMRNLMLVGDGIGKSVITGSKSAGGGSTTYNSAAFAVTGEK  236

Query  303  FIAQGITFRNTAGPENHQAVALRSGADLSVFYKCGFEGYQDTLYAHSQRQFYKDCYIYGT  124
            F+A+GITFRNTAGP  HQAVALRS +DLSVF++C FEGYQDTLY HS RQFY++C +YGT
Sbjct  237  FMARGITFRNTAGPAKHQAVALRSNSDLSVFHQCSFEGYQDTLYVHSLRQFYRECEVYGT  296

Query  123  VDFIFGNAAVVFQNCMIYARKPMDKQKITITAQGRTDPNQN  1
            VDFIFGNAAVVFQ+C IY R+PM +QK TITAQGRTDPNQN
Sbjct  297  VDFIFGNAAVVFQSCNIYVRRPMSQQKNTITAQGRTDPNQN  337



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3249488224448