BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84323_g1_i1 len=2564 path=[1:0-2563]

Length=2564
                                                                      Score     E

dbj|BAE79385.1|  unnamed protein product                                211   5e-58   Ipomoea batatas [batate]
dbj|BAE79382.1|  unnamed protein product                                209   2e-57   Ipomoea batatas [batate]
dbj|BAE79384.1|  unnamed protein product                                206   4e-57   Ipomoea batatas [batate]
ref|XP_008242678.1|  PREDICTED: putative ribonuclease H protein A...    162   8e-40   
ref|XP_008237302.1|  PREDICTED: putative ribonuclease H protein A...    160   4e-39   
gb|AID60103.1|  hypothetical protein                                    127   3e-36   
ref|XP_004301145.1|  PREDICTED: putative ribonuclease H protein A...    151   7e-36   
ref|XP_007039838.1|  RNA-directed DNA polymerase (Reverse transcr...    147   1e-35   
ref|XP_009101981.1|  PREDICTED: putative ribonuclease H protein A...    132   2e-35   
ref|XP_009344908.1|  PREDICTED: uncharacterized protein LOC103936764    140   6e-35   
ref|XP_009119466.1|  PREDICTED: uncharacterized protein LOC103844431    125   1e-34   
gb|ABD28505.2|  RNA-directed DNA polymerase (Reverse transcriptas...    144   2e-33   Medicago truncatula
ref|XP_010670869.1|  PREDICTED: uncharacterized protein LOC104887816    129   9e-33   
ref|XP_007023195.1|  Non-LTR retroelement reverse transcriptase         140   2e-32   
ref|XP_008221358.1|  PREDICTED: putative ribonuclease H protein A...    137   1e-31   
ref|XP_007023230.1|  Non-LTR retroelement reverse transcriptase         141   5e-31   
ref|XP_008382509.1|  PREDICTED: putative ribonuclease H protein A...    134   1e-30   
ref|XP_008367475.1|  PREDICTED: uncharacterized protein LOC103431103    132   2e-30   
ref|XP_008222990.1|  PREDICTED: putative ribonuclease H protein A...    132   6e-30   
ref|XP_009144970.1|  PREDICTED: putative ribonuclease H protein A...    132   1e-29   
ref|XP_004299997.1|  PREDICTED: putative ribonuclease H protein A...    124   3e-29   
gb|ABW81175.1|  non-LTR retrotransposon transposase                     124   4e-29   Arabidopsis cebennensis
ref|XP_008382267.1|  PREDICTED: putative ribonuclease H protein A...    125   1e-28   
dbj|BAB09815.1|  non-LTR retroelement reverse transcriptase-like        127   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007033353.1|  Non-LTR retroelement reverse transcriptase-like    101   2e-27   
ref|XP_004305757.1|  PREDICTED: putative ribonuclease H protein A...    119   2e-27   
gb|KFK31801.1|  hypothetical protein AALP_AA6G160600                    125   2e-27   
ref|XP_009151561.1|  PREDICTED: putative ribonuclease H protein A...    122   2e-27   
ref|XP_009107896.1|  PREDICTED: putative ribonuclease H protein A...    125   5e-27   
ref|XP_008351723.1|  PREDICTED: putative ribonuclease H protein A...    120   8e-27   
sp|P0C2F6.1|RNHX1_ARATH  RecName: Full=Putative ribonuclease H pr...    122   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124282.1|  PREDICTED: putative ribonuclease H protein A...    120   9e-27   
gb|AAF23831.1|AC007234_3  F1E22.12                                      121   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006492639.1|  PREDICTED: putative ribonuclease H protein A...    121   8e-26   
ref|XP_007039706.1|  Non-LTR retroelement reverse transcriptase         120   1e-25   
ref|XP_007042183.1|  Ribonuclease H protein                             121   2e-25   
ref|XP_008229470.1|  PREDICTED: putative ribonuclease H protein A...    116   3e-25   
ref|XP_008245777.1|  PREDICTED: putative ribonuclease H protein A...    118   5e-25   
emb|CCA65997.1|  hypothetical protein                                   107   1e-24   
gb|ABE80133.2|  Polynucleotidyl transferase, Ribonuclease H fold        115   2e-24   Medicago truncatula
gb|AAC63844.1|  putative non-LTR retroelement reverse transcriptase     114   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007031938.1|  Ribonuclease H protein                             117   6e-24   
ref|XP_008233168.1|  PREDICTED: putative ribonuclease H protein A...    117   8e-24   
gb|AAD22368.1|  putative non-LTR retroelement reverse transcriptase     114   9e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004295896.1|  PREDICTED: putative ribonuclease H protein A...    113   2e-23   
ref|XP_009116295.1|  PREDICTED: putative ribonuclease H protein A...    110   2e-23   
ref|XP_004289445.1|  PREDICTED: putative ribonuclease H protein A...    111   2e-23   
ref|XP_006469101.1|  PREDICTED: putative ribonuclease H protein A...    100   4e-23   
ref|XP_008233465.1|  PREDICTED: putative ribonuclease H protein A...    113   1e-22   
emb|CAB78008.1|  putative protein                                       103   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123770.1|  PREDICTED: putative ribonuclease H protein A...    105   2e-22   
ref|XP_008221996.1|  PREDICTED: putative ribonuclease H protein A...    112   2e-22   
ref|XP_010039376.1|  PREDICTED: uncharacterized protein LOC104428079    103   4e-22   
ref|XP_004306074.1|  PREDICTED: putative ribonuclease H protein A...    102   4e-22   
ref|XP_008345768.1|  PREDICTED: putative ribonuclease H protein A...    103   5e-22   
ref|XP_010689711.1|  PREDICTED: uncharacterized protein LOC104903385    102   5e-22   
emb|CCA66009.1|  hypothetical protein                                   112   7e-22   
ref|XP_007010351.1|  Polynucleotidyl transferase, putative              108   8e-22   
ref|XP_008377870.1|  PREDICTED: putative ribonuclease H protein A...    102   9e-22   
ref|XP_009107495.1|  PREDICTED: putative ribonuclease H protein A...    107   1e-21   
gb|KHN33900.1|  Putative ribonuclease H protein                         107   1e-21   
ref|XP_008357937.1|  PREDICTED: putative ribonuclease H protein A...    100   2e-21   
gb|ABD33209.1|  Ribonuclease H                                          106   3e-21   Medicago truncatula
ref|XP_008223806.1|  PREDICTED: putative ribonuclease H protein A...    105   3e-21   
gb|ABK28199.1|  unknown                                                 106   3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006480844.1|  PREDICTED: putative ribonuclease H protein A...  93.2    3e-21   
gb|AAD21515.1|  putative reverse transcriptase                          105   3e-21   Arabidopsis thaliana [mouse-ear cress]
gb|ABE65462.1|  hypothetical protein At2g27870                          105   3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008384440.1|  PREDICTED: putative ribonuclease H protein A...    100   4e-21   
ref|XP_008225764.1|  PREDICTED: putative ribonuclease H protein A...  99.4    4e-21   
ref|XP_008366684.1|  PREDICTED: uncharacterized protein LOC103430323  99.8    5e-21   
ref|XP_007206968.1|  hypothetical protein PRUPE_ppb019197mg             105   6e-21   
ref|XP_009147282.1|  PREDICTED: putative ribonuclease H protein A...    105   7e-21   
gb|AAC26674.1|  putative non-LTR retroelement reverse transcriptase     108   7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008385092.1|  PREDICTED: putative ribonuclease H protein A...  99.8    1e-20   
ref|XP_008381797.1|  PREDICTED: uncharacterized protein LOC103444619  98.2    1e-20   
ref|XP_007017129.1|  Uncharacterized protein TCM_042328               83.2    1e-20   
ref|XP_010668235.1|  PREDICTED: uncharacterized protein LOC104885230    101   3e-20   
ref|XP_010674616.1|  PREDICTED: uncharacterized protein LOC104890737    100   3e-20   
ref|XP_008375089.1|  PREDICTED: uncharacterized protein LOC103438319  96.7    4e-20   
ref|XP_007226572.1|  hypothetical protein PRUPE_ppa024162mg             102   6e-20   
ref|XP_008354602.1|  PREDICTED: uncharacterized protein LOC103418244  95.1    8e-20   
emb|CDP17945.1|  unnamed protein product                              95.5    1e-19   
ref|XP_004296004.1|  PREDICTED: putative ribonuclease H protein A...  91.7    1e-19   
ref|XP_007227312.1|  hypothetical protein PRUPE_ppa016553mg           92.8    2e-19   
ref|XP_006584399.1|  PREDICTED: putative ribonuclease H protein A...  95.1    2e-19   
ref|XP_008370907.1|  PREDICTED: putative ribonuclease H protein A...  94.4    2e-19   
ref|XP_008346965.1|  PREDICTED: putative ribonuclease H protein A...  94.4    4e-19   
ref|XP_009124780.1|  PREDICTED: putative ribonuclease H protein A...  99.8    5e-19   
ref|XP_007008704.1|  Uncharacterized protein TCM_042330               77.8    5e-19   
ref|XP_010672383.1|  PREDICTED: uncharacterized protein LOC104888966    102   7e-19   
ref|XP_004293076.1|  PREDICTED: putative ribonuclease H protein A...    100   8e-19   
ref|XP_007203348.1|  hypothetical protein PRUPE_ppa020364mg           97.8    2e-18   
ref|XP_008383873.1|  PREDICTED: putative ribonuclease H protein A...  98.2    2e-18   
ref|XP_010667070.1|  PREDICTED: uncharacterized protein LOC104884169  87.0    2e-18   
ref|XP_009120305.1|  PREDICTED: putative ribonuclease H protein A...  97.4    2e-18   
ref|XP_007219945.1|  hypothetical protein PRUPE_ppb019389mg             100   3e-18   
ref|XP_008369981.1|  PREDICTED: uncharacterized protein LOC103433498  89.4    4e-18   
ref|XP_008227502.1|  PREDICTED: putative ribonuclease H protein A...  94.7    4e-18   
ref|XP_007210660.1|  hypothetical protein PRUPE_ppa022173mg           96.3    5e-18   
ref|XP_008245452.1|  PREDICTED: putative ribonuclease H protein A...  97.1    6e-18   
ref|NP_189164.1|  ribonuclease H-like protein                         95.9    9e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126860.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  85.5    2e-17   
ref|XP_008220882.1|  PREDICTED: uncharacterized protein LOC103320918  97.4    2e-17   
ref|XP_007226339.1|  hypothetical protein PRUPE_ppa022315mg           94.4    2e-17   
ref|XP_008344356.1|  PREDICTED: putative ribonuclease H protein A...  94.4    3e-17   
gb|KHN02883.1|  Putative ribonuclease H protein                       92.8    7e-17   
ref|XP_010682933.1|  PREDICTED: uncharacterized protein LOC104897695  89.4    8e-17   
ref|XP_008244613.1|  PREDICTED: putative ribonuclease H protein A...  95.9    8e-17   
gb|ADK92871.1|  retrotransposon protein                               83.6    8e-17   
ref|XP_009115103.1|  PREDICTED: putative ribonuclease H protein A...  92.4    9e-17   
ref|XP_006469117.1|  PREDICTED: putative ribonuclease H protein A...  93.2    1e-16   
ref|XP_004308214.1|  PREDICTED: putative ribonuclease H protein A...  93.2    1e-16   
ref|XP_007010390.1|  Retrotransposon, unclassified-like protein       75.5    1e-16   
ref|XP_006584439.1|  PREDICTED: putative ribonuclease H protein A...  92.4    2e-16   
ref|XP_004309110.1|  PREDICTED: putative ribonuclease H protein A...  92.4    3e-16   
ref|XP_006492749.1|  PREDICTED: uncharacterized protein LOC102612946  89.0    3e-16   
ref|XP_008346905.1|  PREDICTED: uncharacterized protein LOC103409892  89.7    4e-16   
ref|XP_010026656.1|  PREDICTED: uncharacterized protein LOC104417027  88.2    5e-16   
ref|XP_008358855.1|  PREDICTED: uncharacterized protein LOC103422573  86.7    5e-16   
ref|XP_008341993.1|  PREDICTED: uncharacterized protein LOC103404803  93.6    6e-16   
ref|XP_009144812.1|  PREDICTED: putative ribonuclease H protein A...  87.4    6e-16   
ref|XP_006490008.1|  PREDICTED: uncharacterized protein LOC102624085  93.2    7e-16   
ref|XP_010058710.1|  PREDICTED: uncharacterized protein LOC104446568  90.1    8e-16   
ref|XP_007224406.1|  hypothetical protein PRUPE_ppa021713mg           90.5    8e-16   
ref|XP_006464882.1|  PREDICTED: putative ribonuclease H protein A...  85.1    9e-16   
ref|XP_006493122.1|  PREDICTED: putative ribonuclease H protein A...  84.7    9e-16   
ref|XP_008349386.1|  PREDICTED: putative ribonuclease H protein A...  89.4    9e-16   
ref|XP_010054376.1|  PREDICTED: uncharacterized protein LOC104442671  88.6    1e-15   
ref|XP_006493121.1|  PREDICTED: putative ribonuclease H protein A...  84.3    1e-15   
ref|XP_008224763.1|  PREDICTED: putative ribonuclease H protein A...  89.0    1e-15   
ref|XP_004309882.1|  PREDICTED: putative ribonuclease H protein A...  86.3    1e-15   
ref|XP_009102110.1|  PREDICTED: putative ribonuclease H protein A...  90.5    1e-15   
ref|XP_008233458.1|  PREDICTED: putative ribonuclease H protein A...  88.6    1e-15   
gb|EPS69206.1|  hypothetical protein M569_05560                       75.9    2e-15   
ref|NP_001066197.2|  Os12g0156200                                     79.0    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008225175.1|  PREDICTED: putative ribonuclease H protein A...  88.2    2e-15   
ref|XP_008389974.1|  PREDICTED: putative ribonuclease H protein A...  81.6    2e-15   
ref|XP_007224103.1|  hypothetical protein PRUPE_ppa015621mg           86.7    2e-15   
ref|XP_006480463.1|  PREDICTED: putative ribonuclease H protein A...  89.4    3e-15   
ref|XP_008221992.1|  PREDICTED: uncharacterized protein LOC103321917  78.2    3e-15   
ref|XP_007046404.1|  Uncharacterized protein TCM_011923               62.0    3e-15   
ref|XP_002516183.1|  conserved hypothetical protein                   87.0    3e-15   Ricinus communis
ref|XP_007026458.1|  Uncharacterized protein TCM_021522               80.9    4e-15   
ref|XP_009114067.1|  PREDICTED: putative ribonuclease H protein A...  89.0    5e-15   
ref|XP_002461212.1|  hypothetical protein SORBIDRAFT_02g042875        89.0    5e-15   Sorghum bicolor [broomcorn]
gb|EEC69465.1|  hypothetical protein OsI_38661                        82.4    5e-15   Oryza sativa Indica Group [Indian rice]
gb|KHN24231.1|  Putative ribonuclease H protein                       86.7    6e-15   
ref|XP_008244843.1|  PREDICTED: putative ribonuclease H protein A...  87.8    6e-15   
ref|XP_008364703.1|  PREDICTED: putative ribonuclease H protein A...  89.4    6e-15   
ref|XP_008226782.1|  PREDICTED: putative ribonuclease H protein A...  89.7    6e-15   
ref|XP_010030447.1|  PREDICTED: uncharacterized protein LOC104420277  86.3    7e-15   
ref|XP_008340288.1|  PREDICTED: putative ribonuclease H protein A...  87.0    7e-15   
gb|EEE53388.1|  hypothetical protein OsJ_36435                        82.4    8e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...  80.9    1e-14   Oryza sativa Japonica Group [Japonica rice]
gb|KHN40328.1|  Putative ribonuclease H protein                       84.3    1e-14   
gb|AAP54617.2|  retrotransposon protein, putative, unclassified       80.5    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009113843.1|  PREDICTED: putative ribonuclease H protein A...  83.6    1e-14   
gb|KHN01590.1|  Putative ribonuclease H protein                       88.6    1e-14   
ref|XP_009148725.1|  PREDICTED: uncharacterized protein LOC103872128  88.6    1e-14   
ref|XP_010490159.1|  PREDICTED: uncharacterized protein LOC104767890  80.1    1e-14   
ref|XP_008222000.1|  PREDICTED: putative ribonuclease H protein A...  87.8    1e-14   
ref|XP_008348238.1|  PREDICTED: uncharacterized protein LOC103411380  80.9    1e-14   
ref|XP_010667308.1|  PREDICTED: uncharacterized protein LOC104884364  82.8    2e-14   
ref|XP_008795667.1|  PREDICTED: putative ribonuclease H protein A...  79.3    2e-14   
ref|XP_006483194.1|  PREDICTED: putative ribonuclease H protein A...  80.1    2e-14   
ref|XP_004292002.1|  PREDICTED: uncharacterized protein LOC101312896  85.5    2e-14   
ref|XP_009119675.1|  PREDICTED: putative ribonuclease H protein A...  88.6    2e-14   
ref|XP_010673997.1|  PREDICTED: uncharacterized protein LOC104890275  76.3    2e-14   
ref|XP_010684763.1|  PREDICTED: uncharacterized protein LOC104899296  75.9    2e-14   
ref|XP_007220772.1|  hypothetical protein PRUPE_ppa026532mg           85.1    2e-14   
ref|XP_008375111.1|  PREDICTED: putative ribonuclease H protein A...  87.8    2e-14   
gb|AAK39575.1|AC025296_10  putative reverse transcriptase             79.7    2e-14   Oryza sativa [red rice]
ref|XP_008362180.1|  PREDICTED: uncharacterized protein LOC103425857  77.0    2e-14   
emb|CCA66044.1|  hypothetical protein                                 80.5    3e-14   
gb|AEJ07916.1|  putative ZmL1 non-LTR retrotransposon protein         82.4    3e-14   
ref|XP_010041058.1|  PREDICTED: uncharacterized protein LOC104429964  82.0    3e-14   
ref|XP_010451607.1|  PREDICTED: uncharacterized protein LOC104733752  85.1    3e-14   
ref|XP_004301837.1|  PREDICTED: putative ribonuclease H protein A...  85.9    3e-14   
ref|XP_009800085.1|  PREDICTED: uncharacterized protein LOC104246050  87.4    3e-14   
ref|XP_008232623.1|  PREDICTED: putative ribonuclease H protein A...  87.4    3e-14   
ref|XP_006491472.1|  PREDICTED: uncharacterized protein LOC102626455  79.3    3e-14   
ref|XP_010676027.1|  PREDICTED: uncharacterized protein LOC104891937  77.8    3e-14   
gb|ABA97040.1|  retrotransposon protein, putative, unclassified       77.4    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008382787.1|  PREDICTED: putative ribonuclease H protein A...  80.5    4e-14   
ref|XP_008237273.1|  PREDICTED: uncharacterized protein LOC103336015  87.4    4e-14   
gb|AAQ19327.1|  bZIP-like protein                                     79.0    4e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009107025.1|  PREDICTED: putative ribonuclease H protein A...  73.2    4e-14   
ref|XP_008222895.1|  PREDICTED: putative ribonuclease H protein A...  77.4    4e-14   
ref|XP_008346916.1|  PREDICTED: putative ribonuclease H protein A...  86.7    5e-14   
ref|NP_187562.1|  RNase H domain-containing protein                   82.4    5e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006485451.1|  PREDICTED: uncharacterized protein LOC102622884  87.0    5e-14   
ref|XP_007207950.1|  hypothetical protein PRUPE_ppa017250mg           82.8    6e-14   
gb|EEC68446.1|  hypothetical protein OsI_36656                        83.2    7e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_007219414.1|  hypothetical protein PRUPE_ppa021915mg           85.5    7e-14   
ref|XP_010424493.1|  PREDICTED: uncharacterized protein LOC104709611  80.5    8e-14   
ref|XP_010507122.1|  PREDICTED: uncharacterized protein LOC104783698  82.8    8e-14   
ref|XP_007208821.1|  hypothetical protein PRUPE_ppa025050mg           67.8    9e-14   
ref|XP_006492478.1|  PREDICTED: putative ribonuclease H protein A...  82.8    1e-13   
emb|CCA66050.1|  hypothetical protein                                 86.3    1e-13   
ref|XP_008378657.1|  PREDICTED: putative ribonuclease H protein A...  83.6    1e-13   
ref|XP_010418809.1|  PREDICTED: uncharacterized protein LOC104704411  82.0    1e-13   
ref|XP_009145555.1|  PREDICTED: putative ribonuclease H protein A...  85.5    1e-13   
ref|XP_007044601.1|  Uncharacterized protein TCM_010295               82.4    1e-13   
ref|XP_008356537.1|  PREDICTED: uncharacterized protein LOC103420255  77.8    1e-13   
ref|XP_008223235.1|  PREDICTED: uncharacterized protein LOC103323054  84.7    1e-13   
gb|EEE54600.1|  hypothetical protein OsJ_01823                        80.1    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008794416.1|  PREDICTED: uncharacterized protein LOC103710479  64.7    1e-13   
gb|ABE80156.1|  Ribonuclease H                                        84.0    2e-13   Medicago truncatula
ref|XP_006478726.1|  PREDICTED: putative ribonuclease H protein A...  79.0    2e-13   
ref|NP_001175214.1|  Os07g0501200                                     84.7    2e-13   
ref|XP_008364397.1|  PREDICTED: putative ribonuclease H protein A...  82.4    2e-13   
ref|XP_008353155.1|  PREDICTED: putative ribonuclease H protein A...  82.4    2e-13   
gb|KHM99756.1|  TMV resistance protein N                              85.1    2e-13   
ref|XP_008228034.1|  PREDICTED: putative ribonuclease H protein A...  84.7    2e-13   
ref|XP_009130050.1|  PREDICTED: putative ribonuclease H protein A...  84.7    2e-13   
emb|CCA65995.1|  hypothetical protein                                 73.2    2e-13   
ref|XP_010480729.1|  PREDICTED: uncharacterized protein LOC104759515  75.9    2e-13   
ref|XP_010026542.1|  PREDICTED: uncharacterized protein LOC104416906  81.6    3e-13   
ref|XP_008233455.1|  PREDICTED: putative ribonuclease H protein A...  72.4    3e-13   
ref|XP_008385035.1|  PREDICTED: putative ribonuclease H protein A...  82.4    3e-13   
gb|EMS67416.1|  Protein argonaute 1D                                  77.8    3e-13   
ref|XP_004293049.1|  PREDICTED: putative ribonuclease H protein A...  74.7    4e-13   
ref|XP_008243410.1|  PREDICTED: uncharacterized protein LOC103341644  82.0    4e-13   
ref|XP_002462720.1|  hypothetical protein SORBIDRAFT_02g030860        74.7    4e-13   Sorghum bicolor [broomcorn]
gb|EEC81662.1|  hypothetical protein OsI_25211                        78.6    4e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_008780552.1|  PREDICTED: putative ribonuclease H protein A...  80.5    4e-13   
ref|XP_008352230.1|  PREDICTED: putative ribonuclease H protein A...  82.0    5e-13   
ref|NP_680382.1|  polynucleotidyl transferase, ribonuclease H-lik...  80.1    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151515.1|  PREDICTED: putative ribonuclease H protein A...  82.8    5e-13   
ref|XP_008238071.1|  PREDICTED: putative ribonuclease H protein A...  82.8    5e-13   
ref|XP_007022459.1|  RNase H family protein                           64.3    5e-13   
dbj|BAI67988.1|  hypothetical protein                                 80.9    5e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_008808028.1|  PREDICTED: uncharacterized protein LOC103720203  73.9    6e-13   
ref|XP_010474601.1|  PREDICTED: uncharacterized protein LOC104754160  77.0    6e-13   
gb|AAF79490.1|AC022492_34  F1L3.4                                     80.1    6e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446251.1|  PREDICTED: uncharacterized protein LOC104729051  77.0    6e-13   
ref|XP_008366311.1|  PREDICTED: putative ribonuclease H protein A...  79.7    6e-13   
gb|EAZ40370.1|  hypothetical protein OsJ_24816                        82.8    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006494016.1|  PREDICTED: uncharacterized protein LOC102608298  74.3    6e-13   
ref|XP_007019466.1|  Polynucleotidyl transferase, putative            81.3    7e-13   
dbj|BAB09192.1|  non-LTR retroelement reverse transcriptase-like ...  80.1    7e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CAB39638.1|  RNA-directed DNA polymerase-like protein             76.3    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413  72.4    7e-13   
gb|AAF97302.1|AC007843_5  Hypothetical protein                        79.7    8e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010495165.1|  PREDICTED: uncharacterized protein LOC104772227  79.3    9e-13   
ref|XP_008804236.1|  PREDICTED: putative ribonuclease H protein A...  78.6    9e-13   
ref|XP_007227248.1|  hypothetical protein PRUPE_ppa018001mg           82.0    9e-13   
ref|XP_006587415.1|  PREDICTED: putative ribonuclease H protein A...  81.6    1e-12   
gb|ABA99231.1|  hypothetical protein LOC_Os12g34030                   80.1    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010682492.1|  PREDICTED: uncharacterized protein LOC104897331  80.5    1e-12   
ref|XP_009121276.1|  PREDICTED: putative ribonuclease H protein A...  60.5    1e-12   
ref|XP_007020288.1|  Uncharacterized protein TCM_036737               82.8    1e-12   
ref|XP_006285450.1|  hypothetical protein CARUB_v10006875mg           80.9    1e-12   
ref|XP_009115971.1|  PREDICTED: putative ribonuclease H protein A...  80.5    1e-12   
ref|XP_009343973.1|  PREDICTED: uncharacterized protein LOC103935882  73.9    2e-12   
gb|AAG51783.1|AC079679_3  reverse transcriptase, putative; 16838-...  79.0    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207072.1|  hypothetical protein PRUPE_ppa026284mg           69.3    2e-12   
ref|XP_006491602.1|  PREDICTED: uncharacterized protein LOC102623801  80.5    2e-12   
ref|XP_010693635.1|  PREDICTED: uncharacterized protein LOC104906563  81.6    2e-12   
emb|CDY67599.1|  BnaAnng24740D                                        79.3    2e-12   
ref|XP_008226028.1|  PREDICTED: putative ribonuclease H protein A...  78.6    2e-12   
ref|XP_002522452.1|  nucleic acid binding protein, putative           80.5    2e-12   Ricinus communis
gb|EPS73861.1|  hypothetical protein M569_00896                       67.8    3e-12   
ref|XP_007010730.1|  Ribonuclease H protein, putative                 78.2    3e-12   
ref|XP_010692615.1|  PREDICTED: uncharacterized protein LOC104905704  75.9    3e-12   
gb|AAD20714.1|  putative non-LTR retroelement reverse transcriptase   81.6    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004305406.1|  PREDICTED: putative ribonuclease H protein A...  79.7    3e-12   
ref|XP_008240554.1|  PREDICTED: uncharacterized protein LOC103339056  77.8    3e-12   
ref|XP_010513530.1|  PREDICTED: uncharacterized protein LOC104789549  77.0    3e-12   
ref|XP_009113011.1|  PREDICTED: putative ribonuclease H protein A...  71.6    3e-12   
ref|XP_010039097.1|  PREDICTED: uncharacterized protein LOC104427753  81.3    3e-12   
ref|XP_010446022.1|  PREDICTED: uncharacterized protein LOC104728786  73.9    4e-12   
gb|EMS48472.1|  Subtilisin-like protease                              80.9    4e-12   
ref|XP_006470496.1|  PREDICTED: uncharacterized protein LOC102617255  78.2    4e-12   
ref|XP_007040751.1|  Uncharacterized protein TCM_016625               76.3    4e-12   
gb|ABA94593.2|  retrotransposon protein, putative, unclassified       68.2    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007033565.1|  Non-LTR retroelement reverse transcriptase-l...  79.0    4e-12   
ref|XP_008377023.1|  PREDICTED: uncharacterized protein LOC103440132  79.3    4e-12   
ref|XP_010430818.1|  PREDICTED: uncharacterized protein LOC104715064  79.0    5e-12   
ref|XP_007219731.1|  hypothetical protein PRUPE_ppa026013mg           76.3    5e-12   
ref|XP_008340321.1|  PREDICTED: putative ribonuclease H protein A...  73.9    5e-12   
ref|XP_008367096.1|  PREDICTED: putative ribonuclease H protein A...  80.1    6e-12   
ref|XP_010666352.1|  PREDICTED: uncharacterized protein LOC104883509  80.5    6e-12   
ref|XP_010485231.1|  PREDICTED: uncharacterized protein LOC104763574  73.2    6e-12   
ref|XP_010495329.1|  PREDICTED: uncharacterized protein LOC104772406  80.1    6e-12   
ref|XP_002458698.1|  hypothetical protein SORBIDRAFT_03g038480        71.2    6e-12   
ref|XP_007019354.1|  Uncharacterized protein TCM_035385               79.7    6e-12   
ref|XP_009334551.1|  PREDICTED: uncharacterized protein LOC103927359  80.1    7e-12   
ref|XP_008374301.1|  PREDICTED: putative ribonuclease H protein A...  79.3    7e-12   
ref|XP_009334552.1|  PREDICTED: uncharacterized protein LOC103927360  80.1    7e-12   
ref|XP_008780392.1|  PREDICTED: putative ribonuclease H protein A...  78.6    7e-12   
ref|XP_010419048.1|  PREDICTED: uncharacterized protein LOC104704706  78.2    7e-12   
gb|AAB82639.1|  putative non-LTR retroelement reverse transcriptase   80.1    7e-12   
ref|XP_008245529.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  80.1    7e-12   
ref|XP_008810175.1|  PREDICTED: putative ribonuclease H protein A...  78.6    8e-12   
ref|XP_007018598.1|  Uncharacterized protein TCM_034780               78.2    8e-12   
ref|XP_002462405.1|  hypothetical protein SORBIDRAFT_02g025125        78.6    8e-12   
ref|XP_008234850.1|  PREDICTED: putative ribonuclease H protein A...  73.9    8e-12   
ref|XP_008393344.1|  PREDICTED: putative ribonuclease H protein A...  77.4    8e-12   
ref|NP_001045511.1|  Os01g0967700                                     77.4    8e-12   
ref|XP_010431723.1|  PREDICTED: uncharacterized protein LOC104716077  78.6    9e-12   
ref|XP_007036869.1|  Ribonuclease H-like superfamily protein          77.4    1e-11   
ref|XP_009142123.1|  PREDICTED: putative ribonuclease H protein A...  79.3    1e-11   
ref|XP_010667173.1|  PREDICTED: uncharacterized protein LOC104884250  79.3    1e-11   
ref|XP_007212995.1|  hypothetical protein PRUPE_ppa022768mg           79.3    1e-11   
ref|XP_010696568.1|  PREDICTED: uncharacterized protein LOC104909080  76.6    1e-11   
ref|XP_008359621.1|  PREDICTED: putative ribonuclease H protein A...  78.6    1e-11   
ref|XP_009121351.1|  PREDICTED: uncharacterized protein LOC103846197  69.7    1e-11   
ref|XP_010261288.1|  PREDICTED: uncharacterized protein LOC104600144  78.2    1e-11   
emb|CDP14369.1|  unnamed protein product                              77.0    1e-11   
ref|XP_008359361.1|  PREDICTED: putative ribonuclease H protein A...  76.6    1e-11   
ref|XP_002456315.1|  hypothetical protein SORBIDRAFT_03g033860        77.4    1e-11   
gb|AEL30350.1|  RNA-directed DNA polymerase                           78.6    1e-11   
ref|XP_010513536.1|  PREDICTED: uncharacterized protein LOC104789557  74.3    1e-11   
emb|CCA66020.1|  hypothetical protein                                 79.3    1e-11   
ref|XP_008392821.1|  PREDICTED: putative ribonuclease H protein A...  77.8    1e-11   
ref|XP_006487438.1|  PREDICTED: putative ribonuclease H protein A...  76.6    1e-11   
ref|XP_010693383.1|  PREDICTED: uncharacterized protein LOC104906342  67.0    1e-11   
ref|XP_009102105.1|  PREDICTED: putative ribonuclease H protein A...  63.9    1e-11   
ref|XP_008387184.1|  PREDICTED: putative ribonuclease H protein A...  79.0    1e-11   
ref|XP_004288816.1|  PREDICTED: uncharacterized protein LOC101301910  75.5    2e-11   
ref|XP_010431244.1|  PREDICTED: uncharacterized protein LOC104715548  76.6    2e-11   
ref|XP_010687249.1|  PREDICTED: uncharacterized protein LOC104901378  78.6    2e-11   
ref|XP_009141426.1|  PREDICTED: putative ribonuclease H protein A...  78.6    2e-11   
ref|XP_010694896.1|  PREDICTED: uncharacterized protein LOC104907635  79.0    2e-11   
ref|NP_178368.1|  RNase H domain-containing protein                   77.0    2e-11   
ref|XP_009113005.1|  PREDICTED: uncharacterized protein LOC103838323  77.8    2e-11   
ref|XP_006358721.1|  PREDICTED: uncharacterized protein LOC102596481  78.6    2e-11   
ref|XP_008228450.1|  PREDICTED: putative ribonuclease H protein A...  66.2    2e-11   
ref|XP_010468805.1|  PREDICTED: uncharacterized protein LOC104748926  77.0    2e-11   
ref|XP_002459639.1|  hypothetical protein SORBIDRAFT_02g007880        77.4    2e-11   
ref|XP_006482369.1|  PREDICTED: putative ribonuclease H protein A...  77.4    2e-11   
ref|XP_009140270.1|  PREDICTED: putative ribonuclease H protein A...  78.2    2e-11   
gb|EEE50824.1|  hypothetical protein OsJ_31232                        78.6    2e-11   
gb|EEC83100.1|  hypothetical protein OsI_28249                        78.6    2e-11   
ref|XP_004301477.1|  PREDICTED: uncharacterized protein LOC101302844  76.6    2e-11   
ref|XP_002466618.1|  hypothetical protein SORBIDRAFT_01g011130        77.0    2e-11   
ref|XP_008386346.1|  PREDICTED: putative ribonuclease H protein A...  76.3    2e-11   
gb|AAD32950.1|  putative non-LTR retroelement reverse transcriptase   77.8    2e-11   
gb|AAD24831.1|  putative non-LTR retroelement reverse transcriptase   78.2    2e-11   
ref|XP_002448781.1|  hypothetical protein SORBIDRAFT_06g033056        74.3    3e-11   
ref|XP_008240710.1|  PREDICTED: putative ribonuclease H protein A...  77.0    3e-11   
ref|XP_008342743.1|  PREDICTED: putative ribonuclease H protein A...  74.7    3e-11   
ref|XP_007015619.1|  Uncharacterized protein TCM_041190               73.6    3e-11   
ref|XP_007212486.1|  hypothetical protein PRUPE_ppa019229mg           77.0    3e-11   
ref|XP_010693629.1|  PREDICTED: uncharacterized protein LOC104906557  75.5    3e-11   
ref|XP_004301407.1|  PREDICTED: putative ribonuclease H protein A...  60.5    3e-11   
ref|XP_009107610.1|  PREDICTED: putative ribonuclease H protein A...  77.4    3e-11   
ref|XP_007219162.1|  hypothetical protein PRUPE_ppa016360mg           74.3    3e-11   
ref|XP_008376986.1|  PREDICTED: putative ribonuclease H protein A...  75.5    3e-11   
ref|XP_008798809.1|  PREDICTED: putative ribonuclease H protein A...  77.4    3e-11   
emb|CDX80327.1|  BnaC09g34150D                                        77.0    3e-11   
gb|ACP30591.1|  disease resistance protein                            77.8    4e-11   
ref|XP_007049342.1|  Ribonuclease H protein                           75.9    4e-11   
ref|XP_009118884.1|  PREDICTED: putative ribonuclease H protein A...  77.0    4e-11   
ref|XP_009132673.1|  PREDICTED: putative ribonuclease H protein A...  67.0    4e-11   
ref|XP_007207799.1|  hypothetical protein PRUPE_ppa024472mg           77.4    4e-11   
ref|XP_010451797.1|  PREDICTED: uncharacterized protein LOC104733977  77.4    4e-11   
ref|XP_008364002.1|  PREDICTED: putative ribonuclease H protein A...  77.4    4e-11   
ref|XP_010468749.1|  PREDICTED: uncharacterized protein LOC104748866  75.1    4e-11   
ref|XP_004295654.1|  PREDICTED: uncharacterized protein LOC101314263  67.8    4e-11   
ref|XP_008366390.1|  PREDICTED: putative ribonuclease H protein A...  74.7    4e-11   
gb|AAP44645.1|  putative reverse transcriptase                        75.9    4e-11   
ref|XP_009102116.1|  PREDICTED: uncharacterized protein LOC103828254  73.6    5e-11   
ref|XP_010681460.1|  PREDICTED: uncharacterized protein LOC104896407  77.4    5e-11   
ref|XP_007226707.1|  hypothetical protein PRUPE_ppa020120mg           62.4    5e-11   
ref|XP_006487889.1|  PREDICTED: uncharacterized protein LOC102617714  77.4    5e-11   
ref|XP_003629388.1|  Cytochrome P450                                  77.0    5e-11   
ref|XP_008356060.1|  PREDICTED: uncharacterized protein LOC103419743  72.8    5e-11   
ref|XP_008666641.1|  PREDICTED: putative ribonuclease H protein A...  76.3    5e-11   
ref|XP_002443080.1|  hypothetical protein SORBIDRAFT_08g007680        76.6    5e-11   
ref|XP_009150014.1|  PREDICTED: putative ribonuclease H protein A...  76.3    5e-11   
ref|XP_010445461.1|  PREDICTED: uncharacterized protein LOC104728130  71.6    6e-11   
ref|XP_010688970.1|  PREDICTED: uncharacterized protein LOC104902764  64.3    6e-11   
ref|XP_009123659.1|  PREDICTED: uncharacterized protein LOC103848514  75.5    6e-11   
emb|CAH66131.1|  OSIGBa0135L04.5                                      76.3    6e-11   
ref|XP_010687065.1|  PREDICTED: uncharacterized protein LOC104901211  75.9    6e-11   
gb|ABA98491.1|  retrotransposon protein, putative, unclassified       77.0    7e-11   
gb|KHN24484.1|  TMV resistance protein N                              77.0    7e-11   
gb|EEE59920.1|  hypothetical protein OsJ_12548                        72.0    7e-11   
ref|XP_008358487.1|  PREDICTED: putative ribonuclease H protein A...  74.7    7e-11   
ref|XP_006579325.1|  PREDICTED: uncharacterized protein LOC102669832  73.6    7e-11   
gb|EEC76169.1|  hypothetical protein OsI_13484                        72.0    7e-11   
ref|XP_006493638.1|  PREDICTED: putative ribonuclease H protein A...  70.9    7e-11   
ref|XP_008355160.1|  PREDICTED: putative ribonuclease H protein A...  74.7    7e-11   
ref|XP_006580409.1|  PREDICTED: putative ribonuclease H protein A...  72.4    8e-11   
gb|AAD24601.1|  putative non-LTR retroelement reverse transcriptase   74.3    8e-11   
ref|XP_009112590.1|  PREDICTED: uncharacterized protein LOC103837948  76.6    8e-11   
pir||T00833  RNA-directed DNA polymerase homolog T13L16.7 - Arabi...  72.4    8e-11
ref|XP_002446117.1|  hypothetical protein SORBIDRAFT_06g001955        73.2    9e-11   
gb|ABO80459.1|  RNA-directed DNA polymerase (Reverse transcriptas...  76.3    9e-11   
ref|XP_009115910.1|  PREDICTED: putative ribonuclease H protein A...  76.3    9e-11   
ref|XP_010666820.1|  PREDICTED: uncharacterized protein LOC104883940  67.4    9e-11   
ref|XP_008799170.1|  PREDICTED: putative ribonuclease H protein A...  72.0    9e-11   
gb|AAS82603.1|  putative glycerol 3-phosphate permease                76.6    9e-11   
ref|XP_008779683.1|  PREDICTED: uncharacterized protein LOC103699441  69.7    9e-11   
ref|XP_010675636.1|  PREDICTED: uncharacterized protein LOC104891623  74.3    9e-11   
ref|XP_010490248.1|  PREDICTED: uncharacterized protein LOC104767992  73.9    1e-10   
ref|XP_009375083.1|  PREDICTED: uncharacterized protein LOC103963932  76.6    1e-10   
ref|XP_010667582.1|  PREDICTED: uncharacterized protein LOC104884596  73.9    1e-10   
ref|XP_009146506.1|  PREDICTED: uncharacterized protein LOC103870148  70.9    1e-10   
ref|XP_009114817.1|  PREDICTED: putative ribonuclease H protein A...  73.9    1e-10   
ref|XP_008341112.1|  PREDICTED: uncharacterized protein LOC103404034  69.3    1e-10   
ref|XP_008808418.1|  PREDICTED: putative ribonuclease H protein A...  70.9    1e-10   
ref|XP_004301440.1|  PREDICTED: putative ribonuclease H protein A...  67.8    1e-10   
ref|XP_002443302.1|  hypothetical protein SORBIDRAFT_08g017205        74.3    1e-10   
ref|XP_002461200.1|  hypothetical protein SORBIDRAFT_02g042745        72.8    1e-10   
gb|EEC75888.1|  hypothetical protein OsI_12930                        75.9    1e-10   
ref|XP_009118875.1|  PREDICTED: uncharacterized protein LOC103843847  76.3    1e-10   
gb|AAU89136.1|  F-box domain containing protein                       75.9    1e-10   
ref|XP_006580378.1|  PREDICTED: uncharacterized protein LOC102670245  72.8    1e-10   
ref|XP_010495244.1|  PREDICTED: uncharacterized protein LOC104772312  73.2    1e-10   
ref|XP_009103763.1|  PREDICTED: uncharacterized protein LOC103829818  75.9    1e-10   
ref|XP_010501716.1|  PREDICTED: uncharacterized protein LOC104779014  74.3    1e-10   
ref|XP_008391838.1|  PREDICTED: uncharacterized protein LOC103454030  65.9    1e-10   
ref|XP_002439202.1|  hypothetical protein SORBIDRAFT_09g002195        75.1    1e-10   
ref|XP_008228453.1|  PREDICTED: putative ribonuclease H protein A...  75.5    1e-10   
ref|XP_006493637.1|  PREDICTED: putative ribonuclease H protein A...  69.7    1e-10   
gb|EEE59647.1|  hypothetical protein OsJ_12023                        75.9    1e-10   
ref|XP_008387750.1|  PREDICTED: putative ribonuclease H protein A...  69.3    2e-10   
ref|XP_010266974.1|  PREDICTED: uncharacterized protein LOC104604373  72.0    2e-10   
ref|XP_009766855.1|  PREDICTED: uncharacterized protein LOC104218145  75.5    2e-10   
ref|XP_010445465.1|  PREDICTED: uncharacterized protein LOC104728135  68.2    2e-10   
emb|CAB75484.1|  putative protein                                     75.5    2e-10   
ref|XP_008359192.1|  PREDICTED: putative ribonuclease H protein A...  73.9    2e-10   
ref|XP_010684129.1|  PREDICTED: uncharacterized protein LOC104898724  75.5    2e-10   
dbj|BAF36312.1|  hypothetical protein                                 69.3    2e-10   
ref|XP_004308229.1|  PREDICTED: uncharacterized protein LOC101292263  72.0    2e-10   
ref|XP_009137133.1|  PREDICTED: uncharacterized protein LOC103861184  71.6    2e-10   
ref|XP_010684120.1|  PREDICTED: uncharacterized protein LOC104898717  74.3    2e-10   
ref|XP_008385416.1|  PREDICTED: putative ribonuclease H protein A...  70.5    2e-10   
ref|XP_010513556.1|  PREDICTED: uncharacterized protein LOC104789580  73.6    2e-10   
ref|XP_009117702.1|  PREDICTED: uncharacterized protein LOC103842791  73.6    2e-10   
ref|XP_010690177.1|  PREDICTED: uncharacterized protein LOC104903764  67.0    2e-10   
ref|XP_009125370.1|  PREDICTED: putative ribonuclease H protein A...  69.3    3e-10   
ref|XP_006599770.1|  PREDICTED: putative ribonuclease H protein A...  72.0    3e-10   
ref|XP_004959141.1|  PREDICTED: putative ribonuclease H protein A...  74.7    3e-10   
ref|XP_008386420.1|  PREDICTED: putative ribonuclease H protein A...  68.6    3e-10   
ref|NP_194638.1|  ribonuclease H-like protein                         72.8    3e-10   
ref|XP_010667378.1|  PREDICTED: uncharacterized protein LOC104884431  68.2    3e-10   
ref|XP_007219947.1|  hypothetical protein PRUPE_ppb019489mg           73.9    3e-10   
ref|XP_010680467.1|  PREDICTED: uncharacterized protein LOC104895604  72.8    4e-10   
ref|XP_010451246.1|  PREDICTED: uncharacterized protein LOC104733362  73.2    4e-10   
ref|XP_007021221.1|  Uncharacterized protein TCM_031281               68.6    4e-10   
gb|EEE57524.1|  hypothetical protein OsJ_07834                        73.2    4e-10   
ref|XP_007017131.1|  Uncharacterized protein TCM_033752               74.7    4e-10   
ref|XP_008339024.1|  PREDICTED: putative ribonuclease H protein A...  73.2    4e-10   
gb|EEC83406.1|  hypothetical protein OsI_28856                        70.5    4e-10   
ref|XP_009139300.1|  PREDICTED: putative ribonuclease H protein A...  73.6    4e-10   
ref|XP_010424205.1|  PREDICTED: uncharacterized protein LOC104709261  72.8    4e-10   
ref|XP_008355389.1|  PREDICTED: putative ribonuclease H protein A...  63.2    4e-10   
ref|XP_008809469.1|  PREDICTED: putative ribonuclease H protein A...  62.8    4e-10   
ref|XP_009124968.1|  PREDICTED: uncharacterized protein LOC103850017  74.3    4e-10   
pir||S65812  RNA-directed DNA polymerase (EC 2.7.7.49) (clone DW1...  68.9    4e-10
ref|XP_007207609.1|  hypothetical protein PRUPE_ppa018907mg           74.3    4e-10   
ref|XP_008354134.1|  PREDICTED: putative ribonuclease H protein A...  72.8    4e-10   
ref|XP_003621614.1|  DNA-directed RNA polymerase III subunit RPC6     73.2    4e-10   
emb|CCA66036.1|  hypothetical protein                                 66.2    5e-10   
ref|XP_009109964.1|  PREDICTED: putative ribonuclease H protein A...  66.6    5e-10   
ref|XP_008780141.1|  PREDICTED: putative ribonuclease H protein A...  72.8    5e-10   
ref|XP_010667861.1|  PREDICTED: uncharacterized protein LOC104884854  72.0    5e-10   
ref|XP_010696208.1|  PREDICTED: uncharacterized protein LOC104908756  73.9    5e-10   
ref|XP_010672625.1|  PREDICTED: uncharacterized protein LOC104889168  74.3    5e-10   
ref|XP_009102231.1|  PREDICTED: uncharacterized protein LOC103828378  71.2    5e-10   
ref|XP_008359109.1|  PREDICTED: putative ribonuclease H protein A...  72.8    5e-10   
ref|XP_008780302.1|  PREDICTED: putative ribonuclease H protein A...  72.0    5e-10   
gb|EPS57564.1|  hypothetical protein M569_17254                       72.4    5e-10   
ref|XP_008393342.1|  PREDICTED: putative ribonuclease H protein A...  73.6    6e-10   
ref|XP_010541748.1|  PREDICTED: uncharacterized protein LOC104815125  71.2    6e-10   
ref|XP_010495441.1|  PREDICTED: uncharacterized protein LOC104772536  68.2    6e-10   
emb|CDP09717.1|  unnamed protein product                              68.9    6e-10   
ref|XP_008391252.1|  PREDICTED: putative ribonuclease H protein A...  67.4    6e-10   
emb|CCA66153.1|  hypothetical protein                                 73.9    6e-10   
ref|XP_009140188.1|  PREDICTED: uncharacterized protein LOC103864181  61.2    6e-10   
ref|XP_009148188.1|  PREDICTED: uncharacterized protein LOC103871664  73.2    6e-10   
ref|XP_002454911.1|  hypothetical protein SORBIDRAFT_03g001293        72.4    6e-10   
ref|XP_002455739.1|  hypothetical protein SORBIDRAFT_03g023736        70.5    7e-10   
ref|XP_008352730.1|  PREDICTED: putative ribonuclease H protein A...  71.6    7e-10   
ref|XP_008382376.1|  PREDICTED: uncharacterized protein LOC103445169  73.6    7e-10   
ref|XP_004308707.1|  PREDICTED: putative ribonuclease H protein A...  60.5    7e-10   
ref|XP_010670309.1|  PREDICTED: uncharacterized protein LOC104887391  72.0    7e-10   
ref|XP_008232034.1|  PREDICTED: uncharacterized protein LOC103331202  73.2    7e-10   
ref|XP_002438073.1|  hypothetical protein SORBIDRAFT_10g007695        69.7    7e-10   
ref|XP_002534238.1|  conserved hypothetical protein                   70.9    8e-10   
ref|XP_009124894.1|  PREDICTED: putative ribonuclease H protein A...  68.6    8e-10   
ref|XP_009353199.1|  PREDICTED: uncharacterized protein LOC103944460  73.6    8e-10   
ref|XP_008393540.1|  PREDICTED: putative ribonuclease H protein A...  72.0    8e-10   
gb|AAF19536.1|AC007190_4  F23N19.5                                    54.3    8e-10   
ref|XP_009102722.1|  PREDICTED: uncharacterized protein LOC103828828  72.0    8e-10   
ref|XP_008226959.1|  PREDICTED: putative ribonuclease H protein A...  71.6    9e-10   
ref|XP_003548282.1|  PREDICTED: TMV resistance protein N              73.2    9e-10   
ref|XP_009140970.1|  PREDICTED: uncharacterized protein LOC103864947  73.2    9e-10   
emb|CCA66222.1|  hypothetical protein                                 73.2    9e-10   
ref|XP_008367240.1|  PREDICTED: putative ribonuclease H protein A...  62.0    9e-10   
ref|XP_003612608.1|  Replication protein A 70 kDa DNA-binding sub...  73.2    9e-10   
ref|XP_009125042.1|  PREDICTED: uncharacterized protein LOC103850087  70.1    1e-09   
ref|XP_007226650.1|  hypothetical protein PRUPE_ppa021858mg           70.9    1e-09   
ref|XP_009105634.1|  PREDICTED: putative ribonuclease H protein A...  70.1    1e-09   
ref|XP_010674005.1|  PREDICTED: uncharacterized protein LOC104890282  70.1    1e-09   



>dbj|BAE79385.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score =   211 bits (538),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/273 (38%), Positives = 157/273 (58%), Gaps = 2/273 (1%)
 Frame = +3

Query  1050  ALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISC--TVDENWPW  1223
             AL   L   +++ +RA P+ ++    D L+W  ST+G   V+SAYSLI+     D +  W
Sbjct  980   ALHNILPTNMIDMVRATPIAINSEQEDFLSWPHSTTGMVTVSSAYSLIAGHDGDDRSHDW  1039

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             +W+  C EK+K  +W ++K  +  NVER+RR L D ++C  C +E+E+L HLF  C  A 
Sbjct  1040  IWRATCTEKIKLFMWKIVKNGLMVNVERKRRGLADAASCPVCGEEDETLDHLFRRCLLAE  1099

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIF  1583
              CW++          NHL M++W+++   S+     G  WS+ F Y LW +WK RN L+F
Sbjct  1100  ACWDSAVPPLTFQTSNHLHMHSWMKAACSSQQKDGYGTNWSLIFPYILWNLWKARNRLVF  1159

Query  1584  NNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSC  1763
             +NN   P  +   +   +SEAR  + +  G       WV W+PP  G+ K+N DGA KS 
Sbjct  1160  DNNITAPSDILNRSFMESSEARCLLAKRTGLQTAFQTWVVWSPPAAGFTKLNSDGACKSH  1219

Query  1764  TGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             + LASAGG++R+++G WV G+   IG  +SF A
Sbjct  1220  SHLASAGGLLRNENGLWVAGYICNIGTANSFLA  1252


 Score = 43.5 bits (101),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNV  1041
             +W VG+G+ ++FW+DWWV D  L  + +     ++ D KV + I   R W+ 
Sbjct  927   KWNVGNGRKINFWNDWWVGDGPLASNTDCINQPHMTDIKVEDLITSQRRWDT  978


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  1979  LVKDCLDLSRKFRKFKISHIMREGNRCADWLANYGQNITWRTLLLDSAPAELNDIIQADS  2158
             LVKDC  L   F++ K++HI+REGN+CAD+LAN GQ+ +W T +L+  P +L   +Q D+
Sbjct  1298  LVKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQRDA  1357

Query  2159  LQQA*SK  2179
             +  A S+
Sbjct  1358  IGLASSR  1364



>dbj|BAE79382.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score =   209 bits (533),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/273 (38%), Positives = 156/273 (57%), Gaps = 2/273 (1%)
 Frame = +3

Query  1050  ALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISC--TVDENWPW  1223
             AL   L   +++ +RA P+ ++    D L+W  ST+G   V+SAYSLI+     D +  W
Sbjct  980   ALHNILPTNMIDMVRATPIAINSEQEDFLSWPHSTTGMVTVSSAYSLIAGHDGDDRSHDW  1039

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             +W+  C EK+K  +W ++K  +  NVER+RR L D ++C  C +E+E+L HLF  C  A 
Sbjct  1040  IWRATCTEKIKLFMWKIVKNGLMVNVERKRRGLADAASCPVCGEEDETLDHLFRRCLLAE  1099

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIF  1583
              CW++          NHL M++W+++   S+        WS+ F Y LW +WK RN L+F
Sbjct  1100  ACWDSAVPPLTFQTSNHLHMHSWMKAACSSQQKDGYSTNWSLIFPYILWNLWKARNRLVF  1159

Query  1584  NNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSC  1763
             +NN   P  +   +   +SEAR  + +  G       WV W+PP  G+ K+N DGA KS 
Sbjct  1160  DNNITAPSDILNRSFMESSEARCLLAKRTGLQTAFQTWVVWSPPAAGFTKLNSDGACKSH  1219

Query  1764  TGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             + LASAGG++R+++G WV G+   IG  +SF A
Sbjct  1220  SHLASAGGLLRNENGLWVAGYTCNIGTANSFLA  1252


 Score = 43.5 bits (101),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNV  1041
             +W VG+G+ ++FW+DWWV D  L  + +     ++ D KV + I   R W+ 
Sbjct  927   KWNVGNGRKINFWNDWWVGDGPLASNTDCINQPHMTDIKVEDLITSQRRWDT  978


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  1979  LVKDCLDLSRKFRKFKISHIMREGNRCADWLANYGQNITWRTLLLDSAPAELNDIIQADS  2158
             LVKDC  L   F++ K++HI+REGN+CAD+LAN GQ+ +W T +L+  P +L   +Q D+
Sbjct  1298  LVKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQRDA  1357

Query  2159  LQQA*SK  2179
             +  A S+
Sbjct  1358  IGLASSR  1364



>dbj|BAE79384.1| unnamed protein product [Ipomoea batatas]
Length=1898

 Score =   206 bits (525),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 156/273 (57%), Gaps = 2/273 (1%)
 Frame = +3

Query  1050  ALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDE--NWPW  1223
             AL   L   +++ +RA P+ ++    D  +W  ST+G   V+SAYSLI+    +  +  W
Sbjct  1512  ALHNILPINMIDMVRATPIAINSEQEDFPSWPHSTTGMVTVSSAYSLIAGHDGDGRSHDW  1571

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             +W+  C EK+K  +W ++K  +  NVER+RR L D ++C  C +E+E+L HLF  C  A 
Sbjct  1572  IWRATCTEKIKLFMWKIVKNGLMVNVERKRRGLADAASCPVCGEEDETLDHLFRRCLLAE  1631

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIF  1583
              CW++          NHL M++W+++   S+     G  WS+ F Y LW +WK RN L+F
Sbjct  1632  ACWDSAVPPLTFQTSNHLHMHSWMKAACSSQQKDGYGTNWSLIFPYILWNLWKARNRLVF  1691

Query  1584  NNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSC  1763
             +NN   P  +   +   +SEAR  + +  G       WV W+PP  G+ K+N DGA KS 
Sbjct  1692  DNNITAPSDILNRSFMESSEARCLLAKRTGLQTAFQTWVVWSPPAAGFTKLNSDGACKSH  1751

Query  1764  TGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             + LASAGG++R+++G WV G+   IG  +SF A
Sbjct  1752  SHLASAGGLLRNENGLWVAGYTCNIGTANSFLA  1784


 Score = 45.8 bits (107),  Expect(2) = 4e-57, Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWN  1038
             +W VG+G+ ++FW+DWWV D  L  + +     ++ D KV +     R W+
Sbjct  1459  KWNVGNGRKINFWNDWWVGDGPLASNTDCINQPHMTDIKVEDLTTSQRRWD  1509


 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  1979  LVKDCLDLSRKFRKFKISHIMREGNRCADWLANYGQNITWRTLLLDSAPAELNDIIQADS  2158
             LVKDC  L   F++ K++HI+REGN+CAD+LAN GQ+ +W T +L+  P +L   +Q D+
Sbjct  1830  LVKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQRDA  1889

Query  2159  LQQA*SK  2179
             +  A S+
Sbjct  1890  IGLASSR  1896



>ref|XP_008242678.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=390

 Score =   162 bits (410),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 133/269 (49%), Gaps = 4/269 (1%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDEN  1214
             +D L   L E+LV ++ ++PV    S  DT  W+ ST+G F V SAYSL      T D  
Sbjct  51    IDKLRGVLCEDLVQQVISVPVGFLGSLPDTQIWKGSTNGDFSVKSAYSLFFGGCSTPDSC  110

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W  LW LN   K++  +WL  +G++ +N +R RR L  D +C  C    E+++H+  DC+
Sbjct  111   WKSLWSLNVPPKLQYFMWLASQGKILSNDQRVRRQLASDPSCGFCSWPTETVLHILRDCE  170

Query  1395  FARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
              AR  W AI          HL    W++ N+ S+   N   PWS  FV+T W +W  RN 
Sbjct  171   RARSTWNAILPACAHRF-FHLDAQPWMKVNMLSREKWNGDVPWSTVFVFTCWHLWCWRNK  229

Query  1575  LIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAM  1754
              +F N         ++ C  A E                  V W  P PG  K+N+DG+ 
Sbjct  230   HVFQNEDTILFSPRQVICGAAQEWIKSTSNLTVKVNKVQIHVAWELPGPGQFKLNVDGSR  289

Query  1755  KSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
             +S TG   AGG++RD  G WV GFA  +G
Sbjct  290   RSVTGCIGAGGVIRDPFGGWVSGFAINLG  318



>ref|XP_008237302.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=394

 Score =   160 bits (405),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/269 (32%), Positives = 135/269 (50%), Gaps = 3/269 (1%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDEN  1214
             ++ L   L +ELV ++ + PV  +    D   W+ S++G F V SAY+++   S   D  
Sbjct  1     MEKLRAALPDELVQRVISCPVGFNSGLQDAQIWKFSSNGIFSVKSAYNMVFEGSTCSDVA  60

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W +LWKL    K+    WL+ +G++ +N +R RR L  D++C  C    ES++H+  DC 
Sbjct  61    WTFLWKLRIPPKLHIFFWLVFQGKILSNEQRVRRQLSLDASCGSCHWPMESILHILRDCV  120

Query  1395  FARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
              A++ W A+           +    W+  N+ SKIV  DG PW++ FV+T W IWK RN+
Sbjct  121   KAKKVWNALLNSSQSARFFTMDFQPWLRVNLMSKIVWADGIPWNLVFVFTCWYIWKWRNH  180

Query  1575  LIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAM  1754
              +F+ + +      ++      E                 W  W PP  G  K+N+DG+ 
Sbjct  181   YVFHGDEDLAFDSIQIITAAVKEWFKTSNVSFTKCAKVEAWFAWEPPPAGVFKLNVDGSR  240

Query  1755  KSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
             K  +G   AGG++RD  G W  GFA  +G
Sbjct  241   KVASGHIGAGGVLRDVSGDWCSGFAINLG  269



>gb|AID60103.1| hypothetical protein [Brassica napus]
Length=620

 Score =   127 bits (320),  Expect(3) = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 130/266 (49%), Gaps = 11/266 (4%)
 Frame = +3

Query  1077  LVNKIRAIPVPVDDST--VDTLTWQDSTSGTFFVASAYSLIS------CTVDENWPWLWK  1232
             L N+++   + +D+ T   D ++W ++  G F V +AY+ ++        +++ +  +W+
Sbjct  234   LQNRLQLASLVIDEVTGARDRMSWGEAKDGLFSVKAAYAFLTKDAVPRPNMEDLYSRVWR  293

Query  1233  LNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECW  1412
             +   E+V+  LWL+    + TN+ER+RRH+ ++ TC  C+  +E+++H+  DC  A   W
Sbjct  294   VTAPERVRVFLWLVTHQVIMTNMERKRRHISENGTCPLCKSGDETILHVLRDCPAAAGLW  353

Query  1413  EAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNN-  1589
               +     +    +L +  W+  N+ +    N G  W   F  T+W  WK R   +F   
Sbjct  354   RKLVLPTRQQRFFNLTLFEWLYENLANDKSVN-GDQWPSLFALTVWWCWKWRCGYVFGEI  412

Query  1590  -NSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCT  1766
                   V   K       +A   +             + W  P+ GWVK+N DGA +   
Sbjct  413   GKCRDRVRFVKDKAQEVIKANKKVREPSAIGVHVERQIAWFVPENGWVKLNTDGASRGNP  472

Query  1767  GLASAGGIVRDDHGCWVIGFATKIGV  1844
             GLA+AGG +RD+ G W+ GF+  IG+
Sbjct  473   GLATAGGALRDEEGKWIGGFSLNIGI  498


 Score = 40.4 bits (93),  Expect(3) = 3e-36, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 33/77 (43%), Gaps = 0/77 (0%)
 Frame = +2

Query  1925  SCGAVMNRGDHSEETVVTLVKDCLDLSRKFRKFKISHIMREGNRCADWLANYGQNITWRT  2104
             S    +  G H    +  LV+ C     +      SH+ RE NR AD LANY  ++ +  
Sbjct  532   SVVGFLKTGIHDSHPLSFLVRLCYGFVSRDWIVNFSHVYRETNRLADGLANYAFSLQFGL  591

Query  2105  LLLDSAPAELNDIIQAD  2155
                DS P  +  I+  D
Sbjct  592   HFFDSVPEHVAPIMLED  608


 Score = 34.3 bits (77),  Expect(3) = 3e-36, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSW  1035
             W +GDG+ + FW D W+  + L     IDIP+ L + K  +  +    W
Sbjct  175   WILGDGRRVRFWRDRWLLKEPLEALSLIDIPEELVEAKTRDLWQQGIGW  223



>ref|XP_004301145.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=411

 Score =   151 bits (382),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 135/276 (49%), Gaps = 3/276 (1%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDEN  1214
             +  L + L + +V +I ++P     S  D L W  + +G F V SAY+     +   +  
Sbjct  16    IPLLKSVLPDHVVMQIISVPSGFGVSGHDKLIWNATANGKFSVKSAYNSFFDSAGVSNPL  75

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W  LWKLNC  K+KT +W +L  ++ TNV+R RR     ++C  C++ +E+L+HL  DC 
Sbjct  76    WTHLWKLNCPPKLKTFMWYVLHQKILTNVQRVRRGFSTIASCPICKNADETLLHLLRDCP  135

Query  1395  FARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
              ++  W +I + G  T    L  N WI +  H  +V  +   W   FV+  W IWK RN 
Sbjct  136   RSQAIWNSILSPGSITNSFSLDWNGWICAQFHCHVVIKNNIQWCNLFVFVCWFIWKWRNK  195

Query  1575  LIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAM  1754
             +IF+     P    K+   +  E  +   +    S   Y   +W  P   + K+NIDG+ 
Sbjct  196   VIFDPAFILPACPNKVIWNYVDEWSSAQSKASMQSMFSYTMFSWCKPPENFYKLNIDGSR  255

Query  1755  KSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
                +G   AGG++RD  G W+ GF   +G  +   A
Sbjct  256   SFSSGCIGAGGVLRDHLGIWIDGFQVNLGTGEVLDA  291



>ref|XP_007039838.1| RNA-directed DNA polymerase (Reverse transcriptase), Polynucleotidyl 
transferase, Ribonuclease H fold-like protein [Theobroma 
cacao]
 gb|EOY24339.1| RNA-directed DNA polymerase (Reverse transcriptase), Polynucleotidyl 
transferase, Ribonuclease H fold-like protein [Theobroma 
cacao]
Length=616

 Score =   147 bits (371),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/293 (32%), Positives = 139/293 (47%), Gaps = 31/293 (11%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS-------CTV  1205
             + L T L  +LVNKI     P+     DT  W  S SG   VAS Y ++           
Sbjct  277   EKLATCLHSDLVNKILMFLPPLLSFKPDTPYWASSASGVCTVASTYEVLREDYPNYIGQQ  336

Query  1206  DENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFC  1385
                W   WK +  ++++T L   L G++ TN+E RRR++   +TCA C   +ES++HL  
Sbjct  337   SRKWAIAWKWDGPQRIRTFLMQCLHGKLLTNLECRRRNMSSSATCALCSVSDESVLHLLR  396

Query  1386  DCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
             DC  ++E W  + +  G      LL++ W+ +N+ +  V  DG PW I F +T W IWK 
Sbjct  397   DCPHSKEVWLKLGSRMGYGNFFDLLLSDWLLTNLKNYNVCVDGIPWVILFGFTCWYIWKW  456

Query  1566  RNNLIFNNN--------------SETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVT  1703
             RN  +F                      H  ++ CT +        R  G  +     V 
Sbjct  457   RNVKVFEGKLIPMDRKLSMIKGLVAASYHAVQIPCTHS--------RLNGYKREML--VG  506

Query  1704  WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             W  P  GWV +N DGA++  T +A+AGG+ RD +  W+ GFA K+G   S+ A
Sbjct  507   WQNPPQGWVAVNTDGALRRNTNMAAAGGVFRDCNEYWLGGFAAKLGKCYSYRA  559


 Score = 33.1 bits (74),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 6/54 (11%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSL---GLDMEIDIPKNLYDKKVSNFIKDDRSWN  1038
             RW +GDG S+ FW D W+ D  L   G  + I   +N     V  F+ D   WN
Sbjct  225   RWVLGDGLSIRFWKDIWLEDTPLLEQGHTLNIVTSENCC---VREFLLDTGEWN  275



>ref|XP_009101981.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1235

 Score =   132 bits (333),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/266 (31%), Positives = 128/266 (48%), Gaps = 15/266 (6%)
 Frame = +3

Query  1083  NKIRAIPVPVDDST--VDTLTWQDSTSGTFFVASAYSLISCTV------DENWPWLWKLN  1238
             N +R   V +D+ T   D ++W  S  G F V SAY+ ++  V      +  +  +W++ 
Sbjct  851   NSLRLASVVIDEVTGARDRMSWSGSNDGQFSVKSAYTFLTKNVVPRQNMEALYRRVWRVA  910

Query  1239  CVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEA  1418
               E+ +  LWL+    + TN+ER+RRHL D S C  C++ +E+++H+  DC  A   W  
Sbjct  911   VPERTRVFLWLVSHQVIMTNMERKRRHLSDSSVCLLCKNGDETILHVLRDCPAAAGLWLR  970

Query  1419  IETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSE  1598
             I T   +     L +  W+  N+ S   +  G  W   F  T+W  WK R   +F    +
Sbjct  971   IVTPSRRQRFFELPLLEWLYENLASD-SSVSGDQWPTLFALTVWWCWKWRCGYVFGEVGK  1029

Query  1599  TPVHVA----KLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCT  1766
                 V     K     A+     +   GG        + W  P+  WVK+N DGA +   
Sbjct  1030  CRDRVEFVRDKAKEVLAAYKNLRVHSPGGLR--VEKQIAWHRPESNWVKLNTDGAARGNP  1087

Query  1767  GLASAGGIVRDDHGCWVIGFATKIGV  1844
             GLA+AGG+VRD++G W  GFA  IG+
Sbjct  1088  GLATAGGVVRDEYGTWRGGFAINIGI  1113


 Score = 34.7 bits (78),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 0/54 (0%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             W +GDG+ + FW D W+ D+ L      DIP+ + + K  +  +    W   LM
Sbjct  790   WILGDGRRVRFWRDNWLLDQPLYELSTADIPEEIIEAKARDLWQHGTGWLTQLM  843


 Score = 33.1 bits (74),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 36/88 (41%), Gaps = 4/88 (5%)
 Frame = +2

Query  1901  RRV---VNGLCSCGAVMNRGDHSEETVVTLVKDCLDLSRKFRKFKISHIMREGNRCADWL  2071
             RRV   V+  C  G  +  G      +  LV+ C     +    K SH+ RE N  AD L
Sbjct  1137  RRVEVEVDSECVVG-FLQTGIQDSHPLSFLVRLCYGFISRDWLVKFSHVYREANHLADGL  1195

Query  2072  ANYGQNITWRTLLLDSAPAELNDIIQAD  2155
             ANY  ++ +     +  P  +  +   D
Sbjct  1196  ANYAFSLPFGLHYFEVIPEPVAHVFLDD  1223



>ref|XP_009344908.1| PREDICTED: uncharacterized protein LOC103936764 [Pyrus x bretschneideri]
Length=1365

 Score =   140 bits (352),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 87/274 (32%), Positives = 135/274 (49%), Gaps = 13/274 (5%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN---  1214
             V+ L + L  ++V  I ++ V + +   D + W  + SGTF V +AY  +S   D++   
Sbjct  974   VELLYSCLPPDIVEHIFSLHVGIANHREDKVIWSLTNSGTFSVKTAY--LSLFGDDDIIP  1031

Query  1215  --WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCD  1388
               W ++WKL    K+ T LW +  G++ TNV+R RR   ++  C  C + EES+ H+F  
Sbjct  1032  WKWNFIWKLKLPPKLVTFLWTIGHGKILTNVQRARRGFTNNPCCPICPNIEESMDHIFRS  1091

Query  1389  CQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCR  1568
             C+ +   W  +           L   +W+  N+ ++  T  G PW++ F  TLW  WK R
Sbjct  1092  CKQSPFFWNGVGIPPEVAHSFALDFQSWMAINLRTQCSTIHGLPWNLIFASTLWYCWKGR  1151

Query  1569  NNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVT---WTPPQPGWVKIN  1739
             NNL+FN+  + PV   K    F   AR +   +  TS      +    W  P  G  KIN
Sbjct  1152  NNLVFNDGQQPPVSPQKFIFQF---ARDWYDANKSTSSKPPRQIISIHWIHPPIGRYKIN  1208

Query  1740  IDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
              DG+        SAGG++R+  G W+ GFA  +G
Sbjct  1209  TDGSCNDPFRHISAGGLIRNSEGDWIKGFAANLG  1242


 Score = 37.7 bits (86),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 33/66 (50%), Gaps = 4/66 (6%)
 Frame = +1

Query  862   LMGVEIRA---RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRS  1032
             L G +I     RWRVG G  + FW D W+    L     I +  ++ +  V +F+ DD  
Sbjct  913   LFGAQIIPNGMRWRVGSGSQIHFWKDNWLESGVLENFATIPLSADMLEWSVDDFLTDD-G  971

Query  1033  WNVTLM  1050
             WNV L+
Sbjct  972   WNVELL  977



>ref|XP_009119466.1| PREDICTED: uncharacterized protein LOC103844431 [Brassica rapa]
Length=1834

 Score =   125 bits (313),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/261 (32%), Positives = 123/261 (47%), Gaps = 19/261 (7%)
 Frame = +3

Query  1104  VPVDDST--VDTLTWQDSTSGTFFVASAYSLISCTVDEN--------WPWLWKLNCVEKV  1253
             V +DD T   D ++W  S  G F V SAY+L+  T DE         +  +W++   E+V
Sbjct  1457  VVIDDVTGARDRMSWGGSKDGLFSVKSAYALL--TKDEKPRPNMNAFYDRVWRVIVPERV  1514

Query  1254  KTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAI--ET  1427
             +  LWL+    + TN+ER+RRHL D+  C  C+   E+++H   DC  +   W  +   +
Sbjct  1515  RVFLWLVSHQVIMTNMERKRRHLSDNGMCQLCKSGNETILHTLRDCPASMGLWRRLVDPS  1574

Query  1428  YGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETP-  1604
                +     LL   W+  N+ S    N G  W   F  T+W  WK R   +F    + P 
Sbjct  1575  RQQRFFDQSLLQ--WLYENLTSAQSAN-GERWPTMFALTVWWCWKWRCGYVFGETGKCPD  1631

Query  1605  -VHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASA  1781
              V   K      + A   +  H          + W  P  GW K+N DGA +   GLA+A
Sbjct  1632  RVKFVKDKTQEVTLANNKLRLHLAVGLREERHIKWRRPSNGWCKLNTDGASRGNPGLATA  1691

Query  1782  GGIVRDDHGCWVIGFATKIGV  1844
             GG++RD++G W  GFA  IG+
Sbjct  1692  GGVMRDENGEWQGGFAVNIGI  1712


 Score = 36.6 bits (83),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 33/74 (45%), Gaps = 0/74 (0%)
 Frame = +2

Query  1934  AVMNRGDHSEETVVTLVKDCLDLSRKFRKFKISHIMREGNRCADWLANYGQNITWRTLLL  2113
               +  G H    +  LV+ C     +    KISH+ RE N  AD LANY  ++++     
Sbjct  1749  GFLKTGIHDAHPLSFLVRLCYGFISRDWLVKISHVYREANCLADGLANYAFSLSFGVHYF  1808

Query  2114  DSAPAELNDIIQAD  2155
             +  P  +  I+  D
Sbjct  1809  ELVPEHVASILLED  1822


 Score = 35.8 bits (81),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 28/54 (52%), Gaps = 0/54 (0%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             W +GDG+ + FW D W+  + L     +DIP+ L + K  +  +  R W +  +
Sbjct  1389  WILGDGRRVRFWKDNWLMQEPLQSLSTVDIPEELLEAKARDLWQSGRGWLIQCI  1442



>gb|ABD28505.2| RNA-directed DNA polymerase (Reverse transcriptase); Polynucleotidyl 
transferase, Ribonuclease H fold [Medicago truncatula]
Length=729

 Score =   144 bits (362),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/277 (31%), Positives = 136/277 (49%), Gaps = 4/277 (1%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS---CTVDEN  1214
             ++ L+  L  ++VN+I A+P P D    DT+ W  + +  F V SAY+L       V  +
Sbjct  404   LNFLMDNLHVDIVNQILALPTPSDFDGPDTIGWGGTNTLKFTVQSAYNLQQENPFAVGGD  463

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W  LW      +++T +WL   GR+ TN  R +  +    TC  C  E+E+++H+  DC 
Sbjct  464   WKTLWNWKGPHRIQTFIWLAAHGRILTNYRRSKWGVGISPTCPCCAREDETVIHVLRDCV  523

Query  1395  FARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
              + + W  +  +   T         W+ +N++ K + ++ A W  TF+ T W +W  RN 
Sbjct  524   HSTQVWLRLIPHNYITNFFSFDCREWVFNNLNKKGIGDNPATWQTTFMTTCWYLWNWRNK  583

Query  1575  LIFNNNSETPVHVAKLACTFASEARAFI-IRHGGTSQGCYNWVTWTPPQPGWVKINIDGA  1751
              IF    + P +   +   F  E      + H  + Q    ++ W  P  GWVK+N DGA
Sbjct  584   SIFEIGFQRPSNPTLVIQKFTREIEDNTKLVHKSSHQKETIYIGWMRPPFGWVKLNCDGA  643

Query  1752  MKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
              K    LA  GG++RD  G W+ G+  KIG+ D+F A
Sbjct  644   WKGSGTLAGCGGLLRDSDGRWIKGYFKKIGMCDAFHA  680


 Score = 28.9 bits (63),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  889  WRVGDGKSLDFWSDWWVNDKS  951
            W++GDG+S +FW D W+++ +
Sbjct  355  WQIGDGRSTNFWLDKWISNNT  375



>ref|XP_010670869.1| PREDICTED: uncharacterized protein LOC104887816 [Beta vulgaris 
subsp. vulgaris]
Length=1295

 Score =   129 bits (325),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 79/275 (29%), Positives = 122/275 (44%), Gaps = 12/275 (4%)
 Frame = +3

Query  1062  FLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTV----DENWPWLW  1229
             +L E+ +  I+A  V  D    D L W     G F + SA  +I        D+ W  +W
Sbjct  930   YLSEDSLKLIQAHVVIDDPEVEDLLYWDGDPKGKFSIKSAIRIIRKESTEFQDQLWNLVW  989

Query  1230  KLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAREC  1409
             K +  ++V+  +WL+   R+  N  R +R+L DD  C  C D  ES +H+  DC  AR  
Sbjct  990   KASVQQRVRAFMWLVCHDRLLGNANRFKRNLTDDPKCFVCGDFVESTLHILRDCPAARSV  1049

Query  1410  WEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNN  1589
             W  +E +        + +  WI SN+      ND   W   F   +W +W+ RN  +F  
Sbjct  1050  WRKVEGFALDPNFYRVDLKNWISSNLE----YNDQETWPSFFAIIIWWLWRWRNMFVFGR  1105

Query  1590  NSETPVHV-AKLACTFASEARAF---IIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMK  1757
              +E P+ V A L   F    R+    +   G        ++ W+PP  GW  +N DGA +
Sbjct  1106  GNEVPIDVGAFLKIRFDETWRSLHGDMDTSGSNGHRVEKYIAWSPPPMGWYVLNTDGAAR  1165

Query  1758  SCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
                G A  G I+R+  G ++   +   G   +F A
Sbjct  1166  GTPGDAGGGVIIRNHSGMFISALSLNFGRCCAFRA  1200


 Score = 40.8 bits (94),  Expect(2) = 9e-33, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 1/54 (2%)
 Frame = +2

Query  1925  SCGAVMNRGDHSEETVVTLVKDCLDL-SRKFRKFKISHIMREGNRCADWLANYG  2083
             SC   +N G+ S      L++ CL+L  R+    K+ H+ REGNR ADWLAN G
Sbjct  1228  SCVQALNSGNSSCGGCTHLIRHCLNLLRREVWVVKVVHVFREGNRAADWLANRG  1281



>ref|XP_007023195.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
 gb|EOY25817.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
Length=874

 Score =   140 bits (352),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 134/284 (47%), Gaps = 13/284 (5%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY----SLISCTVDEN  1214
             + L + L  E+VN+I  I  P   +++D   W  S SG F ++S Y    SL   T +EN
Sbjct  522   ERLTSILPIEVVNQILYIIPPTLSASLDMPYWALSPSGYFTISSTYEHLGSLADSTREEN  581

Query  1215  ---WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFC  1385
                W  +W      +V   L+  L  R+ TN ER RR +  D++C  C   EE+ +H+  
Sbjct  582   NKMWHLVWDWKGPHRVCLFLFFCLHKRILTNAERVRRKMSSDASCPHCYGVEETCLHVLR  641

Query  1386  DCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
             DC  +   W  I    G      + +  W+ SN++ K +     PW+I F  T W  WK 
Sbjct  642   DCLASETLWRRILPESGINQFFQIPLIDWLSSNLNLKNLYVFDVPWNIVFGTTCWYTWK-  700

Query  1566  RNNLIFNNNSETPVH-----VAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWV  1730
             R+NL      E  V      +  +A    +    + I  GG        V W+PP   W+
Sbjct  701   RSNLFIFEGRELSVEGRLNIIRSMAVDSHNTWSTYRIISGGMRHQEKILVGWSPPPEDWI  760

Query  1731  KINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
              +N+DGA KS     +AGG++RD HG W++G+A K+  +  F A
Sbjct  761   TVNLDGAFKSAARTTAAGGVLRDAHGTWIVGYACKLETSSVFRA  804


 Score = 29.3 bits (64),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 0/25 (0%)
 Frame = +1

Query  880  RARWRVGDGKSLDFWSDWWVNDKSL  954
              RW +GDG  ++FW D WV +  L
Sbjct  468  HVRWSIGDGALVNFWIDTWVGEVPL  492



>ref|XP_008221358.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=877

 Score =   137 bits (346),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/273 (30%), Positives = 130/273 (48%), Gaps = 8/273 (3%)
 Frame = +3

Query  1065  LRE----ELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDENWPW  1223
             LRE     ++  I ++    + S  D   WQ + +G+F V SAYS       +V  +W +
Sbjct  490   LRECLPLHIIQLILSVHASFNGSGADRCIWQFTPNGSFSVKSAYSSFLPTEASVKWDWQF  549

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             +W L    KVKT LW++   ++ TNV+R++R L    TC +C    +++ HLF DC F+ 
Sbjct  550   IWGLLLPPKVKTFLWIVCHQKLLTNVQRQKRGLTQVPTCPKCDYPMKAIAHLFKDCPFSL  609

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIF  1583
               W  ++  G  +  + +    W+  N+ SK    +G PW + F   LW IWK R   +F
Sbjct  610   AIWNYLQI-GDNSSLDLMDFKEWLLRNLQSKRKVYNGLPWPLVFALYLWFIWKWRCKGVF  668

Query  1584  NNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSC  1763
                   P ++ +L   +A E          +       + W  P  G  KIN DG+  S 
Sbjct  669   YQRFVMPGNLQQLILQYALEWFNATKPPPPSYVPYVVQLHWIAPTYGVCKINTDGSRNSV  728

Query  1764  TGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             +     GG++RD++G W+ GF+  +GV     A
Sbjct  729   SRFIGVGGLLRDNYGAWIKGFSVNLGVGSVLEA  761


 Score = 28.9 bits (63),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 13/44 (30%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  892   RVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKD  1023
             RVG G ++ FW+D W++   L     ID+ + +    V +F+++
Sbjct  439   RVGSGDNVLFWTDRWLSRGPLYQYALIDLSEEMLQLNVCDFLEE  482



>ref|XP_007023230.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
 gb|EOY25852.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
Length=1011

 Score =   141 bits (356),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 92/295 (31%), Positives = 132/295 (45%), Gaps = 35/295 (12%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY----SLISCTVDEN  1214
             + L + L  E+VN+I  I  P   +++D   W  S  G F ++S Y    SL   T +EN
Sbjct  650   ERLTSILPIEVVNQILCIIPPTLSASLDMPYWALSPYGYFTISSTYKHLGSLADSTREEN  709

Query  1215  ---WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFC  1385
                W  +W L    +V   L+  L  R+ TN ER RR +  D++C  C   EE+ +H+  
Sbjct  710   NKMWRLVWDLRGPHRVCLFLFFCLHKRILTNAERVRRKMSSDASCPHCYGVEETCLHVLR  769

Query  1386  DCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
             DC      W  I    G      + +  W+ SN++ K +     PW+I    T W  WK 
Sbjct  770   DCPALETLWRRILPQSGINQFFQIPLIDWLSSNLNLKNLYVFDVPWNIVLGITCWYTWKW  829

Query  1566  RNNLIFNNNSETPVHVAKLACTFASEARAFIIR----------------HGGTSQGCYNW  1697
             RN  IF                 + E R  IIR                 GG        
Sbjct  830   RNLFIFEGRE------------LSVEGRLSIIRSVAVDSHNTWSTPRIISGGMRHQEEIL  877

Query  1698  VTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             V W+PP   W+ +N DGA KS  G+A+AGG++RD HG W++G+A K+  +  F A
Sbjct  878   VGWSPPPEDWIAVNSDGAFKSAVGIAAAGGVLRDSHGTWIVGYACKLETSSVFRA  932



>ref|XP_008382509.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=350

 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/270 (32%), Positives = 126/270 (47%), Gaps = 4/270 (1%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY-SLISCTVDENWP  1220
             VD L + L  ++V  I ++   + +   D + W  + SGT  V +AY SL S      W 
Sbjct  17    VDLLYSCLPPDVVEHIFSLHAGIANQREDKIIWSLTNSGTLSVKTAYLSLFSDDDIIPWK  76

Query  1221  W--LWKLNCVEKVKTLLWLLLKGRMFTNVER-RRRHLIDDSTCARCRDEEESLVHLFCDC  1391
             W  +WKL    K+ T LW +  G+M TNV+R ++  L +D  C  C   EES+ H+F  C
Sbjct  77    WNFIWKLKLPPKLVTFLWTIGYGKMLTNVQRAKKXXLQNDPCCPICPTVEESMDHIFRYC  136

Query  1392  QFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRN  1571
             + +   W  +           L   +W+  N+ +   T  G PW++ F  TLW  WK RN
Sbjct  137   RHSPSLWNNVGIPYEVAHSFALDFQSWMAINLRTHCSTTHGLPWNLIFASTLWYCWKMRN  196

Query  1572  NLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGA  1751
               +FNN  + PV   K+   FA +                  + W  P  G  KIN DG+
Sbjct  197   MFVFNNGQQPPVPPLKVIFQFARDWYDANKCSSSKPPRQIISIHWIRPPIGRYKINTDGS  256

Query  1752  MKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
              K      SAGG++R+  G W+ GFA  +G
Sbjct  257   CKDPFSHISAGGLIRNSEGDWIKGFAANLG  286



>ref|XP_008367475.1| PREDICTED: uncharacterized protein LOC103431103 [Malus domestica]
Length=1108

 Score =   132 bits (331),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 89/279 (32%), Positives = 133/279 (48%), Gaps = 10/279 (4%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN---  1214
             V AL   L EE V KI AIP+ ++D   D + W+ S  G F V SAY  ++   DE+   
Sbjct  832   VSALRAVLPEEYVWKISAIPIGLNDGDSDCIIWKHSNDGNFSVKSAY--LASIDDEDFVD  889

Query  1215  WPW--LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCD  1388
             W W  +WKL    +V   LWL L GR+  N +R +R + D+S C  C    ES+ H+   
Sbjct  890   WSWSDIWKLKLPPRVLHFLWLTLHGRLLCNEQRAKRXITDNSYCDFCDGCVESIDHILRR  949

Query  1389  CQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCR  1568
             C  A+  W  +  +        +  +  +  N+ S+ +      W   F +  W + K R
Sbjct  950   CDRAKLVWNQLGMHSIVLSSVGIDFHXXMRVNLFSRRLLCQNLXWWGVFAFACWWLXKLR  1009

Query  1569  NNLIFNNNSETPVHVAKLACTFASEARAFIIRH-GGTSQGCYNWVTWTPPQPGWVKINID  1745
             N  IF ++   P     L   F +    F +++ G        ++ W PP P +VK+N+D
Sbjct  1010  NLSIFASDFIFPSQPYIL--IFKAAKEWFEVQNFGAKPVKSRIFLAWDPPSPNYVKLNVD  1067

Query  1746  GAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             G+ KS  G +SAGGI+R     W+ GF   IGV    +A
Sbjct  1068  GSRKSGKGCSSAGGILRAAACVWIAGFTINIGVRSVLNA  1106


 Score = 30.8 bits (68),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (52%), Gaps = 1/54 (2%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             WRVG G ++ FW D W++D  L     I +  +    KV +F   +  WNV+ +
Sbjct  783   WRVGSGANISFWFDAWLDDGILTNKALIPLDVSAKAVKVIDFCYGN-CWNVSAL  835



>ref|XP_008222990.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=346

 Score =   132 bits (333),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 108/215 (50%), Gaps = 6/215 (3%)
 Frame = +3

Query  1206  DENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFC  1385
             D  W +LWKL    K+    WL+ +G++ +N +R RR L  D++C  C    ES++H+  
Sbjct  10    DVAWTFLWKLRIPPKLHIFFWLVFQGKILSNEQRVRRQLSLDASCGSCHWPMESILHILR  69

Query  1386  DCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
             +C  A++ W A+           +    W+  N+ SKIV  DG PW++ FV+T W IWK 
Sbjct  70    NCVKAKKVWNALLNSSQSARFFTIDFQPWLRVNLMSKIVWADGIPWNLVFVFTCWYIWKW  129

Query  1566  RNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYN---WVTWTPPQPGWVKI  1736
             RN+ +F+ + E      ++     +  + +      +S  C     W  W PP  G  K+
Sbjct  130   RNHYVFHRDEELAFDSIQI---ITAAMKEWFKTSNVSSTKCAKVEAWFAWEPPPAGVFKL  186

Query  1737  NIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
             N+DG+ K   G   AGG++RD    W  GFA  +G
Sbjct  187   NVDGSRKVAYGHIGAGGMLRDVSSDWCSGFAVNLG  221



>ref|XP_009144970.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=448

 Score =   132 bits (332),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/275 (31%), Positives = 139/275 (51%), Gaps = 19/275 (7%)
 Frame = +3

Query  1080  VNKIRAIPVPVDD--STVDTLTWQDSTSGTFFVASAYSLIS------CTVDENWPWLWKL  1235
             +N +R   V +D+   T D ++W +S  G F V SAY+ ++        ++  +  +W +
Sbjct  63    MNCLRLASVVIDEVTGTRDRMSWGESKDGLFTVKSAYTFLTRNTVPRPNMEALYRRVWSV  122

Query  1236  NCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWE  1415
                E+V+  LWL+    + TN+ER+RRHL ++S C  C+  +E+++H+  +C  A   W 
Sbjct  123   INPERVRVFLWLVTHQVIMTNMERKRRHLSENSVCPLCKGGDETILHVLRECPAAAGLWI  182

Query  1416  AIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS  1595
              +     +     L +  W+  N+ +K   N G  W   F  T+W  WK R   +F +  
Sbjct  183   RLVPISQQQRFFTLPLLEWLFENL-AKREPNWGDSWPTLFALTVWWCWKWRCGYVFGDEG  241

Query  1596  ETPVHVAKLACTFASEARAFIIRHG---GTSQG---CYNWVTWTPPQPGWVKINIDGAMK  1757
             +    V  L      +AR  ++ +    G SQG       ++W  P  GW+KIN DGA K
Sbjct  242   KCRDRVKFLR----EKAREVVVANDNLCGRSQGRERVEMQISWQKPASGWIKINTDGAAK  297

Query  1758  SCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
                GLA+AGG++RD++G W  GFA  IG+  +  A
Sbjct  298   GNPGLATAGGVLRDEYGMWHGGFALNIGICSARMA  332


 Score = 27.7 bits (60),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 24/49 (49%), Gaps = 0/49 (0%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSW  1035
             W  GDG  + FW D W+  + L     +++P+   +++V +  +    W
Sbjct  3     WVTGDGCQIRFWRDRWLLKELLSELSTVELPEEGLEERVCDLWQTGTGW  51



>ref|XP_004299997.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=448

 Score =   124 bits (312),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 132/284 (46%), Gaps = 21/284 (7%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN---  1214
             ++ L   +  E+VN+I + P   +DS  D L W+ +++G F V SAY + S  + E    
Sbjct  55    IEMLSDVVPPEVVNQIISFPTGFEDSGNDQLIWKATSNGVFSVKSAY-ISSFDMAEPQHH  113

Query  1215  -WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDC  1391
              W  +WKLNC+ K+KT  W +L  ++ TNV+R RR     + C  C   +ESL       
Sbjct  114   YWKVVWKLNCLPKLKTFFWTVLHKKILTNVQRVRRRFTTSAVCPICNSADESL-------  166

Query  1392  QFARECWEAIETYGGKTLKNHLLMN-------AWIESNVHSKIVTNDGAPWSITFVYTLW  1550
                 E    ++ +G       + +         WI + +  +    +G  W   FV+  W
Sbjct  167   --HSETVTGLKRFGNLFAPLLIFLTRLSWAGIIWISAQLFCQSKVKNGIKWCNLFVFVCW  224

Query  1551  QIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWV  1730
              +WK RN ++F+++   P   A +   +  E  +       ++     +++W  P    +
Sbjct  225   FLWKWRNKIVFDSSFVMPGDPALVIWNYVEEWTSAQSNPSSSNMFNVTYLSWLRPPANCL  284

Query  1731  KINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             K+NIDG   S +G   AGG++RD  G W+ G    +GV +   A
Sbjct  285   KLNIDGTRSSSSGKIGAGGVLRDHAGNWIFGCQINLGVGEVLYA  328


 Score = 33.9 bits (76),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 8/57 (14%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKD---DRSWNVTLM  1050
             WR+GDGK + FWSD WV    L   ++  +P  + +  +S+ + D   D  WN+ ++
Sbjct  7     WRIGDGKMVKFWSDTWVLSVPL---LQFALPHAVIN--LSSTVCDFWCDTGWNIEML  58



>gb|ABW81175.1| non-LTR retrotransposon transposase [Arabidopsis cebennensis]
Length=799

 Score =   124 bits (311),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 83/261 (32%), Positives = 120/261 (46%), Gaps = 12/261 (5%)
 Frame = +3

Query  1086  KIRAIPVPVDDST--VDTLTWQDSTSGTFFVASAYSLI------SCTVDENWPWLWKLNC  1241
             ++R   V VD+ T   D L+W +S  G F V SAYS +         +   +  +WK+  
Sbjct  416   RLRLKAVVVDNITGVRDRLSWGESLDGKFTVKSAYSSLMKDNTPRSDLSRMYDRVWKVIA  475

Query  1242  VEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAI  1421
              E+VK  LWL +   + TN+ER+RRHL D   C  C+  +E+++H+  DC      W  I
Sbjct  476   PERVKIFLWLGVHQVIMTNMERQRRHLSDTGICQVCKGGDETIIHILRDCPAMYGIWTRI  535

Query  1422  ETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSET  1601
                  +       +  W+  N+       DG PWS   V   W+ W+C N    N     
Sbjct  536   IPRRKRGTFFTQTLLEWVYDNLGDSGKV-DGCPWSC--VRWGWK-WRCGNVFGVNGKCRD  591

Query  1602  PVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASA  1781
              V   +   +   +A       G         V+W  P  GW+K+N DGA K   GLA+A
Sbjct  592   MVKFVRDRASEVIQAHLVEGNSGKIRGRIERMVSWVKPAEGWLKLNTDGASKGNPGLATA  651

Query  1782  GGIVRDDHGCWVIGFATKIGV  1844
             GGI+R   G W+ GFA  IG+
Sbjct  652   GGILRQQDGSWIGGFAVNIGI  672


 Score = 34.3 bits (77),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 26/49 (53%), Gaps = 0/49 (0%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSW  1035
             W VGDG++  FW+D W+ +  L  D+    P  L + +V +  +  R W
Sbjct  354   WVVGDGQTTRFWADKWLMNTPLREDIIGPAPVGLEEARVCDLWQHGRGW  402



>ref|XP_008382267.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=377

 Score =   125 bits (313),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 121/241 (50%), Gaps = 5/241 (2%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDEN  1214
             +D L   L E++V KI   P     + +D + W+ +++G F V  AY+L        D  
Sbjct  132   IDKLRDVLPEDMVQKIICRPAGTTGAGMDKIIWRCASNGVFTVKLAYNLFFDEEDLPDSC  191

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W ++W++N   K+K  LWL+ KGR+ +N +R RR L  DS+C  C    ES+ H+F DC 
Sbjct  192   WDFIWRVNVPPKLKVFLWLMSKGRLLSNEQRVRRQLTSDSSCMTCCGPIESIAHIFKDCS  251

Query  1395  FARECWEAIETYGGKTLKNHLLMNAWIESNVH-SKIVTNDGAPWSITFVYTLWQIWKCRN  1571
              A   W+++          +L   AW+ +N+  S   TN+GA W   F++  W IWK RN
Sbjct  252   RAMCIWKSMGVPWQLRNAQNLEFKAWLLANLKVSSKGTNEGA-WCTLFLFICWHIWKWRN  310

Query  1572  NLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGA  1751
               IF+ N   P++   +      E     +++          ++W  P  GW K+N+DG+
Sbjct  311   KQIFDVNFVMPMYPKAIIERDVDEWLKACVKYSVKPVKRQISLSWDHPDVGWCKLNVDGS  370

Query  1752  M  1754
             +
Sbjct  371   V  371


 Score = 32.0 bits (71),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 41/77 (53%), Gaps = 4/77 (5%)
 Frame = +1

Query  802   NVLQVQVKCITSASSSTTIRLMGVEIRAR---WRVGDGKSLDFWSDWWVNDKSLGLDMEI  972
             ++L  ++   T  S S    L GV +  +   WR+G+G+S+ FW D WV +  L   +++
Sbjct  52    SILDPKIHERTECSYSWKGILYGVNLLKKGMTWRIGNGESVKFWKDSWVLNVPLMETIDV  111

Query  973   DIPKNLYDKKVSNFIKD  1023
                 N+ D  VS F+++
Sbjct  112   ANISNI-DCVVSEFLRN  127



>dbj|BAB09815.1| non-LTR retroelement reverse transcriptase-like [Arabidopsis 
thaliana]
Length=676

 Score =   127 bits (320),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/275 (28%), Positives = 125/275 (45%), Gaps = 9/275 (3%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCT------V  1205
             ++ +  FL E +  ++ A+ +       D ++W  + +G F V+SAY + S        +
Sbjct  281   MERIAVFLPEFMRQRLLAVVIGGCYGVEDKMSWVGTENGRFTVSSAYLIQSVDEISKQCM  340

Query  1206  DENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFC  1385
                +  +W++   E+ +  LWL+    + TN ER RRH+ D   C  C+   ESL+H+  
Sbjct  341   SRFFDRVWRVMVPERARIFLWLVGNQVVLTNAERVRRHMADSDVCPLCKGASESLIHVLR  400

Query  1386  DCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
             DC      W  +     +       +  W+  N+  +   ++   W   F  T+W  WK 
Sbjct  401   DCPAMMGIWMRVVPVMEQRRFFETSLLEWMYGNLKER-SDSERRSWPTLFALTVWWGWKW  459

Query  1566  RNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCY--NWVTWTPPQPGWVKIN  1739
             R   +F  +S     V  L    A    A +  +G   +       + W  P  GWV +N
Sbjct  460   RCGYVFGEDSRCRDRVKFLKSAVAEVEAAHLAANGDAREDVLVERMIAWRKPAEGWVTMN  519

Query  1740  IDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGV  1844
              DGA     G A+AGG++RD+HG W++GFA  IGV
Sbjct  520   TDGASHGNPGQATAGGVIRDEHGSWLVGFALNIGV  554


 Score = 25.4 bits (54),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 26/51 (51%), Gaps = 0/51 (0%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNV  1041
             W +GDGK + FW D W+    L   +   +P     ++V+++  +   W++
Sbjct  231   WVLGDGKIIRFWQDRWLLSTPLLEWVSDQLPVEERGQRVADYWIEGVGWDM  281



>ref|XP_007033353.1| Non-LTR retroelement reverse transcriptase-like [Theobroma cacao]
 gb|EOY04279.1| Non-LTR retroelement reverse transcriptase-like [Theobroma cacao]
Length=438

 Score =   101 bits (252),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/270 (29%), Positives = 120/270 (44%), Gaps = 35/270 (13%)
 Frame = +3

Query  1065  LREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDENWPWLWKL  1235
             L   ++  I A+ +       DT  W  S+ G F + S Y L    S   + +W ++WK 
Sbjct  86    LPRNIILMILAVKLDPTSEEGDTSCWIPSSDGRFSIKSTYDLQRVDSFDAETHWSYIWKT  145

Query  1236  NCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWE  1415
              C  KVK  +W +L   + T                        LV L  +       W 
Sbjct  146   VCTRKVKVFIWRILHESLPT------------------------LVWLLIEMNL----WL  177

Query  1416  AIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS  1595
              I+          L + +WI  NV S  +   G PWSI F+Y+LW IW  RN  +F ++ 
Sbjct  178   QIDPTLINGSFFSLDLKSWIMDNVRSVDILA-GIPWSIIFMYSLWLIWYWRNLFVFYDSF  236

Query  1596  ETPVHVAKLACTFASEARAFIIR-HGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGL  1772
                    +   T + EA  F+ R H    +     ++W  P+  +VK+N+DG+ K   G+
Sbjct  237   NWSRDAWQQIWTKSKEAWDFLKREHDAVKKDIL--ISWELPKHSYVKLNVDGSAKGQPGM  294

Query  1773  ASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             A+AGG++R + G W++GF  KIG++ S  A
Sbjct  295   AAAGGVIRYEVGNWLLGFNYKIGISCSLQA  324


 Score = 51.2 bits (121),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 53/95 (56%), Gaps = 3/95 (3%)
 Frame = +2

Query  1877  KGGFKAQSRRVVNGLCSCGAVMNRGDHSEETVVTLVKDCLDLSRKFRKFKISHIMREGNR  2056
             KG  K Q     + L +   + N+    E+    L+K   +L ++F    ++HI RE N+
Sbjct  339   KGFRKVQVES--DSLLAVQKISNQSLQPEQNA-GLLKCIKELFQRFWNCTLTHIHREANQ  395

Query  2057  CADWLANYGQNITWRTLLLDSAPAELNDIIQADSL  2161
             CADW+A + +N+  +  ++DS P+ ++ I+ ADS+
Sbjct  396   CADWMATHHENLLLKLHIMDSPPSSISAILLADSI  430



>ref|XP_004305757.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=395

 Score =   119 bits (298),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/276 (28%), Positives = 115/276 (42%), Gaps = 47/276 (17%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDEN  1214
             V+ LL+ L  E+VN I  +P    +S  DT  W  +++G F V SAYS I   S  ++  
Sbjct  61    VELLLSVLSREIVNLIVNVPTGFSESGDDTRIWCSTSNGQFSVKSAYSSIFYSSDPMNPQ  120

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W  +WKL+   K+KT LW +L  ++ TNV+R  R      +C  C   +E+L+HL  D  
Sbjct  121   WKAMWKLDLPPKLKTFLWTILHKKLLTNVQRATRGFTSSPSCPICHSADETLLHLLRDYP  180

Query  1395  FARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
              A+  W A                                 PW              RN 
Sbjct  181   RAKIIWRAFSK------------------------------PW--------------RNK  196

Query  1575  LIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAM  1754
              +F  +   P    K+   +A E R   ++        Y    W  P   +  +N+DG  
Sbjct  197   QVFEPSFVLPTSFKKIIWDYALEWRKSKLKSNNNYMFSYTMHAWKKPPENFFNLNVDGTR  256

Query  1755  KSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
              S TG   AGG++R+ +G W+ GF   +GV +   A
Sbjct  257   VSLTGKIGAGGVIRNHYGDWISGFQINLGVGEILDA  292


 Score = 33.5 bits (75),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 26/43 (60%), Gaps = 1/43 (2%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNF  1014
             +WRVG+G S+ FW D+W+  ++L ++  +       D  +SNF
Sbjct  12    KWRVGNGNSIKFWYDFWLLPQAL-INFALSSAVIFEDAVISNF  53



>gb|KFK31801.1| hypothetical protein AALP_AA6G160600 [Arabis alpina]
Length=373

 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/267 (29%), Positives = 122/267 (46%), Gaps = 28/267 (10%)
 Frame = +3

Query  1062  FLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS--CTVDENWPWL---  1226
             ++ EE+  ++R++ V       D ++W  ++ G F V SAYS+++   T+ ++   L   
Sbjct  7     YVPEEITLQLRSLVVDTMMGAKDKISWSGNSDGKFTVKSAYSMLTRNLTLRQDLSRLFQR  66

Query  1227  -WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
              W L   E+V+  +WL +   + TNVER+RRHL     C  CR  EE+++H+  DC    
Sbjct  67    VWALIVPERVRIFIWLGVHKVLMTNVERQRRHLTSSGVCEVCRGSEETIMHILWDCPAME  126

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIF  1583
               W        + L     +  W+ + +       +              IWKCR+ L F
Sbjct  127   GIWRRFVPPRKQGLFFTQTLLEWLYTKLGDDSKVGN-------------SIWKCRDRLKF  173

Query  1584  NNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSC  1763
                      +  LA    S       R     +   + + W PP+ GWVK+N DGA +  
Sbjct  174   ---------LKDLALEVTSAHNKLGKRQSRNQERIEHMIKWQPPRDGWVKLNTDGASRGN  224

Query  1764  TGLASAGGIVRDDHGCWVIGFATKIGV  1844
              GLA+AGG++RD  G W  GF   IG+
Sbjct  225   PGLAAAGGVLRDGDGNWCGGFVLNIGI  251



>ref|XP_009151561.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1204

 Score =   122 bits (306),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/263 (30%), Positives = 118/263 (45%), Gaps = 11/263 (4%)
 Frame = +3

Query  1083  NKIRAIPVPVD--DSTVDTLTWQDSTSGTFFVASAYSLIS------CTVDENWPWLWKLN  1238
              ++  + V VD      D L W +  +G F V +AY LI+        ++  +  +W++ 
Sbjct  820   RRLERVAVVVDTVSGVKDRLAWGEVPNGQFTVKTAYDLITRDNTPRQQMENLFKSMWRVV  879

Query  1239  CVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEA  1418
               E+V+  LWL+    + TN ER RRHL     C  C+   E+++H+  DC      W  
Sbjct  880   APERVRVFLWLVGNQAIMTNAERYRRHLSGTDVCQVCKGGVETILHVLRDCPAMEGIWSR  939

Query  1419  IETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS-  1595
                   +     + +  W+  N++     N+  PW+ TF   +W  WK R   +F +N  
Sbjct  940   FVPSTKRQAFFSMPLLEWLYRNLYDNDAQNE-IPWATTFALGVWWGWKWRCGNVFGDNRL  998

Query  1596  -ETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGL  1772
                 V   +        A+          Q     V WTPP+ GW+K+N DGA     GL
Sbjct  999   WRDRVKFLRNLAREVMRAKKTEEESRARVQRVEIMVGWTPPRGGWMKLNTDGASHGNPGL  1058

Query  1773  ASAGGIVRDDHGCWVIGFATKIG  1841
             ASAGG++RD  G W  GFA  IG
Sbjct  1059  ASAGGVLRDGEGEWCGGFALNIG  1081


 Score = 30.0 bits (66),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 16/65 (25%), Positives = 36/65 (55%), Gaps = 4/65 (6%)
 Frame = +1

Query  862   LMGV-EIRAR---WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDR  1029
             +MG+ E+ A+   W +G+G+ + FW+D W++ + L  ++  D+P+   +        D  
Sbjct  746   VMGIREVVAKGHSWVIGNGREIKFWTDKWLSRQPLMGEVLGDLPEGYENITARELWLDGG  805

Query  1030  SWNVT  1044
              W+++
Sbjct  806   GWDLS  810



>ref|XP_009107896.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=416

 Score =   125 bits (313),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 79/268 (29%), Positives = 125/268 (47%), Gaps = 25/268 (9%)
 Frame = +3

Query  1086  KIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS------CTVDENWPWLWKLNCVE  1247
             ++ A+ V       D L W ++ +G F V +AY LI         ++  +  +W++   E
Sbjct  35    ELLAVVVDTVTGVKDRLAWGETPNGQFTVKTAYELIRRDDTSRQQMESLFKSVWRVVAPE  94

Query  1248  KVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIET  1427
             +V+  LWL+    + TN ER RRHL     C  C+   E+++H+  DC      W    T
Sbjct  95    RVRVFLWLVGNQAIITNAERYRRHLSGTDVCQICKGGVETILHVLRDCPAMEGIWNRFVT  154

Query  1428  YGGKTLKNHLLMNAWIESNVHSKIVTND---GAPWSITFVYTLWQIWKCRNNLIFNNNSE  1598
                   K H   +  +   ++  +  ND   G PW+ TF   +W  WK R   +F +N  
Sbjct  155   ----GTKRHAFFSMPLLEWLYRNLCDNDAPSGIPWATTFALAVWWGWKWRGGNVFGDNRL  210

Query  1599  TPVHV-------AKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMK  1757
                 V       +++ C   +E +  +++     Q     + WTPP+ GW+K+N DGA  
Sbjct  211   WRDRVQFLRNLASEVTCVKKAEEKNMVMK-----QRVDIMIGWTPPRVGWMKLNTDGASH  265

Query  1758  SCTGLASAGGIVRDDHGCWVIGFATKIG  1841
                GLAS GG++RD +G W  GFA  IG
Sbjct  266   GNPGLASVGGVLRDGNGEWYGGFALNIG  293



>ref|XP_008351723.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=678

 Score =   120 bits (300),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 88/279 (32%), Positives = 125/279 (45%), Gaps = 42/279 (15%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN---  1214
             V A    L EE V KI AIP+ ++D   D + W+ S  G F V SAY  ++   DE+   
Sbjct  434   VSAXRAVLXEEYVWKISAIPIGLNDGDSDCIIWKHSNDGNFSVKSAY--LASIDDEDFVD  491

Query  1215  WPW--LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCD  1388
             W W  +WKL    +V   LWL L GR+  N +R +R + D+S C  C    ES+ H+   
Sbjct  492   WSWSDIWKLKLPPRVLHFLWLTLHGRLLCNEQRAKRXITDNSYCDFCDGCVESIDHILRR  551

Query  1389  CQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCR  1568
             C  A+   +                      N+H          W   F +  W +WK R
Sbjct  552   CDRAKLLCQ----------------------NLH----------WWGVFAFACWWLWKLR  579

Query  1569  NNLIFNNNSETPVHVAKLACTFASEARAFIIRH-GGTSQGCYNWVTWTPPQPGWVKINID  1745
             N  IF ++   P     L   F +    F +++ G        ++ W PP P +VK+N D
Sbjct  580   NLSIFASDFIFPSQPYIL--IFKAAKEWFEVQNFGAKPVKSRIFLAWDPPSPNYVKLNAD  637

Query  1746  GAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             G+ KS  G +SAGGI+R     W+ GF   IGV    +A
Sbjct  638   GSRKSGKGCSSAGGILRAAACVWIAGFTINIGVGSVLNA  676


 Score = 30.4 bits (67),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 27/52 (52%), Gaps = 1/52 (2%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNVT  1044
             WRVG G ++ FW D W++D  L     I +  +    KV +F   +  WNV+
Sbjct  385   WRVGSGANISFWFDAWLDDGILTNKALIPLDVSAKAVKVIDFCYGN-CWNVS  435



>sp|P0C2F6.1|RNHX1_ARATH RecName: Full=Putative ribonuclease H protein At1g65750 [Arabidopsis 
thaliana]
Length=620

 Score =   122 bits (305),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 85/262 (32%), Positives = 121/262 (46%), Gaps = 13/262 (5%)
 Frame = +3

Query  1086  KIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDE--------NWPWLWKLNC  1241
             ++RA+ + +     D L+W+ S  G F V SAY ++  TVDE         +  LWK+  
Sbjct  239   ELRAVVLDLVTGARDRLSWKFSQDGQFSVRSAYEML--TVDEVPRPNMASFFNCLWKVRV  296

Query  1242  VEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAI  1421
              E+VKT LWL+    + T  ER RRHL   + C  C+   ES++H+  DC      W  +
Sbjct  297   PERVKTFLWLVGNQAVMTEEERHRRHLSASNVCQVCKGGVESMLHVLRDCPAQLGIWVRV  356

Query  1422  ETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSE-  1598
                  +       +  W+  N+  +    D  PWS  F   +W  WK R   IF  N++ 
Sbjct  357   VPQRRQQGFFSKSLFEWLYDNLGDRSGCED-IPWSTIFAVIIWWGWKWRCGNIFGENTKC  415

Query  1599  -TPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLA  1775
                V   K        A +  +  G T       + W  P  GWVK+N DGA +   GLA
Sbjct  416   RDRVKFVKEWAVEVYRAHSGNVLVGITQPRVERMIGWVSPCVGWVKVNTDGASRGNPGLA  475

Query  1776  SAGGIVRDDHGCWVIGFATKIG  1841
             SAGG++RD  G W  GF+  IG
Sbjct  476   SAGGVLRDCTGAWCGGFSLNIG  497


 Score = 28.5 bits (62),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 29/55 (53%), Gaps = 9/55 (16%)
 Frame = +1

Query  829  ITSASSSTTIRLMGVEIR------ARWRVGDGKSLDFWSDWWVNDKSLGLDMEID  975
            I   S S+T R + + +R        W  GDG+ + FW+D WV+ K L   +E+D
Sbjct  149  IPKGSWSSTWRSIAIGLRDVVSHGVGWIPGDGQQIRFWTDRWVSGKPL---LELD  200



>ref|XP_009124282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1011

 Score =   120 bits (302),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 82/269 (30%), Positives = 123/269 (46%), Gaps = 11/269 (4%)
 Frame = +3

Query  1062  FLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS------CTVDENWPW  1223
             F+ +E   ++ A+ V   + + D L W  + +G F V SAY+LI+        ++  +  
Sbjct  622   FVTDETRLELAAVVVDTVNDSEDRLAWSQTNNGQFTVKSAYALITRDDAPRPNMEYLFRR  681

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             +W +   E+V+  LWL+    + TN ER RRHL     C  C+   E+++H+  DC   R
Sbjct  682   MWHVVAPERVRMFLWLVGNQAIMTNAERYRRHLSGTDVCQVCKGGIETILHVLRDCPAMR  741

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIF  1583
               W+       +     + +  W+  N+ S   T    PW  TF   +W  WK R   IF
Sbjct  742   GIWDRFVPAVKRQTFFSMPLLEWLYKNL-SDNGTGSEIPWPTTFALAVWWGWKWRCGNIF  800

Query  1584  NNNSETPVHVAKLACTFASEARAFIIRHGGTS---QGCYNWVTWTPPQPGWVKINIDGAM  1754
               NS     V  L    A E  +      G S         V W PP+ GW+K+N DG+ 
Sbjct  801   GKNSLWRDRVGFLR-NLAKEVMSANEAEKGNSNVDHRTERMVGWAPPRSGWMKLNTDGSS  859

Query  1755  KSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
                 G A+AGG++R+  G W  GFA  IG
Sbjct  860   HGNPGAATAGGVLRNGEGEWCGGFALNIG  888


 Score = 29.3 bits (64),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 23/39 (59%), Gaps = 0/39 (0%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKV  1005
             W +G+G+ + FW+D W++++ L      ++P+   D  V
Sbjct  566   WAIGNGRDIKFWTDRWLSNQPLSSVTIGELPEGYEDVTV  604



>gb|AAF23831.1|AC007234_3 F1E22.12 [Arabidopsis thaliana]
Length=1055

 Score =   121 bits (304),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 85/262 (32%), Positives = 121/262 (46%), Gaps = 13/262 (5%)
 Frame = +3

Query  1086  KIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDE--------NWPWLWKLNC  1241
             ++RA+ + +     D L+W+ S  G F V SAY ++  TVDE         +  LWK+  
Sbjct  348   ELRAVVLDLVTGARDRLSWKFSQDGQFSVRSAYEML--TVDEVPRPNMASFFNCLWKVRV  405

Query  1242  VEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAI  1421
              E+VKT LWL+    + T  ER RRHL   + C  C+   ES++H+  DC      W  +
Sbjct  406   PERVKTFLWLVGNQAVMTEEERHRRHLSASNVCQVCKGGVESMLHVLRDCPAQLGIWVRV  465

Query  1422  ETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSE-  1598
                  +       +  W+  N+  +    D  PWS  F   +W  WK R   IF  N++ 
Sbjct  466   VPQRRQQGFFSKSLFEWLYDNLGDRSGCED-IPWSTIFAVIIWWGWKWRCGNIFGENTKC  524

Query  1599  -TPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLA  1775
                V   K        A +  +  G T       + W  P  GWVK+N DGA +   GLA
Sbjct  525   RDRVKFVKEWAVEVYRAHSGNVLVGITQPRVERMIGWVSPCVGWVKVNTDGASRGNPGLA  584

Query  1776  SAGGIVRDDHGCWVIGFATKIG  1841
             SAGG++RD  G W  GF+  IG
Sbjct  585   SAGGVLRDCTGAWCGGFSLNIG  606


 Score = 28.5 bits (62),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 19/29 (66%), Gaps = 3/29 (10%)
 Frame = +1

Query  889  WRVGDGKSLDFWSDWWVNDKSLGLDMEID  975
            W  GDG+ + FW+D WV+ K L   +E+D
Sbjct  284  WIPGDGQQIRFWTDRWVSGKPL---LELD  309



>ref|XP_006492639.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=569

 Score =   121 bits (303),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 81/273 (30%), Positives = 118/273 (43%), Gaps = 8/273 (3%)
 Frame = +3

Query  1041  YVDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTV----D  1208
             Y D    FL   ++ +I A+  P  D   D+L W  S SG F   SAY  +S       D
Sbjct  111   YWDRFEQFLPSHIILQIAALHPPSPDKGTDSLFWAHSKSGRFTTHSAYLALSNDTPMHDD  170

Query  1209  ENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCD  1388
               W  +W     + V+  LW +   R+ T  E  RRH+   ++C RC    E  +H+  D
Sbjct  171   RLWRMVWNWKGPQSVRIFLWQVFHDRLKTKAELARRHIPVSTSCDRCGAVNEDAMHVLRD  230

Query  1389  CQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCR  1568
             C   +  W  I     +    +  +  W+ +NV         + W+I F   LW++W  R
Sbjct  231   CALVKLFWLLILPANKRQQFFNSRLQEWLRTNVGIVGRLGSVSNWAIFFGIALWRLWFWR  290

Query  1569  NNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCY--NWVTWTPPQPGWVKINI  1742
             N   FN  S  P  V     T  +E    I  H  T+       W++W PP   W  +N 
Sbjct  291   NQFFFNQASMDPNVVLMDVLTRTAEMHK-IHTHPLTTGHIRVTRWISWKPPDWPWCSLNT  349

Query  1743  DGAMKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
             DGA  +  G ++A G++RD  G W+ GF   IG
Sbjct  350   DGA-HNRGGTSTAWGLIRDHMGRWLSGFGMMIG  381


 Score = 26.2 bits (56),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +1

Query  973   DIPKNLYDKKVSNFIKDDRSW  1035
             ++P N+ + KV++F+K D SW
Sbjct  90    NLPSNISNGKVADFVKADSSW  110



>ref|XP_007039706.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
 gb|EOY24207.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
Length=391

 Score =   120 bits (301),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 125/273 (46%), Gaps = 12/273 (4%)
 Frame = +3

Query  1056  LTF-LREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY----SLISCTVDEN--  1214
             LTF L  E+VN+I  I  P   +++D   W  S S  F ++S Y    SL   T ++N  
Sbjct  26    LTFILPIEVVNQILYIIPPTLSASLDMPYWALSPSRYFTISSTYEHLWSLADSTREDNNK  85

Query  1215  -WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDC  1391
              W  +W      +V   L+  L  R+ TN E  R  +  D++C      +E+ +H+  DC
Sbjct  86    MWRLVWDWRGPHRVCLFLFFCLHKRILTNAEGVRHKMSSDASCPHYYGAKETCLHVLRDC  145

Query  1392  QFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRN  1571
               ++  W  I    G        +  W+ SN++ K +     PW+I F    W  WK RN
Sbjct  146   PASKTLWRNILPQSGINQFFQTPLIDWLSSNLNLKNLYVFDVPWNIVFGIACWYTWKWRN  205

Query  1572  NLIFNNNS---ETPVHVAK-LACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKIN  1739
               IF       E  + + K +A    +      I  GG        V W+PP   W+ +N
Sbjct  206   LFIFEGRELSVEGRLSIIKSMAVNSHNTWSTPSIISGGMRHQEEILVGWSPPPKDWIAVN  265

Query  1740  IDGAMKSCTGLASAGGIVRDDHGCWVIGFATKI  1838
              DG  KS    A+AGG++RD HG W++G+A K+
Sbjct  266   SDGVFKSAARTAAAGGVLRDAHGTWIVGYACKL  298



>ref|XP_007042183.1| Ribonuclease H protein [Theobroma cacao]
 gb|EOX98014.1| Ribonuclease H protein [Theobroma cacao]
Length=528

 Score =   121 bits (303),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 85/283 (30%), Positives = 121/283 (43%), Gaps = 38/283 (13%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN----  1214
             D L   L  E+V ++  I  P      D   W  S SG F +ASAY  +           
Sbjct  46    DKLSYCLPNEVVLQVVQIMPPTVTIAQDMPYWGKSASGQFTIASAYDYLRQLSSPTKARP  105

Query  1215  ---WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFC  1385
                W   WK    ++V+T L+  L GR+ TN +R  R L  DS C +CR E+E++ H+  
Sbjct  106   SGIWQGAWKWQGSQRVRTFLFQCLHGRLLTNRKRLHRQLTADSLCPQCRMEDETVTHVLR  165

Query  1386  DCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
             DC  A   W           K  L++                G PWSI F    W +WK 
Sbjct  166   DCMVATSLW-----------KQQLIL----------------GNPWSIVFRLACWYLWKW  198

Query  1566  RNNLIFN---NNSETPVHVAK-LACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVK  1733
             RN ++F+   N +   + + K +A    + +  F        +     + W  PQ GWV 
Sbjct  199   RNGVVFDVAFNPTRKRISMIKSMATATIAPSADFDGVQVERRKKEEVLIEWRAPQVGWVC  258

Query  1734  INIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             +N DGA K     ASAGG+ R+  G W  GF  K+G   ++ A
Sbjct  259   LNTDGAYKRSIEEASAGGVKRNAEGDWQAGFVAKLGKCSAYRA  301



>ref|XP_008229470.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=248

 Score =   116 bits (291),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/255 (30%), Positives = 122/255 (48%), Gaps = 19/255 (7%)
 Frame = +3

Query  1077  LVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDENWPWLWKLNCVE  1247
             +V KI   PV    ++ D    + +++G F V  A+ LI   S   D  W  L  ++   
Sbjct  1     MVQKITCFPVGFGGNSQDAQIRRPTSNGIFTVKYAFQLIHGGSNWSDACWKGLRSMSLPP  60

Query  1248  KVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIET  1427
             K+K  LWL+ +G++ TN +R RR+L  +S+C  C    E+++H   D   A+E W  +  
Sbjct  61    KLKVFLWLVFQGKILTNEQRVRRYLAVESSCFVCGWHSENIIHTLRDYGRAKEVW--LTV  118

Query  1428  YGGKTLKNHLLMN--AWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSET  1601
                    +  L +  +W+ SN+ SK      +PW+I FV+T W +WK RN  IFN+  + 
Sbjct  119   LPPSKFHDFFLSDYPSWLRSNLFSKAKWEGRSPWNIMFVFTCWYVWKWRNQYIFNDAVDL  178

Query  1602  PVHVAKLACTFASEARAFIIRHGGTSQGCYN------WVTWTPPQPGWVKINIDGAMKSC  1763
                   + C       A +     +S  C N       + W P   GWVK+N+DG   + 
Sbjct  179   SCDPRNIICA------AVLDWVKASSVNCRNVPRTQVMLRWEPLGSGWVKLNVDGTCMNA  232

Query  1764  TGLASAGGIVRDDHG  1808
             +G   A G+++D  G
Sbjct  233   SGKIGASGVIKDCFG  247



>ref|XP_008245777.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=349

 Score =   118 bits (295),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 78/263 (30%), Positives = 126/263 (48%), Gaps = 13/263 (5%)
 Frame = +3

Query  1077  LVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDENWPWLWKLNCVE  1247
             +V KI   PV    ++ D    + +++G F V  A+ LI   S   D  W  L  ++   
Sbjct  1     MVQKITCFPVGFGGNSQDAQIRRPTSNGIFTVKYAFQLIHGGSNWSDACWKGLRSMSLPP  60

Query  1248  KVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIET  1427
             K+K  LWL+ +G++ TN +R RR+L  +S+C+      E+++H   D   A+E W  +  
Sbjct  61    KLKVFLWLVFQGKILTNEQRVRRYLAVESSCSVGGWHSENIIHTLRDYGRAKEVW--LTV  118

Query  1428  YGGKTLKNHLLMN--AWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSET  1601
                    +  L +  +W+ SN+ SK       PW+I FV+T W +WK RN  IFN+  + 
Sbjct  119   LPPSKFHDFFLSDYPSWLRSNLFSKAKWEWRYPWNIMFVFTCWYVWKWRNQYIFNDAEDL  178

Query  1602  PVHVAKLACTFASE---ARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGL  1772
                   + C    +   A     R+   +Q     + W P   GWVK+N+DG   + +G 
Sbjct  179   SCDPRNIICAAVLDWVKASNLNCRNVPRTQVM---LRWEPLGSGWVKLNVDGTCMNASGK  235

Query  1773  ASAGGIVRDDHGCWVIGFATKIG  1841
               A G+++D  G W  GF   +G
Sbjct  236   IGASGVIKDCFGEWCGGFVVNLG  258



>emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1363

 Score =   107 bits (268),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 117/268 (44%), Gaps = 16/268 (6%)
 Frame = +3

Query  1062  FLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDE-----NWPWL  1226
              L  +++ +I+ IP+       D  TW    +GTF V SAY LI+   +E     +W  L
Sbjct  982   LLPPDILKQIKEIPLASMSEVEDDFTWNFEKNGTFSVKSAYYLINRREEETGGKGSWRGL  1041

Query  1227  WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARE  1406
             W+ N   K K L+W  +   + T +   +R    +  C  C    E ++HLF DC  A  
Sbjct  1042  WRKNIPFKYKLLIWNGIHNILPTALFLAKRIHNFNPQCVACDHPIEDMIHLFRDCCVASS  1101

Query  1407  CWEAIETYGGKTLKN---HLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNL  1577
              W  I  +     +N   +L    WI+ N+      N    W   F    W IW  RN  
Sbjct  1102  VWIEILKHHKPNNQNLFFNLEWEEWIDFNL------NQHDYWVTKFTTAFWHIWCSRNKT  1155

Query  1578  IFNNNSETPVHVA-KLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAM  1754
             +F      P     ++   F +  RAF + +     G    + W PP  G++K+N DGA 
Sbjct  1156  VFECAVNHPKFTYNRVVADFFTNIRAFQV-NNTQGNGSKVVLRWKPPHQGFLKLNTDGAW  1214

Query  1755  KSCTGLASAGGIVRDDHGCWVIGFATKI  1838
             K+    A  GG+ RD  G W +GFA ++
Sbjct  1215  KADWENAGIGGVFRDAVGNWELGFAKRV  1242


 Score = 35.8 bits (81),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 0/46 (0%)
 Frame = +1

Query  892   RVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDR  1029
             R+G+G+S   W  WWV    L   M  +IP+ +   +VSN IK  R
Sbjct  928   RIGNGRSTSLWYHWWVGGGPLVDVMGSNIPEFMSHWQVSNIIKRGR  973



>gb|ABE80133.2| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=282

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/270 (29%), Positives = 114/270 (42%), Gaps = 44/270 (16%)
 Frame = +3

Query  1065  LREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSL---ISCTVDENWPWLWKL  1235
             L  ++VN+I A+P P D    DT+ W  + +  F V SAY+L    S  V   W  LW  
Sbjct  4     LPVDIVNQILALPTPSDFDGPDTIGWGGTNTLQFTVQSAYNLQQETSFAVGGEWKTLWNW  63

Query  1236  NCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWE  1415
                 +++T +WL   GR+ TN  R +  +    TC  C  E+E+++H+  DC  A +   
Sbjct  64    KGPHRIQTFIWLAANGRILTNYRRSKWGVGISPTCPCCAREDETIIHVLRDCVHATQ---  120

Query  1416  AIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS  1595
                                                    F  T W +W  RN  IF    
Sbjct  121   -------------------------------------TNFTTTCWYLWNWRNKSIFEIGF  143

Query  1596  ETPVHVAKLACTFASEARAFI-IRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGL  1772
             + P +   +   F  E      + H  + Q    ++ W  P  GWVK+N DGA K+    
Sbjct  144   QRPSNPTLVIQKFTREIEDNTKLVHKSSHQKETIYIGWMRPPFGWVKLNCDGAWKASGTF  203

Query  1773  ASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             A  GG++RD  G W+ G+  KIG+ D+F A
Sbjct  204   AGCGGLLRDSDGRWIKGYFKKIGMCDAFHA  233



>gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1231

 Score =   114 bits (284),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 80/278 (29%), Positives = 127/278 (46%), Gaps = 21/278 (8%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN---  1214
             ++ L  +L E +  ++ ++ V V     D ++W+ +  G F V SAYSL+   V +    
Sbjct  840   LEILGLYLPETVKRRLLSVVVQVFLGNGDEISWKGTQDGAFTVRSAYSLLQGDVGDRPNM  899

Query  1215  ---WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFC  1385
                +  +WKL   E+V+  +WL+ +  + TNVER RRHL +++ C+ C   EE+++H+  
Sbjct  900   GSFFNRIWKLITPERVRVFIWLVSQNVIMTNVERVRRHLSENAICSVCNGAEETILHVLR  959

Query  1386  DCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTND---GAPWSITFVYTLWQI  1556
             DC      W  +       L+ H   + +   ++   + TN       W   F   +W  
Sbjct  960   DCPAMEPIWRRL-----LPLRRH---HEFFSQSLLEWLFTNMDPVKGIWPTLFGMGIWWA  1011

Query  1557  WKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQG---CYNWVTWTPPQPGW  1727
             WK R   +F         + K     A E R   +   G           + W  P  GW
Sbjct  1012  WKWRCCDVFGERKICRDRL-KFIKDMAEEVRRVHVGAVGNRPNGVRVERMIRWQVPSDGW  1070

Query  1728  VKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
             VKI  DGA +   GLA+AGG +R+  G W+ GFA  IG
Sbjct  1071  VKITTDGASRGNHGLAAAGGAIRNGQGEWLGGFALNIG  1108


 Score = 26.9 bits (58),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 28/57 (49%), Gaps = 6/57 (11%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKS---LGLDMEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             W  GDG ++ FW D W+  +    LG DM   IP+    K  +++      WN+ ++
Sbjct  790   WVPGDGCTIRFWLDRWLLQEPLVELGTDM---IPEGERIKVAADYWLPGSGWNLEIL  843



>ref|XP_007031938.1| Ribonuclease H protein [Theobroma cacao]
 gb|EOY02864.1| Ribonuclease H protein [Theobroma cacao]
Length=660

 Score =   117 bits (294),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 82/283 (29%), Positives = 121/283 (43%), Gaps = 12/283 (4%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN----  1214
             D L   L  E+V ++     P      D   W +S SG F VAS Y  +           
Sbjct  262   DKLSYCLPNEVVLQVVQTMPPTVIIAQDMPYWGESASGQFTVASVYDYLRQLSSPAKARP  321

Query  1215  ---WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFC  1385
                W   WK    ++V+T L+  L GR+ TN ER  R L  DS C +CR E+E++ H+  
Sbjct  322   SGIWQGAWKWQGSQRVRTFLFQCLHGRLLTNRERLHRQLTTDSLCPQCRMEDETVTHVLR  381

Query  1386  DCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
             DC  A   W  I     +       +  W+ SN+  + +   G PWS+ F    W +WK 
Sbjct  382   DCMVATSLWVKIIPQHEQNDFFTFPLREWLVSNLQKQQLIL-GNPWSVVFGLACWCLWKW  440

Query  1566  RNNLI----FNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVK  1733
             RN ++    FN   +    +  +A    + +  F        +     + W  PQ GWV 
Sbjct  441   RNGVVFYAAFNPTRKRISMIKSMATATIATSADFDGVQVERRKKEEVLIGWRTPQVGWVC  500

Query  1734  INIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             +N D A K     AS GG++R+  G W   F  K+G   ++ A
Sbjct  501   LNTDEAYKRSIEEASTGGVIRNAEGDWQAEFLAKLGKCSAYRA  543



>ref|XP_008233168.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=612

 Score =   117 bits (293),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 80/261 (31%), Positives = 115/261 (44%), Gaps = 34/261 (13%)
 Frame = +3

Query  1086  KIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI--SC-TVDENWPWLWKLNCVEKVK  1256
             ++ ++PV    S  DT  W+ S +  F V  AYSL    C T D     LW LN   K++
Sbjct  316   QVISVPVGFLGSLPDTQIWKGSDNDNFSVKFAYSLFFQGCYTSDSCSKSLWSLNVPPKLQ  375

Query  1257  TLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGG  1436
                WL  +G++ +N +  RR L  D +C  C    E+++H+  DC+ AR  W  I     
Sbjct  376   YFKWLASQGKILSNDQCVRRQLASDPSCGFCSWPTETVLHILHDCERARSTWNVIRPAYA  435

Query  1437  KTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVA  1616
                  HL    W++ NV S+   N   PWS  FV+T W +W  RN  +F N         
Sbjct  436   HNF-FHLDAQPWMKVNVLSREKWNGDVPWSTVFVFTCWHLWCWRNKHVFQNED-------  487

Query  1617  KLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVR  1796
                  F+                        PP+PG  K+N+DG+ +S T   S  G++R
Sbjct  488   --TVIFSPRQE--------------------PPRPGQFKLNVDGSRRSVTSCISVRGVIR  525

Query  1797  DDHGCWVIGFATKIGVTDSFS  1859
             D  G W + F  K  + D FS
Sbjct  526   DPFGDWHV-FRDKNIIADRFS  545



>gb|AAD22368.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=321

 Score =   114 bits (284),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 97/203 (48%), Gaps = 10/203 (5%)
 Frame = +3

Query  1245  EKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIE  1424
             E+V+  LWL+++  + TNVER RRHL D   C  C+  EE+++H+  DC      W  + 
Sbjct  4     ERVRVFLWLVVQQVIITNVERYRRHLSDTRVCQICQGGEETILHVLRDCPAMAGIWSRLV  63

Query  1425  TYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETP  1604
                         +  WI  N+  +        W   FV  +W  WK R   IF  N +  
Sbjct  64    PRDQIRQFFTASLLEWIYKNLRER------GSWPTVFVMAVWWGWKWRCGNIFGGNGKCR  117

Query  1605  VHVAKLACTFASE---ARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLA  1775
               V K     A E   A AF+  +          V+W  P+ GWVK+N DGA +   G A
Sbjct  118   DRV-KFIKDLAEEVAIANAFVKGNEVRVSRVERLVSWVSPEDGWVKLNTDGASRGNPGFA  176

Query  1776  SAGGIVRDDHGCWVIGFATKIGV  1844
             +AGG++RD +G W+ GFA  IGV
Sbjct  177   TAGGVLRDHNGAWIGGFAVNIGV  199



>ref|XP_004295896.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=312

 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 112/276 (41%), Gaps = 39/276 (14%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDEN  1214
             V+ LL+ L    VN I  +P   ++   D   W  +++G F V  AY+ +   S  V+  
Sbjct  13    VELLLSVLPRNNVNFIINVPTGFNECGDDIRIWNSTSNGQFSVKCAYNSLFDLSEPVNPQ  72

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W  LW  +   K+KT LW LL  ++ TNV+R  R    +  C  C               
Sbjct  73    WSALWNFDLPPKLKTFLWTLLHKKLLTNVQRVTRGFASNPACPICHS-------------  119

Query  1395  FARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
                                    N WI +++H      D   W   F++  W IWK RN 
Sbjct  120   -----------------------NGWINASLHCHTAIQDNIRWKCLFIFICWFIWKWRNK  156

Query  1575  LIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAM  1754
              +F      P     +   +A E +   ++    S   Y  ++W  P   + K+N+DG  
Sbjct  157   QVFEPGFVLPACFKNMIWDYAIEWKKTKLKSNENSMFSYTMLSWKRPPENFFKLNVDGTR  216

Query  1755  KSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
              S +G   AGG++R+  G W+IGF   + V +   A
Sbjct  217   TSPSGKIGAGGVIRNHCGDWIIGFHINLEVGEILDA  252



>ref|XP_009116295.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=782

 Score =   110 bits (274),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 119/270 (44%), Gaps = 15/270 (6%)
 Frame = +3

Query  1062  FLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS------CTVDENWPW  1223
             F+ +E   ++ A+ V   + + D L W  + +G   V SAY+LI+        ++  +  
Sbjct  393   FVTDETRLELAAVVVDTVNDSEDRLAWSQTKNGQLTVKSAYALITRDDAPRPNMEYLFRR  452

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             +W +   E+VK  LWL+    + TN ER R HL     C  C+   E+++H+  DC   R
Sbjct  453   MWHVVPPERVKMFLWLVGNQAIMTNAERYRWHLSGTDVCQVCKGGIETILHVLRDCPAMR  512

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIF  1583
               W+       +     + +  W+  N+ S   T    PW  TF   +W  WK R   IF
Sbjct  513   GIWDLFVPAVKRQTFFSMPLLEWLYKNL-SDNGTGREIPWPTTFALAVWWGWKWRCGNIF  571

Query  1584  NNNSETPVHVAKL-----ACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDG  1748
               NS     V  L         A+EA      +          V W PPQ GW+K+N DG
Sbjct  572   GKNSLWRNRVGFLRNLAKEVMLANEAEK---GNPNVDHRTEIMVGWAPPQSGWMKLNTDG  628

Query  1749  AMKSCTGLASAGGIVRDDHGCWVIGFATKI  1838
             +     G  +AGG++R+  G W  GFA  I
Sbjct  629   SSHGNPGPETAGGVLRNGEGEWCGGFALNI  658


 Score = 29.3 bits (64),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 23/39 (59%), Gaps = 0/39 (0%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKV  1005
             W +G+G+ + FW+D W++++ L      ++P+   D  V
Sbjct  337   WAIGNGRDIKFWTDRWLSNQPLSSVTIGELPEGYEDVTV  375



>ref|XP_004289445.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=719

 Score =   111 bits (277),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 95/184 (52%), Gaps = 3/184 (2%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDEN  1214
             +  L + L + +V +I ++P     S  D L W  + +G F V S Y+     +   +  
Sbjct  503   ISLLKSVLPDHVVMQIISVPSGFGVSGHDKLIWNATANGKFSVKSTYNSFFDSAGVSNPL  562

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W  LWKLNC  K+KT +W +L  ++ TNV+R RR     ++C  C++ +E+L+HL  DC 
Sbjct  563   WTHLWKLNCPPKLKTFMWSVLHQKILTNVQRVRRGFSTIASCPICKNADETLLHLLRDCP  622

Query  1395  FARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
              ++  W +I   G  T    L  N WI +  H  +V  +   W   FV+  W IWK RN 
Sbjct  623   RSQAIWNSILRPGSITNSFSLDWNGWISAQFHCHVVIKNNIQWCNLFVFVCWFIWKWRNK  682

Query  1575  LIFN  1586
             +IF+
Sbjct  683   VIFD  686


 Score = 27.7 bits (60),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 5/38 (13%)
 Frame = +1

Query  829  ITSASSSTTIR--LMGVEIRAR---WRVGDGKSLDFWS  927
            I  A  S T R  + GVE+  R   WR+GDG  + FW+
Sbjct  452  IAPADCSNTWRGIVHGVELMRRNLKWRIGDGAKIKFWN  489



>ref|XP_006469101.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=684

 Score =   100 bits (248),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 112/270 (41%), Gaps = 18/270 (7%)
 Frame = +3

Query  1086  KIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN-----WPWLWKLNCVEK  1250
             +I ++  P     VD L W+    G F V SAY  + C +D N     W   W     + 
Sbjct  334   QIASVMPPNHLLGVDKLFWRYEPRGNFTVRSAYEAL-CQLDSNDTGTAWKLAWTWKGPQA  392

Query  1251  VKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETY  1430
             V+  LW  L  ++ T  E  RRH+     C RC    E ++H+  DCQ     W  +   
Sbjct  393   VRIFLWQALHAKLKTKEELSRRHIPISIGCERCGAPIEDVIHVLRDCQCIMRVWLRL---  449

Query  1431  GGKTLKNHL-----LMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS  1595
                  +NHL      +  WI +N+ +K      + W   F   +W++W  RN+ + +   
Sbjct  450   --VPARNHLSFFQSTLRDWITANLQNKWKIASPSTWECIFGVAIWRLWFWRNHFMVDGKL  507

Query  1596  ETPVHVAKLACTFASEARAFIIRH-GGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGL  1772
                  +       A+E       H     +    ++ W PP   W K+N DG+ +   G 
Sbjct  508   TDSSTIYLDITARANEIHKLNNSHISQQPRRKEIFIGWIPPPWPWCKLNTDGSCRKSEG-  566

Query  1773  ASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             A AGGI+RD  G W+ GF   IG +    A
Sbjct  567   AGAGGILRDSVGHWISGFCLNIGESSVLMA  596


 Score = 38.1 bits (87),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 25/53 (47%), Gaps = 1/53 (2%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEID-IPKNLYDKKVSNFIKDDRSWN  1038
             ARW V DG    FW D W   +   +++ I  +P+ L    VS FI     WN
Sbjct  267   ARWAVCDGTRTRFWLDCWATKQGPLINLAIHPVPQELVKATVSEFINVHGDWN  319



>ref|XP_008233465.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=547

 Score =   113 bits (282),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 122/246 (50%), Gaps = 13/246 (5%)
 Frame = +3

Query  1128  DTLTWQDSTSGTFFVASAYSLI---SCTVDENWPWLWKLNCVEKVKTLLWLLLKGRMFTN  1298
             D   W+ + +G F V +AY+L        D ++  LWKL    K++   WL  +G++ +N
Sbjct  179   DCHIWKGTANGVFSVKTAYNLFFKGPSWPDYSFSSLWKLKIPLKLQIFAWLTAQGKILSN  238

Query  1299  VERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAI--ETYGGKTLKNHLLMNAW  1472
              +R RR LI +++C  C    E+ +H+  DC  AR  W  +   ++ G   +   L   W
Sbjct  239   EQRVRRQLIFNASCGVCEWPIETTLHILRDCYKARGIWNTVLMPSHHGHFFQMDFL--PW  296

Query  1473  IESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASE---  1643
              ++N+ S+ V     PWS  F++T W +WK RN+ +F  + + P    +L      E   
Sbjct  297   FQTNLLSQAVWCSNIPWSPVFIFTCWYVWKWRNHQVFQGDEDVPFDPKQLIVRAVHEWFK  356

Query  1644  ARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIG  1823
             A   + +H    Q     + W P   G  K+N+DG+ ++ +G    GG++R+  G W+ G
Sbjct  357   ASHVLSKHNHKVQVD---LKWEPLISGQFKLNVDGSKRNGSGHVGVGGVIRNSSGDWISG  413

Query  1824  FATKIG  1841
             FA  +G
Sbjct  414   FAVNLG  419



>emb|CAB78008.1| putative protein [Arabidopsis thaliana]
 emb|CAB82119.1| putative protein [Arabidopsis thaliana]
Length=947

 Score =   103 bits (258),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 106/248 (43%), Gaps = 27/248 (11%)
 Frame = +3

Query  1128  DTLTWQDSTSGTFFVASAYSLISCTVDEN------WPWLWKLNCVEKVKTLLWLLLKGRM  1289
             D L+W  S  G F V SAY L++   D        +  LW++  +E+VKT LW       
Sbjct  658   DRLSWGYSADGVFTVKSAYRLLTEDHDPRPNMAAFFDRLWRVVALERVKTFLW-------  710

Query  1290  FTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEA-IETYGGKTLKNHLLMN  1466
                      H+ D S C  C+  +E+++H+  DC      W   ++        N  L  
Sbjct  711   ---------HIGDTSVCQVCKGGDETILHVLKDCPSIAGIWRRLVQVQRSYDFFNGSLF-  760

Query  1467  AWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSE--TPVHVAKLACTFAS  1640
              W+  N+  K     G  W+  F   +W  WK R   +F    +    V   +      S
Sbjct  761   GWLYVNLGMK-NAETGYAWATLFAIVVWWSWKWRCGYVFGEVGKCRDRVKFFRDLAAEVS  819

Query  1641  EARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVI  1820
              A A   ++GG        V W PP   WVK+N DGA +   GLA+ GG++RD  G W  
Sbjct  820   HAHAIHSQNGGLRTRVERLVAWKPPDGEWVKLNTDGASRGNLGLATTGGVLRDGIGHWCG  879

Query  1821  GFATKIGV  1844
             GFA  IGV
Sbjct  880   GFALDIGV  887


 Score = 32.7 bits (73),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNV  1041
             +RW VG+G+ + FWSD W++ ++L     I+IP +  + +V +   +   W +
Sbjct  578   SRWVVGNGRDILFWSDNWLSHEALINRAVIEIPNSEKELRVKDLWANGLGWKL  630



>ref|XP_009123770.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=532

 Score =   105 bits (263),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 112/280 (40%), Gaps = 56/280 (20%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN----  1214
             D +  F+  E   ++ A+ V       D L W  + +G F V SAY+L+  T DEN    
Sbjct  169   DRITPFVTAERRLELMAVVVDTVTGAKDRLAWGQTPNGQFTVKSAYTLL--TRDENPRPQ  226

Query  1215  ----WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLF  1382
                 +  +W++   E+V+  LWL+    + TN ER RRHL     C  CR   E+++H+ 
Sbjct  227   MGSFFRSMWRVVAPERVRMFLWLVANQAIMTNAERHRRHLSGTDLCQVCRGGIETIIHVL  286

Query  1383  CDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWK  1562
              DC                                    +   G PW+  F  TLW  WK
Sbjct  287   RDC----------------------------------PAIKGGGVPWATIFALTLWWGWK  312

Query  1563  CRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYN-------WVTWTPPQP  1721
              R   +F +       + +    F  E    +I    T              V W PP  
Sbjct  313   WRCGNVFGDT-----RLWRDRVKFLRELAKGVITANRTENAHIKERHMVEIMVGWKPPCV  367

Query  1722  GWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
             GW+K+N DGA     G A+AGG +R+  G W  GFA  IG
Sbjct  368   GWMKLNTDGASHGNPGPAAAGGALRNGEGEWCGGFAINIG  407


 Score = 30.4 bits (67),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 13/56 (23%), Positives = 28/56 (50%), Gaps = 0/56 (0%)
 Frame = +1

Query  871   VEIRARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWN  1038
             V +   W  G+G+++ FW+D W+  + L  ++   +P+   D  V +   +   W+
Sbjct  112   VLVGHSWITGNGRNIRFWTDSWIAGQPLMTEVIAGLPEGYEDITVRDMWGEGGGWD  167



>ref|XP_008221996.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=545

 Score =   112 bits (279),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 121/274 (44%), Gaps = 5/274 (2%)
 Frame = +3

Query  1056  LTFLREELV--NKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYS---LISCTVDENWP  1220
             L  L EE++  N I +I      S +D   W+ + +G F V S Y    L    +   W 
Sbjct  156   LIDLSEEMLQLNMILSIHADFLGSGLDKRIWKCTPNGDFSVKSVYGISFLEGNVLPWQWG  215

Query  1221  WLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFA  1400
             ++WKL    K+K  LWLL   ++ TN +R++R L   + C RC    E++ HL   C  +
Sbjct  216   FIWKLKIPPKIKAFLWLLCHKKLLTNFQRQKRGLASCAACPRCSYPVETIEHLVSGCCCS  275

Query  1401  RECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLI  1580
              + W            +    + W+  N+ SK V  D   W + F   LW IWK R  ++
Sbjct  276   MDIWSGFGLNDEWAHCHDGDFDVWLLHNLQSKRVGCDKLSWPLVFAVCLWFIWKWRCKIV  335

Query  1581  FNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKS  1760
             F      P    K+   +A +          + + C   V W    PG  K+N DG+  S
Sbjct  336   FEAGFVMPSEPHKMIQQYAMDWFIACKPMLSSPKKCVVQVHWHASLPGVFKLNTDGSRNS  395

Query  1761  CTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
              +G   AGG++R+  G W+ GFA   GV  +  A
Sbjct  396   GSGAIGAGGVIRNSAGVWITGFAVNQGVGSTLEA  429



>ref|XP_010039376.1| PREDICTED: uncharacterized protein LOC104428079 [Eucalyptus grandis]
Length=1343

 Score =   103 bits (257),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 72/289 (25%), Positives = 122/289 (42%), Gaps = 21/289 (7%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS-------CT  1202
             V  L     +++VN+I  +P+ V     D L W  + SG + V S Y++I+       C 
Sbjct  936   VPLLNQLFDQKIVNEILTLPI-VHQQKDDKLIWTGNHSGQYTVKSGYNMINDVSLPQECN  994

Query  1203  VDEN--------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDE  1358
                +        W  LW ++   K++  LW L +  + T  +  +R ++ D  C  C   
Sbjct  995   RASSSYQPPRSLWTKLWHMSIPPKLRIFLWSLCQDALPTKEKLHQRKILPDPLCPLCSKY  1054

Query  1359  EESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFV  1538
              E++ H+F  CQ  ++ W            +   M+ W+   +  K   +D        V
Sbjct  1055  PETVEHIFLHCQQVKKIWSDPRLNISHVTSSATRMDKWVAEYLLVKTQASDPE----LIV  1110

Query  1539  YTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNW-VTWTPP  1715
               LWQIWK RNN IF      P  +   A      ++ +I      S+G  +  VTW  P
Sbjct  1111  EVLWQIWKNRNNFIFRKTHGQPQALIDTALAQNRVSQRWIPTKSSKSKGNEHLPVTWKAP  1170

Query  1716  QPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             +   +K+N+D +  +     S  G++RD +G  + GFA ++       A
Sbjct  1171  KTPDLKLNVDSSWIATDSACSVAGLLRDSNGSVIDGFAEEVHAASPLQA  1219


 Score = 31.2 bits (69),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 30/57 (53%), Gaps = 8/57 (14%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKK-VSNFIKDDR-SWNVTLM  1050
             +W VGDGKS+    D W++   LG       P+N  D   V++ I  +R  WNV L+
Sbjct  889   KWTVGDGKSIHIRQDHWLSQGILG------GPENRNDPHLVADLIDQERKEWNVPLL  939



>ref|XP_004306074.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=407

 Score =   102 bits (254),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 86/169 (51%), Gaps = 3/169 (2%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDEN  1214
             V  LL  +  E+VNKI  +P+    S  DTL W  + +G FFV SAY+ +   S  ++  
Sbjct  237   VHKLLDVVPFEIVNKIVNVPIDFGVSGSDTLIWGATANGKFFVKSAYNSLFDMSAPLNPQ  296

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W ++W++    K+KT LW  L  ++ TN++R  R     + C  C+  +ES +HLF DC 
Sbjct  297   WNYIWRMKIPPKLKTFLWTFLHKKLLTNMQRVTRGFTASALCPICQSADESFLHLFRDCP  356

Query  1395  FARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVY  1541
              +   W A    G  +    L  N WI++ +H    T++   W   FV+
Sbjct  357   RSVLIWNAFVKPGSISQSFSLDWNGWIQAQLHCHSFTSNNIRWCDLFVF  405


 Score = 32.3 bits (72),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  886  RWRVGDGKSLDFWSDWW  936
            +WR+GDGKS+ FW D+W
Sbjct  188  KWRLGDGKSIKFWHDYW  204



>ref|XP_008345768.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=591

 Score =   103 bits (256),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 76/286 (27%), Positives = 124/286 (43%), Gaps = 26/286 (9%)
 Frame = +3

Query  1071  EELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP-WLWKLNCV  1244
              +L N+I  +P+P+D+   D L W+ STSG F  +  Y ++      ++W   +W+    
Sbjct  194   PDLTNEILEMPLPIDEDK-DVLIWEVSTSGVFSFSDGYEIVRHRFPVKSWASTIWRPFIP  252

Query  1245  EKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIE  1424
              +   L+W +L  ++ T  + +RR +     C  C    ES+ HLF  C+FA+  W  + 
Sbjct  253   PRYSILVWKILFNKLPTEDQLQRRGIPLAPICQLCHKNSESIBHLFSSCEFAQCAWRWLA  312

Query  1425  T-YGGKTLKNHLLMNAWIE--SNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS  1595
             T +G        L + W+   S   S  + N    W  +  + L  IWK RN + F    
Sbjct  313   TQFGTXIPPTGSLSDLWLVFLSXXFSPHLRNV---WJASGFFLLMAIWKMRNKVKFEGKP  369

Query  1596  ETPVHVAKLACTFASEA-------------RAFIIRHGGTSQGCYNW----VTWTPPQPG  1724
              +   + +    +  +              R  ++  G +   C       V W PP   
Sbjct  370   PSFSRLCRSTSAWIRQVGALTPGHVRGILDRQLLVSLGISPNSCKAPSIVPVLWLPPXFS  429

Query  1725  WVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             WVK+N DG  K   G A+ GG+ RD  G ++ GF+  +G   SF A
Sbjct  430   WVKVNTDGLAKGNPGPAACGGVFRDSAGYFLGGFSLSLGHRTSFYA  475


 Score = 31.6 bits (70),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 0/46 (0%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
              RW +G+G +   W D W++   + +    +I  +L   KVSN I+
Sbjct  134   CRWVIGNGSTTSLWVDKWLDKPIVDVVGATEIAPSLSRTKVSNIIR  179



>ref|XP_010689711.1| PREDICTED: uncharacterized protein LOC104903385 [Beta vulgaris 
subsp. vulgaris]
Length=1533

 Score =   102 bits (254),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 80/269 (30%), Positives = 115/269 (43%), Gaps = 22/269 (8%)
 Frame = +3

Query  1032  LECYVDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDE  1211
             +E   D + T   E     I AIP+       D LTW  S  G + V +AY L      E
Sbjct  1150  MEWRTDMIETHFDERDQRCILAIPLS-SRRISDKLTWAYSKDGLYSVKTAYMLGKGGNLE  1208

Query  1212  N----WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHL  1379
             +    W  +W L    KV+  LW +    +      +RRHL DD +C RC   EES  H+
Sbjct  1209  DFHRVWGLIWSLEVSPKVRHFLWRVCTNSLPVRAALKRRHLTDDDSCPRCACGEESAQHV  1268

Query  1380  FCDCQFARECWEAIETYGGKTLKNH----LLMNAWIESNVHSKIVTNDGAPWSITFVYTL  1547
             F DC  A + W+ +   G K +  H     +++  I  N   K +   G+       Y +
Sbjct  1269  FFDCTHASQLWDLV---GCKEMTRHDVGEEMVDLIIRWNDLDKKLVQKGS-------YLM  1318

Query  1548  WQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIR--HGGTSQGCYNWVTWTPPQP  1721
             W +W  +N ++F N S  PV VA+       E    I R   GG  +   +   WT P  
Sbjct  1319  WNLWTEKNKIVFENCSHPPVVVAQRVGRQVEEFNEHITRIYGGGQQRVMASSSRWTTPPD  1378

Query  1722  GWVKINIDGAMKSCTGLASAGGIVRDDHG  1808
             G+VK+N D ++    G    G + RD  G
Sbjct  1379  GFVKLNSDASIGD-DGWIGLGVVARDSQG  1406


 Score = 32.0 bits (71),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVND  945
             WRVGDGK +D WS+ WV D
Sbjct  1106  WRVGDGKLIDLWSEPWVGD  1124



>emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1378

 Score =   112 bits (280),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 118/268 (44%), Gaps = 18/268 (7%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYS------LISCTV  1205
             VD    +L E  +  I A  +  D+  +D + W  S SG F + SA +      L +   
Sbjct  981   VDVFANYLPEATLKLIAAHELIDDEEAIDDIYWNGSPSGGFTIGSAMNITRNAELANMDA  1040

Query  1206  DENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFC  1385
                W  +WK+   ++V+  +WL ++ R+ TN  R  R L DD  C  C + EE+  H+  
Sbjct  1041  HPKWSAVWKIPTPQRVRFFIWLAIQDRLMTNSNRFLRRLTDDPRCLVCGEVEENTDHILR  1100

Query  1386  DCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
              C  AR  W  +   G    +  + + +WI  N+ +  +   G+ W   F  + W +W+ 
Sbjct  1101  RCPVARILWRKLGMLGEHN-REEINLGSWITKNLSADTMM--GSEWLRVFAVSCWWLWRW  1157

Query  1566  RNNLIFNNNSETPVHVAKLACTFASEARAFIIR-------HGGTSQGCYNWVTWTPPQPG  1724
             RN+  FN N   P+           E +  + R       H G  +     V W  P+ G
Sbjct  1158  RNDRCFNRNPSIPIDQVSFIFARVKEIKEAMDRNDTNKSQHSGRRKEIL--VRWQCPKEG  1215

Query  1725  WVKINIDGAMKSCTGLASAGGIVRDDHG  1808
             WVK+N DGA K   G A  GG++R   G
Sbjct  1216  WVKLNTDGASKGNPGPAGGGGLIRGPRG  1243



>ref|XP_007010351.1| Polynucleotidyl transferase, putative [Theobroma cacao]
 gb|EOY19161.1| Polynucleotidyl transferase, putative [Theobroma cacao]
Length=419

 Score =   108 bits (271),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 108/211 (51%), Gaps = 2/211 (1%)
 Frame = +3

Query  1230  KLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAREC  1409
             KL    KV+ L+W +L   + T+    +RHL   +   RC    E+LVH   DC  ++  
Sbjct  97    KLTSSSKVRLLIWRILHEALPTSEWLLKRHLRSTAFYFRCEAPVETLVHALRDCGKSKLL  156

Query  1410  WEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNN  1589
             W  +      +      +  W+  N+  K    +G PW+I F++ +W +W  RN  +F+ 
Sbjct  157   WLQLRPNIHSSDFFSEELKPWVLKNLACKDPV-EGIPWAIIFIHAIWLLWFWRNMNLFDK  215

Query  1590  NSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTG  1769
             +   P +  K   T A EA   + +     +     + W  P+ G+VK+N+DG+ K   G
Sbjct  216   SFIWPANATKQVWTKAKEAWDTLGKENHRLKQEV-LIAWEKPKNGYVKLNVDGSAKGQPG  274

Query  1770  LASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             LA++GG++RD++G W+ GF  KIG+T S +A
Sbjct  275   LAASGGVIRDEYGNWIAGFCQKIGITFSLTA  305



>ref|XP_008377870.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=591

 Score =   102 bits (254),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 127/299 (42%), Gaps = 34/299 (11%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP  1220
             + ++ +    +L  +I  +P+P+D+   D L W+ STSG F  +  Y ++      ++W 
Sbjct  185   IPSIFSSTFPDLTKEILEMPLPIDEDK-DVLIWEASTSGGFSFSDGYEIVRHRFPVKSWA  243

Query  1221  -WLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
               +W+     +   L+W +L  ++ T  + +RR +     C  C    ES+ HLF  C F
Sbjct  244   SIIWRPFIPPRYSILVWXILFNKLPTEDQLQRRGIPLAPICQLCHKNSESIDHLFSSCDF  303

Query  1398  ARECWEAIETYGGKTLKNH-LLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
             A+  W  + T  G  ++    L + W++  +  +   +    W  +  + L  IWK RN 
Sbjct  304   AQCAWRWLATQFGTIIQPMGSLSDLWLD-FLSKRFSPHLRNVWLASGFFLLMAIWKMRNK  362

Query  1575  LIFNNNSE-------------------TPVHVAKLACTFASEARAFIIRHGGTSQGCYN-  1694
             + F                        TP HV        +  R  ++  G +   C   
Sbjct  363   VKFEGKPPSFSRLCRSTSXWIRQVGALTPGHVR------GTLDRQLLVSLGISPNPCKAP  416

Query  1695  ---WVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
                 V W PP   WVK+N DG  K   G A+ GG+ RD  G ++ GF+  +G   SF A
Sbjct  417   SIVPVLWHPPPSSWVKVNTDGLAKGNPGPAACGGVFRDSAGYFLGGFSLSLGHRTSFYA  475


 Score = 31.6 bits (70),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 0/46 (0%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
              RW +G+G +   W D W++   + +    +I  +L   KVSN I+
Sbjct  134   CRWVIGNGSTTSLWVDKWLDKPIVDVVGATEIAPSLSRTKVSNIIR  179



>ref|XP_009107495.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=305

 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 98/218 (45%), Gaps = 24/218 (11%)
 Frame = +3

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             +W+L  +E+++  LWL+ +  + TN ER RRH+   + C  CR   ES++H+  DC   +
Sbjct  8     IWRLKVLERIRVFLWLVSQQAIMTNEERFRRHIGVSNVCQVCRGGVESIIHVLRDCPAMQ  67

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWK-------  1562
               W+ I     +       +  W   N+ S  V  +   W + F   +W  WK       
Sbjct  68    GIWDRIIPRIKRQRFFRQSLFEWTYDNLSSSEVKTETGLWVVLFAVAVWWAWKWRCGNVF  127

Query  1563  -----CRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGW  1727
                  CR+ + F       +++       A +    I R          W+ W  P  GW
Sbjct  128   GVKRLCRDRVQFVKEQAKEINMCS-----AKKEEVRITR-------VERWIKWEKPLTGW  175

Query  1728  VKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
               +N DGA +   GLA+AGG++RD++G W+ GF   IG
Sbjct  176   FMVNTDGASRGNPGLATAGGVLRDENGSWLCGFGLNIG  213



>gb|KHN33900.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=385

 Score =   107 bits (268),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 120/262 (46%), Gaps = 19/262 (7%)
 Frame = +3

Query  1041  YVDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI----SCTVD  1208
             + + L T L  E   +I++    ++D+  D + W  S    F   +A+  +    S  + 
Sbjct  135   HFEKLSTPLPMETKKQIQS--YILNDNMEDVIVWGPSGDKIFTATTAFKWLIAVNSLPIS  192

Query  1209  E--NWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLF  1382
             +  NW W+WKL   E +K   WL   G + TN  R  RHL   S+C RC   +E ++HL 
Sbjct  193   QFGNWSWIWKLQIPENIKHFFWLTFHGSLPTNEFRVFRHLSIVSSCNRCMHGQEIILHLL  252

Query  1383  CDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWK  1562
              DC ++R+ W+ ++            M+ WI +N++S           I F  T W IWK
Sbjct  253   RDCHYSRQVWQFLQLDHDSNFYVANYMD-WIVNNINSVR--------GILFAVTCWTIWK  303

Query  1563  CRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINI  1742
              RN+LIF N   T   +        ++    + +      G    V+W PP   +VK+N 
Sbjct  304   SRNSLIFPNKRWTTWQIVNQVNILFNDVINTLQQPTQPRIGRN--VSWDPPTFPFVKLNT  361

Query  1743  DGAMKSCTGLASAGGIVRDDHG  1808
             DG+  S  G +  GGI+RD  G
Sbjct  362   DGSSISNPGDSGYGGIIRDHVG  383



>ref|XP_008357937.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1048

 Score =   100 bits (250),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/285 (26%), Positives = 121/285 (42%), Gaps = 26/285 (9%)
 Frame = +3

Query  1074  ELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP-WLWKLNCVE  1247
             +L  +I  +P+P+D+   D L W+ STSG F  +  Y ++      ++W   +W+     
Sbjct  652   DLTKEILEMPLPIDEDK-DVLIWEVSTSGVFSFSDGYEIVRHXFPVKSWASIIWRPFIPP  710

Query  1248  KVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIET  1427
             +   L+W +L  ++ T  + +RR +     C  C    ES+ HLF  C+FA+  W  + T
Sbjct  711   RYSILVWKILFNKLPTEDQLQRRGIPLAPICQLCHKNSESIDHLFSSCEFAQCAWRWLAT  770

Query  1428  -YGGKTLKNHLLMNAWIE--SNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSE  1598
              +G          + W+   S   S  + N    W  +  + L  IWK RN   F     
Sbjct  771   QFGTXIPPTGSJSDLWLVFLSKXFSPHLXNV---WIASGFFLLMAIWKMRNKXKFEGKPP  827

Query  1599  TPVHVAKLACTFASEA-------------RAFIIRHGGTSQGCYNW----VTWTPPQPGW  1727
             +   + +    +  +              R  ++  G +   C       V W PP   W
Sbjct  828   SXSRLCRSTSAWIRQVGALTPGHVRGILDRQLLVSLGISPNSCKAPSIVPVXWHPPLFSW  887

Query  1728  VKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             VK+N DG  K   G A+ GG+ RD  G ++ GF+  +G   SF A
Sbjct  888   VKVNTDGLAKGNPGPAACGGVFRDSAGYFLGGFSLSLGHRTSFYA  932


 Score = 31.6 bits (70),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 0/46 (0%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
              RW +G+G +   W D W++   + +    +I  +L   KVSN I+
Sbjct  591   CRWVIGNGSTTSLWVDKWLDKPIVDVVGATEIAPSLSXTKVSNIIR  636



>gb|ABD33209.1| Ribonuclease H [Medicago truncatula]
Length=302

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 122/273 (45%), Gaps = 42/273 (15%)
 Frame = +3

Query  1053  LLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDENWPW  1223
             L   L E +  ++ A+P P++    DT+ W+ +++  F V SAY+L+     TVD +W  
Sbjct  21    LFQNLPENIATRVIALPAPIEVDGPDTIGWRGTSTHQFIVKSAYNLLVRDQSTVDGDWKM  80

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             LW+     +++T +WL+  GR+ TN  R R      +T   C + +E+++H+  DC+ A 
Sbjct  81    LWEWRGPHRIQTFMWLVAHGRILTNYRRSRWGTGVSATWPCCGNADETVLHVLRDCRPAS  140

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIF  1583
             + +        K     L +  +   N  + ++ N        F+  + ++       + 
Sbjct  141   QGYIGFSKTLAKDQLEFLSLEGFQIPNNPTYVIQN--------FIRAIEEV-------VQ  185

Query  1584  NNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSC  1763
             ++  + P H   +                        ++ W  P  GWVK+N DGA K  
Sbjct  186   DHLQKNPHHKEIV------------------------YIDWKRPLDGWVKLNCDGACKGN  221

Query  1764  TGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
               LA  GG++R   G W+ GF+ KIG  D+  A
Sbjct  222   GELAGCGGLLRQSDGTWIKGFSRKIGACDALHA  254



>ref|XP_008223806.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=296

 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 98/210 (47%), Gaps = 3/210 (1%)
 Frame = +3

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W  +WKL    K+   LWL+ +G++ +N +  R   I D  C  C    ES +H+  DC 
Sbjct  54    WKVIWKLKLPPKILFFLWLVYEGKIISNEQYTRMLFIGDPACCICDWHTESTLHILRDCT  113

Query  1395  FARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
              A+  W                ++ W+ SN  SK +     PW   F    W +WK RN+
Sbjct  114   RAKRVWNLFLNTNQNVPFFQAELHLWLLSNFCSKNMFLQ-IPWKTLFGVICWHLWKWRND  172

Query  1575  LIFNNNSETPVHVAKLACTFASE-ARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGA  1751
              IF N  + P +  +L  +   E  +A      G  +   + + WTP + G +K+N+DG+
Sbjct  173   FIFKNKDDLPFNPRELILSATKEWIKASTNNQLGGDKIQVS-LAWTPLENGVLKLNVDGS  231

Query  1752  MKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
             +   +G   AGG++RD  G W  GFA  +G
Sbjct  232   LMRSSGSIGAGGVIRDHLGNWFGGFAVNLG  261



>gb|ABK28199.1| unknown [Arabidopsis thaliana]
Length=315

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 92/189 (49%), Gaps = 4/189 (2%)
 Frame = +3

Query  1287  MFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMN  1466
             + TN ERRRRHL D   C  C+  E++++H+  DC      W  +   G +       + 
Sbjct  5     LMTNAERRRRHLSDSDICQICKGAEKTIIHILRDCXAMEGIWIRLVPAGKRREFFTQSLL  64

Query  1467  AWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEA  1646
              W+ +N+  +  T + + WS  F  ++W  WK R   IF    +    V  L       +
Sbjct  65    EWLFANLGDRRKTCE-STWSTLFALSIWWAWKWRCGNIFGVQDKCRDRVRFLKDLARETS  123

Query  1647  RAFIIRH---GGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWV  1817
              A +I     GG  +     + W+ P+ GW K+N DGA +   GLASAGG++RD+ G W 
Sbjct  124   MAHVIVRTLSGGHGERVERLIAWSKPEEGWWKLNTDGASRGNPGLASAGGVLRDEEGAWR  183

Query  1818  IGFATKIGV  1844
              GFA  IGV
Sbjct  184   GGFALNIGV  192



>ref|XP_006480844.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=768

 Score = 93.2 bits (230),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 111/277 (40%), Gaps = 46/277 (17%)
 Frame = +3

Query  1062  FLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTV----DENWPWLW  1229
              L  + V  I +I  P   + VD + W  S  G F V SAY L+  +     D  W   W
Sbjct  412   ILPHQAVMIIASIHPPSACNGVDQVYWAASPQGDFTVKSAYDLLDQSRGQERDSYWKIAW  471

Query  1230  KLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAREC  1409
                  + +K  +WL+L  R+ T  E   R L  + +C RC    E+ +H+  DC +++  
Sbjct  472   SWKGPQSIKIFIWLVLHNRLKTRAELATRRLNIEPSCERCGAGLENTIHVLHDCPYSK--  529

Query  1410  WEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNN  1589
               A  + G K                           W + F   +W++W  RN  IF  
Sbjct  530   --ASTSLGTKL--------------------------WRVIFGVAIWRLWFWRNRFIFTK  561

Query  1590  NSETPVHVAKLACTFASEARAFIIRHGGTSQGCYN------WVTWTPPQPGWVKINIDGA  1751
             +     H    A     + RA  I+   +S    +      W+ W  P   WVK+N DGA
Sbjct  562   D-----HWESSAIALDIKVRAAEIQQCNSSLTATDKSRVEKWIRWGAPTWPWVKLNTDGA  616

Query  1752  MKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
              K  +  A AG ++RD  G W IG+   +G     SA
Sbjct  617   KKP-SDHAGAGELIRDYKGVWQIGYCANLGFCSVTSA  652


 Score = 38.5 bits (88),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (54%), Gaps = 1/52 (2%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEID-IPKNLYDKKVSNFIKDDRSWN  1038
             RW VG+G  + FW D W        D+ I  IP +L D  V++F+  D SWN
Sbjct  354   RWIVGNGWKVKFWWDCWATTPLTLADLAIHPIPPDLSDLYVADFVSTDGSWN  405



>gb|AAD21515.1| putative reverse transcriptase [Arabidopsis thaliana]
 gb|AAM15081.1| putative reverse transcriptase [Arabidopsis thaliana]
Length=314

 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 92/189 (49%), Gaps = 4/189 (2%)
 Frame = +3

Query  1287  MFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMN  1466
             + TN ERRRRHL D   C  C+  E++++H+  DC      W  +   G +       + 
Sbjct  5     LMTNAERRRRHLSDSDICQICKGAEKTIIHILRDCPAMEGIWIRLVPAGKRREFFTQSLL  64

Query  1467  AWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEA  1646
              W+ +N+  +  T + + WS  F  ++W  WK R   IF    +    V  L       +
Sbjct  65    EWLFANLGDRRKTCE-STWSTLFALSIWWAWKWRCGNIFGVQDKCRDRVRFLKDLARETS  123

Query  1647  RAFIIRH---GGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWV  1817
              A +I     GG  +     + W+ P+ GW K+N DGA +   GLASAGG++RD+ G W 
Sbjct  124   MAHVIVRTLSGGHGERVERLIAWSKPEEGWWKLNTDGASRGNPGLASAGGVLRDEEGAWR  183

Query  1818  IGFATKIGV  1844
              GFA  IGV
Sbjct  184   GGFALNIGV  192



>gb|ABE65462.1| hypothetical protein At2g27870 [Arabidopsis thaliana]
Length=314

 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 92/189 (49%), Gaps = 4/189 (2%)
 Frame = +3

Query  1287  MFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMN  1466
             + TN ERRRRHL D   C  C+  E++++H+  DC      W  +   G +       + 
Sbjct  5     LMTNAERRRRHLSDSDICQICKGAEKTIIHILRDCPAMEGIWIRLVPAGKRREFFTQSLL  64

Query  1467  AWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEA  1646
              W+ +N+  +  T + + WS  F  ++W  WK R   IF    +    V  L       +
Sbjct  65    EWLFANLGDRRKTCE-STWSTLFALSIWWAWKWRCGNIFGVQDKCRDRVRFLKDLARETS  123

Query  1647  RAFIIRH---GGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWV  1817
              A +I     GG  +     + W+ P+ GW K+N DGA +   GLASAGG++RD+ G W 
Sbjct  124   MAHVIVRTLSGGHGERVERLIAWSKPEEGWWKLNTDGASRGNPGLASAGGVLRDEEGAWR  183

Query  1818  IGFATKIGV  1844
              GFA  IGV
Sbjct  184   GGFALNIGV  192



>ref|XP_008384440.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=577

 Score =   100 bits (248),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 76/295 (26%), Positives = 127/295 (43%), Gaps = 26/295 (9%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP  1220
             + ++ +    +L  +I  +P+P+D+   D L W+ STSG F  +  Y ++      ++W 
Sbjct  171   IPSIFSSTFPDLTKEILXMPLPIDEDK-DVLIWEVSTSGVFSFSDGYEIVRHRFPVKSWA  229

Query  1221  -WLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
               +W+     +   L+W +L  ++ T  + +RR +     C  C    ES+ HLF  C F
Sbjct  230   SIIWRPFIPPRYSILVWKILFNKLPTEDQLQRRGIPLAPICQLCHKNSESIDHLFSSCXF  289

Query  1398  ARECWEAIETYGGKTLK-NHLLMNAWIE--SNVHSKIVTNDGAPWSITFVYTLWQIWKCR  1568
             A+     + T  G  +     L + W++  S   S  + N    W  +  + L  IWK R
Sbjct  290   AQCAXRWLATQFGTIIPPTGSLSDLWLDFLSKRFSPHLRNX---WLASGFFLLMAIWKMR  346

Query  1569  NNLIFNNNSETPVHVAKLACTFASEA-------------RAFIIRHGGTSQGCYNW----  1697
             N + F     +   + +    +  +              R  ++  G +   C       
Sbjct  347   NKVKFEGKPPSFSRLCRSTSAWIRQVGALTPGHVRGILDRQLLVSLGISPNSCKAPSIVP  406

Query  1698  VTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             V W PP   WVK+N DG  K   GLA+ GGI RD  G ++ GF+  +G   SF A
Sbjct  407   VLWHPPPFSWVKVNTDGLAKGNPGLAACGGIFRDSAGYFLGGFSLSLGHRTSFYA  461


 Score = 31.6 bits (70),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 0/46 (0%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
              RW +G+G +   W D W++   + +    +I  +L   KVSN I+
Sbjct  120   CRWVIGNGSTTSLWVDKWLDKPIVDVXGATEIAXSLSRTKVSNIIR  165



>ref|XP_008225764.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=346

 Score = 99.4 bits (246),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 84/163 (52%), Gaps = 4/163 (2%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDEN  1214
             +D L   L E+LV ++ ++PV    S  DT  W+ ST+G F V SAYSL      T D  
Sbjct  51    IDKLRGVLCEDLVQQVISVPVGFLGSLPDTQIWKGSTNGDFSVKSAYSLFFGGCSTPDSC  110

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W  LW LN   K++  +WL  +G++ +N +R RR L  D +C  C    E+++H+  DC+
Sbjct  111   WKSLWSLNVPPKLQYFMWLASQGKILSNDQRVRRQLASDPSCGFCSWPTETVLHILRDCE  170

Query  1395  FARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPW  1523
              AR  W AI          HL    W++ N+ S+   N   PW
Sbjct  171   RARSTWNAILPACAHRF-FHLDAQPWMKVNMLSREKWNGDVPW  212


 Score = 32.0 bits (71),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 26/46 (57%), Gaps = 3/46 (7%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSL-GLDMEIDIPKNLYDKKVSNFIKD  1023
             WR+G G S+ FW D WV D  L  L   + IP + Y   VS+F K+
Sbjct  3     WRIGRGDSVKFWEDNWVTDAPLMQLAGVLTIPDSNY--PVSSFSKN  46



>ref|XP_008366684.1| PREDICTED: uncharacterized protein LOC103430323 [Malus domestica]
Length=1380

 Score = 99.8 bits (247),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 113/271 (42%), Gaps = 34/271 (13%)
 Frame = +3

Query  1128  DTLTWQDSTSGTFFVASAYSLISCT-VDENWP-WLWKLNCVEKVKTLLWLLLKGRMFTNV  1301
             D L W+ S +G F  +S Y LI     D  W   +W+     ++  L W L   ++ T  
Sbjct  1004  DKLIWEPSPTGKFSFSSGYHLIRXRHSDCAWAKVIWQHFIPPRLSILAWRLFHDKLPTED  1063

Query  1302  ERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIES  1481
               +RR +   S C  C + EES  HLF  C+ +R+ W  +    G +L     + A+ + 
Sbjct  1064  ALQRRGISLASICCLCHNSEESTAHLFFGCRISRQLWRWLXCQFGTSLPLPDSLVAFWDV  1123

Query  1482  NVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFII  1661
              V           W    + T+  IWK RN  IF      P++  +L  +  S      I
Sbjct  1124  YVRKPFSKQLHNLWIFAGLXTISAIWKARNKFIFEGR---PIYFHRLCMSINSA-----I  1175

Query  1662  RHGGTSQGCYNW------------------------VTWTPPQPGWVKINIDGAMKSCTG  1769
              HGG     Y+                         V W+PP   WVK+N DG  K   G
Sbjct  1176  VHGGKFIPGYSQGFDTRIIXSLGIQPIPRKAPTILPVLWSPPWFPWVKLNTDGLSKGNPG  1235

Query  1770  LASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
              A+ GG+ R+ HG ++ GF  +IG  +SF A
Sbjct  1236  PAACGGVFRNCHGXFLGGFCQRIGHCNSFFA  1266


 Score = 31.6 bits (70),  Expect(2) = 5e-21, Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 33/54 (61%), Gaps = 4/54 (7%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDM-EIDIPKNLYDKKVSNFIKDDRSWNV  1041
             +RW +GDG+ + FW D W+++  +   +  +  PK L   +VS+ I + +SW++
Sbjct  927   SRWIIGDGRXVSFWFDKWLDEPIISXSLFSVISPKVL--PRVSDVI-EAQSWSL  977



>ref|XP_007206968.1| hypothetical protein PRUPE_ppb019197mg [Prunus persica]
 gb|EMJ08167.1| hypothetical protein PRUPE_ppb019197mg [Prunus persica]
Length=363

 Score =   105 bits (263),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 84/274 (31%), Positives = 122/274 (45%), Gaps = 32/274 (12%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENWPW  1223
             VD L  FL E+ V KI ++ V  D    D   W+ + +G+F V SAY+L+    D   PW
Sbjct  21    VDKLRNFLAEDTVQKITSLAVDFDGRLEDIRIWKYTDNGSFTVKSAYNLLFKRPDWPDPW  80

Query  1224  ---LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
                 W++    K++   WL+ +G++ +N +R   HL  DS+C +C               
Sbjct  81    WKVPWQMRIHPKLQIFCWLVYQGKILSNEQRVGTHLTFDSSC-QC---------------  124

Query  1395  FARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
                 C   IE  G           AW+ SN+ SK V  D  PW          IWK RN+
Sbjct  125   ----CGWPIEPRGDAARFFQANFKAWLVSNLCSKSVY-DLQPWLF--------IWKWRNS  171

Query  1575  LIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAM  1754
              +FN  +E P H  ++  +  SE                  + W PP  G  K+N+DG+ 
Sbjct  172   RVFNVEAELPFHPKRIIASAVSEWLQTCPNSISKRTQVQIMLAWEPPMNGVFKLNVDGSR  231

Query  1755  KSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSF  1856
             K   G   AGGI+RD  G W+ GFA  +G+  + 
Sbjct  232   KGGIGCIGAGGIIRDSFGDWMGGFAVNLGIGQTL  265



>ref|XP_009147282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=308

 Score =   105 bits (261),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 90/187 (48%), Gaps = 3/187 (2%)
 Frame = +3

Query  1290  FTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNA  1469
              TN+ER+RRHL D+  C  C++ +E+++H+  DC  A   W  I     +    +L +  
Sbjct  1     MTNMERKRRHLCDNGVCQLCKNGDETILHVLRDCSAAAGLWVKIVPLSKRQRFLNLPLLE  60

Query  1470  WIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSE--TPVHVAKLACTFASE  1643
             W+  N+      N+  PW+I F  T+W  WK R   +F    +    V   K        
Sbjct  61    WLYENLIKDASKNED-PWAILFALTVWWCWKWRCGYVFGETGKCRDRVKFVKDKAHEVVL  119

Query  1644  ARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIG  1823
             A   +  H          ++W  P   W K+N DGA +   GLA+AGG++RD++G W  G
Sbjct  120   ANKKLKHHLAVGVRVEKRISWIRPANSWCKMNTDGASRGNPGLATAGGVLRDEYGEWKGG  179

Query  1824  FATKIGV  1844
             FA  IG+
Sbjct  180   FAVNIGI  186



>gb|AAC26674.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=970

 Score =   108 bits (271),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 119/281 (42%), Gaps = 35/281 (12%)
 Frame = +3

Query  1065  LREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN------WPWL  1226
             L +E ++ +    +  D    D L+W+ + +G F V SAY L+    +E          +
Sbjct  588   LLQEQLSAVAKESISADALLSDELSWKGTQNGDFTVRSAYELLKPEAEERPLIGSFLKQI  647

Query  1227  WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARE  1406
             WKL   E+V+  +WL+    + TNVER RRHL D +TC+ C   +ES++H+  DC     
Sbjct  648   WKLVAPERVRVFIWLVSHMVIMTNVERVRRHLSDIATCSVCNGADESILHVLRDCPAMTP  707

Query  1407  CWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWK--------  1562
              W+ +     +          W+ +N+           W   F   +W  WK        
Sbjct  708   IWQRL--LPQRRQNEFFSQFEWLFTNLDPA-----KGDWPTLFSMGIWWAWKWRCGDVFG  760

Query  1563  ----CRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWV  1730
                 CR+ L F  +    V  A +        RA + R           + W  P   WV
Sbjct  761   ERKLCRDRLKFIKDIAEEVRKAHVGTLNNHVKRARVERM----------IRWKAPSDRWV  810

Query  1731  KINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDS  1853
             K+  DGA +   GLA+A G + +  G W+ GFA  IG  D+
Sbjct  811   KLTTDGASRGHQGLAAASGAILNLQGEWLGGFALNIGSCDA  851



>ref|XP_008385092.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=715

 Score = 99.8 bits (247),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 122/290 (42%), Gaps = 38/290 (13%)
 Frame = +3

Query  1077  LVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP-WLWKLNCVEK  1250
             L  +I  +P+P+D+   D L W+ STSG F  +  Y ++      ++W   +W+     +
Sbjct  320   LTXEILEMPLPIDEDK-DVLIWEVSTSGVFSFSDGYEIVRHRFPVKSWASXIWRPFIPPR  378

Query  1251  VKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETY  1430
                L+W +L  ++ T  + +RR +     C  C    ES+ HLF  C+FA+  W  + T 
Sbjct  379   YSILVWKILFNKLPTEDQLQRRGIPLAPICQLCHKNSESIDHLFSXCEFAQCAWRWLATQ  438

Query  1431  GGKTLK-NHLLMNAWIE--SNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSE-  1598
              G  +     L + W+   S   S  + N    W  +  + L  IWK RN + F      
Sbjct  439   FGTIIPPTGSLSDLWLXFLSKXFSPHLRNV---WJASGFFLLMAIWKMRNKVKFEGKPPS  495

Query  1599  ------------------TPVHVAKLACTFASEARAFIIRHGGTSQGCYNW----VTWTP  1712
                               TP HV  +        R  ++  G +   C       V W P
Sbjct  496   FSRLCRSTXAWIRQVGALTPGHVRGIL------DRQLLVSLGISPNSCKAPSIVPVLWHP  549

Query  1713  PQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             P   WVK+N DG  K   G A+ GG+ RD  G ++ GF+  +G   SF A
Sbjct  550   PXFSWVKVNTDGLAKGNXGPAACGGVFRDSAGYFLGGFSLSLGHRTSFYA  599


 Score = 30.4 bits (67),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 0/46 (0%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
              RW +G+G +   W D W++     +    +I  +L   KVSN I+
Sbjct  258   CRWVIGNGSTTSLWVDKWLDKPIXDVVGATEIAXSLSRTKVSNIIR  303



>ref|XP_008381797.1| PREDICTED: uncharacterized protein LOC103444619 [Malus domestica]
Length=1183

 Score = 98.2 bits (243),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 122/295 (41%), Gaps = 26/295 (9%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP  1220
             + ++ +    +L  +I  +P+P+D+   D L W+ STSG F  +  Y ++      ++W 
Sbjct  845   IPSIFSXXFPDLTKEILXMPLPIDEDK-DVLIWEVSTSGVFSFSDGYEIVRHXFPVKSWA  903

Query  1221  WL-WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
              + W+     +    +W +L  ++ T  + +RR +     C  C    ES+ HLF  C F
Sbjct  904   SIXWRPFIPPRYSIXVWKILFNKLPTXDQLQRRGIPLAPICQLCHKNSESIDHLFSSCXF  963

Query  1398  ARECWEAIET-YGGKTLKNHLLMNAWIE--SNVHSKIVTNDGAPWSITFVYTLWQIWKCR  1568
             A+  W  + T +G          + W+   S   S  + N    W  +  + L  IWK R
Sbjct  964   AQCAWRWLATQFGTXIPPTGSJSDLWLXFLSKXFSPHLXNV---WJASGFFLLMAIWKMR  1020

Query  1569  NNLIFNNNS--------ETPVHVAKLACTFASEARAFIIRHGGTSQGCYN---------W  1697
             N + F             T   + ++        R  + R    S G             
Sbjct  1021  NKVKFEGKPPSXSRLCRSTSAWIRQVGXLXPGHVRGILDRQLLVSLGISPNSXKAPSIVP  1080

Query  1698  VTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             V W PP   WVK+N DG  K   G A+ GG+ RD  G ++ GF+  +G   SF A
Sbjct  1081  VLWLPPXFSWVKVNTDGLAKGNPGPAACGGVFRDSXGYFLGGFSLSLGHRTSFYA  1135


 Score = 31.6 bits (70),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 0/46 (0%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
              RW +G+G +   W D W++   + +    +I  +L   KVSN I+
Sbjct  794   CRWVIGNGSTTSLWVDKWLDXPIVDVXGATEIAXSLSXTKVSNIIR  839



>ref|XP_007017129.1| Uncharacterized protein TCM_042328 [Theobroma cacao]
 gb|EOY34748.1| Uncharacterized protein TCM_042328 [Theobroma cacao]
Length=910

 Score = 83.2 bits (204),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/293 (26%), Positives = 122/293 (42%), Gaps = 24/293 (8%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISC--TVDENW  1217
             V+ L T L++E+V++I  IP+  D  + D   W  + +G F   SA+ LI     V+  +
Sbjct  510   VEKLKTVLQQEVVDEIAKIPI--DTMSKDEAYWTPTPNGDFSTKSAWQLIRKRKVVNPVF  567

Query  1218  PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
              ++W           LW LL   +   ++ + + L   S C RC   EES++H+  D   
Sbjct  568   NFIWHKTVPLTTSFFLWRLLHDWIPVELKMKSKGLQLASRC-RCCKSEESIMHVMWDNPV  626

Query  1398  ARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNL  1577
             A + W          + N   +N  I +  HS      G   ++  ++ LW +W  RN+ 
Sbjct  627   AMQVWNYFAKLFQICIINPCTINQIIGAWFHSGDYCKPGHIRTLVPLFILWFLWVERNDA  686

Query  1578  IFNNNSETPVHVA----KLACTFASEARAFIIRHGGTSQGCYNW--------------VT  1703
                N    P  V     KL    +   +    +  G  Q    W               +
Sbjct  687   KHRNLGMYPNRVVWRVLKLIQQLSLGQQLLKWQWKGDKQIAQEWGIILQAESLAPPKVFS  746

Query  1704  WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             W  P  G  K+N+DG+ K     A+ GGI+RD  G  V GF+  +G+ +S  A
Sbjct  747   WHKPTTGEFKLNVDGSAKHSHN-AAGGGILRDHAGVMVFGFSENLGIQNSLQA  798


 Score = 35.8 bits (81),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 27/48 (56%), Gaps = 4/48 (8%)
 Frame = +2

Query  1943  NRGDHSEETVVTLVKDCLDLSRKFRKFKISHIMREGNRCADWLANYGQ  2086
             +RG H+   ++  ++  L        F+ SHI REGN+ AD+LAN G 
Sbjct  835   HRGPHAIRYLMVSLRQLLS----HFSFRFSHIFREGNQAADFLANRGH  878


 Score = 30.8 bits (68),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 21/39 (54%), Gaps = 7/39 (18%)
 Frame = +1

Query  838  ASSSTTIRLMGVEIRARWRVGDGKSLDFWSDWWVNDKSL  954
             SS+TT      E   RWRVG G +L FW D W+ D  L
Sbjct  454  TSSATT------EQHMRWRVGQG-NLFFWHDCWMGDAPL  485



>ref|XP_010668235.1| PREDICTED: uncharacterized protein LOC104885230 [Beta vulgaris 
subsp. vulgaris]
Length=1607

 Score =   101 bits (251),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 109/273 (40%), Gaps = 11/273 (4%)
 Frame = +3

Query  1050  ALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY--SLISCTVDENWPW  1223
              L   +  +L N+I     P  +S  D L         F +  AY   +      ++  W
Sbjct  1231  PLTIHIPSDLRNRILNTSPPTPESQADLLIPNFVDHRGFMLHRAYIAQIPHSPNHDDLSW  1290

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             +WK  C  K+   +WL    R+        R LI D++C RC    E   H+  DC  + 
Sbjct  1291  IWKGKCEPKLHFFIWLTWHDRLPHRNLLASRGLIVDTSCPRCHQHIEHSAHILRDCHISE  1350

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIF  1583
               W+ +    G TL  H     WI  N+HS     D  PW+  F Y   +IWK RN  +F
Sbjct  1351  RVWDHV----GMTLGPHDDFRLWIRENLHSNGKFRD-LPWASVFPYICHEIWKDRNQCVF  1405

Query  1584  NNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSC  1763
              N   +      L        R FI+     +    + V   P +  ++ I++D +    
Sbjct  1406  KNQKASSPQAICLRAM--GRVREFILATETITGNVIHPVFAHPNE--FLMIHVDASFIDI  1461

Query  1764  TGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
                A  GG+VR   G W+ GF  KI   +SF A
Sbjct  1462  LQGAGIGGVVRKPSGQWIGGFGKKIFTNNSFVA  1494


 Score = 27.3 bits (59),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 9/23 (39%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +1

Query  871   VEIRARWRVGDGKSLDFWSDWWV  939
             ++  + W +GDGK + FW D W+
Sbjct  1174  IQDNSSWFLGDGKIISFWHDDWL  1196



>ref|XP_010674616.1| PREDICTED: uncharacterized protein LOC104890737 [Beta vulgaris 
subsp. vulgaris]
Length=1149

 Score =   100 bits (248),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 121/280 (43%), Gaps = 21/280 (8%)
 Frame = +3

Query  1062  FLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD------ENWPW  1223
              L +E+V++I AIP+   D   D L W  +T G F + +AY  ++ +        + W  
Sbjct  767   LLPQEIVDEICAIPLTKFDEVKDGLRWLFTTDGEFSIKTAYRNLNPSNSRRIQSLKKWSK  826

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             LW++    K + L W ++   + T V  ++R    D+TC  C    E+ +HLF +C  A 
Sbjct  827   LWRIEIPFKYRMLFWNVVHEILPTAVNLQKRIHAFDTTCQCCLLATETHLHLFRNCLHAN  886

Query  1404  ECWEAI--ETYGGKTLKNHLLMNA----WIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
               W+      +  + +  H   N     WI  N+      +    W   FV  LW IWK 
Sbjct  887   LLWKFFFQNCHLARAIDIHCFFNNDWEDWINFNL------DQSLEWLQMFVIALWHIWKN  940

Query  1566  RNNLIFNNN-SETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINI  1742
             RN ++F    + +          +     AF       +        W PP  G++K+N 
Sbjct  941   RNKVVFERAMARSSSQFNHFFLDYLHNKNAF-QNQDKVAPNVQQITIWKPPVHGYLKLNT  999

Query  1743  DGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             DG+ K+    AS GG++R   G W +GF+ K    +  +A
Sbjct  1000  DGSWKA-NDKASGGGVIRRTDGSWFMGFSIKFRAVNLAAA  1038


 Score = 28.5 bits (62),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query  895   VGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNVT  1044
             VG+G+ +  W   WV  + L    ++ IP+++   +V++ I  ++ WN+T
Sbjct  714   VGNGEDISLWFHHWVGKEPLYKLKDLVIPEDIAHWRVAHII-HNKEWNIT  762



>ref|XP_008375089.1| PREDICTED: uncharacterized protein LOC103438319 [Malus domestica]
Length=1384

 Score = 96.7 bits (239),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/283 (26%), Positives = 118/283 (42%), Gaps = 22/283 (8%)
 Frame = +3

Query  1074  ELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP-WLWKLNCVE  1247
             +L  +I  +P+P+D+   D L W+ STSG F  +  Y ++      ++W   +W+     
Sbjct  988   DLTKEILEMPLPIDEDK-DVLIWEVSTSGVFSFSDGYEIVRHRFPVKSWASIIWRPFIPP  1046

Query  1248  KVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIET  1427
             +   L+W +L  ++ T    +RR +     C  C    ES+ HLF  C+FA+  W  + T
Sbjct  1047  RYSILVWKILFNKLPTXDXLQRRGIPLAPICQLCHKNSESIDHLFSSCEFAQCAWRWLAT  1106

Query  1428  YGGKTLK-NHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS---  1595
               G  +     L + W+   +  +   +    W  +  + L  IWK RN + F       
Sbjct  1107  QFGTIIPPTGSLSDLWLVF-LSKRFSPHLXNVWIASGFFLLMAIWKMRNKVKFEGKPPSX  1165

Query  1596  -----ETPVHVAKLACTFASEARAFIIRHGGTSQGCYN---------WVTWTPPQPGWVK  1733
                   T   + ++        R  + R    S G               W PP   WVK
Sbjct  1166  SRLCRSTSAWIRQVGAJXPGHVRGILDRQLLXSLGISPNSCKAPSIVPXLWHPPPFSWVK  1225

Query  1734  INIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             +N DG  K   G A+ GG+ RD  G ++ GF+  +G   SF A
Sbjct  1226  VNTDGLAKGNXGPAACGGVFRDSAGYFLGGFSLSLGHRTSFYA  1268


 Score = 31.6 bits (70),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 0/45 (0%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
             RW +G+G +   W D W++   + +    +I  +L   KVSN I+
Sbjct  928   RWVIGNGSTTSLWVDKWLDKPIVDVVGATEIAPSLSCTKVSNIIR  972



>ref|XP_007226572.1| hypothetical protein PRUPE_ppa024162mg [Prunus persica]
 gb|EMJ27771.1| hypothetical protein PRUPE_ppa024162mg [Prunus persica]
Length=297

 Score =   102 bits (253),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 82/154 (53%), Gaps = 3/154 (2%)
 Frame = +3

Query  1098  IPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDENWPWLWKLNCVEKVKTLLW  1268
             + V  +    D   W+ S +G F V SAY+++   S   D +W +LWKL    K+    W
Sbjct  7     LSVGFNSGIQDAQIWKFSPNGIFSVKSAYNMLFEGSACSDVDWKFLWKLKIPPKLHIFFW  66

Query  1269  LLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLK  1448
             L+ +G++ +N +R RR +  D++C  C    ES++H+  DC  AR+ W A+         
Sbjct  67    LIFQGKILSNEQRARRQMSLDASCGSCHWPVESILHILHDCVKARKVWNALLNSSQSAGF  126

Query  1449  NHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLW  1550
               +    W++ N+ SKIV  DG PW++ FV+T W
Sbjct  127   FTMDFQPWLKVNLMSKIVWADGIPWNLVFVFTCW  160



>ref|XP_008354602.1| PREDICTED: uncharacterized protein LOC103418244 [Malus domestica]
Length=1384

 Score = 95.1 bits (235),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 115/288 (40%), Gaps = 32/288 (11%)
 Frame = +3

Query  1074  ELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP-WLWKLNCVE  1247
             +L   I  +P+P+D+   D L W+ STSG F  +  Y ++      ++W   +W+     
Sbjct  988   DLTKXILEMPLPIDEDK-DVLIWEVSTSGVFSFSDGYEIVRHRFPVKSWASIIWRPFIPP  1046

Query  1248  KVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIET  1427
             +   L+W +L  ++ T    +RR +     C  C    ES+ HLF  C+FA   W  + T
Sbjct  1047  RYSILVWKILFNKLPTXDXLQRRGIPLAPICQLCHKNSESIDHLFSSCEFAXCAWXWLAT  1106

Query  1428  YGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSE---  1598
               G  +      +      +  +   +    W  +  + L  IWK RN + F        
Sbjct  1107  QFGTIIPXTXSJSDLXLVFLSKRFSPHLRNVWJASGFFLLMAIWKMRNKVKFEGKPPSFS  1166

Query  1599  ----------------TPVHVAKLACTFASEARAFIIRHGGTSQGCYNW----VTWTPPQ  1718
                             TP HV  +        R  ++  G +   C       V W  P 
Sbjct  1167  RLCXSTSXWIRQVGALTPXHVRGIL------DRQLLVSLGISPNSCKAPSIVPVXWHXPP  1220

Query  1719  PGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
               WVK+N DG  K   G A+ GG+ RD  G ++ GF+  +G   SF A
Sbjct  1221  FSWVKVNTDGLAKGNPGPAACGGVXRDSAGYFLGGFSLSLGHRTSFYA  1268


 Score = 32.0 bits (71),  Expect(2) = 8e-20, Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 0/45 (0%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
             RW +G+G +   W D W++   + +    +I  +L   KVSN I+
Sbjct  928   RWVIGNGSTTSLWVDKWLDXPIVDVVGATEIAXSLSRTKVSNIIR  972



>emb|CDP17945.1| unnamed protein product [Coffea canephora]
Length=463

 Score = 95.5 bits (236),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 126/304 (41%), Gaps = 45/304 (15%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENWPW  1223
             VD L  FL  ELV ++  I  P D    DT+ W  + SG F  ASAYSLI  + D +W +
Sbjct  57    VDMLHQFLDGELVTQVLEIDPPTDRGN-DTMVWALTNSGVFSTASAYSLIRQSNDNSWLF  115

Query  1224  --LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRD-EEESLVHLFCDCQ  1394
               +W+     KV   +  LL+GR+      +R  +   S C  C++ +EE L H+FC  +
Sbjct  116   GRIWQQGLPVKVSFFMLRLLQGRLPLMDRLKRFGVCGPSRCLCCQNPQEEDLNHVFCSGE  175

Query  1395  FARECWEAIET----YGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTL-----  1547
              AR  W   E+    + G     H++ + W+         TND     + F++ +     
Sbjct  176   GARLVWRHFESTAGEFSGVHTVRHMVWSCWLRRG------TND----RVKFLHNILPSVV  225

Query  1548  -WQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNW---------  1697
              W +WK RN  +F                F  +      R  G       W         
Sbjct  226   CWVLWKARNEGVFEGRKMRIRPTVNRIVQFLHD--FLQSRFPGVQPSAPTWEGLLLELGS  283

Query  1698  ---------VTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTD  1850
                      V W  P+ G+ K+N DG  +   G +  GG+VRD  G +V G+A   GV  
Sbjct  284   HQRRMVIRPVYWVTPRRGY-KLNSDGCSRGNPGRSGGGGLVRDSRGNFVFGYAEPFGVIT  342

Query  1851  SFSA  1862
             S  A
Sbjct  343   SMQA  346


 Score = 31.6 bits (70),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 7/54 (13%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             W V +G +LDFW D W+   +L   +E+      +D  V +F+ D R+WNV ++
Sbjct  14    WVVREG-ALDFWHDNWMGSGALCDKVEV-----FHDHSVVDFV-DQRAWNVDML  60



>ref|XP_004296004.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=751

 Score = 91.7 bits (226),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 117/284 (41%), Gaps = 21/284 (7%)
 Frame = +3

Query  1065  LREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDE-NWPW-LWKLN  1238
             L  +   +I  IP+P +    D L W+ S+SG F  +  Y L+    ++ +W   +W   
Sbjct  420   LFPDCAKQILEIPLP-NTPESDILIWEHSSSGIFSFSDGYELVRPYFEKLDWASSVWHSF  478

Query  1239  CVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCR-DEEESLVHLFCDCQFARECWE  1415
                +   L W +   ++ T+ + +RR +   S C  C     E + HLF +C FA+  W+
Sbjct  479   IPPRYSVLAWRIFHLKLPTDDQLQRRGIPFVSVCQLCSFSHTEDIPHLFVNCSFAQHIWQ  538

Query  1416  AIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS  1595
              +  Y G +L +   +N    S             W  + ++ L  IWK  N L F+N  
Sbjct  539   WLAYYFGTSLPSSGSLNDLWSSVTGKAFSPQLKNIWFASCLFALMAIWKSHNKLRFDNKQ  598

Query  1596  ETPVHVAK--------LACTFASEARAFIIRHGGTSQG---------CYNWVTWTPPQPG  1724
              + + V +        +A       R  +     +S G             V W PP   
Sbjct  599   PSLMRVFRSVKAWVRYIAPYTPGCVRGVLDSKVLSSMGVILVLKCQSALRIVLWHPPLIP  658

Query  1725  WVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSF  1856
             W+K+N +G  K   GLA  GG+ RD  G  + G+   +G   +F
Sbjct  659   WLKLNTNGFSKGNPGLAGCGGVFRDSFGRLIGGYCQGLGTQTTF  702


 Score = 34.7 bits (78),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +1

Query  880   RARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDR  1029
              +RW +GDG S+ FWSD W++  S+   + +    +L + +V++FI D +
Sbjct  362   HSRWIIGDGNSILFWSDKWLHS-SIIQQLNMGSLSHLLNSRVADFIWDQQ  410



>ref|XP_007227312.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
 gb|EMJ28511.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
Length=992

 Score = 92.8 bits (229),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 87/282 (31%), Positives = 119/282 (42%), Gaps = 38/282 (13%)
 Frame = +3

Query  1059  TFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY----SLISCT--------  1202
              F  EE V  IR+IP+ +   T D L W     G F V SAY    SL S T        
Sbjct  625   VFFPEE-VMLIRSIPLSLR-LTPDMLVWHYDKKGMFTVKSAYHVARSLHSSTGRASSSNS  682

Query  1203  --VDENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVH  1376
               V  NW  LWK     +VKT  W ++ G + T     R+ +  D  C  C    +SL+H
Sbjct  683   DAVARNWSLLWKAIVPARVKTFWWRVISGILPTKANLARKKVSLDEECMLCEGPVKSLIH  742

Query  1377  LFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQI  1556
             +  DC +           G  + K+      W+      ++ + D A    TF+   W I
Sbjct  743   ILRDCPW---------NNGAHSPKD------WV-CRCAEQLSSQDFA----TFLMVGWAI  782

Query  1557  WKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKI  1736
             W+ RN L++NN       V+  A     +        G  S+       W PP    +KI
Sbjct  783   WEARNGLLWNNKKSRHEQVSLHASLRLHDFLRVSNCLGSQSRQGQIKQMWQPPHENSLKI  842

Query  1737  NIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             N+DGA K  T     G +VRD  G +V G ATK+  T+ FSA
Sbjct  843   NVDGAWKPGTTEGGVGVVVRDSTGKFVAGCATKL--TNVFSA  882


 Score = 33.1 bits (74),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 29/57 (51%), Gaps = 2/57 (4%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK-DDRSWNVTLM  1050
             +RW+VG G ++  W D W+   +    +    P++    KVS+ I  D R WN  L+
Sbjct  567   SRWQVGSGDTIGIWEDRWLPQPN-SFQIFSPRPEHSAITKVSDLIHGDSREWNAPLL  622



>ref|XP_006584399.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=470

 Score = 95.1 bits (235),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/281 (23%), Positives = 124/281 (44%), Gaps = 13/281 (5%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS----CTVDEN  1214
             + L   + ++++  I+AI  P D++  D   W  +  G +FVAS Y+ ++     +    
Sbjct  78    ELLSLLIPQDIIKCIKAIIPPRDNADDDRRLWTGNKLGEYFVASGYNQVNGFQNLSQSHI  137

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTN--VERRRRHLIDDSTCARCRDEEESLVHLFCD  1388
             W  +WK+   E++K  +W +   R+ TN  +  R       ++C  C   EE+++H+  D
Sbjct  138   WNKIWKIKAPERIKVFIWQVTHERLLTNSCIAHRGN---GQASCHHCVILEENILHVLRD  194

Query  1389  CQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCR  1568
             C  A   W  +          +  +  WI+ N+   +       W   +    + +W  R
Sbjct  195   CPLANLVWLHLLDQSNVANFFYPDLMEWIDMNLSRDLNATSKDDWQSVWAQGCYFLWYWR  254

Query  1569  NNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYN---WVTWTPPQPGWVKIN  1739
             N  + N++   P  + +         +  ++ H  +SQ        + W PP   W K+N
Sbjct  255   NQQVHNSSFVRPFRLWESILQNCRNYKILMV-HMDSSQVVSKKQIMIKWMPPDQRWYKLN  313

Query  1740  IDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
              DG     +G    GG++RD++G WV+GF   +G+  ++ A
Sbjct  314   SDGLKVGDSGGTGYGGLIRDENGRWVVGFVRNLGIASAYVA  354


 Score = 30.8 bits (68),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLD--MEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             W VG   S+  W D W++   + L   M++ IP ++ + KV++ +K D  W+  L+
Sbjct  26    WAVGKSDSVSVWYDRWISADIIKLSNVMQV-IPDHVANYKVNDMVKQDGQWDFELL  80



>ref|XP_008370907.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=899

 Score = 94.4 bits (233),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 76/285 (27%), Positives = 120/285 (42%), Gaps = 26/285 (9%)
 Frame = +3

Query  1074  ELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP-WLWKLNCVE  1247
             +L  +I  +P+P+D+   D L W+ STSG F  +  Y ++      ++W   +W+     
Sbjct  503   DLTXEILEMPLPIDEDK-DVLIWEVSTSGVFSFSDGYEIVRHRFPVKSWASIIWRPFIPP  561

Query  1248  KVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIET  1427
             +   L+W +L  ++ T  + +RR +     C  C    ES+ HLF  C FA+  W  + T
Sbjct  562   RYSILVWKILFNKLPTEDQLQRRGIPLAPICQLCHKNSESIDHLFSSCXFAQCAWRWLAT  621

Query  1428  YGGKTL-KNHLLMNAWIE--SNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS-  1595
               G  +     L + W++  S   S  + N    W  +  + L  IWK RN + F     
Sbjct  622   QFGTIIPPTGSLSDLWLDFLSKRFSPHLRNV---WLASGFFLLMAIWKMRNKVKFEGKPP  678

Query  1596  -------ETPVHVAKLACTFASEARAFIIRHGGTS-----QGCYN----WVTWTPPQPGW  1727
                     T   + ++        R  + R    S       C       V W PP   W
Sbjct  679   SFSXLCRSTSAWIRQVGALTXGHVRGILDRQLLVSLXISPNSCKAPSIVPVLWHPPHFSW  738

Query  1728  VKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             VK+N DG  K   G A+ GG+ RD  G ++  F+  +G   SF A
Sbjct  739   VKVNTDGLAKGNXGPAACGGVFRDSAGYFLGXFSLSLGHRTSFYA  783


 Score = 31.2 bits (69),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 0/46 (0%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
              RW +G+G +   W D W++   + +    +I  +L   KVSN I+
Sbjct  442   CRWVIGNGSTTSLWVDKWLDXPIVDVVGATEIAPSLSRTKVSNIIR  487



>ref|XP_008346965.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=768

 Score = 94.4 bits (233),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 74/289 (26%), Positives = 118/289 (41%), Gaps = 34/289 (12%)
 Frame = +3

Query  1074  ELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP-WLWKLNCVE  1247
             +L  +I  +P+P+D+   D L W+ STSG F  +  Y ++      ++W   +W      
Sbjct  372   DLTKEILEMPLPIDEDK-DVLIWEASTSGGFSFSDGYEIVRHRFPVKSWASIIWXPFIPX  430

Query  1248  KVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIET  1427
             +   L+W +L  ++ T  + +RR +     C  C    ES+ HLF  C FA+  W  + T
Sbjct  431   RYSILVWKILFNKLPTEDQLQRRGIXLAPXCQLCHKNSESIDHLFSSCDFAQCAWRWLAT  490

Query  1428  -YGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNN-----  1589
              +G        L + W++  +  +   +    W  +    L  IWK RN + F       
Sbjct  491   QFGTIIXPXGSLSDLWLD-FLSKRFSPHXXNVWLASGFXLLMAIWKMRNKVKFEGXPPSF  549

Query  1590  --------------NSETPVHVAKLACTFASEARAFIIRHGGTSQGCYN----WVTWTPP  1715
                            + TP HV           R  ++  G +   C       V W PP
Sbjct  550   SRLCXSTXAWIRXVGALTPGHVR------GXLDRQLLVSLGISPNXCKAXSIVXVXWHPP  603

Query  1716  QPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
                W K+N D   K   G A+ GG+ RD  G ++ GF+  +G   SF A
Sbjct  604   XXSWXKVNTDXLAKGNXGPAACGGVFRDSXGYFLGGFSLSLGHXTSFYA  652


 Score = 30.4 bits (67),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 0/46 (0%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
              RW +G+G +   W D W++   + +     I  +L   KVSN I+
Sbjct  311   CRWVIGNGSTTSLWVDKWLDKPIVDVVGATXIAPSLSRTKVSNIIR  356



>ref|XP_009124780.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=332

 Score = 99.8 bits (247),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 92/212 (43%), Gaps = 11/212 (5%)
 Frame = +3

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             +W++   E+V+  LWL+    + TN ER RRHL     C  CR   E+++H+  DC   +
Sbjct  1     MWRVVAPERVRMFLWLVANQAIMTNAERHRRHLSGTDLCQVCRGGIETIIHVLRDCPAIK  60

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIF  1583
               WE       +     + +  W+  N+        G PW+  F  TLW  WK R   +F
Sbjct  61    GIWERFVPRMRREAFFRMPLLEWLYKNLCDN-NAGGGVPWATIFALTLWWGWKWRCGNVF  119

Query  1584  NNNS------ETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINID  1745
              +        +    +AK   T      A    H          V W PP  GW+K+N D
Sbjct  120   GDTRLWRDRVKFLRDLAKGVITANRTENA----HIKERHMVEIMVGWKPPCVGWMKLNTD  175

Query  1746  GAMKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
             GA     G A+AGG +R+  G W  GFA  IG
Sbjct  176   GASHGNPGPAAAGGALRNGEGEWCGGFAINIG  207



>ref|XP_007008704.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
 gb|EOY17514.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
Length=2249

 Score = 77.8 bits (190),  Expect(3) = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 123/293 (42%), Gaps = 24/293 (8%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISC--TVDENW  1217
             ++ L T L++E+V++I  IP+  D  + D   W  + +G F   SA+ LI     V+  +
Sbjct  1849  IEKLKTVLQQEVVDEIAKIPI--DAMSKDEAYWAPTPNGEFSTKSAWQLIRKREVVNPVF  1906

Query  1218  PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
              ++W       +   LW LL   +   ++ + +     S C RC   EES++H+  D   
Sbjct  1907  NFIWHKTVPLTISFFLWRLLHDWIPVELKMKSKGFQLASRC-RCCKSEESIMHVMWDNPV  1965

Query  1398  ARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNL  1577
             A + W     +    + N   +N  + +  +S      G   ++  ++TLW +W  RN+ 
Sbjct  1966  ATQVWNYFSKFFQILVINPCTINQILGAWFYSGDYCKPGHIRTLVPIFTLWFLWVERNDA  2025

Query  1578  IFNNNSETPVHVA----KLACTFASEARAFIIRHGGTSQGCYNW--------------VT  1703
                N    P  +     KL    +   +    +  G  Q    W                
Sbjct  2026  KHRNLGMYPNRIVWRILKLIQQLSLGQQLLKWQWKGDKQIAQEWGITFQAESLPPPKVFP  2085

Query  1704  WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             W  P  G  K+N+DG+ K     A+ GG++RD  G  V GF+  +G+ +S  A
Sbjct  2086  WHKPSIGEFKLNVDGSAKLSQN-AAGGGVLRDHAGVMVFGFSENLGIQNSLQA  2137


 Score = 36.6 bits (83),  Expect(3) = 5e-19, Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 4/47 (9%)
 Frame = +2

Query  1946  RGDHSEETVVTLVKDCLDLSRKFRKFKISHIMREGNRCADWLANYGQ  2086
             RG H+   ++  ++  L        F++SHI REGN+ AD+LAN G 
Sbjct  2175  RGPHAIRYLLVSIRQLL----SHFSFRLSHIFREGNQAADFLANRGH  2217


 Score = 30.0 bits (66),  Expect(3) = 5e-19, Method: Composition-based stats.
 Identities = 14/27 (52%), Positives = 16/27 (59%), Gaps = 1/27 (4%)
 Frame = +1

Query  874   EIRARWRVGDGKSLDFWSDWWVNDKSL  954
             E   RWRVG GK L FW D W+ +  L
Sbjct  1799  EQNMRWRVGQGK-LFFWHDCWMGETPL  1824



>ref|XP_010672383.1| PREDICTED: uncharacterized protein LOC104888966 [Beta vulgaris 
subsp. vulgaris]
Length=1431

 Score =   102 bits (255),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 110/258 (43%), Gaps = 11/258 (4%)
 Frame = +3

Query  1101  PVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENWPWLWKLNCVEKVKTLLWLLLK  1280
             P P D   +    + +    +  +A     +     EN   LWK+N   K++  LWL+  
Sbjct  1057  PHPEDQKDIRAPIFLEPQGFSLALAYNEQFLDHNT-ENLGELWKINTSPKIQFFLWLVCL  1115

Query  1281  GRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLL  1460
              R+  N   R RHL  ++ C RC  + E   H+   C  ++  W+ ++TY     +N   
Sbjct  1116  DRLPHNKMLRDRHLTQEARCPRCASDVEDTNHILRLCPTSQRIWDQVDTYTSTHNQN---  1172

Query  1461  MNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFAS  1640
             M AW+  N+ S+     G  W++ F +  ++IWK RN+ +F  N   P     L   + +
Sbjct  1173  MKAWVGENIKSR-RDYRGLEWAVVFPFLCFEIWKSRNHSVFKPNLNHPGPDVVLQLAWKN  1231

Query  1641  EARAFIIRHG----GTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHG  1808
              AR FI   G       +   N +    P   W  +++D A K  T     GGI R   G
Sbjct  1232  -ARDFIQAKGPHEAQPEKTTINHLAHHTPS-NWTMLSVDAAFKDQTRTCGLGGIFRTSEG  1289

Query  1809  CWVIGFATKIGVTDSFSA  1862
              WV+GF       D+  A
Sbjct  1290  LWVLGFTKTAYARDALGA  1307



>ref|XP_004293076.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=487

 Score =   100 bits (249),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 128/282 (45%), Gaps = 30/282 (11%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENWP-  1220
             +  LL  L +E V +I  IP+ V +   D   W   T G F V SA  L    ++++   
Sbjct  101   IQKLLQVLDQETVKQITGIPILVSNQ-CDECIWAPPTDGRFSVKSATWLQYQNLEKHQQS  159

Query  1221  ----WLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCD  1388
                  +WKL+   KVK   WLLL+GR+ T     +   IDD++C  C  + E+  HLF  
Sbjct  160   DLINKVWKLDVPLKVKLFGWLLLRGRLKTRDRLSKFGYIDDNSCPLCDSDNETADHLFGH  219

Query  1389  CQFARECWE-----AIETYGGKTLK--NHLLMNAWIESNVHSKIVTNDGAPWSITFVYTL  1547
             C F  E +      A+  +    LK    + +N   +  + +K++           +Y  
Sbjct  220   CDFTTEVFRLAGISALMDWHEGYLKVLREMFINQPYDKFLFAKVL----------IIY--  267

Query  1548  WQIWKCRNNLIFNNN-SETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPG  1724
             WQIWK RN+ IF +  +      A  A  F   A    +  GG SQ   + + W PP   
Sbjct  268   WQIWKARNDTIFRDVITTATNVAATAAFHFNETALYKAVVGGGISQTTSSTIRWLPPHNN  327

Query  1725  WVKINIDGAMKSCTGLASAGGIV-RDDHGCWVIGFATKIGVT  1847
             ++KIN DG   S  G ++AGG V R+  G  ++  A  +G T
Sbjct  328   FIKINFDG---SVQGRSAAGGFVFRNSDGNVILAAAKGLGST  366


 Score = 23.5 bits (49),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +1

Query  886  RWRVGDGKSLDFWSDWWVNDKSL  954
            RW VG+G+++ FW+  W  +  L
Sbjct  50   RWIVGNGENIKFWTFNWAYEFPL  72



>ref|XP_007203348.1| hypothetical protein PRUPE_ppa020364mg, partial [Prunus persica]
 gb|EMJ04547.1| hypothetical protein PRUPE_ppa020364mg, partial [Prunus persica]
Length=295

 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 81/175 (46%), Gaps = 1/175 (1%)
 Frame = +3

Query  1338  CARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGA  1517
             C  C+   ES +H+  DC  AR  W+                + W+ +N+ SK       
Sbjct  6     CDYCKWPIESTLHILRDCSRARNVWDLFMNSTKALPFFQTDFHPWLLNNLCSK-AHFAQI  64

Query  1518  PWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNW  1697
             PW I FV+  W IWK RN+ IF N ++ P +   L  T   +    I      +      
Sbjct  65    PWRILFVFICWYIWKWRNDFIFKNETDLPFNPRDLIFTATKDWFQAIFCTSSGANKVQVL  124

Query  1698  VTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             + W PP+ G VK+NIDG+ +  TG   AGG++RD  G W+ GFA  +G  +   A
Sbjct  125   LAWVPPEIGVVKLNIDGSCRGSTGAIDAGGVLRDHLGQWIAGFAVNLGQGEVLDA  179



>ref|XP_008383873.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=389

 Score = 98.2 bits (243),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 120/277 (43%), Gaps = 26/277 (9%)
 Frame = +3

Query  1098  IPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP-WLWKLNCVEKVKTLLWL  1271
             +P+P+D+   D L W+ STSG F  +  Y ++      ++W   +W+     +   L+W 
Sbjct  1     MPLPIDEDK-DVLIWEVSTSGVFSFSDGYEIVRHRFPVKSWASIIWRPFIPPRYSILVWK  59

Query  1272  LLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLK-  1448
             +L  ++ T  + +RR +     C  C    ES+ HLF  C+FA+  W  + T  G T+  
Sbjct  60    ILFNKLPTEDQLQRRGIPLAPICQLCHKNSESIDHLFSSCEFAQCAWRWLATQFGTTIPP  119

Query  1449  NHLLMNAWIE--SNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKL  1622
                + + W+   S   S  + N    W  +  + L  IWK RN + F     +   + + 
Sbjct  120   TGSISDLWLVFLSKQFSPHLRNV---WIASGFFLLMAIWKMRNKVKFEGKPPSLSRLCRS  176

Query  1623  ACTFASEA-------------RAFIIRHGGTSQGCYNW----VTWTPPQPGWVKINIDGA  1751
                +  +              R  ++  G +   C       V W PP   WVK+N DG 
Sbjct  177   TSAWIRQVGALTPGHVRGILDRQLLVSLGISPNSCKAPSIVPVLWLPPPFSWVKVNTDGL  236

Query  1752  MKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
              K   G A+ GG+ RD  G ++ GF+  +G   SF A
Sbjct  237   AKGNPGPAACGGVFRDSTGYFLGGFSLSLGHRTSFYA  273



>ref|XP_010667070.1| PREDICTED: uncharacterized protein LOC104884169 [Beta vulgaris 
subsp. vulgaris]
Length=358

 Score = 87.0 bits (214),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 106/240 (44%), Gaps = 11/240 (5%)
 Frame = +3

Query  1152  TSGTFFVASAY--SLISCTVDENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLI  1325
             TS  F +  AY   L S     +  W+W+     K+K  +WLL   R+        R + 
Sbjct  7     TSSGFSLGLAYKAQLPSHHDTSDLSWIWEGFMEPKIKFFIWLLWHDRIPHRHLLTIRRIT  66

Query  1326  DDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVT  1505
              DS+C RC++  E   H+   CQ + E W    T      +      +W++ N+ S   +
Sbjct  67    QDSSCPRCQELGEDSHHIIKTCQKSAEIWNLPNTPQIHEDE----FRSWLKENMSSN-KS  121

Query  1506  NDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQ-  1682
               G PW   F YT ++IWK RN  +F N   +P+ V     +    AR +I+    TS  
Sbjct  122   FRGIPWKCVFPYTCYEIWKDRNQCVFKNLHPSPIQVISFKASGG--ARDYILSIKDTSML  179

Query  1683  GCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             G         P+  ++ I +D +  S   +A  GG+V D    WV+G+  K+   DS +A
Sbjct  180   GITRRPMMYHPR-EFLCIYVDASFISPLVVAGLGGVVMDHEKKWVLGWGKKVYTNDSLAA  238


 Score = 35.4 bits (80),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 24/83 (29%), Positives = 40/83 (48%), Gaps = 5/83 (6%)
 Frame = +2

Query  1928  CGAVMNRGDHSEE--TVVTLVKDCLDLSRKFRKFKISHIMREGNRCADWLANYGQNITWR  2101
             C   ++  +H +E   V  +V  C     +F + +I H  REGNR AD LA   +     
Sbjct  264   CKEAVDLVNHRKEFDKVANMVNACRQWRTRFPEIQIKHCRREGNRTADALARNCRTSDMA  323

Query  2102  ---TLLLDSAPAELNDIIQADSL  2161
                T +L S P+   D++++D +
Sbjct  324   CVVTRVLPSPPSYCRDLLKSDCM  346



>ref|XP_009120305.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=308

 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 82/186 (44%), Gaps = 3/186 (2%)
 Frame = +3

Query  1290  FTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNA  1469
              TN ER RRHL     C  C+   E+++H+  DC      W        +     + +  
Sbjct  1     MTNAERYRRHLSGTDVCQVCKGGVETILHVLRDCPAMEGIWSRFVPSTKRQAFFSMPLLE  60

Query  1470  WIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS--ETPVHVAKLACTFASE  1643
             W+  N++     N+  PW+ TF   +W  WK R   +F +N      V   +        
Sbjct  61    WLYRNLYDNDAQNE-IPWATTFALGVWWGWKWRCGNVFGDNRLWRDRVKFLRNLARKVMR  119

Query  1644  ARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIG  1823
             A+          Q     V WTPP+ GW+K+N DGA     GLASAGG++RD  G W  G
Sbjct  120   AKKTEEESRARVQRVEIMVGWTPPRGGWMKLNTDGASHGNPGLASAGGVLRDGEGEWCGG  179

Query  1824  FATKIG  1841
             FA  IG
Sbjct  180   FALNIG  185



>ref|XP_007219945.1| hypothetical protein PRUPE_ppb019389mg [Prunus persica]
 gb|EMJ21144.1| hypothetical protein PRUPE_ppb019389mg [Prunus persica]
Length=786

 Score =   100 bits (248),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 96/217 (44%), Gaps = 22/217 (10%)
 Frame = +3

Query  1212  NWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDC  1391
             +W +LW+L    K+KT LW++   ++ TNV+R++R L     C RC    E++ HLF DC
Sbjct  574   DWQFLWRLRLPPKIKTFLWIVCHRKLLTNVQRQKRGLTQAPACPRCDYPMETIAHLFKDC  633

Query  1392  QFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRN  1571
               +   W  ++  G     + +    W+  N+HSK                     + R 
Sbjct  634   PLSLTIWNCLQI-GNNPSPDMVDFKEWLLRNLHSK---------------------RKRC  671

Query  1572  NLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGA  1751
               IF+     P    +L   +A E          +       + W  P  G  KIN DG+
Sbjct  672   KGIFDQRFVMPGEPHQLILQYALEWFNATKPPSLSYVPSIVQLHWIAPTYGVCKINTDGS  731

Query  1752  MKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
                 +GL SAGG++RD++G W+ GF+  +GV     A
Sbjct  732   RNCVSGLISAGGLLRDNYGAWIKGFSVNLGVGSVLEA  768



>ref|XP_008369981.1| PREDICTED: uncharacterized protein LOC103433498 [Malus domestica]
Length=1384

 Score = 89.4 bits (220),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 121/285 (42%), Gaps = 26/285 (9%)
 Frame = +3

Query  1074  ELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP-WLWKLNCVE  1247
             +L  +I  +P+P+D+   D L W+ STSG F  +  Y ++      ++W   +W+     
Sbjct  988   DLTKEILEMPLPIDEDK-DVLIWEVSTSGVFSFSDGYEIVRHRFPVKSWASIIWRPFIPP  1046

Query  1248  KVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIET  1427
             +   L+W +L  ++ T  + +RR +     C  C    ES  HLF  C FA+  W  + T
Sbjct  1047  RYSILVWKILFNKLPTXDQLQRRGIPLAPICQLCHKNSESXDHLFSSCXFAQCAWRWLAT  1106

Query  1428  YGGKTLK-NHLLMNAWIE--SNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSE  1598
               G  +     L + W+   S   S  + N    W  +  + L  IWK RN + F     
Sbjct  1107  QFGTIIPPTGSLSDLWLXFLSKRFSPHLXNX---WJASGFFLLMAIWKMRNKVKFEGKPP  1163

Query  1599  TPVHVAKLACTFASEA-------------RAFIIRHGGTSQGCYNW----VTWTPPQPGW  1727
             +   + +    +  +              R  ++  G +   C       V W PP   W
Sbjct  1164  SXSRLCRSTSAWIRQVGALXPGHVRGILDRQLLVSLGISPNSCKAPSIVPVLWXPPXFSW  1223

Query  1728  VKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             VK+N DG  K   G A+ GG+ RD  G ++ GF+  +G   SF A
Sbjct  1224  VKVNTDGLAKGNXGXAACGGVFRDSAGYFLGGFSLSLGHRTSFYA  1268


 Score = 32.0 bits (71),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 0/45 (0%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
             RW +G+G +   W D W++   + +    +I  +L   KVSN I+
Sbjct  928   RWVIGNGSTTSLWVDKWLDKPIVDVVGATEIAXSLSRTKVSNIIR  972



>ref|XP_008227502.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=198

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 76/157 (48%), Gaps = 0/157 (0%)
 Frame = +3

Query  1275  LKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNH  1454
             LKG++ +N +R RRHL DD  C       ES++H+F DC+ A   W A+          H
Sbjct  30    LKGKILSNEQRARRHLADDPACNYYNWPVESILHIFRDCEKATNVWHAMLGPVAHPHFFH  89

Query  1455  LLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTF  1634
             +  + W+ SN+ SK +  D  PW++ FV+T W +WK R N IFN + E      K+    
Sbjct  90    MEFHPWLRSNLLSKAMWGDHVPWTLVFVFTCWVLWKWRTNHIFNIDDEVRYEPKKIIVVA  149

Query  1635  ASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINID  1745
               E           +      + W PP+ G  K+N+D
Sbjct  150   VKEWYTSSQIGDTKASKIPLLLAWEPPELGQFKLNVD  186



>ref|XP_007210660.1| hypothetical protein PRUPE_ppa022173mg, partial [Prunus persica]
 gb|EMJ11859.1| hypothetical protein PRUPE_ppa022173mg, partial [Prunus persica]
Length=343

 Score = 96.3 bits (238),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 92/198 (46%), Gaps = 8/198 (4%)
 Frame = +3

Query  1281  GRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLL  1460
             G++ +N  R +R L  D +C+      E+++H+  +   A+E W AI             
Sbjct  122   GKILSNEHRYKRQLTLDPSCSIYGGSSETILHILREGPQAKEVWRAILLLLQVPHFFQHD  181

Query  1461  MNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFAS  1640
             +  W+  N+ +K     G PW+  F +T W IWK RN+ +FNN    P        T   
Sbjct  182   LQPWLSCNILNKNKGCVGLPWNTIFGFTYWYIWKWRNHCVFNNEEALPYCPQN---TILK  238

Query  1641  EARAFIIRHGGTSQ----GCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHG  1808
              A+ +++ H   SQ         + W PP  GW K+N+DG  +  +G    GG++R+ +G
Sbjct  239   AAKEWLL-HAYVSQPKKLKVLVSLAWVPPDVGWFKLNVDGYRRFSSGNIGTGGVLRNCNG  297

Query  1809  CWVIGFATKIGVTDSFSA  1862
              WV GF T +G      A
Sbjct  298   DWVEGFTTSLGQGQVLDA  315



>ref|XP_008245452.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=418

 Score = 97.1 bits (240),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 123/285 (43%), Gaps = 21/285 (7%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN---  1214
             +D++ TF+  +++  IR IP+    S  D L W  ++SG++ V S Y       + +   
Sbjct  10    LDSISTFINNDILQSIRCIPIG-HSSRPDRLVWPWNSSGSYTVKSGYHRFHARQNTDIAS  68

Query  1215  ------------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDE  1358
                         W  +WK+  + K+K  LW  L G + T +   +R +  D  C  C   
Sbjct  69    HNHSSHFVSEGVWKTIWKMETLPKIKLFLWRALSGSISTRLALFKRKIATDPICPICEGF  128

Query  1359  EESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFV  1538
             EES+ H+   C + +  W   +       +     + WIE  +     +     + ++F+
Sbjct  129   EESVEHILFLCPWTQLVWFGSDLSYKVDPRRISTFDRWIEGIISIPGTSRTDGNFLLSFL  188

Query  1539  YTL-WQIWKCRNNLIFNNNSETP---VHVAKLACTFASEARAFIIRHGGTSQGCYNWVT-  1703
               L W+IWK R   +FN  S  P   +  A+ AC+      + +   G  S   +   T 
Sbjct  189   SFLCWEIWKARCKFVFNGVSPDPRLAITHARDACSEYLAVVSKVDARGNLSPVHHVQGTR  248

Query  1704  WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKI  1838
             W+ P P +VK N+DG+    T   S G + R+  G W  G A+ +
Sbjct  249   WSKPGPNYVKFNLDGSWLPGTMKGSIGIVSRNSSGDWCGGLASPL  293



>ref|NP_189164.1| ribonuclease H-like protein [Arabidopsis thaliana]
 dbj|BAB02086.1| reverse transcriptase-like protein [Arabidopsis thaliana]
 gb|AEE77003.1| ribonuclease H-like protein [Arabidopsis thaliana]
Length=343

 Score = 95.9 bits (237),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 100/221 (45%), Gaps = 11/221 (5%)
 Frame = +3

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             +WKL    K+K  LW LL G + T    +RRH+ +   C RC  E+E+  HLF DC +A+
Sbjct  18    IWKLKTAPKIKHFLWKLLSGALATGDNLKRRHIRNHPQCHRCCQEDETSQHLFFDCFYAQ  77

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIF  1583
             + W A      +     + M   +E  + S +       +++  ++ LW++WK RN L+F
Sbjct  78    QVWRASGIPHQELRTTGITMETKMELLLSSCLANRQPQLFNLA-IWILWRLWKSRNQLVF  136

Query  1584  NNNS---ETPVHVAKLACTFASEARAFI------IRHGGTSQGCYNWVTWTPPQPGWVKI  1736
                S   +  +  A+       +   ++      +      Q       W  P   W+K 
Sbjct  137   QQKSISWQNTLQRARNDVQEWEDTNTYVQSLNQQVHSSRHQQPTMARTKWQRPPSTWIKY  196

Query  1737  NIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFS  1859
             N DGA    T  A AG ++RD++G + +G    IG T S S
Sbjct  197   NYDGAFNHQTRNAKAGWLMRDENGVY-MGSGQAIGSTTSDS  236



>ref|XP_009126860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851737 
[Brassica rapa]
Length=1638

 Score = 85.5 bits (210),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/228 (24%), Positives = 103/228 (45%), Gaps = 11/228 (5%)
 Frame = +3

Query  1077  LVNKIRAIPVPVDDST--VDTLTWQDSTSGTFFVASAYSLIS------CTVDENWPWLWK  1232
             L N+++   + +D+ T   D ++W ++  G F V +AY+ ++        +++ +  +W+
Sbjct  1412  LQNRLQLASLVIDEVTGARDRMSWGEAKDGLFSVKAAYAFLTKDAVPRPNMEDLYSRVWR  1471

Query  1233  LNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECW  1412
             +   E+V+  LWL+    + TN+ER+RRH+ ++ TC  C+  +E+++H+  DC  A   W
Sbjct  1472  VTAPERVRVFLWLVTHQVIMTNMERKRRHISENGTCPLCKSGDETILHVLRDCPAAAGLW  1531

Query  1413  EAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNN-  1589
               +     +    +L +  W+  N+ +    N G  W   F  T+W  WK R   +F   
Sbjct  1532  RKLVLPTRQQRFFNLTLFEWLYENLANDKSVN-GDQWPSLFALTVWWCWKWRCGYVFGEI  1590

Query  1590  -NSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWV  1730
                   V   K       +A   +             + W  P+ GWV
Sbjct  1591  GKCRDRVRFVKDKAQEVIKANKKVREPSAIGGHVERPIAWVVPENGWV  1638


 Score = 34.3 bits (77),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSW  1035
             W +GDG+ + FW D W+  + L     IDIP+ L + K  +  +    W
Sbjct  1353  WILGDGRRVRFWRDRWLLKEPLEALSLIDIPEELEEAKTRDLWQQGIGW  1401



>ref|XP_008220882.1| PREDICTED: uncharacterized protein LOC103320918 [Prunus mume]
Length=687

 Score = 97.4 bits (241),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 98/206 (48%), Gaps = 25/206 (12%)
 Frame = +3

Query  1248  KVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIET  1427
             K+KT +WL+  G++ TNV+R +R +     C +C    E++ H+F  C            
Sbjct  449   KLKTFVWLIGHGKILTNVQREKRLMTTSPNCHKCLSLPETMDHVFKGC------------  496

Query  1428  YGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPV  1607
                           W+  N+ SKI+ +   PW+  F +++W  WK R N IFN   E P 
Sbjct  497   -----------FTDWLRINLKSKIMLSGNLPWTFVFTFSIWHCWKWRCNSIFNPGYEPPT  545

Query  1608  HVAKLACTFASE-ARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAG  1784
             +       F+SE   A  + +   ++     V W+ P  G  K+N+DG+ K+ +    A 
Sbjct  546   NPHHTILQFSSEWLDANNVVNAKPTREVIQ-VHWSLPTLGNFKLNVDGSCKTDSWKICAV  604

Query  1785  GIVRDDHGCWVIGFATKIGVTDSFSA  1862
              ++RD +G W+ GF+  IG+ + + A
Sbjct  605   CLLRDSNGAWICGFSANIGIGNIYEA  630



>ref|XP_007226339.1| hypothetical protein PRUPE_ppa022315mg, partial [Prunus persica]
 gb|EMJ27538.1| hypothetical protein PRUPE_ppa022315mg, partial [Prunus persica]
Length=307

 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 80/271 (30%), Positives = 110/271 (41%), Gaps = 22/271 (8%)
 Frame = +3

Query  1059  TFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY----SLISCT--------  1202
              F  EE V  IR+IP+ +   T D L W     G F V SAY    SL S T        
Sbjct  28    VFFPEE-VMLIRSIPLSLR-LTPDMLVWHYDKKGMFTVKSAYHVARSLHSSTGRASSSNS  85

Query  1203  --VDENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVH  1376
               V  NW  LWK     +VKT  W ++ G + T     R+ +  D  C  C    ES +H
Sbjct  86    DAVARNWSLLWKAIVPARVKTFWWRVISGILPTKANLARKKVSLDEECMLCEGPVESSIH  145

Query  1377  LFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQI  1556
             +  DC FA   W +      +          W+      ++ + D A    TF+   W I
Sbjct  146   ILRDCPFAICAWRSSTLSSSRWNNGAHSPKDWV-FRCAEQLSSQDFA----TFLMVGWAI  200

Query  1557  WKCRNNLIFNNNSETPVHVAKLACTFASE-ARAFIIRHGGTSQGCYNWVTWTPPQPGWVK  1733
             W+ RN L++NN    P  V+  A     +  R        + QG      W PP    +K
Sbjct  201   WEARNGLLWNNKKSRPEQVSLHASLRLQDFLRVSNCLGSQSRQGQIKQKMWQPPHENSLK  260

Query  1734  INIDGAMKSCTGLASAGGIVRDDHGCWVIGF  1826
             IN+DGA K  T     G +VR     W++ +
Sbjct  261   INVDGAWKPGTTEGGVGVVVRCWRDLWILTY  291



>ref|XP_008344356.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=348

 Score = 94.4 bits (233),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 79/180 (44%), Gaps = 0/180 (0%)
 Frame = +3

Query  1302  ERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIES  1481
             +R +R   +D  C  C   EES  H+F  C+ +   W  +           L   +W+  
Sbjct  46    KRAKRGFTNDPCCPICPTVEESXDHIFRYCRHSPSFWNNVGIPLEVAHSFALDFQSWMAI  105

Query  1482  NVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFII  1661
             N+ +   T  G PW++ F  TLW  WK RNN  FNN  + PV   K+   FA +      
Sbjct  106   NLRTHCSTIHGLPWNLIFASTLWYCWKRRNNFXFNNGQQPPVSPLKVIFQFARDWYDANK  165

Query  1662  RHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
                         + W  P  G  KIN DG+ K      SAGG++R+  G W+ GFA  +G
Sbjct  166   CXSSKPPRQIISIHWIRPPIGRYKINTDGSCKDXFSHISAGGLIRNSEGDWIXGFAANLG  225



>gb|KHN02883.1| Putative ribonuclease H protein [Glycine soja]
Length=313

 Score = 92.8 bits (229),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 70/263 (27%), Positives = 107/263 (41%), Gaps = 28/263 (11%)
 Frame = +3

Query  1110  VDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-------ENWPWLWKLNCVEKVKTLLW  1268
             ++ +  DT+ W  + +  F   +AY  +    +       EN  W+W +   + +K  LW
Sbjct  61    LNSTIADTVIWSAAQNHVFMAKTAYWWLQSQANVSLGAQAENNSWMWLMKIPQNIKFFLW  120

Query  1269  LLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLK  1448
             L     + T      RHL  +  C RC ++ ES++HL  DC  A   W   +        
Sbjct  121   LTSHKSLPTKFFLVYRHLSSNPFCCRCSNQVESVLHLLRDCDKACSVWSMFQPTLVVDFA  180

Query  1449  NHLLMNAWIESNV--HSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKL  1622
              H       +S+V  H       GA     F    W IW+ RN + F+N +     +A  
Sbjct  181   EH-------DSSVWLHKHATCATGA----LFCLICWFIWRDRNAMTFSNENWQEWFIASQ  229

Query  1623  A---CTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIV  1793
                     S  +    R+  T Q     V W PP P  +K+N DG+     G +  GG++
Sbjct  230   VNNMLNIISNQQECQPRNRYTVQ-----VAWKPPPPTVLKLNTDGSSLVNPGQSGFGGVI  284

Query  1794  RDDHGCWVIGFATKIGVTDSFSA  1862
             RD    W+IG+    GVT S  A
Sbjct  285   RDSQRDWIIGYTGSCGVTTSLQA  307



>ref|XP_010682933.1| PREDICTED: uncharacterized protein LOC104897695 [Beta vulgaris 
subsp. vulgaris]
Length=1326

 Score = 89.4 bits (220),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 74/265 (28%), Positives = 108/265 (41%), Gaps = 30/265 (11%)
 Frame = +3

Query  1071  EELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSL------------ISCTVDEN  1214
             EE +  IR IP+       D   W  ST G F   SAY L                  E 
Sbjct  948   EEDILLIREIPLS-SRKPPDLQYWWPSTDGFFTTKSAYWLGRLGHLRGWLGHFGGANGEV  1006

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W  +W L    K+K  LW    G + T    + RH+++D  C  C  E+ES+VH    C 
Sbjct  1007  WKVIWGLEGPPKLKHFLWRACMGALATRGRLKERHIVEDGCCTHCNREDESIVHAIFRCS  1066

Query  1395  FARECWE-AIETYGGKTLKNHLLMN--AWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
                  WE +  TY  +       M+   W+ S +    +        ++F+   W  W  
Sbjct  1067  LVSPIWENSPFTYYVRDGPTSSFMDFFVWLISRMERTDL--------LSFMAMAWAAWSY  1118

Query  1566  RNNLIF----NNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVK  1733
             RN++ F    +N + + V   KL   + S A A + R G  + G  +  +W  P  G  +
Sbjct  1119  RNSVTFEEPWSNVTVSVVGFMKLVSDYKSYA-ALVFRAGPVTTGFPSRSSWVAPDEGRFR  1177

Query  1734  INIDGAMKSCTGLASAGGIVRDDHG  1808
             +N D AM +  GL   G +VRD  G
Sbjct  1178  LNTDAAMLA-EGLVGVGAVVRDSRG  1201


 Score = 27.7 bits (60),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 28/51 (55%), Gaps = 1/51 (2%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWN  1038
             +WRVGDG S+  W + W+  +S  +    ++ ++  D +VS+ +     W+
Sbjct  889   KWRVGDGSSIGVWEESWLPGESAAVVPTPNM-ESPADLRVSDLLDASGRWD  938



>ref|XP_008244613.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=930

 Score = 95.9 bits (237),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 74/285 (26%), Positives = 121/285 (42%), Gaps = 21/285 (7%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN---  1214
             +D++ TF+  +++  IR IP+    S  D L W  ++SG++ V S Y       + +   
Sbjct  522   LDSISTFINNDILQSIRCIPIG-HSSRPDRLVWPWNSSGSYTVKSGYHRFHARQNTDIAS  580

Query  1215  ------------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDE  1358
                         W  +WK+  + K+K  LW  L G + T +   +R +  D  C  C   
Sbjct  581   HNHSSHFVSEGVWKTIWKVETLPKIKLFLWRALSGYISTRLALFKRKIATDPICPICEGF  640

Query  1359  EESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFV  1538
             EES+ H+   C + +  W           +     + WIE  +     +     + ++F+
Sbjct  641   EESVEHILFLCPWTQLVWFGSNLSYKVDPRRISTFDRWIEGIISIPGTSRTDGDFLLSFL  700

Query  1539  YTL-WQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIR---HGGTSQGCYNWVT-  1703
               L W+IWK R   +FN  S  P  V   A    SE  A + +    G  S   +   T 
Sbjct  701   SFLCWEIWKARCKFVFNGVSPDPRLVITHARDACSEYLAVVSKVDARGNLSPVHHVQGTR  760

Query  1704  WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKI  1838
             W+ P P +VK N+DG+    T   S G + R+  G W  G A+ +
Sbjct  761   WSKPGPNYVKFNLDGSWLPGTMKGSIGIVSRNSSGDWCGGLASPL  805



>gb|ADK92871.1| retrotransposon protein [Hypericum perforatum]
Length=593

 Score = 83.6 bits (205),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 106/266 (40%), Gaps = 23/266 (9%)
 Frame = +3

Query  1065  LREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSL-------------ISCTV  1205
               EE V +I  I + +    +D + W+    G + V S Y +             ++   
Sbjct  219   FEEEDVTRILQIRLSLR-RPLDMVRWKFIKDGEYTVRSGYYIDFNCWWHENYATPLTHAG  277

Query  1206  DENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFC  1385
             +E W   W L C  ++KTLLW L+   +       RR +  D  C  C    E+  HLF 
Sbjct  278   EERWKTCWGLRCPPRIKTLLWRLIDNNLSVRTNLTRRGIQVDEVCPCCAGPSETAAHLFF  337

Query  1386  DCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
              C +  + W+ +          ++L+      N+   +  +  A        TLW IW+ 
Sbjct  338   CCPYTLDIWKEVNVQIQVESSENILLAIDSLLNIRDPVEQSRRAA-------TLWIIWRV  390

Query  1566  RNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINID  1745
             RN+++F    E  V   +L   F             T +G      W  P  G+ KIN+D
Sbjct  391   RNSIVFRTGEEI-VICKELEKGFRFWQDFMDTEGNPTVRGAPRTSKWNAPTAGFYKINVD  449

Query  1746  GAMKSCTGLASAGGIVRDDHGCWVIG  1823
               +++  G    G +VRDD G +V+ 
Sbjct  450   AGLRAERG-GQVGIVVRDDTGAFVMA  474


 Score = 33.5 bits (75),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (52%), Gaps = 2/54 (4%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             WR+G G ++  WSD W+     GL        +LY   VS+FI++   WN  L+
Sbjct  164   WRIGQGNTVRTWSDPWIPGSDTGLPKYHSPGSDLYT-HVSDFIQNG-GWNENLL  215



>ref|XP_009115103.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=308

 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 86/189 (46%), Gaps = 9/189 (5%)
 Frame = +3

Query  1290  FTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNA  1469
              TN ER RRHL     C  C+   E+++H+  DC      W+ +     +     + +  
Sbjct  1     MTNAERFRRHLSGTDVCQICKGGIETILHVLRDCPAMSGIWDRLVPTRKRQAFFSMSLFE  60

Query  1470  WIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKL-----ACTF  1634
             W   N+ S      G PW+ TF   +W  WK R   +F +N      V  L         
Sbjct  61    WFYLNL-SDTQEGSGVPWATTFSLAVWWGWKWRCGNVFGDNRLWKDRVKFLRNLATEVMA  119

Query  1635  ASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCW  1814
             A +A +     GG ++     + WTPP+ GW+K+N DGA     GLA+AGG++R+  G W
Sbjct  120   AKDAESRKWDRGGRTEIM---IGWTPPRVGWMKLNTDGASHGNPGLATAGGVLRNGDGEW  176

Query  1815  VIGFATKIG  1841
               GF   IG
Sbjct  177   CGGFVLNIG  185



>ref|XP_006469117.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=491

 Score = 93.2 bits (230),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/241 (28%), Positives = 103/241 (43%), Gaps = 7/241 (3%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS----CTVDEN  1214
             D+    L   ++ +I A+  P++    D   W +S  G F V SAY  I+          
Sbjct  216   DSFEHLLPNCIILRIAAVQPPMEGKGDDKFFWANSQRGDFSVKSAYMAITKNEIGIEHSR  275

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W   WK     +V+T +WL L  R+ T  E  RRH+  D TC  C    E+ +H+  DC 
Sbjct  276   WNIAWKWKGPPRVQTFIWLALHDRLKTKAEIGRRHIHIDWTCDHCGVASETTLHVLRDCF  335

Query  1395  FARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
              A+  W  +     + +     +  W+  N+ S     +G  WS  F   +W++W  RN 
Sbjct  336   MAKRLWNQLLPSEWRQVFFSSNLLDWLTLNLRSNQCMENGLEWSCMFGVAIWRLWFWRNQ  395

Query  1575  LIFNNNSETPVHVAKLACTFASEARAFIIRHGGTS--QGCYNWVTWTPPQPGWVKINIDG  1748
               FN  S   + +A+     A E  +   + G  S  +    W+ W PP     K+N DG
Sbjct  396   YQFNKVSTDSISMAQDVLIRAKEITSS-NKSGLNSPTRKVEKWIGWQPPVWPLCKLNSDG  454

Query  1749  A  1751
             A
Sbjct  455   A  455


 Score = 23.5 bits (49),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 23/51 (45%), Gaps = 1/51 (2%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVN-DKSLGLDMEIDIPKNLYDKKVSNFIKDDRSW  1035
             +W + +G+ + FW D WV   K L       IP       + +F+  + +W
Sbjct  163   QWNIVNGRRVRFWLDCWVTKHKPLSSYALAPIPVESLMNLIVDFVDANGNW  213



>ref|XP_004308214.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=409

 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 81/306 (26%), Positives = 124/306 (41%), Gaps = 53/306 (17%)
 Frame = +3

Query  1053  LLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDE-NWPWL-  1226
             LL F   ++   I  +P+ +     D L W  S+SG      A+  +   +   +W  L 
Sbjct  9     LLQFHFLDICKLINDVPISIVPDMSDKLIWVPSSSGELLAKEAFQFMRPRLPSLDWSKLI  68

Query  1227  WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARC-RDEEESLVHLFCDCQFAR  1403
             W    + ++    W +L+GR+ +    +RR ++  S C  C RD E S  H+F  C F  
Sbjct  69    WSKFIIPRISLHSWKVLRGRVLSEDLLQRRGIVLASRCVLCGRDCESSFPHIFLTCSFVA  128

Query  1404  ECWE---------------AIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFV  1538
               W                    Y G   ++H L   W+                 I + 
Sbjct  129   SLWNNWACLFELGSLPQNLVDLIYYGGVGRSHQLKEIWL-----------------ICYT  171

Query  1539  YTLWQIWKCRNNLIFNNNSET--PVH---------VAKLA--CTFASEARAFIIRHGGT-  1676
              TLW I K RN +  +N +     VH         V+KLA  C   S  +  +++  G  
Sbjct  172   TTLWFIGKARNKIRHDNCTIVVDAVHQLIMGHVKAVSKLASGCMSNSLTKLRVLKKFGLL  231

Query  1677  SQGCYNW----VTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGV  1844
                C       V W PP  GW+K+N DGA +  TG +  GGI RD HG ++  FA+ + +
Sbjct  232   CHPCQALRITKVNWHPPLFGWIKVNTDGAWQKTTGKSGYGGIFRDFHGSFLGAFASNLEI  291

Query  1845  TDSFSA  1862
              +S  A
Sbjct  292   PNSVDA  297



>ref|XP_007010390.1| Retrotransposon, unclassified-like protein [Theobroma cacao]
 gb|EOY19200.1| Retrotransposon, unclassified-like protein [Theobroma cacao]
Length=1368

 Score = 75.5 bits (184),  Expect(3) = 1e-16, Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 116/293 (40%), Gaps = 23/293 (8%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENW--  1217
             VD L TF+   +V +I  IP+  +    D   W  + +G F + SA+ L+      N   
Sbjct  935   VDKLKTFIPNAIVEEILKIPISREKE--DIAYWALTANGDFSIKSAWELLRQRKQVNLVG  992

Query  1218  PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
               +W  +    V   LW  L   +   V  + + +   S C  C+ EE SL+H+  +   
Sbjct  993   QLIWHKSIPLTVSFFLWRTLHNWLPVEVRMKAKGIQLASKCLCCKSEE-SLLHVLWESPV  1051

Query  1398  ARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNL  1577
             A++ W     +    + N   +   + S  +S   T  G   ++  ++  W +W  RN+ 
Sbjct  1052  AQQVWNYFSKFFQIYVHNPQNILQILNSWYYSGDFTKPGHIRTLILLFIFWFVWVERNDA  1111

Query  1578  IFNNNSETPVHV-------------AKLACTFASEARAFIIRHGG-----TSQGCYNWVT  1703
                +    P  +               L C +  +    I  H G       Q     + 
Sbjct  1112  KHRDLGMYPDRIIWRIMKILRKLFQGGLLCKWQWKGDLDIAIHWGFNFAQERQARPKIIN  1171

Query  1704  WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             W  P  G +K+N+DG+ K     A+ GG++RD  G  + GF+   G  +S  A
Sbjct  1172  WIKPLIGELKLNVDGSSKDEFQNAAGGGVLRDHTGNLIFGFSENFGYQNSLQA  1224


 Score = 33.1 bits (74),  Expect(3) = 1e-16, Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 4/48 (8%)
 Frame = +2

Query  1943  NRGDHSEETVVTLVKDCLDLSRKFRKFKISHIMREGNRCADWLANYGQ  2086
             ++G +  + ++  ++ CL +       +ISHI REGN+ AD+L+ +G 
Sbjct  1261  HKGSYKIQYLLESIRKCLQVI----SVRISHIHREGNQAADFLSKHGH  1304


 Score = 27.7 bits (60),  Expect(3) = 1e-16, Method: Composition-based stats.
 Identities = 18/52 (35%), Positives = 30/52 (58%), Gaps = 5/52 (10%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNV  1041
             RWR+G G  + FW D W+ D+ L ++      +++   KV+ F  DD +W+V
Sbjct  889   RWRIGKG-DIFFWHDAWMGDEPL-VNSFPSFSQSMM--KVNYFFNDD-AWDV  935



>ref|XP_006584439.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=396

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/263 (27%), Positives = 107/263 (41%), Gaps = 28/263 (11%)
 Frame = +3

Query  1110  VDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-------ENWPWLWKLNCVEKVKTLLW  1268
             ++ +  DT+ W  + +  F   +AY  +    +       EN  W+W +   + +K  LW
Sbjct  144   LNSTIADTVIWSAAQNHVFMAKTAYWWLQSQANVSLGAQAENNSWMWLMKIPQNIKFFLW  203

Query  1269  LLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLK  1448
             L     + T      RHL  +  C RC ++ ES++HL  DC  A   W   +        
Sbjct  204   LTSHKSLPTKFFLVYRHLSSNPFCCRCSNQVESVLHLLRDCDKACSVWSMFQPTLVVDFA  263

Query  1449  NHLLMNAWIESNV--HSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKL  1622
              H       +S+V  H       GA     F    W IW+ RN + F+N +     +A  
Sbjct  264   EH-------DSSVWLHKHATCATGA----LFCLICWFIWRDRNAMTFSNENWQEWFIASQ  312

Query  1623  A---CTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIV  1793
                     S  +    R+  T Q     V W PP P  +K+N DG+     G +  GG++
Sbjct  313   VNNMLNIISNQQECQPRNRYTVQ-----VAWKPPPPTVLKLNTDGSSLVNPGQSGFGGVI  367

Query  1794  RDDHGCWVIGFATKIGVTDSFSA  1862
             RD    W+IG+    GVT S  A
Sbjct  368   RDSQRDWIIGYTGSCGVTTSLQA  390



>ref|XP_004309110.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=872

 Score = 92.4 bits (228),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 120/300 (40%), Gaps = 35/300 (12%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENWPW  1223
             +  LL      + N I  +P+ ++ S  D L WQ S++G      A+  +        PW
Sbjct  469   LPPLLQLNLSAVCNLICQVPISINPSMEDKLIWQASSTGELTAKQAFLFLQ-QASPVVPW  527

Query  1224  ---LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
                LW    + ++    W +++G + +    +RR +   S C  C +  ESL H+F  C 
Sbjct  528   GKPLWSKFILPRMSLHAWKVMRGTVISYHLLQRRGVALVSRCEFCGNSTESLDHIFLHCS  587

Query  1395  FARECW-EAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAP-----WSITFVYTLWQI  1556
             FA   W   I  +    + N +       + V S  +  D +P     W I F   LW I
Sbjct  588   FAASVWNHFIYIFEIGLVPNTI-------AEVFSLGLAMDRSPQLKELWLICFTSILWYI  640

Query  1557  WKCRNNLIFNNNSETPVHVAKLACTF--ASEARAFIIRHGGTSQGC--------------  1688
             W  RN + F++ + +   V +L      AS   A    H      C              
Sbjct  641   WHARNQIRFDSRTFSVAGVCRLVSRHIQASSRLATGHMHNTIHDLCILKSFGACCRSRRI  700

Query  1689  --YNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
                  V W PP  GW+KIN DGA K   G+   G + R   G +V  FA+ I +  S +A
Sbjct  701   PRMVEVIWHPPSIGWIKINSDGAWKHEEGIGGFGAVFRYYKGQFVGAFASHIDIPSSIAA  760


 Score = 23.1 bits (48),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 11/20 (55%), Gaps = 0/20 (0%)
 Frame = +1

Query  871  VEIRARWRVGDGKSLDFWSD  930
            V+   RW VG G  + FW D
Sbjct  415  VQNNTRWLVGTGDKISFWRD  434



>ref|XP_006492749.1| PREDICTED: uncharacterized protein LOC102612946 [Citrus sinensis]
Length=589

 Score = 89.0 bits (219),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/264 (26%), Positives = 107/264 (41%), Gaps = 41/264 (16%)
 Frame = +3

Query  1089  IRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI-----------SCTVDENWPWLWKL  1235
             IR IP+P      D + W  +  G + V S Y L            S    + W  +W+L
Sbjct  219   IRNIPLPRTPQE-DMVIWHYNKKGIYSVKSGYQLALKIKFSESPAGSTGAPQGWQHIWRL  277

Query  1236  NCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWE  1415
             N  EK+K  +W   K  +       RR ++ + TC  C+   E + H   +C+ AR+ W+
Sbjct  278   NLPEKIKIFVWKATKNLLPMAENLWRRKVLKEPTCHLCKAGCEDVFHALMECRVARKIWK  337

Query  1416  --AIETYGGKTLKNHLL------MNAWIESNVHSKIVTNDGAPWSITFVYTLWQI-WKCR  1568
                +E      ++  +L      MN W +S V               +V T+W + W  R
Sbjct  338   CTHLENEVKSVIREDMLSVMIGAMNNWAKSEV--------------DYVATIWWVAWHAR  383

Query  1569  NNLIFNNNSETPVHVAKLACTFASEARAFIIR----HGGTSQGCYNWVTWTPPQPGWVKI  1736
             N L+F      P+       T     +A  ++    H  T +G      WTPP    VK+
Sbjct  384   NKLLFQGKKLDPIGSVAKGKTVMEVYQAQQVKERESHRNTVKGKMQ--IWTPPPNNKVKV  441

Query  1737  NIDGAMKSCTGLASAGGIVRDDHG  1808
             N+D A+K     A  G ++R+  G
Sbjct  442   NVDAAVKEDRKSAGLGVVIRNHRG  465


 Score = 26.2 bits (56),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 27/56 (48%), Gaps = 4/56 (7%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEID-IPKNLYDKKVSNFIKDDRSWNVTLM  1050
             RWR+G+G+ +   S  W+   S    + +  +P    + KVS  +  +  WN  ++
Sbjct  155   RWRIGNGEKIQIHSSNWIPKPSTFKPILVQSLPT---ESKVSELLDQNLQWNEIMI  207



>ref|XP_008346905.1| PREDICTED: uncharacterized protein LOC103409892 [Malus domestica]
Length=1251

 Score = 89.7 bits (221),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 124/295 (42%), Gaps = 26/295 (9%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS--CTVDENW  1217
             + ++ +    +L  +I  +P+P+D+   D L W+ STSG F  +  Y ++     V    
Sbjct  845   IPSIFSXXFXDLTKEILXMPLPIDEDK-DVLIWEXSTSGXFSFSDGYEIVRHRFPVKSXA  903

Query  1218  PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
               +W+     +   L+W +L  ++ T    +RR +     C  C    ES+ HLF  C F
Sbjct  904   SIIWRPFIPPRYSILVWKILFNKLPTEDXLQRRGIPLAPICQLCHKNSESIDHLFSSCXF  963

Query  1398  ARECWEAIET-YGGKTLKNHLLMNAWIE--SNVHSKIVTNDGAPWSITFVYTLWQIWKCR  1568
             A+  W  + T +G        L + W++  S   S  + N    W  +  + L  IWK R
Sbjct  964   AQCAWRWLATQFGTIIXXTGSLSDLWLDFLSKRFSPHLRNX---WLASGFFLLMAIWKMR  1020

Query  1569  NNLIFNNNSETPVHVAKLACTFASEA-------------RAFIIRHGGTSQGCYNW----  1697
             N + F     +   + +    +  +              R  ++  G +   C       
Sbjct  1021  NKVKFEGKPPSFSRLCRSTSAWIRQVGALTPGHVRGXLDRQLLVSLGISPNXCKAPSIVP  1080

Query  1698  VTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             V W PP   WVK+N DG  K   G A+ GG+ RD  G ++ GF+  +G   SF A
Sbjct  1081  VLWHPPXFSWVKVNTDGLAKGNPGPAACGGVFRDSAGYFLGGFSLSLGHRTSFYA  1135


 Score = 25.0 bits (53),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 20/46 (43%), Gaps = 0/46 (0%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
              RW +G+G +   W   W++     +     I  +    KVSN I+
Sbjct  794   CRWVIGNGXTTSLWVXKWLDKPIXDVXGATXIAXSXSRTKVSNIIR  839



>ref|XP_010026656.1| PREDICTED: uncharacterized protein LOC104417027 [Eucalyptus grandis]
Length=1695

 Score = 88.2 bits (217),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 102/262 (39%), Gaps = 24/262 (9%)
 Frame = +3

Query  1077  LVNKIRAIPV-PVDDSTVDTLTWQDSTSGTFFVASAY-SLISCTVDEN------------  1214
             +V ++  IP+ P+   T D L W  S  G + V S Y SL    V  +            
Sbjct  1305  IVREVIKIPIRPL--FTSDQLIWAASKDGIYSVKSNYQSLHFSEVPRSVNGASSSNSQDS  1362

Query  1215  --WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDE-EESLVHLFC  1385
               W  +W ++   KV+  LW +    + T     RRH+  D  C  C  +  E++ H+F 
Sbjct  1363  LIWKRIWTMSTEPKVRMFLWSVFHNALATKDNLFRRHITSDPICDLCNQQTPETIEHIFF  1422

Query  1386  DCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
              C + +E W+  +            +  WI + V  K       P      Y LWQIW+ 
Sbjct  1423  SCSWTKEIWKHPDLIALNIQTTVHSIAGWIATQVRQK----SSVPGLAFIAYVLWQIWRG  1478

Query  1566  RNNLIFNNNSETPVHVAKLA-CTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINI  1742
             RN+ +F +       V   A     S  R    R    S   Y+   W PP  G +K NI
Sbjct  1479  RNSFVFRHKQPKSHFVVPDARAQLNSYDRINPRRKKPQSNALYSEFLWRPPDRGAIKCNI  1538

Query  1743  DGAMKSCTGLASAGGIVRDDHG  1808
             DGA +      S   I RD  G
Sbjct  1539  DGAYQQGCNKGSMACISRDFKG  1560


 Score = 26.2 bits (56),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 0/37 (0%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYD  996
             RW VGDGK +    D W+   S+   +  D P+ + D
Sbjct  1247  RWSVGDGKRISIRQDQWLPIGSIPGPLARDEPQIVAD  1283



>ref|XP_008358855.1| PREDICTED: uncharacterized protein LOC103422573 [Malus domestica]
Length=1419

 Score = 86.7 bits (213),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 69/293 (24%), Positives = 121/293 (41%), Gaps = 22/293 (8%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP  1220
             + ++ +    +L  +I  +P+P+D+   D L W+ S SG F  +  Y ++      ++W 
Sbjct  978   IPSIFSXXFPDLTKEILEMPLPIDEDK-DVLIWEXSXSGXFSFSDGYEIVRHRFPVKSWA  1036

Query  1221  -WLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
               +W      +   L+W +L  ++ T  + +RR +     C  C    ES+ HLF  C F
Sbjct  1037  SIIWXPFIPPRYSILVWKILFNKLPTEDQLQRRGIXLAPICQLCHKNSESIBHLFSSCXF  1096

Query  1398  ARECWEAIET-YGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
             A+  W  + T +G        L + W+   +  +   +    W  +  + L  IWK RN 
Sbjct  1097  AQCAWRWLATQFGTXIXPXGSLSDLWLXF-LSKRFSPHLXNVWLASGFFLLMAIWKMRNK  1155

Query  1575  LIFNNNSETPVHVAKLACTFASEA-------------RAFIIRHGGTSQGCYN----WVT  1703
             + F     +   + +    +  +              R  ++  G +   C         
Sbjct  1156  VKFEGKPPSFSRLCRSTXAWIRQVGALTPGHVRGXLDRQLLVSLGISPNXCKAPSIVXXX  1215

Query  1704  WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             W PP   W K+N DG  K   G A+ GG+ RD  G ++ GF+  +G   SF A
Sbjct  1216  WHPPPXSWXKVNTDGLAKGNPGXAACGGVFRDSXGYFLGGFSLSLGHRTSFYA  1268


 Score = 27.7 bits (60),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 13/44 (30%), Positives = 21/44 (48%), Gaps = 0/44 (0%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFI  1017
             RW +G+G +   W D W++   + +     I  +    KVSN I
Sbjct  928   RWVIGNGSTTSLWVDKWLDKPIVDVVGATXIAPSXSRTKVSNII  971



>ref|XP_008341993.1| PREDICTED: uncharacterized protein LOC103404803 [Malus domestica]
Length=1433

 Score = 93.6 bits (231),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 79/180 (44%), Gaps = 0/180 (0%)
 Frame = +3

Query  1302  ERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIES  1481
             +R +R   +D  C  C   EES  H+F  C+ +   W  +           L   +W+  
Sbjct  1131  KRAKRGFTNDPCCPICPTVEESXDHIFRYCRHSPSFWNNVGIPLEVAHSFALDFQSWMAI  1190

Query  1482  NVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFII  1661
             N+ +   T  G PW++ F  TLW  WK RNN  FNN  + PV   K+   FA +      
Sbjct  1191  NLRTHCSTIHGLPWNLIFASTLWYCWKRRNNFXFNNGQQPPVSPLKVIFQFARDWYDANK  1250

Query  1662  RHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
                         + W  P  G  KIN DG+ K      SAGG++R+  G W+ GFA  +G
Sbjct  1251  CXSSKPPRQIISIHWIRPPIGRYKINTDGSCKDXFSHISAGGLIRNSEGDWIXGFAANLG  1310



>ref|XP_009144812.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=389

 Score = 87.4 bits (215),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 72/270 (27%), Positives = 113/270 (42%), Gaps = 42/270 (16%)
 Frame = +3

Query  1053  LLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS------CTVDEN  1214
             +  F+ +E   ++ A+ V       D L W  + +G F V SA+ LI+        + E 
Sbjct  81    IAPFVTDETRLELAAVVVDTVMEGEDRLAWGHTNNGQFTVKSAHDLITHDDTPRPYMGEF  140

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             +  +W +  +E+V+  LWL+ +  + TN ER RRHL     C  C+ E E+++H+  DC 
Sbjct  141   FRGMWHVVALERVRIFLWLVGQQAIMTNAERYRRHLSGTDVCQVCKGEIETILHVLRDCP  200

Query  1395  FARECWE----AIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWK  1562
                  WE    A++ Y        LL   W+  N+    V   G PWS +F   +W  WK
Sbjct  201   AMSGIWERLVPAVKRY--SFFSKPLL--EWLYENLRENGVGR-GVPWSTSFALAIWWGWK  255

Query  1563  CRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNW-VTWTPPQPGWVKIN  1739
              R   +F  N        +L               GG  +  + W   W P         
Sbjct  256   WRCCNVFGEN--------RLWRDRDRNTGEMDYPSGGVDEDEHRWGFIWNP---------  298

Query  1740  IDGAMKSCTGLASAGGIVRDDHGCWVIGFA  1829
                      G A+AGG+++++ G W  GFA
Sbjct  299   ---------GPAAAGGVMQNEEGEWCGGFA  319


 Score = 26.6 bits (57),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 27/48 (56%), Gaps = 6/48 (13%)
 Frame = +1

Query  829  ITSASSSTTIRLMGVEIR------ARWRVGDGKSLDFWSDWWVNDKSL  954
            +   + S+T R + + IR        W +G+G+ + FW+D W++++ L
Sbjct  2    VARKNGSSTWRSVALGIREVVSKGHSWVMGNGREIKFWTDRWLSNQPL  49



>ref|XP_006490008.1| PREDICTED: uncharacterized protein LOC102624085 [Citrus sinensis]
Length=1635

 Score = 93.2 bits (230),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 82/182 (45%), Gaps = 4/182 (2%)
 Frame = +3

Query  1062  FLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN----WPWLW  1229
              L   ++ KI ++  P      D+  W  S++G F V SAY L+   +       W  +W
Sbjct  1432  LLPNNILLKIASVHPPTASHGADSFFWGASSNGNFSVKSAYELLDDPIGNGDHSFWCLVW  1491

Query  1230  KLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAREC  1409
                    ++  LWLLL GR+ T  E  RRHLID + C RC    E ++H   DC  AR  
Sbjct  1492  SWKGPHSIRVFLWLLLHGRLKTKKELNRRHLIDSTQCDRCGGPVEDILHTLRDCVTARRV  1551

Query  1410  WEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNN  1589
             W  +             ++ W++ N+  K        W + F   +W++W  RNN +FN+
Sbjct  1552  WSHLLPNNYPHSFFLCPLSDWLQMNLMRKKNNTSQEYWRVCFGVAVWRLWFWRNNFLFNH  1611

Query  1590  NS  1595
              S
Sbjct  1612  GS  1613



>ref|XP_010058710.1| PREDICTED: uncharacterized protein LOC104446568 [Eucalyptus grandis]
Length=1356

 Score = 90.1 bits (222),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 69/272 (25%), Positives = 110/272 (40%), Gaps = 27/272 (10%)
 Frame = +3

Query  1107  PVDDSTV-DTLTWQDSTSGTFFVASAYSLISCTVDE----------NWPWLWK----LNC  1241
             P++ S + D L W ++ SGT+ V S Y  +S    +          N P LW+    +  
Sbjct  1016  PINPSLLHDQLVWTETPSGTYIVKSCYYYLSLQYQQPTHKPSSSYTNPPLLWRKIWHMCT  1075

Query  1242  VEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDE-EESLVHLFCDCQFARECWEA  1418
               K++  LWL  K  + T     +RH+I    C+ C +   ES+ HLF  C +  + W  
Sbjct  1076  APKIRVFLWLACKNAIATQHNLYQRHIIPHPYCSLCNNSVPESIEHLFFFCPWTNDIWNH  1135

Query  1419  IETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSE  1598
              E     +  +    +AWI      +      +P      + LW+IW+ RNN +F     
Sbjct  1136  EEIRVKISPTSVSRFDAWIV----DRASLPQASPEFEVVAHILWEIWRQRNNAVFRQIPP  1191

Query  1599  TPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVT----WTPPQPGWVKINIDGAMKSCT  1766
              P+ V   A T   +   F +      +     V+    W PP  G++K NIDGA +  +
Sbjct  1192  DPLQVVNDALT---QTTIFKVLQPSPQKIKNKLVSLEQRWKPPAEGYIKCNIDGAYRKES  1248

Query  1767  GLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
                +   I RD  G         +    +F A
Sbjct  1249  ETGTITCIYRDSKGILTDVHTRSVPAQSAFQA  1280


 Score = 23.5 bits (49),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 16/62 (26%), Positives = 27/62 (44%), Gaps = 6/62 (10%)
 Frame = +1

Query  868   GVEIRARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRS-WNVT  1044
              +  + RW VGDG  +    D W+    +G      +P+    + V+N I    S W  +
Sbjct  944   AITPKLRWLVGDGSQIHIREDNWLPIGPIG-----GLPEEGEPELVANLIDLQHSEWKSS  998

Query  1045  LM  1050
             L+
Sbjct  999   LV  1000



>ref|XP_007224406.1| hypothetical protein PRUPE_ppa021713mg, partial [Prunus persica]
 gb|EMJ25605.1| hypothetical protein PRUPE_ppa021713mg, partial [Prunus persica]
Length=406

 Score = 90.5 bits (223),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 98/266 (37%), Gaps = 80/266 (30%)
 Frame = +3

Query  1065  LREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENWPWLWKLNCV  1244
             L E +V  I  +   +  S  D   W+ + +G+F                  ++W L   
Sbjct  153   LPETIVQMILCVHAGLPSSGNDKCIWRHTGNGSF-----------------TFIWNLPVP  195

Query  1245  EKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIE  1424
              K+KT LW +  G++ TNV+R+RR L     C+RC    E++ HLF  C ++   W+ + 
Sbjct  196   PKIKTFLWTVCHGKLLTNVQRQRRGLTQVPACSRCNYPMETIAHLFMYCPYSLSIWDNLP  255

Query  1425  TYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETP  1604
             T              W+  N+ SK     G PW + F   +W IWK R            
Sbjct  256   T-------------EWLLKNLQSKKKVYHGLPWHLVFTNFMWFIWKWRT-----------  291

Query  1605  VHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAG  1784
                                                    G  KIN DG+    +G   AG
Sbjct  292   ---------------------------------------GTCKINTDGSRSPSSGSIGAG  312

Query  1785  GIVRDDHGCWVIGFATKIGVTDSFSA  1862
             G++RD  G W  GF+  +G+     A
Sbjct  313   GLLRDTTGEWSKGFSVNLGIGSVLEA  338



>ref|XP_006464882.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=769

 Score = 85.1 bits (209),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 111/276 (40%), Gaps = 31/276 (11%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---------SC  1199
             D +     +E   +I  IP+P   S  D + W     G + V S Y L          S 
Sbjct  384   DVIRQHFHQEDAAQILKIPLPRQLSP-DQVLWHYDKKGNYSVKSGYQLALQMKFPNRPSS  442

Query  1200  TVDENWPW--LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLV  1373
             + ++N  W  +W L   EKVK  +W      + T+    +R ++    C RCR   E++ 
Sbjct  443   SKEDNNSWNSIWYLQIPEKVKIFMWRATNDLLPTSENLWKRRILQTPWCQRCRSHRETIF  502

Query  1374  HLFCDCQFARECW------EAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITF  1535
             H   DC+ +R+ W      E ++    K + + LL  A   S    +++           
Sbjct  503   HSLFDCKASRKIWKLTTFEEEVKALKCKDVLSLLLALADRRSKTEMELI-----------  551

Query  1536  VYTLWQIWKCRNNLIFNNNSET-PVHVAKLACTFASEARAFIIR-HGGTSQGCYNWVTWT  1709
             V   W IW  RN  IF N  E   + VA       S  R  + +    ++Q   +   W 
Sbjct  552   VAVCWSIWHSRNLFIFQNKKEDFQLSVAGAEAIVQSYKRIQMPQLQAFSNQDLVSHKHWK  611

Query  1710  PPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWV  1817
              P  GW K+N+D A+K        G ++R+  G ++
Sbjct  612   CPPAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFI  647


 Score = 28.5 bits (62),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 2/50 (4%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSW  1035
             RWR+GDGK +  +   W+          I  P    D  VS  I +D+ W
Sbjct  334   RWRIGDGKLVKVYQSGWLPRPETF--KPISPPSLPLDTTVSVLIDEDQCW  381



>ref|XP_006493122.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X2 [Citrus sinensis]
Length=765

 Score = 84.7 bits (208),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 110/276 (40%), Gaps = 31/276 (11%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---------SC  1199
             D +     +E   +I  IP+P   S  D + W     G + V S Y L          S 
Sbjct  384   DVIRQHFHQEDAAQILKIPLPRQLSP-DQVLWHYDKKGNYSVKSGYQLALQMKFPNRPSS  442

Query  1200  TVDENWPW--LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLV  1373
             + ++N  W  +W L   EKVK  +W      + T+    +R ++    C RCR   E++ 
Sbjct  443   SKEDNNSWNSIWYLQIPEKVKIFMWRATNDLLPTSENLWKRRILQTPWCQRCRSHRETIF  502

Query  1374  HLFCDCQFARECW------EAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITF  1535
             H   DC+ +R+ W      E ++    K + + LL  A   S    +++           
Sbjct  503   HSLFDCKASRKIWKLTTFEEEVKALKCKDVLSLLLALADRRSKTEMELI-----------  551

Query  1536  VYTLWQIWKCRNNLIFNNNSET-PVHVAKLACTFASEARAFIIR-HGGTSQGCYNWVTWT  1709
             V   W IW  RN  IF N  E   + VA       S  R  + +    + Q   +   W 
Sbjct  552   VAVCWSIWHSRNLFIFQNKKEDFQLSVAGAEAIVQSYKRIQMPQLQAFSDQDLVSHKHWK  611

Query  1710  PPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWV  1817
              P  GW K+N+D A+K        G ++R+  G ++
Sbjct  612   CPPAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFI  647


 Score = 28.5 bits (62),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 2/50 (4%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSW  1035
             RWR+GDGK +  +   W+          I  P    D  VS  I +D+ W
Sbjct  334   RWRIGDGKLVKVYQSGWLPRPETF--KPISPPSLPLDTTVSVLIDEDQCW  381



>ref|XP_008349386.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=327

 Score = 89.4 bits (220),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 114/280 (41%), Gaps = 38/280 (14%)
 Frame = +3

Query  1098  IPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP-WLWKLNCVEKVKTLLWL  1271
             +P+P+D+   D L W+ STSG F  +  Y ++      ++W   +W+     +   L+W 
Sbjct  1     MPLPIDEDK-DVLIWEVSTSGVFSFSDGYEIVRRRFPVKSWASIIWRPFIPPRYSILVWK  59

Query  1272  LLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIET-YGGKTLK  1448
             +L  ++ T  + +RR +     C  C    ES+ HLF  C+FA+  W  + T +G     
Sbjct  60    ILSNKLQTEDQLQRRGIPLTPICQLCHKNFESIDHLFSSCEFAQCAWRWLATQFGTIXPP  119

Query  1449  NHLLMNAWIE--SNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSE--------  1598
                L + W+   S   S  + N    W  +  + L  IWK RN + F             
Sbjct  120   TGSLSDLWLVFLSKRFSPHLRNV---WIASGFFLLMAIWKMRNKVKFEGKPPSFSRLCRS  176

Query  1599  -----------TPVHVAKLACTFASEARAFIIRHGGTSQGCYNW----VTWTPPQPGWVK  1733
                        TP HV  +        R  ++  G +   C       V W PP   WVK
Sbjct  177   TLAWIRQVGALTPGHVRGIL------DRQLLVSLGISPNSCKAPSIVPVLWHPPHFSWVK  230

Query  1734  INIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDS  1853
             +N DG  K   G A+ GG+ RD  G  V      +G+  S
Sbjct  231   VNTDGLAKGNPGPAACGGVFRDSAGNVVADKLANLGLLSS  270



>ref|XP_010054376.1| PREDICTED: uncharacterized protein LOC104442671 [Eucalyptus grandis]
Length=1509

 Score = 88.6 bits (218),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 113/299 (38%), Gaps = 48/299 (16%)
 Frame = +3

Query  1053  LLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS----CTVDEN--  1214
             L  F  E+   +I  IPV   + T D L W ++T+G + + SAY  +     C +     
Sbjct  1110  LNNFYDEQTTAEILRIPV-RRNLTQDKLVWTETTNGQYTIRSAYHSVRKASICKLTRQAS  1168

Query  1215  ---------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCR-DEEE  1364
                      W  +W +    K+K   W +    + T     RR +  D  C  C  ++ E
Sbjct  1169  SSYQQPPQLWKCIWSVKLPPKLKVFFWSVCHNALPTKENLFRRRITPDPICPLCTLNQPE  1228

Query  1365  SLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESN--------VHSKIVTNDGAP  1520
             S+ HLF  C +    W            +H  +N  I++         +  +I+     P
Sbjct  1229  SIEHLFLLCPWTTAIW------------SHPTINIHIDTTTVRRIDEWIVDRILHKKSKP  1276

Query  1521  WSITFVYTLWQIWKCRNNLIFNNNSETP---VHVAKLACTFASEARAFIIRHG---GTSQ  1682
                 F+   WQ+WK RN  IF+ +   P   VH A     FA    A I  H       Q
Sbjct  1277  DLELFIAVCWQVWKARNGAIFSKHQPDPHFGVHAA-----FAQVRSAAICDHSLMTKPKQ  1331

Query  1683  GCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFS  1859
                    W PP PG ++INIDGA  S     S   I RD  GC   G    +    +  
Sbjct  1332  SVDLGHFWQPPAPGTLRINIDGAYTSGHTEGSIAFICRDKSGCLQEGLTRSVQAASALQ  1390


 Score = 24.6 bits (52),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 8/18 (44%), Positives = 13/18 (72%), Gaps = 0/18 (0%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWV  939
             +W VGDGK+++   D W+
Sbjct  1060  QWSVGDGKNINIREDRWL  1077



>ref|XP_006493121.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X1 [Citrus sinensis]
Length=968

 Score = 84.3 bits (207),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 110/276 (40%), Gaps = 31/276 (11%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---------SC  1199
             D +     +E   +I  IP+P   S  D + W     G + V S Y L          S 
Sbjct  587   DVIRQHFHQEDAAQILKIPLPRQLSP-DQVLWHYDKKGNYSVKSGYQLALQMKFPNRPSS  645

Query  1200  TVDENWPW--LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLV  1373
             + ++N  W  +W L   EKVK  +W      + T+    +R ++    C RCR   E++ 
Sbjct  646   SKEDNNSWNSIWYLQIPEKVKIFMWRATNDLLPTSENLWKRRILQTPWCQRCRSHRETIF  705

Query  1374  HLFCDCQFARECW------EAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITF  1535
             H   DC+ +R+ W      E ++    K + + LL  A   S    +++           
Sbjct  706   HSLFDCKASRKIWKLTTFEEEVKALKCKDVLSLLLALADRRSKTEMELI-----------  754

Query  1536  VYTLWQIWKCRNNLIFNNNSET-PVHVAKLACTFASEARAFIIR-HGGTSQGCYNWVTWT  1709
             V   W IW  RN  IF N  E   + VA       S  R  + +    + Q   +   W 
Sbjct  755   VAVCWSIWHSRNLFIFQNKKEDFQLSVAGAEAIVQSYKRIQMPQLQAFSDQDLVSHKHWK  814

Query  1710  PPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWV  1817
              P  GW K+N+D A+K        G ++R+  G ++
Sbjct  815   CPPAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFI  850


 Score = 28.9 bits (63),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 2/50 (4%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSW  1035
             RWR+GDGK +  +   W+          I  P    D  VS  I +D+ W
Sbjct  537   RWRIGDGKLVKVYQSGWLPRPETF--KPISPPSLPLDTTVSVLIDEDQCW  584



>ref|XP_008224763.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=468

 Score = 89.0 bits (219),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 79/295 (27%), Positives = 119/295 (40%), Gaps = 36/295 (12%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY-------------  1184
             +D +   L  E +N IR+ P+ +     D L W  + +G+F V S Y             
Sbjct  56    LDLIADCLDRETINLIRSTPISLSPRP-DRLVWPWNPNGSFSVRSGYHRFHTSKNGPLLQ  114

Query  1185  -SLISCTVDEN-WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDE  1358
              +  S +VD   W  +W +  + K+K  LW  + G + + +   RR L+ +  C  C   
Sbjct  115   HTYSSHSVDAKVWKVIWNIKTLPKIKHFLWRAISGAISSRLALFRRKLVTNPLCPICNCF  174

Query  1359  EESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAW--IESNVHSKIVTNDGAPWSIT  1532
             EES+ H+   C +    W       G      ++ NA+  ++  +H  +   D       
Sbjct  175   EESVEHILFLCPWTHPVW------FGSVFSYRIIPNAFTTLDRWLHDMLSIPDTPHEDFL  228

Query  1533  FVYTL-----WQIWKCRNNLIFNNNSETPVHVAKLACTFAS---EARAFIIRHGGT----  1676
               ++L     W+IWK R + +F   +  P  V K A    S   EA     R  G+    
Sbjct  229   HRFSLLSFLCWEIWKARCDFVFKGTNPDPRLVIKRANDSYSEFWEANTCFSRLSGSRTSP  288

Query  1677  SQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
             S        W PP    +KIN DGA    T   S G I RDD G W  G A+ I 
Sbjct  289   SSPYVGRDRWLPPPANAIKINFDGAWSPGTSHGSIGVIARDDCGTWRGGTASPIS  343


 Score = 24.3 bits (51),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 12/59 (20%), Positives = 28/59 (47%), Gaps = 1/59 (2%)
 Frame = +1

Query  877   IRARWRVGDGKSLDFWSDWWVNDKSLG-LDMEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             + A++++ +G + + W D W++  + G +     +P            K + SWN+ L+
Sbjct  1     MEAKFQIFNGATTNIWKDNWISASNSGVIKPTCPVPITAPQLVCEIMDKPNHSWNLDLI  59



>ref|XP_004309882.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=152

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 67/125 (54%), Gaps = 3/125 (2%)
 Frame = +3

Query  1062  FLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY-SLISCTVDENWPW--LWK  1232
             FL E++  KI ++      S  DT+ W+ S +G F V SAY SL   +  E WPW  +WK
Sbjct  5     FLPEDVKLKILSMHAGGIQSGDDTIIWKLSHNGKFTVKSAYHSLFLNSETEPWPWDFIWK  64

Query  1233  LNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECW  1412
             L    KVK  LW L+  R+ TN  R RR L  D+ C RC    ESL HLF DC  +   W
Sbjct  65    LQVPPKVKIFLWTLIHDRLLTNKARVRRGLAIDALCPRCNFPLESLDHLFKDCTISTRIW  124

Query  1413  EAIET  1427
              A+ +
Sbjct  125   SALHS  129



>ref|XP_009102110.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=712

 Score = 90.5 bits (223),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 123/281 (44%), Gaps = 33/281 (12%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENW--  1217
             +D L   + +E + KI  + +    +  D + W  + +G + V S Y L++   D N+  
Sbjct  314   LDKLREDVIQEDIEKILELKIS-SKARQDLMGWHYTDNGLYTVKSGYWLVTHLPDNNYIP  372

Query  1218  ---------PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESL  1370
                        LWK+    K+K  LW +    + T    +RRH+  D+ C RC  EEE+ 
Sbjct  373   PTYGSVALKQKLWKVKVPAKLKHFLWRISSRSIATGNNLKRRHVTPDAICKRCWLEEETE  432

Query  1371  VHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITF-----  1535
              HLF  C +A++ W A          N+L++++ + S    K+        +I+      
Sbjct  433   EHLFFTCPYAKKVWRASGI-------NNLVLDSTM-STYEEKLEACLQVSTAISLSHYQD  484

Query  1536  --VYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQG------CY  1691
               ++ LW++WK RN L+F        ++   A + A E R    +    S G        
Sbjct  485   LPIWILWRLWKSRNVLVFQQRDFHWKNILSAARSDAREWRNIETQDNNASDGHSISPTSR  544

Query  1692  NWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCW  1814
             +   W  P   W+K N+D +       +SAG ++RD+HG +
Sbjct  545   SSQRWKAPPNRWLKCNVDASFIDTREPSSAGWVIRDEHGIY  585


 Score = 22.3 bits (46),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 7/19 (37%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +1

Query  886  RWRVGDGKSLDFWSDWWVN  942
            R+ +G+G+S   W+D W++
Sbjct  264  RYIIGNGESTKMWTDSWLS  282



>ref|XP_008233458.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=811

 Score = 88.6 bits (218),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 79/294 (27%), Positives = 119/294 (40%), Gaps = 36/294 (12%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY-------------  1184
             +D +   L  E +N IR+ P+ +     D L W  + +G+F V S Y             
Sbjct  399   LDLIADCLDRETINLIRSTPISLSPRP-DRLVWPWNPNGSFSVRSGYHRFHTSKNGPLLQ  457

Query  1185  -SLISCTVDEN-WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDE  1358
              +  S +VD   W  +W +  + K+K  LW  + G + + +   RR L+ +  C  C   
Sbjct  458   HTYSSHSVDAKVWKVIWNIKTLPKIKHFLWRAISGAISSRLALFRRKLVTNPLCPICNCF  517

Query  1359  EESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAW--IESNVHSKIVTNDGAPWSIT  1532
             EES+ H+   C +    W       G      ++ NA+  ++  +H  +   D       
Sbjct  518   EESVEHILFLCPWTHPVWF------GSVFSYRIIPNAFTTLDRWLHDMLSIPDTPHEDFL  571

Query  1533  FVYTL-----WQIWKCRNNLIFNNNSETPVHVAKLACTFAS---EARAFIIRHGGT----  1676
               ++L     W+IWK R + +F   +  P  V K A    S   EA     R  G+    
Sbjct  572   HRFSLLSFLCWEIWKARCDFVFKGTNPDPRLVIKRANDSYSEFWEANTCFSRLSGSRTSP  631

Query  1677  SQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKI  1838
             S        W PP    +KIN DGA    T   S G I RDD G W  G A+ I
Sbjct  632   SSPYVGRDRWLPPPANAIKINFDGAWSPGTSHGSIGVIARDDCGTWRGGTASPI  685


 Score = 24.3 bits (51),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 12/59 (20%), Positives = 28/59 (47%), Gaps = 1/59 (2%)
 Frame = +1

Query  877   IRARWRVGDGKSLDFWSDWWVNDKSLG-LDMEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             + A++++ +G + + W D W++  + G +     +P            K + SWN+ L+
Sbjct  344   MEAKFQIFNGATTNIWKDNWISASNSGVIKPTCPVPITAPQLVCEIMDKPNHSWNLDLI  402



>gb|EPS69206.1| hypothetical protein M569_05560, partial [Genlisea aurea]
Length=474

 Score = 75.9 bits (185),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/264 (27%), Positives = 106/264 (40%), Gaps = 34/264 (13%)
 Frame = +3

Query  1080  VNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN--------------W  1217
             V+ I AIP+   +   D L W  +  G + V + Y L+  T + N              W
Sbjct  102   VHCILAIPL-AKNPYPDRLIWHFTRQGEYSVKTGYQLLKSTSEMNSPGSSRSNANKILMW  160

Query  1218  PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
               LWKL    ++ T  W   K  +       RR +  D TC+ C ++ E+  H F  C F
Sbjct  161   QALWKLKLPMRILTFNWRFGKHILPLKDSLVRRRIGTDPTCSACEEDRETWFHAFISCSF  220

Query  1398  ARECWE----AIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
             ++  W     +++  G ++L        WI S  H ++ T   A      + TLW IW+ 
Sbjct  221   SQAVWRLGGFSMDMAGLESLHP----GDWILSRFH-QLHTEQFA----GLLVTLWSIWRH  271

Query  1566  RNNLIFNNNSETPVHVAKLACTFA-SEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINI  1742
             R +   N  +  P+    L   +  S   A   +             W  P  G+VK+N 
Sbjct  272   RLDHRHNQITLDPLRTHHLIRYYMDSSVSASQEQLDPPPLPPLPQQGWERPPAGFVKLNF  331

Query  1743  DGA--MKSCTGLASAGGIVRDDHG  1808
             D      S TGL   GG++RDD G
Sbjct  332   DSGRCTPSTTGL---GGLIRDDQG  352


 Score = 36.6 bits (83),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (54%), Gaps = 2/54 (4%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRS-WNVT  1044
             RWR+GDG S+D W D W+ D +         P  + + +V   I  +++ WN++
Sbjct  39    RWRIGDGSSIDVWKDPWIPD-TFAFKPSSPAPLGMANMRVKELIISNQAEWNLS  91



>ref|NP_001066197.2| Os12g0156200 [Oryza sativa Japonica Group]
 gb|ABA96496.2| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29216.2| Os12g0156200 [Oryza sativa Japonica Group]
Length=1764

 Score = 79.0 bits (193),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 105/265 (40%), Gaps = 41/265 (15%)
 Frame = +3

Query  1119  STVDTLTWQDSTSGTFFVASAYSLISCTVD-------------ENWPWLWKLNCVEKVKT  1259
             S  D + W    +G F V SAY L +  V+             + W  +WK    +KVK 
Sbjct  1127  SEEDFIAWHPDKNGMFSVRSAYRLAAQLVNIEESSSSGTNNINKAWEMIWKCKVPQKVKI  1186

Query  1260  LLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGK  1439
               W +    + T V +++R L     C  C  E E   H  C C  A + W  +   G  
Sbjct  1187  FAWRVASNCLATMVNKKKRKLEQSDMCQICDRENEDDAHALCRCIQASQLWSCMHKSGSV  1246

Query  1440  T--LKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHV  1613
             +  +K  +L   W+  +   KI   + A     F+ TLW+ W  RN LI +  S  P   
Sbjct  1247  SVDIKASVLGRFWL-FDCLEKIPEYEQA----MFLMTLWRNWYVRNELI-HGKSAPPTET  1300

Query  1614  AK--------LACTFASEARAFIIR----------HGGTSQGCYN--WVTWTPPQPGWVK  1733
             ++        L        +A +++           GG      N     W  P+ GW+K
Sbjct  1301  SQRFIQSYVDLLFQIRQAPQADLVKGKHVVRTVPLKGGPKYRVLNNHQPCWERPKDGWMK  1360

Query  1734  INIDGAMKSCTGLASAGGIVRDDHG  1808
             +N+DG+  + +G    G I+R+  G
Sbjct  1361  LNVDGSFDASSGKGGLGMILRNSAG  1385


 Score = 33.5 bits (75),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 27/52 (52%), Gaps = 4/52 (8%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWV-NDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNV  1041
             WRVG+G S+  W D W+  D S      I    N   K VS+ I +D SW+V
Sbjct  1055  WRVGNGNSIRIWRDSWLPRDHS---RRPITGKANCRLKWVSDLITEDGSWDV  1103



>ref|XP_008225175.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=583

 Score = 88.2 bits (217),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 79/294 (27%), Positives = 118/294 (40%), Gaps = 36/294 (12%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY-------------  1184
             +D +   L  E +N IR+ P+ +     D L W  +  G+F V S Y             
Sbjct  171   LDLIADCLDRETINLIRSTPISLSPRP-DRLVWPWNPDGSFSVRSGYHRFHTSKNGPLLQ  229

Query  1185  -SLISCTVDEN-WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDE  1358
              +  S +VD   W  +W +  + K+K  LW  + G + + +   RR L+ +  C  C   
Sbjct  230   HTYSSHSVDAKVWKVIWNIKTLPKIKHFLWRAISGAISSRLALFRRKLVTNPLCPICNCF  289

Query  1359  EESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAW--IESNVHSKIVTNDGAPWSIT  1532
             EES+ H+   C +    W       G      ++ NA+  ++  +H  +   D       
Sbjct  290   EESVEHILFLCPWTHPVW------FGSVFSYRIIPNAFTTLDRWLHDMLSIPDTPHEDFL  343

Query  1533  FVYTL-----WQIWKCRNNLIFNNNSETPVHVAKLACTFAS---EARAFIIRHGGT----  1676
               ++L     W+IWK R + +F   +  P  V K A    S   EA     R  G+    
Sbjct  344   HRFSLLSFLCWEIWKARCDFVFKGTNPDPRLVIKRANDSYSEFWEANTCFSRLSGSRTSP  403

Query  1677  SQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKI  1838
             S        W PP    +KIN DGA    T   S G I RDD G W  G A+ I
Sbjct  404   SSPYVGRDRWLPPPANAIKINFDGAWSPGTSHGSIGVIARDDCGTWRGGTASPI  457


 Score = 24.3 bits (51),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 12/59 (20%), Positives = 28/59 (47%), Gaps = 1/59 (2%)
 Frame = +1

Query  877   IRARWRVGDGKSLDFWSDWWVNDKSLG-LDMEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             + A++++ +G + + W D W++  + G +     +P            K + SWN+ L+
Sbjct  116   MEAKFQIFNGATTNIWKDNWISASNSGVIKPTCPVPITAPQLVCEIMDKPNHSWNLDLI  174



>ref|XP_008389974.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=805

 Score = 81.6 bits (200),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/284 (25%), Positives = 117/284 (41%), Gaps = 22/284 (8%)
 Frame = +3

Query  1071  EELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP-WLWKLNCV  1244
              +L  +I  +P+P+D+   D L W+ S+SG F  +  Y ++      ++W   +W+    
Sbjct  408   PDLTKEILEMPLPIDEDK-DVLIWEASSSGGFSFSDGYEIVRHRFPVKSWASIIWRPFIP  466

Query  1245  EKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIE  1424
              +   L+W +L  ++ T  + +RR +     C  C    ES+ HLF  C FA+  W  + 
Sbjct  467   PRYSILVWKILFNKLPTEDQLQRRGIPLAPXCQLCHKNSESIDHLFSSCDFAQCAWRWLA  526

Query  1425  TYGGKTLK-NHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS--  1595
             T  G  ++    L + W++  +  +   +    W  +  + L  IWK RN + F      
Sbjct  527   TQFGTIIQPTGSLSDLWLD-FLSKRFSPHLRNVWLASGFFLLMAIWKMRNKVKFEGKPPS  585

Query  1596  ------ETPVHVAKLACTFASEARAFIIRHGGTSQGCYN---------WVTWTPPQPGWV  1730
                    T   + ++        R  + R    S G             V W P    W 
Sbjct  586   FSRLCRSTXAWIRQVGALTPGHVRGILDRQLLVSLGISPNXCKAPSIVPVLWHPXPXSWX  645

Query  1731  KINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             K+N DG  K   G A  GG+ RD  G ++ GF+  +    SF A
Sbjct  646   KVNTDGLAKGNPGPAXCGGVFRDSXGYFLGGFSLSLXHRTSFYA  689


 Score = 30.4 bits (67),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 0/45 (0%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFI  1017
              RW +G+G +   W D W++   + +    +I  +L   KVSN I
Sbjct  348   CRWVIGNGSTTSLWVDKWLDKPIVDVVGATEIAPSLSRTKVSNII  392



>ref|XP_007224103.1| hypothetical protein PRUPE_ppa015621mg, partial [Prunus persica]
 gb|EMJ25302.1| hypothetical protein PRUPE_ppa015621mg, partial [Prunus persica]
Length=201

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 84/193 (44%), Gaps = 25/193 (13%)
 Frame = +3

Query  1284  RMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLM  1463
             ++ +N +R RRHL  +  C  C+   ES +H+  DC  AR+ W+        +    +  
Sbjct  1     KILSNEQRIRRHLTGNCACDYCKWPIESTLHILRDCSRARKVWDLFMNSTQASPFFQIDF  60

Query  1464  NAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASE  1643
             + W+ +N+ SK       PW I FV+                          L CT A +
Sbjct  61    HPWLLNNLCSK-AHFVQIPWRIMFVFIY------------------------LICTAAKD  95

Query  1644  ARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIG  1823
                 II     +      + W PP+ G VK+NIDG+ +  TG   AGG++RD  G W+ G
Sbjct  96    WFQAIINTNSGANKVQVLLAWVPPEIGLVKLNIDGSCRGSTGAIGAGGVLRDHLGQWIGG  155

Query  1824  FATKIGVTDSFSA  1862
             FA  +G  +   A
Sbjct  156   FAVNLGQGEVLEA  168



>ref|XP_006480463.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=459

 Score = 89.4 bits (220),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 115/269 (43%), Gaps = 33/269 (12%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSL----ISCTVDE  1211
             VD + +   E   N I  IP P   +  D   W  +TSG + V S Y L    +S    +
Sbjct  110   VDLISSKFDERDRNLILNIP-PSKRNEEDVWYWLANTSGVYSVKSTYRLLLGEVSDVAGD  168

Query  1212  NWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDC  1391
              W  +WKL    KV+  +W      + T V  R +H+  +  C     ++E+++HL  DC
Sbjct  169   MWRKIWKLEVPAKVRNFVWRAASNVLPTAVNLRSKHVSLNDLCLVGNFDKETVLHLLVDC  228

Query  1392  QFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRN  1571
              FAR CW  I++  G     +     W+++   +   TN+   W    V   W++W  RN
Sbjct  229   PFARSCW--IKSKVG-FFGIYSSFKDWLQALFRN--CTNEQC-W--IAVMVCWKLWCNRN  280

Query  1572  NLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGA  1751
             NL++    +T   +   A   A                    V W+PP+ GW+K NID  
Sbjct  281   NLVWQGKCDTTKQIVNAAGVGA--------------------VAWSPPRVGWLKCNIDAT  320

Query  1752  MKSCTGLASAGGIVRDDHGCWVIGFATKI  1838
             + +  G    G ++RD+ G +V      I
Sbjct  321   VFANEGRVGLGSVIRDESGKFVAALCCHI  349


 Score = 22.7 bits (47),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 29/57 (51%), Gaps = 2/57 (4%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSN-FIKDDRSWNVTLM  1050
             +R R+G+G      +D W+ D S GL +  D+  +L    V   F+   R W+V L+
Sbjct  58    SRIRIGNGTCTLIKNDPWLPDLSNGL-VSSDLDDDLSVATVKTLFVDGRREWDVDLI  113



>ref|XP_008221992.1| PREDICTED: uncharacterized protein LOC103321917 [Prunus mume]
Length=658

 Score = 78.2 bits (191),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 66/122 (54%), Gaps = 3/122 (2%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY-SLISCTVDENWP  1220
             +D L   L  E+V +I AI    +    D   W  S  G+F V SAY SL      E WP
Sbjct  377   LDTLEQVLHSEIVQRICAIHTGFESQRNDKCIWGLSNYGSFSVKSAYLSLFDDADFEPWP  436

Query  1221  W--LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W  LWKL   +K++T +WL+  G++ TNV+R +R +  +  C +C    E++ H+F  C+
Sbjct  437   WDFLWKLCLPQKLRTFVWLIGHGKILTNVQREKRLMTTNLNCQKCLSIPETMDHVFRGCR  496

Query  1395  FA  1400
             FA
Sbjct  497   FA  498


 Score = 33.5 bits (75),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 24/87 (28%), Positives = 41/87 (47%), Gaps = 9/87 (10%)
 Frame = +1

Query  805   VLQVQVKCITSASSSTTIR-----LMGVEIRAR---WRVGDGKSLDFWSDWWVNDKSLGL  960
             VL++ ++CIT+      +      L G +I  +   WR+G+G  + FW D W     L  
Sbjct  292   VLELLMQCITTVKYQAILNGERGNLFGAQILTKGLKWRLGNGDDILFWKDNWAGCGFLEE  351

Query  961   DMEIDIPKNLYDKKVSNFIKDDRSWNV  1041
                I + K++    V +F+  D  WN+
Sbjct  352   FSAIPLSKDMLLWTVRDFMF-DHGWNL  377



>ref|XP_007046404.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
 gb|EOY02236.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
Length=1954

 Score = 62.0 bits (149),  Expect(3) = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 119/297 (40%), Gaps = 32/297 (11%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENW--  1217
             VD L  +L   LV++I  + +P+D S  D   W  +++G F   SA+  I      N   
Sbjct  1554  VDKLNLYLPMNLVDEI--LQIPIDRSQDDVAYWSLTSNGEFSTRSAWEAIRLRKSPNVLC  1611

Query  1218  PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
               LW  +    +   LW +    +  ++  + +     S C  C + EESL+H+  D   
Sbjct  1612  SLLWHKSIPLSISFFLWRVFHNWIPVDIRLKEKGFHLASKCICC-NSEESLIHVLWDNPI  1670

Query  1398  ARECW----EAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
             A++ W     + + Y  K      ++  W  S  + +     G    +  ++  W +W  
Sbjct  1671  AKQVWNFFANSFQIYISKPQNVSQILWTWYLSGDYVR----KGHIRILIPLFICWFLWLE  1726

Query  1566  RNNLIFNNNSETPVHVA-KLACTFASEARAFIIRH---GGTSQGCYNWVTWTPPQ-----  1718
             RN+    +       V  K+          ++++     G       W  ++PP+     
Sbjct  1727  RNDAKHRHLGMYSDRVVWKIMKLLRQLQDGYLLKSWQWKGDKDFATMWGLFSPPKTRAAP  1786

Query  1719  ---------PGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
                      PG  K+N+DG+ +     A+ GG++RD  G  V  F+  IG ++S  A
Sbjct  1787  QILHWVKPVPGEHKLNVDGSSRQ-NQTAAIGGVLRDHTGTLVFDFSENIGPSNSLQA  1842


 Score = 38.1 bits (87),  Expect(3) = 3e-15, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (60%), Gaps = 4/47 (9%)
 Frame = +2

Query  1946  RGDHSEETVVTLVKDCLDLSRKFRKFKISHIMREGNRCADWLANYGQ  2086
             +G H    ++  ++  L+    F  F+ISHI REGN+ AD+L+N G 
Sbjct  1880  KGSHDIRYLLASIRKYLN----FFSFRISHIFREGNQAADFLSNKGH  1922


 Score = 31.2 bits (69),  Expect(3) = 3e-15, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 1/23 (4%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSL  954
             RWR+G G SL FW D W+ D+ L
Sbjct  1508  RWRIGKG-SLFFWHDCWMGDQPL  1529



>ref|XP_002516183.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46185.1| conserved hypothetical protein [Ricinus communis]
Length=283

 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 90/180 (50%), Gaps = 22/180 (12%)
 Frame = +3

Query  1269  LLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLK  1448
             ++  G +  NV+R RR     S C    DEE S++H   DC  A++ WE + ++     +
Sbjct  1     MVYHGSIMCNVQRARRGFTSHSRCGFYGDEE-SVIHALRDCGLAKQVWEHLLSFNAFVSQ  59

Query  1449  NHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLAC  1628
             ++L ++ W+  N++ +    DG  W++ F ++ W IWK R+       +   +H +K+A 
Sbjct  60    SNLSVDDWVRFNLNPR-SKFDGFEWNVVFAWSQWWIWKWRDV-----KAAFLIH-SKVAI  112

Query  1629  TFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHG  1808
               A++     +RH          V+W PP  GW K+N DG  K    +A  GGI+RD  G
Sbjct  113   PSAAKE----LRH----------VSWIPPGEGWFKLNADGCCKQVRRIAGGGGIIRDSIG  158



>ref|XP_007026458.1| Uncharacterized protein TCM_021522 [Theobroma cacao]
 gb|EOY06960.1| Uncharacterized protein TCM_021522 [Theobroma cacao]
Length=3503

 Score = 80.9 bits (198),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 74/301 (25%), Positives = 125/301 (42%), Gaps = 39/301 (13%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS--CTVDENW  1217
             ++ L + L++E+V +I  IP+  + S+ D   W  + +G F   SA+ L      V+  +
Sbjct  3102  IEKLKSVLQQEVVEEIAKIPI--NASSNDRAYWTPTPNGDFSTKSAWQLSRERKVVNPTY  3159

Query  1218  PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
              ++W  +        LW LL   +   ++ + +     S C RC   EESL+H+  D   
Sbjct  3160  NYIWHKSVPLTTSFFLWRLLHDWVPVELKMKSKGFQLASRC-RCCKSEESLMHVMWDNPV  3218

Query  1398  ARECWEAIETYGGKTLKNHLL--------MNAWIESNVHSKIVTNDGAPWSITFVYTLWQ  1553
             A + W    +Y  K  + H++        ++AW  S  +SK     G   ++  ++ LW 
Sbjct  3219  ANQVW----SYFAKVFQIHIINPCTINHIISAWFYSGDYSK----PGHIRTLVPLFILWF  3270

Query  1554  IWKCRNNLIFNNNSETPVHVA----KLACTFASEARAFIIRHGGTSQGCYNW--------  1697
             +W  RN+    N    P  +     KL        +    +  G  Q    W        
Sbjct  3271  LWVERNDAKHRNLGMYPNRIVWKILKLIHQLFQGKQLQKWQWQGDKQIAQEWGIILKAVA  3330

Query  1698  ------VTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFS  1859
                   + W  P  G  K+N+DG+ K     A+ GG++RD  G  + GF+   G  DS  
Sbjct  3331  PSPPKLLFWNKPSIGEFKLNVDGSSKYNLQTAAGGGLLRDHTGSMIFGFSENFGSQDSLQ  3390

Query  1860  A  1862
             A
Sbjct  3391  A  3391


 Score = 30.4 bits (67),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 14/27 (52%), Positives = 17/27 (63%), Gaps = 1/27 (4%)
 Frame = +1

Query  874   EIRARWRVGDGKSLDFWSDWWVNDKSL  954
             E   RWRVG GK L FW D W+ ++ L
Sbjct  3052  EQNIRWRVGHGK-LFFWHDCWMGEEPL  3077


 Score = 56.2 bits (134),  Expect(3) = 9e-14, Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 118/300 (39%), Gaps = 44/300 (15%)
 Frame = +3

Query  1053  LLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN--WPWL  1226
             L ++L   LV++I  + +P D S  D   W  +++G F   SA+ +I      N    + 
Sbjct  1311  LNSYLPTSLVDEI--LQIPFDRSQEDVAYWALTSNGEFSFWSAWEIIRQRQTPNALLSFN  1368

Query  1227  WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARE  1406
             W  +    +   LW +L   +   +  + + +   S C  CR EE SL+H+  +   A++
Sbjct  1369  WHRSIPLSISFFLWRVLNNWIPVELRMKDKGIHLASKCVCCRSEE-SLIHVLWENPVAKQ  1427

Query  1407  CW----EAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
              W    ++ + Y  K      ++ AW  S  +    T +G    +  ++  W +W  RN+
Sbjct  1428  VWNFFAKSFQIYVSKPKHISQIIWAWFFSGDY----TRNGHIRILIPLFICWFLWLERND  1483

Query  1575  LIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNW-------------------  1697
                 +    P  V        ++       H G+    + W                   
Sbjct  1484  AKHRHMGMYPNRVIWRIMKLLNQL------HAGSLLKQWQWKGDTDIATMWGFKYPPKYC  1537

Query  1698  -----VTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
                  ++W  P  G  K+N+DG+ KS    A+ GG++RD  G     F+  +G   S  A
Sbjct  1538  QSPQIISWIKPFIGEYKLNVDGSSKSSQN-AAGGGVLRDHTGKLAFAFSENLGPLPSLQA  1596


 Score = 39.7 bits (91),  Expect(3) = 9e-14, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 4/47 (9%)
 Frame = +2

Query  1946  RGDHSEETVVTLVKDCLDLSRKFRKFKISHIMREGNRCADWLANYGQ  2086
             +G H    ++  ++ CL   R F  ++ISHI REGN+ AD+L+N GQ
Sbjct  1634  KGSHDIRYLLESIRLCL---RSF-SYRISHIYREGNQAADFLSNKGQ  1676


 Score = 30.4 bits (67),  Expect(3) = 9e-14, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 16/24 (67%), Gaps = 1/24 (4%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLG  957
             RWR+G G+ L FW D W+ D+ L 
Sbjct  1262  RWRIGKGE-LFFWHDCWMGDQPLA  1284



>ref|XP_009114067.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=524

 Score = 89.0 bits (219),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 73/281 (26%), Positives = 116/281 (41%), Gaps = 35/281 (12%)
 Frame = +3

Query  1080  VNKIRAIPVPVD-----------DSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN----  1214
             ++K+R   VP D           ++ +D L W  +  G + V S Y L +   D +    
Sbjct  238   IDKLRDNVVPEDVEVILSLKISSNAQLDLLGWHYTDDGIYTVKSGYWLSTHLPDNDIIEP  297

Query  1215  -W------PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLV  1373
              W        +WK+N   K+K  LW  L   +      +RRH+     C RC    E+  
Sbjct  298   IWGDPLIKQRVWKMNSPPKIKHFLWKTLSRSLAVGSNLKRRHITRYDQCMRCCSAIETEQ  357

Query  1374  HLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIES----NVHSKIVTNDGAPWSITFVY  1541
             H+  DC +A++ W A          ++  +   IE+    N  S +      P     +Y
Sbjct  358   HMLFDCPYAQKIWRASGISSNIINGSYSTLEEKIEACLTCNRSSSLTHIKDLP-----IY  412

Query  1542  TLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRH--GGTSQGCYNWVTWTPP  1715
              LW+IWK RN ++F   +     V   A   A+E   +       GT +     + W  P
Sbjct  413   LLWRIWKSRNMMMFQQRNIQWWSVIHQANADAAEWSKYSQEEVCNGTRRVTKQSINWQRP  472

Query  1716  QPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKI  1838
             + GW+K N DG+  +    + AG +VRD+ G     FA K+
Sbjct  473   REGWMKCNFDGSFYNTATQSRAGWVVRDNFGS--FKFAAKV  511



>ref|XP_002461212.1| hypothetical protein SORBIDRAFT_02g042875 [Sorghum bicolor]
 gb|EER97733.1| hypothetical protein SORBIDRAFT_02g042875 [Sorghum bicolor]
Length=518

 Score = 89.0 bits (219),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 113/281 (40%), Gaps = 29/281 (10%)
 Frame = +3

Query  1083  NKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI-------------------SCTV  1205
             + I  + +PV  ++ D + W     G F V SAY ++                   +CT 
Sbjct  128   DAINILAIPVRQNSDDIIAWHYDPKGIFSVKSAYHVLEGVEEQKRQVQKGETSRQGACTS  187

Query  1206  DEN-WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLF  1382
             ++  W  +W L C  K+K  +W +    +   +  +RRH+  D+ C  C   +E   H F
Sbjct  188   EDRLWKDIWHLQCPPKIKQFIWRVAHNSLAMKMNIKRRHVDLDTRCPVCLRLDEDGGHCF  247

Query  1383  CDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWK  1562
               C+  R CW  ++    +     LL+NA   S    + +        +     LW+ W 
Sbjct  248   LKCKQMRRCWRELQLDSVRC----LLLNAQT-SKEFIRCILGLKTDQCLRTCLLLWKWWD  302

Query  1563  CRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINI  1742
              RN     N SE       + C   S  R   I    T+Q       W PP   ++KIN+
Sbjct  303   ARNKA---NASEPMPSCLDVVCAVNSIFRELSIEESKTTQIQVPRKRWKPPDQQFLKINV  359

Query  1743  DGAMKSCTGLASAGGIVRDDHGCWVIGFATKIG-VTDSFSA  1862
             DG+      + + G IVR+  G  V+  A+ I    D+ SA
Sbjct  360   DGSFIKEDNVGACGFIVRNYLGEPVLAGASNISPALDALSA  400



>gb|EEC69465.1| hypothetical protein OsI_38661 [Oryza sativa Indica Group]
Length=725

 Score = 82.4 bits (202),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 106/274 (39%), Gaps = 58/274 (21%)
 Frame = +3

Query  1074  ELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSL-ISCTVDEN------------  1214
             E + KI+ +  PV+D       W    +G + V SAY + +SC                 
Sbjct  412   EDILKIKIMQFPVEDFP----AWHYERTGVYSVRSAYRIALSCQASSTAGSSSSSPSGER  467

Query  1215  --WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCD  1388
               W  +W L    KVK   W L +  + T   R+ R L+ DSTC  C  EEE   H    
Sbjct  468   RIWRNIWNLQAPPKVKIFAWRLARDCLATQRNRKSRKLVSDSTCRTCGGEEEDGFHAVIS  527

Query  1389  CQFARECWEAIETY----GGKTLKNH----LLMNAWIESNVHSKIVTNDGAPWSITFVYT  1544
             C  A+   + +  Y      + L N+    LL+       +  K+ T + A     FV  
Sbjct  528   CTRAKALRKEMREYWRLPADEELTNYGPDWLLL-------ILEKLGTEERA----QFVLV  576

Query  1545  LWQIW------KCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTW  1706
             LW+ W      + RNN      S  PV +        +  R  I               W
Sbjct  577   LWRSWFLRNDNQTRNNCRHQRKSSVPVSLQSKLKEEEAPVRVNI--------------KW  622

Query  1707  TPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHG  1808
               P  GW K+N+DGA  + TG A AG I+R+  G
Sbjct  623   KAPPIGWAKVNVDGAYVAATGKAGAGIIIRNHMG  656


 Score = 28.1 bits (61),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = +1

Query  889  WRVGDGKSLDFWSDWWVNDKS  951
            WR+GDG  ++ W D W+  +S
Sbjct  351  WRIGDGSKVNIWRDQWIRKES  371



>gb|KHN24231.1| Putative ribonuclease H protein [Glycine soja]
Length=317

 Score = 86.7 bits (213),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 69/226 (31%), Positives = 107/226 (47%), Gaps = 31/226 (14%)
 Frame = +3

Query  1155  SGTFFVASAYSLISCTVDE-----NWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRH  1319
             +G F + SAY  ++   ++     N  W WK    E+++ LLW +    + TN  R  R 
Sbjct  110   NGLFSIKSAYRKVAGFSNDKDLLFNLIWSWK--GPERMRILLWKIANEGLLTNKSRVTRA  167

Query  1320  LIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLL----MNAWIESNV  1487
             + + S C RC  + ES++H   DC +A++ W    T  G +L NHL        W+ SN+
Sbjct  168   MAESSECPRCHLQPESILHCLRDCFYAKQVW---NTLSGNSL-NHLFCAHDCPQWLVSNL  223

Query  1488  HSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRH  1667
              S     +   W++ FV T+  IWK RN +IF+N +++           ASE    I R 
Sbjct  224   RSPQNCEENN-WALFFVITISFIWKARNEMIFSNRTQS-----------ASELVGHIPRM  271

Query  1668  GG---TSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVR  1796
                   S    N + W  P PG  K+N D A+ +  G A+  G++R
Sbjct  272   ALEVIQSLSVENKIHWHLPPPGKFKLNCDAAVDN-MGNAAIVGVIR  316



>ref|XP_008244843.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=390

 Score = 87.8 bits (216),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 98/209 (47%), Gaps = 12/209 (6%)
 Frame = +3

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             +WKLN   KVK   WLL++ R+       R        C  C+   E++ HLF DCQFA+
Sbjct  96    VWKLNIPPKVKIFAWLLIRKRLQVRARLHRFMQHISPLCPFCQSLPETIQHLFMDCQFAK  155

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIF  1583
             + W           +   L N W+ S + +    +D  P S   +   WQIW+ RNN++F
Sbjct  156   DVWALSIDLMPLPSQIGDLYN-WLMS-LSTTTTKSDLDPLSKALLIC-WQIWEARNNVVF  212

Query  1584  NNNSETPV---HVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAM  1754
             +++  T     H A  AC      R   +   G++      + W PP  GW+K+N DG++
Sbjct  213   HDSKATLANCFHAA--ACVGLDFWRLNSMTICGSTDSMI--IKWHPPPTGWIKVNFDGSL  268

Query  1755  KSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
              +    AS G ++RD  G  ++  +  IG
Sbjct  269   MNSH--ASTGFVIRDCEGHVLVAASNNIG  295



>ref|XP_008364703.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=749

 Score = 89.4 bits (220),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 76/283 (27%), Positives = 117/283 (41%), Gaps = 29/283 (10%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS----CTVD-  1208
             ++ L  F  +     IRA P+  D S  D L W  S +G + V S Y  I     C  D 
Sbjct  330   LNFLQPFXTDVEXETIRATPIG-DSSRRDRLIWAASKNGRYSVKSGYRWIQSRSLCLRDS  388

Query  1209  ----------ENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDE  1358
                       E W  LWK+    K++  LW  L   + TN+   +R   +   C  C  +
Sbjct  389   RLPHARSVPEELWKCLWKIEVPPKIRHFLWSSLHNALATNMNLFKRRASNSPICPICLCD  448

Query  1359  EESLVHLFCDCQFARECW-EAIETY--GGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSI  1529
             +ES VH+F  C + +  W   + +Y   G  + +  L   W+++   S     D   W  
Sbjct  449   DESTVHIFLLCPWVKHVWFGGVLSYKVDGSAISSWFL---WLQAIFSSNFGAPDDGMWVR  505

Query  1530  TFV-YTLWQIWKCRNNLIFNNNSETPVHVAKLAC----TFASEARAFII--RHGGTSQGC  1688
             + V +T W IWK R + +FN     P  V         +F +  R+  +     G  Q  
Sbjct  506   SCVAFTCWFIWKARCDFVFNXVKIIPSRVVXAISSAMDSFLAAGRSXEVCGLRXGVGQAS  565

Query  1689  YNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWV  1817
                V WTPP P + KIN+D +    + +   G +VR   G ++
Sbjct  566   XPVVCWTPPDPPFSKINVDASWCRMSLVGFVGVVVRSAEGQFI  608


 Score = 21.6 bits (44),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 13/58 (22%), Positives = 26/58 (45%), Gaps = 5/58 (9%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDME---IDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
              W++  G+ +  W D W+    LG  +    + + +NL   K+  F    R W++  +
Sbjct  278   HWQILGGEDVRVWVDRWLPSLXLGHPVPLGGVAVXRNLRVCKL--FCPLSREWDLNFL  333



>ref|XP_008226782.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=963

 Score = 89.7 bits (221),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 110/256 (43%), Gaps = 21/256 (8%)
 Frame = +3

Query  1128  DTLTWQDSTSGTFFVASAYSLI--SCTV-------------DENWPWLWKLNCVEKVKTL  1262
             D + W  +T+G + V S Y  I   C+               E W  +WK+  + K+K  
Sbjct  583   DKMVWPWTTNGAYSVKSRYRRIHSRCSYLIHATGSTSHSIPKEVWVCIWKIESLPKIKMF  642

Query  1263  LWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKT  1442
             LW +L   + T     RR ++D   C  C  EEE++ HL   C +    W          
Sbjct  643   LWRVLSNAISTRWNLYRRKILDSPVCPICGMEEETIEHLLFLCPWTNVVWFGAPLNYKVD  702

Query  1443  LKNHLLMNAWIESNVHSKIVTNDGAPWSITFV-YTLWQIWKCRNNLIFNNNSETP---VH  1610
             L+    ++ W++  ++ + V+     + +T + +  W+IWK R N IF +N   P   + 
Sbjct  703   LRGFSSVDRWLKGVINFQGVSKREVQFLLTSISFICWEIWKTRCNFIFKSNHIDPRLTID  762

Query  1611  VAKLACTFASEARAFIIRHGGTSQGCYNWVT--WTPPQPGWVKINIDGAMKSCTGLASAG  1784
              A   C    +A+       G +    N +   W PP   +VKIN DGA K  + LA  G
Sbjct  763   RAMQNCREFLDAKVKSHVPFGDASVVPNILAQGWRPPMSNYVKINFDGAWKKDSHLAGLG  822

Query  1785  GIVRDDHGCWVIGFAT  1832
              + RD  G +  G AT
Sbjct  823   VVARDAIGSFCGGLAT  838



>ref|XP_010030447.1| PREDICTED: uncharacterized protein LOC104420277 [Eucalyptus grandis]
Length=1110

 Score = 86.3 bits (212),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 67/271 (25%), Positives = 114/271 (42%), Gaps = 26/271 (10%)
 Frame = +3

Query  1071  EELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYS---LISCTVDEN---------  1214
             E +  +I A+P+       D L W  +++G + V S Y+   + +   D N         
Sbjct  744   ENVAKEILAVPL-SQQPQPDMLIWMGNSTGQYSVKSGYNRAIMNTSKTDYNRPSCSYQPP  802

Query  1215  ---WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFC  1385
                W  +W+L+   KV++ LW + +  + T      R ++ D  C  C    E++ HL  
Sbjct  803   RTLWTQIWRLDVPPKVRSFLWSICQNALPTRENLHTRKIVSDPLCPLCNTSPETIEHLLF  862

Query  1386  DCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
              C++ ++ W+       +   N    + W+ +   +   + D A  S+     LW +WK 
Sbjct  863   LCKWTKKLWKDPVFTKIRPTHNINRTDQWLVNAFRTDQDSPDPALTSM----VLWNVWKM  918

Query  1566  RNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNW---VTWTPPQPGWVKI  1736
             RN+ IF   +  P     L  T   +  +F  R    S+   N    V W PP    +K+
Sbjct  919   RNSWIFRQKAPRP---EDLLITAQDQQLSFSRRKPNRSERKPNRDKPVHWKPPAGTDLKL  975

Query  1737  NIDGAMKSCTGLASAGGIVRDDHGCWVIGFA  1829
             N+D A +    L S  G++RD  G    GFA
Sbjct  976   NVDAAWREGEFLCSVAGVMRDSEGRTHNGFA  1006


 Score = 24.3 bits (51),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 10/37 (27%), Positives = 19/37 (51%), Gaps = 0/37 (0%)
 Frame = +1

Query  871  VEIRARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIP  981
            ++   +W VGDG S+    D W++   +G ++    P
Sbjct  683  IKTNTKWSVGDGNSIRIKEDRWLSQGVIGGEVNQTEP  719



>ref|XP_008340288.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=364

 Score = 87.0 bits (214),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 65/241 (27%), Positives = 99/241 (41%), Gaps = 35/241 (15%)
 Frame = +3

Query  1218  PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
             P++W+     +   L+W +L  ++ T  + +RR +     C  C    ES+ HLF  C F
Sbjct  17    PFIWRPFIPPRYSILVWKILFNKLPTEDQLQRRGIPLAPICQLCHKNSESIDHLFSSCDF  76

Query  1398  ARECWEAIETYGGKTLK-NHLLMNAWIE--SNVHSKIVTNDGAPWSITFVYTLWQIWKCR  1568
             A+  W  + T  G  ++    L + W++  S   S  + N    W  +  + L  IWK R
Sbjct  77    AQCAWRXLATQFGTIIQPTGSLSDLWLDFLSKRFSPHLRNV---WLASGFFLLMAIWKMR  133

Query  1569  NNLIFNNNSE-------------------TPVHVAKLACTFASEARAFIIRHGGTSQGCY  1691
             N + F                        TP HV  +        R  ++  G +   C 
Sbjct  134   NKVKFEGKPPSFSRLCRSTLAWIRQVGALTPGHVRGIL------DRQLLVSLGISPNPCK  187

Query  1692  NW----VTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFS  1859
                   V W PP   WVK+N DG  K   G A+ GG+ RD  G ++ GF+  +G   SF 
Sbjct  188   AHSIVPVLWHPPPSSWVKVNTDGLAKGNPGPAACGGVFRDSTGYFLGGFSLSLGHRTSFY  247

Query  1860  A  1862
             A
Sbjct  248   A  248



>gb|EEE53388.1| hypothetical protein OsJ_36435 [Oryza sativa Japonica Group]
Length=740

 Score = 82.4 bits (202),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 106/274 (39%), Gaps = 58/274 (21%)
 Frame = +3

Query  1074  ELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSL-ISCTVDEN------------  1214
             E + KI+ +  PV+D       W    +G + V SAY + +SC                 
Sbjct  427   EDILKIKIMQFPVEDFP----AWHYERTGVYSVRSAYRIALSCQASSTAGSSSSSPSGER  482

Query  1215  --WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCD  1388
               W  +W L    KVK   W L +  + T   R+ R L+ DSTC  C  EEE   H    
Sbjct  483   RIWRNIWNLQAPPKVKIFAWRLARDCLATQRNRKSRKLVSDSTCRTCGGEEEDGFHAVIS  542

Query  1389  CQFARECWEAIETY----GGKTLKNH----LLMNAWIESNVHSKIVTNDGAPWSITFVYT  1544
             C  A+   + +  Y      + L N+    LL+       +  K+ T + A     FV  
Sbjct  543   CTRAKALRKEMREYWRLPADEELTNYGPDWLLL-------ILEKLGTEERA----QFVLV  591

Query  1545  LWQIW------KCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTW  1706
             LW+ W      + RNN      S  PV +        +  R  I               W
Sbjct  592   LWRSWFLRNDNQTRNNCRHQRKSSVPVSLQSKLKEEEAPVRVNI--------------KW  637

Query  1707  TPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHG  1808
               P  GW K+N+DGA  + TG A AG I+R+  G
Sbjct  638   KAPPIGWAKVNVDGAYVAATGKAGAGIIIRNHMG  671


 Score = 27.7 bits (60),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = +1

Query  889  WRVGDGKSLDFWSDWWVNDKS  951
            WR+GDG  ++ W D W+  +S
Sbjct  366  WRIGDGSKVNIWRDQWIPKES  386



>gb|AAG13524.1|AC068924_29 putative non-LTR retroelement reverse transcriptase [Oryza sativa 
Japonica Group]
Length=1382

 Score = 80.9 bits (198),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 110/284 (39%), Gaps = 44/284 (15%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTV-------  1205
             D + +    ++  +I  IP+       D  +W     G + V SAY+L            
Sbjct  989   DLIRSLFPVDIAKEILQIPIS-RHGDADFASWPHDKLGLYSVRSAYNLARSEAFFADQSN  1047

Query  1206  ------------DENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARC  1349
                          ++W  LWK+N   K+K  LW      + T  + RRRH+     C  C
Sbjct  1048  SGRGMASRLLESQKDWKGLWKINAPGKMKITLWRAAHECLATGFQLRRRHIPSTDGCVFC  1107

Query  1350  RDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLL--MNAWIESNVHSKIVTNDGAPW  1523
              + ++++ H+F  C FA + WE I+      L  +    M  WI        +    +  
Sbjct  1108  -NRDDTVEHVFLFCPFAAQIWEEIKGKCAVKLGRNGFSTMRQWI-----FDFLKRGSSHA  1161

Query  1524  SITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRH---------GGT  1676
             +     T W IW+ RNN   NN +  P  V     ++       I++H         GG 
Sbjct  1162  NTLLAVTFWHIWEARNNTKNNNGTVHPQRVVIKILSYVD----MILKHNTKTVDGQRGGN  1217

Query  1677  SQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHG  1808
             +Q    W    PP   W+ IN D A+ S +     G ++RD+ G
Sbjct  1218  TQAIPRW--QPPPASVWM-INSDAAIFSSSRTMGVGALIRDNTG  1258


 Score = 28.9 bits (63),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 19/29 (66%), Gaps = 3/29 (10%)
 Frame = +1

Query  862  LMGVEIRA---RWRVGDGKSLDFWSDWWV  939
            L G E+ A   RW VGDGK++  +SD W+
Sbjct  927  LFGRELLAKGVRWGVGDGKTIKIFSDNWI  955



>gb|KHN40328.1| Putative ribonuclease H protein [Glycine soja]
Length=175

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 67/133 (50%), Gaps = 8/133 (6%)
 Frame = +3

Query  1053  LLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYS------LISCTVDEN  1214
               + + +E+ NK+ ++ +  DD++ D + W    SG F   SAY               +
Sbjct  27    FYSIIPDEVKNKMTSLVM--DDNSYDIIIWGQLKSGIFTAKSAYEWWIHEPANHSNFPGD  84

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W W+WKL   E +K   WL+L+  + TN  R +RH+  D  C RC  E+ES++HL  DC 
Sbjct  85    WNWVWKLQTPENIKHFTWLILQNSLPTNFFRTKRHISFDPFCCRCGLEDESIIHLLRDCS  144

Query  1395  FARECWEAIETYG  1433
              ARE W  I  Y 
Sbjct  145   EAREIWSHINMYA  157



>gb|AAP54617.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|EAZ16681.1| hypothetical protein OsJ_32156 [Oryza sativa Japonica Group]
Length=1339

 Score = 80.5 bits (197),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 110/284 (39%), Gaps = 44/284 (15%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTV-------  1205
             D + +    ++  +I  IP+       D  +W     G + V SAY+L            
Sbjct  946   DLIRSLFPVDIAKEILQIPIS-RHGDADFASWPHDKLGLYSVRSAYNLARSEAFFADQSN  1004

Query  1206  ------------DENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARC  1349
                          ++W  LWK+N   K+K  LW      + T  + RRRH+     C  C
Sbjct  1005  SGRGMASRLLESQKDWKGLWKINAPGKMKITLWRAAHECLATGFQLRRRHIPSTDGCVFC  1064

Query  1350  RDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLL--MNAWIESNVHSKIVTNDGAPW  1523
              + ++++ H+F  C FA + WE I+      L  +    M  WI        +    +  
Sbjct  1065  -NRDDTVEHVFLFCPFAAQIWEEIKGKCAVKLGRNGFSTMRQWI-----FDFLKRGSSHA  1118

Query  1524  SITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRH---------GGT  1676
             +     T W IW+ RNN   NN +  P  V     ++       I++H         GG 
Sbjct  1119  NTLLAVTFWHIWEARNNTKNNNGTVHPQRVVIKILSYVD----MILKHNTKTVDGQRGGN  1174

Query  1677  SQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHG  1808
             +Q    W    PP   W+ IN D A+ S +     G ++RD+ G
Sbjct  1175  TQAIPRW--QPPPASVWM-INSDAAIFSSSRTMGVGALIRDNTG  1215


 Score = 29.3 bits (64),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 19/29 (66%), Gaps = 3/29 (10%)
 Frame = +1

Query  862  LMGVEIRA---RWRVGDGKSLDFWSDWWV  939
            L G E+ A   RW VGDGK++  +SD W+
Sbjct  884  LFGRELLAKGVRWGVGDGKTIKIFSDNWI  912



>ref|XP_009113843.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=896

 Score = 83.6 bits (205),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 72/251 (29%), Positives = 103/251 (41%), Gaps = 33/251 (13%)
 Frame = +3

Query  1128  DTLTWQDSTSGTFFVASAYSLISCTVD----ENWP-------WLWKLNCVEKVKTLLWLL  1274
             D L W  + SG + V S Y L +        E  P        +WKL    K++  LW +
Sbjct  529   DPLVWHYNKSGEYSVKSGYWLATHDPQDLPIEPPPGSIILKNMIWKLPTAPKLQHFLWKM  588

Query  1275  LKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEA------IETYGG  1436
             +   +      +RRH+     C  C+ +EE+  HLF +C +A+  W A      I     
Sbjct  589   VTSSLPLGSNLQRRHVTTSVKCPHCQ-QEETTEHLFFECFYAQRIWRASGLPHNIFYQAQ  647

Query  1437  KTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS---ETPV  1607
              TL++ L+       N+   +      PW     + LW+IWKCRN +IF   S    T +
Sbjct  648   STLEDKLMALLQKIPNLPDHL---RHLPW-----WILWRIWKCRNKMIFQQTSIHWRTTL  699

Query  1608  HVAKLACTFASEARAFI----IRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLA  1775
               A        EA   +     R G      +    WT P  G+VK N DGA  +     
Sbjct  700   QSAYFDTKEWLEAYQSVDKDEDRQGLRRDMEHQRNKWTKPPTGFVKCNYDGAFNNIQRET  759

Query  1776  SAGGIVRDDHG  1808
              AG I+RDD G
Sbjct  760   KAGWIIRDDMG  770


 Score = 26.2 bits (56),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 7/58 (12%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDK--KVSNFIKDDRS-WNVTLM  1050
             R+ +G+G+S+  W+D W+            IPK+  +   KVS  +K +++ WN  L+
Sbjct  452   RFIIGNGESVSLWADPWLPTSP----PRSPIPKDQSNPMTKVSELMKQNQTGWNEELI  505



>gb|KHN01590.1| Putative ribonuclease H protein [Glycine soja]
Length=695

 Score = 88.6 bits (218),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 94/205 (46%), Gaps = 9/205 (4%)
 Frame = +3

Query  1245  EKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIE  1424
             E++  LL     G + TN ERR RH+  DS C RC   EE+++H   DC      W ++ 
Sbjct  352   ERIINLLGNAADGALITNAERRYRHISMDSFCRRCHSLEETILHALRDCPEVAAFWRSVL  411

Query  1425  TYGGKTLKNHLL---MNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS  1595
                 K L        +  W+E N+  +  +     W   F   +  +W+ RN+L+F+++ 
Sbjct  412   P---KKLAPKFFNGDVTVWLERNLDHQSFSEAALFWPTFFGIAVELLWQFRNDLVFDHSG  468

Query  1596  ETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPG--WVKINIDGAMKSCTG  1769
                + ++          + ++  H   +    N + W P       +++N+ GA    +G
Sbjct  469   RRGLDLSGAIDIVFKRYKDYMGAHASHNLMTRNLLKWKPENSKDWLLRLNVSGAYDPSSG  528

Query  1770  LASAGGIVRD-DHGCWVIGFATKIG  1841
              A+ GGI RD D   +V+GF+ K+G
Sbjct  529   TAACGGIFRDKDDDRFVLGFSVKLG  553



>ref|XP_009148725.1| PREDICTED: uncharacterized protein LOC103872128 [Brassica rapa]
Length=760

 Score = 88.6 bits (218),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 84/209 (40%), Gaps = 38/209 (18%)
 Frame = +3

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             +W++   E+V+  LWL+    + TN ER RRHL     C  CR   E+++H+  DC    
Sbjct  8     MWRVVAPERVRMFLWLMANQAIMTNAERHRRHLSGTDLCQVCRGGIETIIHVLRDC----  63

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIF  1583
                                             +   G PW+  F  TLW  WK R   +F
Sbjct  64    ------------------------------PAIKGGGVPWATIFALTLWWGWKWRCGNVF  93

Query  1584  NNN---SETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAM  1754
              +     +    +  LA    +  RA    H          V W PP  GW+K+N DGA 
Sbjct  94    GDTRLWRDRVKFLRDLAKGVITANRAENA-HMKERHMVEIMVGWKPPCVGWMKLNTDGAS  152

Query  1755  KSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
                 G A+AGG +R+  G W  GFA  IG
Sbjct  153   HGNPGPAAAGGALRNGEGEWCGGFAINIG  181



>ref|XP_010490159.1| PREDICTED: uncharacterized protein LOC104767890 [Camelina sativa]
Length=1712

 Score = 80.1 bits (196),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/249 (27%), Positives = 101/249 (41%), Gaps = 24/249 (10%)
 Frame = +3

Query  1128  DTLTWQDSTSGTFFVASAYSLISCTVD-ENWPW-------------LWKLNCVEKVKTLL  1265
             D+ TW  + +G + V S Y +++  ++ +  P              +W+     KV+  L
Sbjct  1338  DSYTWDYARTGQYSVKSGYWVLTQVINTQKGPQAVTQPSLNPLISQVWRTKASPKVQHFL  1397

Query  1266  WLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECW--EAIETYGGK  1439
             W  L   +        RHL  D++C RC  E ES  HL   C +AR+ W    I    G 
Sbjct  1398  WRCLSNCLSVAKNLSHRHLSRDNSCVRCPHEAESTNHLLFQCTYARQVWALSPIPAPSGG  1457

Query  1440  TLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAK  1619
                N L  N +   N  S     D     + +V  LW++WK RN LIF      P +  +
Sbjct  1458  EWSNSLYANMFFVLNAASLYPQRDDLDKDVPWV--LWRLWKSRNELIFKGKDFNPQNTVE  1515

Query  1620  LACTFASE-ARAFIIRHGGTSQGC-----YNWVTWTPPQPGWVKINIDGAMKSCTGLASA  1781
              A   A E  +     H   ++G           W  P   WVK N DGA +    L+  
Sbjct  1516  TALEDAEEWDQRKKNEHEKLTRGHPVPKRTEDAKWKLPPREWVKCNTDGAWRGEDTLSGT  1575

Query  1782  GGIVRDDHG  1808
             G ++R++ G
Sbjct  1576  GWVLRNNTG  1584


 Score = 29.3 bits (64),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 27/46 (59%), Gaps = 2/46 (4%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDK-SLGLDMEIDIPKNLYDKKVSNFIK  1020
             R  +G+G+S++ W D W+  K +L L     IP +L+ K VS  +K
Sbjct  1253  RAIIGNGESVNLWQDPWLGSKPALSLHNVCIIPSDLH-KSVSKLMK  1297



>ref|XP_008222000.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=561

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 108/270 (40%), Gaps = 36/270 (13%)
 Frame = +3

Query  1098  IPVPVDDSTVDTLTWQDSTSGTFFVASAY----------SLISCTVD-------ENWPWL  1226
             + +P+    +D   W  + +G + V S Y           L + TV        ++W  L
Sbjct  183   LSIPLMGDNLDRRIWNFTKNGRYSVKSGYWAALEYKRLEELSAGTVAGPSSSSLKSWKHL  242

Query  1227  WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARE  1406
             WKL   +K+  LLW + +  + +     RR +     C RC    E+ +H    C    +
Sbjct  243   WKLKVPQKILHLLWRVAQDILPSKEVLFRRRITQGEVCCRCFAPRETTLHALVGCVVCLQ  302

Query  1407  CWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSIT-------FVYTLWQIWKC  1565
              WEA++      L     +  W++            A WSI        F +T+W +W  
Sbjct  303   VWEALDFPRDFLLPTVADVGTWMD------------AAWSIIPPDKQSLFAFTVWVLWNE  350

Query  1566  RNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINID  1745
             RN ++F +       + + A  + +E + +   +  +       + W PP     K+N+D
Sbjct  351   RNGVLFGSQPTPSGVLVQRAKDYDAEFKRYSAANHRSLSSLVRDIKWRPPTGNCFKLNVD  410

Query  1746  GAMKSCTGLASAGGIVRDDHGCWVIGFATK  1835
             GA    TG   AG IVRD HG  V   A +
Sbjct  411   GATDMETGARGAGAIVRDSHGNLVGALAMR  440



>ref|XP_008348238.1| PREDICTED: uncharacterized protein LOC103411380 [Malus domestica]
Length=1384

 Score = 80.9 bits (198),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 112/288 (39%), Gaps = 34/288 (12%)
 Frame = +3

Query  1077  LVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP-WLWKLNCVEK  1250
             L   I  +P+P+D+   D L W+ STS  F  +  Y  +      ++W   +W      +
Sbjct  989   LTXXILEMPLPIDEDK-DVLIWEVSTSXVFSFSDGYEXVRHXFPVKSWASXIWXPFIPPR  1047

Query  1251  VKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR--ECWEAIE  1424
                L+W +L  ++      +RR +     C  C    ES  HLF  C+FA     W A +
Sbjct  1048  YSILVWKILFXKLXXXDXLQRRGIXLAPICXLCXKNSESXBHLFSXCEFAXCAXXWLATQ  1107

Query  1425  TYGGKTLKNHLLMNAWIE--SNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSE  1598
              +G          + W+   S   S  + N    W  +  + L  IWK RN + F     
Sbjct  1108  -FGTXIPXTXSJSDLWLXFLSKXFSPXLXN---VWJXSGFFLLMXIWKMRNKVKFEGK--  1161

Query  1599  TPVHVAKLACTFASEARAFIIRHGGTSQGCYNW--------------------VTWTPPQ  1718
              P   ++L  + ++  R       G  +G  +                         PP 
Sbjct  1162  -PPSXSRLXXSTSAWIRQVXXJXPGHVRGILDRQLLXSLGISPNSXXXPSIVPXLXXPPP  1220

Query  1719  PGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
               WVK+N DG  K   G A+ GG+ RD  G ++ GF+  +G   SF A
Sbjct  1221  FSWVKVNTDGLAKGNPGXAACGGVFRDSXGYFLGGFSLSLGHRTSFYA  1268


 Score = 28.5 bits (62),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 13/45 (29%), Positives = 22/45 (49%), Gaps = 0/45 (0%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
             RW +G+G +   W   W++     +    +I  +L   KVSN I+
Sbjct  928   RWVIGNGXTTSLWVXKWLDXPIXDVXGATEIAXSLSXTKVSNIIR  972



>ref|XP_010667308.1| PREDICTED: uncharacterized protein LOC104884364 [Beta vulgaris 
subsp. vulgaris]
Length=1286

 Score = 82.8 bits (203),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 75/290 (26%), Positives = 119/290 (41%), Gaps = 32/290 (11%)
 Frame = +3

Query  1053  LLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCT-------VDE  1211
             LL F+ EE+   I+ I +P      D L W  S  G + V S   LI          +  
Sbjct  887   LLDFVPEEVGTSIKGIFIP-RQGPEDKLVWALSPDGCYSVKSGVELIQGNGAHLTRPIAS  945

Query  1212  NWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDC  1391
              + W+W L    K+K  LW +    + T       H+     C  C    E+L+HLF +C
Sbjct  946   PFSWIWNLLIPPKIKFFLWKICNDGLPTKKRLEISHVFSPLECIFCNHHSENLMHLFLEC  1005

Query  1392  QFARECWEAIETYGG-KTLKNHLLMNAWIE--SNVHSKIVTNDGAPWSITFVYTLWQIWK  1562
              F  + ++ +  + G  +L       +++E  SN++  +   D A  +IT+    W IW 
Sbjct  1006  PFCIDVFDLLGLHHGWPSLPPKPSDLSFVEFLSNMNKVVSLEDIAKIAITW----WFIWY  1061

Query  1563  CRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNW-------------VT  1703
              RN + F     +P+  + +   F S     +    G      N              ++
Sbjct  1062  ARNGVSFRQEPCSPIGTSLMVWKFYSR---IVENFEGVKLAISNVRSPPRMRKIPRKNIS  1118

Query  1704  WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDS  1853
             W  P  G+ K+N DG+ K   G AS G I+RD+ G   I  A+ I  + S
Sbjct  1119  WVAPPSGFCKLNFDGS-KLNDGSASLGFIIRDEFGIIKICGASPISPSHS  1167


 Score = 26.6 bits (57),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 2/51 (4%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWN  1038
             RW VG+G+ + FW D W       L     + +      V++FI  D  W+
Sbjct  835   RWVVGNGEKISFWFDNWAFQYP--LSSICPVIRGSESLVVAHFIDQDSHWD  883



>ref|XP_008795667.1| PREDICTED: putative ribonuclease H protein At1g65750 [Phoenix 
dactylifera]
Length=502

 Score = 79.3 bits (194),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 103/262 (39%), Gaps = 23/262 (9%)
 Frame = +3

Query  1071  EELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVAS----AYSLISCTVDENWPWLWKLN  1238
             E+LV +I A+P+P   +    L W  +  G  +V +    A++        +  W+W++ 
Sbjct  196   EQLVERILALPIP-SRAEPGKLVWLPT--GRSWVRARDIHAWTRREPERRIDGGWIWRMR  252

Query  1239  CVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEA  1418
                +V   LW +  G + T      R +     C  C D EE++ H+   C  A +CW  
Sbjct  253   VHPRVALFLWKVAWGCLSTRSVLAWRGMRMGPLCEVCLDAEETVGHVLLRCPTAVQCWRL  312

Query  1419  IETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSE  1598
                    T ++   M  ++  ++    V   G+       Y  + IW  RN+ +F     
Sbjct  313   ASALLPPTWESVEDMLRFLSESIRRPSVAETGS----IVAYLAYHIWLARNDRLFEGGRS  368

Query  1599  TPVHVAKLACTFASEARAFIIRHG------------GTSQGCYNWVTWTPPQPGWVKINI  1742
             TP  V + A   A+E                       S   +++  W PP PG++K+N 
Sbjct  369   TPRAVMERALRQAAEISTMTTSAPLGRTRDIWGTCTAASVSKFSYFYWVPPSPGYLKVNF  428

Query  1743  DGAMKSCTGLASAGGIVRDDHG  1808
             DG M         G ++RD  G
Sbjct  429   DGGMAEDGASGGVGFVIRDHRG  450


 Score = 30.0 bits (66),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/52 (29%), Positives = 26/52 (50%), Gaps = 1/52 (2%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLG-LDMEIDIPKNLYDKKVSNFIKDDRSWN  1038
             RW +GDG S+D   D WV +  +  L   +D  + L  +     + ++ SW+
Sbjct  135   RWAIGDGMSVDVLEDSWVTELPISRLPAMVDTSRLLGRRVCDLLVPEEGSWD  186



>ref|XP_006483194.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=765

 Score = 80.1 bits (196),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/272 (26%), Positives = 109/272 (40%), Gaps = 27/272 (10%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN---  1214
             VD L     +E +  I  I +P      D + W     G + V S Y L    +++N   
Sbjct  379   VDRLEQHFMKEDIEAILKILLPSGKEE-DEVLWHFDKKGEYSVKSGYQL---ALNQNFPN  434

Query  1215  -----------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEE  1361
                        W   W L+  EKVK  +W  LK  + T     +R  + +  C RC+ + 
Sbjct  435   EPESSNSSSRLWKIPWMLDLPEKVKIFMWRALKNILPTAENLWKRRSLQEPICQRCKLQV  494

Query  1362  ESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVY  1541
             E++ H+  +C+ AR+ W+ +     +  K+H   N    S +      +  A   +  VY
Sbjct  495   ETVSHVLIECKAARKIWD-LAPLIVQPSKDH---NQDFFSAIQEMWSRSSTAEAELMIVY  550

Query  1542  TLWQIWKCRNNLIFN-NNSETPVHVAKLACTFASEARAFIIR--HGGTSQGCYNWVTWTP  1712
               W IW  RN  IF    S++    AK      +  R       HG   +G  +   W P
Sbjct  551   C-WVIWSARNKFIFEGKKSDSRFLAAKADSVLKAYQRVSKPGNVHGAKDRGI-DQQKWKP  608

Query  1713  PQPGWVKINIDGAMKSCTGLASAGGIVRDDHG  1808
             P    +K+N+D A+ +       G IVRD  G
Sbjct  609   PSQNVLKLNVDAAVSTKXQKVGLGAIVRDAEG  640


 Score = 29.3 bits (64),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (51%), Gaps = 4/53 (8%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNL-YDKKVSNFIKDDRSWNV  1041
             RWR+GDGK +  + D W+   +    +    PK L ++  V++ I  +  W V
Sbjct  330   RWRIGDGKKVLVYKDKWIPRPATFQPIS---PKTLPHETVVADLIDSENKWRV  379



>ref|XP_004292002.1| PREDICTED: uncharacterized protein LOC101312896 [Fragaria vesca 
subsp. vesca]
Length=2277

 Score = 85.5 bits (210),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 115/257 (45%), Gaps = 27/257 (11%)
 Frame = +3

Query  1077  LVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN-----------WPW  1223
             +V+KI+A+P+    S  D   W     G F V SAY +    V E+           W  
Sbjct  1058  IVHKIQALPIS-SRSNSDKWIWAPDRKGLFMVKSAYHIARTRVLEDHVMALNPSAQLWNK  1116

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             +W      KVK  +W +    + +     +R +  D+ C  C +E ES +H   DC  A 
Sbjct  1117  IWNAPVPGKVKICVWKVASNILPSRSRLSQRGIDIDTQCPFCDEEVESPIHALRDCPHAA  1176

Query  1404  ECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSI-TFVYTLWQIWKCRNNLI  1580
                + ++        N L    W+ S++       + +P +  T +  +W +W+ +N+ +
Sbjct  1177  AFIQLVDVPIQLADTNAL---DWLVSSL-------ENSPSTFATLMMIIWSVWRNQNDHV  1226

Query  1581  FNNNSETPVHVAKLACTFASEAR-AFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMK  1757
             +NNN++    V  L   +  E + AF+ R G        W+T   P  G++K+N+D A  
Sbjct  1227  WNNNAKQATEVVPLTLRWWEEFKSAFVKRRGRNVSPRDRWIT---PSSGYIKLNVDAAYN  1283

Query  1758  SCTGLASAGGIVRDDHG  1808
             + + +AS GG+ RD  G
Sbjct  1284  NASCMASLGGVFRDHTG  1300


 Score = 23.5 bits (49),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 8/20 (40%), Positives = 13/20 (65%), Gaps = 0/20 (0%)
 Frame = +1

Query  895   VGDGKSLDFWSDWWVNDKSL  954
             +GDG S + W D W+  ++L
Sbjct  1005  IGDGMSTNVWDDPWLMGENL  1024



>ref|XP_009119675.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1046

 Score = 88.6 bits (218),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 116/297 (39%), Gaps = 41/297 (14%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY-------------  1184
             +D + T   EE+ NKI  I  P   ++ DT  W  + +G + V S Y             
Sbjct  649   LDGMFT---EEIRNKILEI-RPAGKNSKDTYVWDYTKTGHYTVKSGYWVQTSVVSVDKEQ  704

Query  1185  -SLISCTVDENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEE  1361
               ++  ++D  +  +WKL    K+K  LW  L   +        RH+  D  C+RC    
Sbjct  705   SEVLQPSLDSFYQQVWKLQSSPKIKHFLWRCLNNALPVAANMVYRHIGKDKRCSRCDGVA  764

Query  1362  ESLVHLFCDCQFARECWEAIETYGGKTLK--NHLLMNAWIESNVHSKI----VTNDGAPW  1523
             ES+ HL   C +AR  W     +     +  + L  N +   N  +K     V  +  PW
Sbjct  765   ESINHLLFQCPYARLVWAVAHVHIPPEGRWSDSLFANLYWVLNQKTKYPTEEVDEEFVPW  824

Query  1524  SITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLAC-------TFASEARAFIIRHGGTSQ  1682
                    LW++WK RN  +F    + P H+                E +  + +      
Sbjct  825   ------LLWRLWKNRNEFVFRGR-DFPAHITVRKAWEDVMDWKSRIEVQEEVAKEPAVVS  877

Query  1683  GCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDS  1853
                 W+   PP P  +K N DGA    TG+   G ++RD  G  +   A K+ V  S
Sbjct  878   PDKRWI---PPAPMTLKCNTDGAWSKETGVGGVGWLLRDHQGTLLWAGAKKMAVMRS  931



>ref|XP_010673997.1| PREDICTED: uncharacterized protein LOC104890275 [Beta vulgaris 
subsp. vulgaris]
Length=1098

 Score = 76.3 bits (186),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/286 (24%), Positives = 121/286 (42%), Gaps = 29/286 (10%)
 Frame = +3

Query  1053  LLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVAS----AYSLISCTVDE-NW  1217
             LL+ +   +V +I +I +P  +S  D L W  +  G + V S    A  ++  ++++  +
Sbjct  740   LLSLVPPHIVLQICSIYIP-SESQPDNLIWGLTADGEYSVKSGALLAQGMLPSSLEKVEF  798

Query  1218  PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
              W+WKLN   K+K  LW      + T +   + H+     C  C +  ES+ H+   C F
Sbjct  799   NWIWKLNIPPKIKNFLWKACNDGIPTKLRLEKSHIFLPQQCVFCNNAGESIGHICFACPF  858

Query  1398  ARECWEAIETYGGKTLKNHLLMNAWIES--NVHSKIVTNDGAPWSITFVYTLWQIWKCRN  1571
               + +  ++           L N  + S  +V    ++         F +  W +W  RN
Sbjct  859   TLDIFSHLKASFDWPSPPSCLANIDLTSFRSVLEACLSLSSKSEISLFSFVWWFVWFFRN  918

Query  1572  NLIFNNNSETPVHVAKLACTFASE-ARAFIIRHGG---------------TSQGCYNWVT  1703
              L+FN+   +    + +   FA+  ++A      G               T  G      
Sbjct  919   KLVFNDEVVSSRKASFIISNFATSWSKALNSEEMGSKPILAANTKRDKPRTGPGS----V  974

Query  1704  WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
             W+PP PG+ K+N DG+ K   G A+ G ++RD  G  ++  A  +G
Sbjct  975   WSPPAPGFCKLNFDGS-KLNNGNAALGFVIRDSSGDALMAGARSLG  1019


 Score = 32.7 bits (73),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  886  RWRVGDGKSLDFWSDWWVNDKSL  954
            RW++G+GKS++FW D WV   SL
Sbjct  688  RWQIGNGKSINFWMDNWVFQYSL  710



>ref|XP_010684763.1| PREDICTED: uncharacterized protein LOC104899296 [Beta vulgaris 
subsp. vulgaris]
Length=1107

 Score = 75.9 bits (185),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/286 (24%), Positives = 121/286 (42%), Gaps = 29/286 (10%)
 Frame = +3

Query  1053  LLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVAS----AYSLISCTVDE-NW  1217
             LL+ +   +V +I +I +P  +S  D L W  +  G + V S    A  ++  ++++  +
Sbjct  740   LLSLVPPHIVLQICSIYIP-SESQPDNLIWGLTADGEYSVKSGALLAQGMLPSSLEKVEF  798

Query  1218  PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
              W+WKLN   K+K  LW      + T +   + H+     C  C +  ES+ H+   C F
Sbjct  799   NWIWKLNIPPKIKNFLWKACNDGIPTKLRLEKSHIFLPQQCVFCNNAGESIGHICFACPF  858

Query  1398  ARECWEAIETYGGKTLKNHLLMNAWIES--NVHSKIVTNDGAPWSITFVYTLWQIWKCRN  1571
               + +  ++           L N  + S  +V    ++         F +  W +W  RN
Sbjct  859   TLDIFSHLKASFDWPSPPSCLANIDLTSFRSVLEACLSLSSKSEISLFSFVWWFVWFFRN  918

Query  1572  NLIFNNNSETPVHVAKLACTFASE-ARAFIIRHGG---------------TSQGCYNWVT  1703
              L+FN+   +    + +   FA+  ++A      G               T  G      
Sbjct  919   KLVFNDEVVSSRKASFIISNFATSWSKALNSEEMGSKPILAANTKRDKPRTGPGS----V  974

Query  1704  WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
             W+PP PG+ K+N DG+ K   G A+ G ++RD  G  ++  A  +G
Sbjct  975   WSPPAPGFCKLNFDGS-KLNNGNAALGFVIRDSSGDALMAGARSLG  1019


 Score = 33.1 bits (74),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  886  RWRVGDGKSLDFWSDWWVNDKSL  954
            RW++G+GKS++FW D WV   SL
Sbjct  688  RWQIGNGKSINFWMDNWVFQYSL  710



>ref|XP_007220772.1| hypothetical protein PRUPE_ppa026532mg [Prunus persica]
 gb|EMJ21971.1| hypothetical protein PRUPE_ppa026532mg [Prunus persica]
Length=334

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/247 (26%), Positives = 104/247 (42%), Gaps = 41/247 (17%)
 Frame = +3

Query  1140  WQDSTSGTFFVASAYSL---ISCTVDENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERR  1310
             W+ +T+G+F   SAY      S ++D +W ++W +    K+K  LWLL + ++ TN +R 
Sbjct  104   WKRTTNGSFSAKSAYMANCQESSSMDVSWAFIWNIKAPPKIKYFLWLLQQDKLLTNYQRV  163

Query  1311  RRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVH  1490
             +R +   +    C    E+  H+  +C      W            +H LM         
Sbjct  164   KRKMTMTANFDICGVPMENATHIIRNCPVTISVW------------HHSLM---------  202

Query  1491  SKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNN---SETPVHVAKLACTFASEARAFII  1661
                      P +++ +     +WK  N + F++       P HV  +A    ++A    I
Sbjct  203   ---------PMNMSLLQAF--LWKWTNKIFFDHGFVFPNNPRHVILMAAADWTQAN---I  248

Query  1662  RHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIG  1841
                 T       ++W  P    +KIN DG  K   G  +AGG++RD  G W+ GFA  +G
Sbjct  249   EKTRTPTRSLAMLSWQYPNEEVIKINTDGCRKGEDGRIAAGGVLRDSSGQWMRGFAVNLG  308

Query  1842  VTDSFSA  1862
             V     A
Sbjct  309   VGQVLEA  315



>ref|XP_008375111.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=922

 Score = 87.8 bits (216),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 76/283 (27%), Positives = 117/283 (41%), Gaps = 29/283 (10%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS----CTVD-  1208
             ++ L  F  +     IRA P+  D S  D L W  S +G + V S Y  I     C  D 
Sbjct  588   LNFLQPFXTDVEXETIRATPIG-DSSRRDRLIWAASKNGRYSVKSGYRWIQSRSLCLRDS  646

Query  1209  ----------ENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDE  1358
                       E W  LWK+    K++  LW  L   + TN+   +R   +   C  C  +
Sbjct  647   RLPHARSVPEELWKCLWKIEVPPKIRHFLWSSLHNALATNMNLFKRXASNSPICPICLCD  706

Query  1359  EESLVHLFCDCQFARECW-EAIETY--GGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSI  1529
             +ES VH+F  C + +  W   + +Y   G  + +  L   W+++   S     D   W  
Sbjct  707   DESTVHIFLLCPWVKHVWFGGVLSYKVDGXAISSWFL---WLQAIFSSNFGAPDDGMWVR  763

Query  1530  TFV-YTLWQIWKCRNNLIFNNNSETPVHVAKLAC----TFASEARAFII--RHGGTSQGC  1688
             + V +T W IWK R + +FN     P  V         +F +  R+  +     G  Q  
Sbjct  764   SCVAFTCWFIWKARCDFVFNXVKIIPSRVVXAISSAMDSFLAAGRSXEVCGLRXGVGQAS  823

Query  1689  YNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWV  1817
                V WTPP P + KIN+D +    + +   G +VR   G ++
Sbjct  824   XPVVCWTPPDPPFSKINVDASWCRMSLVGFVGVVVRSAEGQFI  866


 Score = 21.2 bits (43),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 13/59 (22%), Positives = 26/59 (44%), Gaps = 5/59 (8%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDME---IDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
               W++  G+ +  W D W+    LG  +    + + +NL   K+  F    R W++  +
Sbjct  535   THWQILGGEDVRVWVDRWLPSLXLGHPVPLGGVAVXRNLRVCKL--FCPLSREWDLNFL  591



>gb|AAK39575.1|AC025296_10 putative reverse transcriptase [Oryza sativa Japonica Group]
 gb|AAP54636.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=791

 Score = 79.7 bits (195),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 105/265 (40%), Gaps = 41/265 (15%)
 Frame = +3

Query  1119  STVDTLTWQDSTSGTFFVASAYSLISCTVD-------------ENWPWLWKLNCVEKVKT  1259
             S  D + W    +G F V SAY L +  V+             + W  +WK    +KVK 
Sbjct  406   SEEDFIAWHPDKNGMFSVRSAYRLAAQLVNIEESSSSGTNNINKAWEMIWKCKVPQKVKI  465

Query  1260  LLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGK  1439
               W +    + T V +++R L     C  C  E E   H  C C  A + W  +   G  
Sbjct  466   FAWRVASNCLATMVNKKKRKLEQSDMCQICDRENEDDAHALCRCIQASQLWSCMHKSGSV  525

Query  1440  T--LKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHV  1613
             +  +K  +L   W+  +   KI   + A     F+ TLW+ W  RN LI +  S  P   
Sbjct  526   SVDIKASVLGRFWL-FDCLEKIPEYEQA----MFLMTLWRNWYVRNELI-HGKSAPPTET  579

Query  1614  AK--------LACTFASEARAFIIR----------HGGTSQGCYN--WVTWTPPQPGWVK  1733
             ++        L        +A +++           GG      N     W  P+ GW+K
Sbjct  580   SQRFIQSYVDLLFQIRQAPQADLVKGKHVVRTVPLKGGPKYRVLNNHQPCWERPKDGWMK  639

Query  1734  INIDGAMKSCTGLASAGGIVRDDHG  1808
             +N+DG+  + +G    G I+R+  G
Sbjct  640   LNVDGSFDASSGKGGLGMILRNSAG  664


 Score = 29.3 bits (64),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (52%), Gaps = 4/52 (8%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWV-NDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNV  1041
             WRVG+G S+  W D W+  D S      I    N   K VS+ I +D SW+V
Sbjct  334   WRVGNGNSIRIWRDPWLPRDHS---RRPITGKANCRLKWVSDLITEDGSWDV  382



>ref|XP_008362180.1| PREDICTED: uncharacterized protein LOC103425857 [Malus domestica]
Length=1384

 Score = 77.0 bits (188),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/280 (23%), Positives = 106/280 (38%), Gaps = 20/280 (7%)
 Frame = +3

Query  1074  ELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD-ENWP-WLWKLNCVE  1247
             +L  +I  +P+P+D+   D L W+ STS  F  +  Y ++      ++W   +W+     
Sbjct  988   DLTKEILEMPLPIDEDK-DVLIWEVSTSXVFSFSDGYEIVRHRFPVKSWASIIWRPFIPP  1046

Query  1248  KVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIET  1427
             +   L+W +L  ++ T  + +RR +     C  C    ES  HLF  C+FA   W  + T
Sbjct  1047  RYSILVWKILFNKLPTEDQLQRRGIPLAPICQLCHKNSESXDHLFSSCEFAXCAWXWLAT  1106

Query  1428  YGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS----  1595
               G  +      +      +           W  +  + L  IWK RN   F        
Sbjct  1107  QFGTXIPXTXSJSDLXLXFLSXXFSXXXXNVWJASGFFLLMXIWKMRNKXKFEGKPPSXS  1166

Query  1596  ----ETPVHVAKLACTFASEARAF----IIRHGGTSQGCYNWVTWTPPQP-----GWVKI  1736
                  T   + ++        R      ++   G S       +  P         WVK+
Sbjct  1167  RLCXSTXAWIRQVGXJTPGHVRGILDXQLLXSLGISPNSXXXXSIVPXXXXXXXFSWVKV  1226

Query  1737  NIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSF  1856
             N +G  K   G A+ G +  D  G ++ GF+  +G   SF
Sbjct  1227  NTBGLAKGNXGXAACGXVFXDSXGYFLXGFSLSLGHRTSF  1266


 Score = 31.6 bits (70),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 0/45 (0%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
             RW +G+G +   W D W++   + +    +I  +L   KVSN I+
Sbjct  928   RWVIGNGSTTSLWVDKWLDXPIVDVVGATEIAXSLSRTKVSNIIR  972



>emb|CCA66044.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1355

 Score = 80.5 bits (197),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 112/286 (39%), Gaps = 36/286 (13%)
 Frame = +3

Query  1032  LECYVDALLTFLREELVNKIRAIPV---PVDDSTVDTLTWQDSTSGTFFVASAYSLISC-  1199
             +E  V  + T   E  +  I +IP+   P+ D     LTW  + +  + V +AY L    
Sbjct  972   MEWKVSLIETVFNERDIKCILSIPLSSLPLKDE----LTWAFTKNAHYSVKTAYMLGKGG  1027

Query  1200  ---TVDENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESL  1370
                +  + W  +W +    KVK  LW L    +      + RH++DD  C R   E ES 
Sbjct  1028  NLDSFHQAWIDIWSMEVSPKVKHFLWRLGTNTLPVRSLLKHRHMLDDDLCPRGCGEPESQ  1087

Query  1371  VHLFCDCQFARECWEAIETYGGKTLKNHLLM-NAWIESNVHSKIVTNDGAPWSITFVYTL  1547
              H    C F R+ W        + L     M  A + S+     V   GA       +  
Sbjct  1088  FHAIFGCPFIRDLWVDSGCDNFRALTTDTAMTEALVNSHGLDASVRTKGA-------FMA  1140

Query  1548  WQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCY---------NWV  1700
             W +W  RN+++FN +S TP H+        +     +  HG  +   Y         +  
Sbjct  1141  WVLWSERNSIVFNQSS-TPPHI------LLARVSRLVEEHGTYTARIYPNRNCCAIPSAR  1193

Query  1701  TWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKI  1838
              W  P P  +K+N+D ++ S  G      I RD HG  +     K+
Sbjct  1194  VWAAPPPEVIKLNVDASLASA-GWVGLSVIARDSHGTVLFAAVRKV  1238


 Score = 28.1 bits (61),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (55%), Gaps = 4/55 (7%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDR-SWNVTLM  1050
             WR+G+G ++  W D WV D+ LG  +  +   NL    VS  I  DR  W V+L+
Sbjct  928   WRIGNGTNVRIWEDPWVLDE-LGRFITSEKHGNL--NMVSELIDFDRMEWKVSLI  979



>gb|AEJ07916.1| putative ZmL1 non-LTR retrotransposon protein [Zea mays]
Length=472

 Score = 82.4 bits (202),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 104/262 (40%), Gaps = 26/262 (10%)
 Frame = +3

Query  1059  TFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN--------  1214
             TFL+E+  + I AIP+   +   DTL W     G F V SAY+L S   D +        
Sbjct  86    TFLQED-ADCILAIPI--QEGMEDTLAWHGDPKGNFSVKSAYALASRRRDHHNNADASSS  142

Query  1215  --------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESL  1370
                     W  +W +N   K+K  LW L        V   RR +  ++ C  C   +E  
Sbjct  143   ISGRGENVWKSIWNVNVTNKIKMFLWRLAHNSHPVRVNIARRGIKIETLCPMCFRLDEDG  202

Query  1371  VHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLW  1550
              HLF  C+  ++ W  +     +TL   L   A     + S +   +     I  V  LW
Sbjct  203   GHLFLKCKKVKQVWRCLCLEDTRTL---LASKASALEVIESILTLREET--KIKVVLLLW  257

Query  1551  QIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWV  1730
               W  RN  I      +   V               I  G +++     + W PP  G+ 
Sbjct  258   CWWSARNKTIQGERCGSTEEVCNTVAYHLMNMEKLQI--GKSARAPPMNLKWQPPPAGFY  315

Query  1731  KINIDGAMKSCTGLASAGGIVR  1796
             KIN DG+ ++ +GL S G I+R
Sbjct  316   KINCDGSYRAKSGLGSWGCIIR  337


 Score = 26.2 bits (56),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 17/33 (52%), Gaps = 3/33 (9%)
 Frame = +1

Query  889  WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKN  987
            WR+GDG  ++ W D W+     G    +  P+N
Sbjct  31   WRIGDGNQVNIWVDPWI---PRGETRRVITPRN  60



>ref|XP_010041058.1| PREDICTED: uncharacterized protein LOC104429964 [Eucalyptus grandis]
Length=1350

 Score = 82.0 bits (201),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 123/295 (42%), Gaps = 34/295 (12%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN---  1214
             ++ L T+     V+ I +IPV   + T D L W  +T+G +   S Y  I     E+   
Sbjct  942   IETLNTYYDAHTVHDILSIPV-RRNLTNDKLIWTATTNGQYTFHSGYHSIRGLERESLTL  1000

Query  1215  ------------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCR-D  1355
                         W  +WKL+   K+K   W +    + T     RR +  +  C  C   
Sbjct  1001  HASSSYQAPPHLWKRIWKLHLPLKLKVFCWNVCHNALPTKDNLCRRRISPNPLCPLCHTH  1060

Query  1356  EEESLVHLFCDCQFARECWEAIETYGGKTLKNHLL--MNAWIESNVHSKIVTNDGAPWSI  1529
             + E++ HLF  C +  + W       G +L +  +  ++ W+ S +  K +       ++
Sbjct  1061  QPETIEHLFLFCPWTSDIWSHPSI--GLSLADTSIRRIDEWLASLIFDKKLVP-----AL  1113

Query  1530  TFVYTL-WQIWKCRNNLIFNNNSETPVHVAKLACTF----ASEARAFIIRHGGTSQGCYN  1694
              F+  + WQ+WK RN+ IF+N    P  V  LA T     A  +   ++RH  + QG   
Sbjct  1114  EFIIAVCWQLWKARNSAIFSNRRLDPSSVV-LAATAQFRSAQLSHPSLLRH--SHQGEIL  1170

Query  1695  WVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFS  1859
                W  P PG ++INIDGA  S     S   I RD  G    GF   +    +  
Sbjct  1171  ARFWRAPPPGSIRINIDGAFISGNLTGSIAVICRDHSGLLKDGFTRSVQAASALQ  1225


 Score = 26.6 bits (57),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 13/42 (31%), Positives = 22/42 (52%), Gaps = 0/42 (0%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSN  1011
             +W VGDG +++   D W+    LG  ++ + P  + D  V N
Sbjct  895   KWSVGDGTNINIRQDRWLPRGILGGPLQREEPTMVSDLLVQN  936



>ref|XP_010451607.1| PREDICTED: uncharacterized protein LOC104733752 [Camelina sativa]
Length=467

 Score = 85.1 bits (209),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/208 (29%), Positives = 90/208 (43%), Gaps = 20/208 (10%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISC-------T  1202
             +D L  +   E V  I AIP+       D++ W  + SG + V S Y    C       T
Sbjct  79    MDRLKKYFASEDVTLIGAIPL-GSRRMDDSMGWHYTKSGKYTVKSGYD-AECSAASQLTT  136

Query  1203  VDENWPWL-------WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEE  1361
             V    P L       W + C  K+K  +W +L G +  +   RRR +  DS C RC  EE
Sbjct  137   VPRAGPQLTPLLASVWDVACPPKIKHFMWQVLTGCISVSANLRRRGIACDSACVRCGAEE  196

Query  1362  ESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVY  1541
             E++ H    C  AR+ W   +   G            + +NV+  + +++       F +
Sbjct  197   ETINHALFQCPSARQAWALAQVPVGPG----AFPTESVYANVNHFLGSSNPGSLIAAFPW  252

Query  1542  TLWQIWKCRNNLIFNNNSETPVHVAKLA  1625
              +W IWK RN  +F N  E P+ V +LA
Sbjct  253   LMWYIWKARNARVFENVMENPLDVVRLA  280


 Score = 23.5 bits (49),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +1

Query  892  RVGDGKSLDFWSDWWVNDKS  951
            +VG G+S+  W+D WV  +S
Sbjct  30   QVGSGESILIWTDPWVPAQS  49



>ref|XP_004301837.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=420

 Score = 85.9 bits (211),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 73/273 (27%), Positives = 116/273 (42%), Gaps = 30/273 (11%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS---------  1196
             VD L      + V  IR IP+ +  S  D L W     G + V S Y L           
Sbjct  80    VDLLEELFYADEVEMIRKIPLSIR-SPDDRLIWHFDKHGLYSVRSGYHLAGGVNADQSRG  138

Query  1197  -----CTVDENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEE  1361
                     ++ W  +WK+  + KVK+ +W L++  + T V   ++  +++  C  CR E 
Sbjct  139   SSSSPAGSNKTWKQVWKVRVLPKVKSFVWRLMRNILPTKVALSKKICMEEQLCPFCRTEN  198

Query  1362  ESLVHLFCDCQFARECWEAIETYGGKTLKNHLL--MNAWIESNVHSKIVTNDGAPWSITF  1535
             E+ +HLF +C  A  C   I   G +  +NH    M  W+   +   ++T         F
Sbjct  199   ETALHLFKECSGA-ACMLIISPLGLRA-RNHGANNMEEWVVGMM--DVLTTGQVE---MF  251

Query  1536  VYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVT--WT  1709
                LW +W  RNN+++   S  P++    +     E +     H   ++     V+  W 
Sbjct  252   FMLLWALWVERNNMVWQGTSFDPINTVTWSMLLLQEYQNL---HPCETKLKRRKVSERWK  308

Query  1710  PPQPGWVKINIDGAMKSCTGLASAGGIVRDDHG  1808
              P  G +K+N DGA +   G   AG IVRD+ G
Sbjct  309   FPPSGRLKLNFDGAYRD-DGWGGAGVIVRDEQG  340



>ref|XP_009800085.1| PREDICTED: uncharacterized protein LOC104246050 [Nicotiana sylvestris]
Length=690

 Score = 87.4 bits (215),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 78/271 (29%), Positives = 120/271 (44%), Gaps = 15/271 (6%)
 Frame = +3

Query  1053  LLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS----CTVDEN-W  1217
             L T    E +N I+ IP+ V +   DT  W+    G + V S Y ++      + D N W
Sbjct  314   LETVFSAEEINCIKHIPL-VFNLCDDTWMWKLDRKGNYTVKSGYLVVQNHNLQSSDGNTW  372

Query  1218  PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
               L  L    KV    W  LKG + T      + ++  + C  C    ES++H    C  
Sbjct  373   KKLRTLKMPAKVLNFAWRALKGVLPTGENLFSKKVLQSNICPACLQYAESIMHCLVMCTA  432

Query  1398  ARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNL  1577
             A+  W    + G + +    +   W  + V +  VT +    +I     LW+IW  RNNL
Sbjct  433   AKLVWLK-SSMGWRPVGASFM--EWFTALVAA--VTKEKLQEAIML---LWEIWNARNNL  484

Query  1578  IFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVT-WTPPQPGWVKINIDGAM  1754
             ++N  +  P  +   A  F  E  +    +   S     +V  W PP PG +K NID   
Sbjct  485   VWNGKTMRPETIILRASRFWKEWTSTRSDNNIYSVARPEFVVKWFPPDPGTLKCNIDAFY  544

Query  1755  KSCTGLASAGGIVRDDHGCWVIGFATKIGVT  1847
             +  +G A AG ++RD HG +V GF+T +G +
Sbjct  545   EVNSGRAWAGMLIRDTHGNFVRGFSTLLGAS  575



>ref|XP_008232623.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
 ref|XP_008238689.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=965

 Score = 87.4 bits (215),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 108/270 (40%), Gaps = 36/270 (13%)
 Frame = +3

Query  1098  IPVPVDDSTVDTLTWQDSTSGTFFVASAY----------SLISCTVD-------ENWPWL  1226
             + +P+    +D   W  + +G + V S Y           L + TV        ++W  L
Sbjct  587   LSIPLMGDNLDRRIWNFTKNGRYSVKSGYWAALEYKRLEELSAGTVAGPSSSSLKSWKHL  646

Query  1227  WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARE  1406
             WKL   +K+  LLW + +  + +     RR +     C RC    E+ +H    C    +
Sbjct  647   WKLKVPQKILHLLWRVAQDILPSKEVLFRRRITQGEVCCRCFAPRETTLHALVGCVVCLQ  706

Query  1407  CWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSIT-------FVYTLWQIWKC  1565
              WEA++      L     +  W++            A WSI        F +T+W +W  
Sbjct  707   VWEALDFPRDFLLPTVADVGTWMD------------AAWSIIPPDKQSLFAFTVWVLWNE  754

Query  1566  RNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINID  1745
             RN ++F +       + + A  + +E + +   +  +       + W PP     K+N+D
Sbjct  755   RNGVLFGSQPTPSGVLVQRAKDYDAEFKRYSAANHRSLSSLVRDIKWRPPTGNCFKLNVD  814

Query  1746  GAMKSCTGLASAGGIVRDDHGCWVIGFATK  1835
             GA    TG   AG IVRD HG  V   A +
Sbjct  815   GATDMETGARGAGAIVRDSHGNLVGALAMR  844



>ref|XP_006491472.1| PREDICTED: uncharacterized protein LOC102626455 [Citrus sinensis]
Length=1452

 Score = 79.3 bits (194),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 70/272 (26%), Positives = 109/272 (40%), Gaps = 27/272 (10%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN---  1214
             VD L     +E +  I  I +P      D + W     G + V S Y L    +++N   
Sbjct  1066  VDRLEQHFMKEDIEAILKILLPSGKEE-DEVLWHFDKKGEYSVKSGYQL---ALNQNFPN  1121

Query  1215  -----------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEE  1361
                        W   W L+  EKVK  +W  LK  + T     +R  + +  C RC+ + 
Sbjct  1122  EPESSNSSSRLWKIPWMLDLPEKVKIFMWRALKNILPTAENLWKRRSLQEPICQRCKLQV  1181

Query  1362  ESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVY  1541
             E++ H+  +C+ AR+ W+ +     +  K+H   N    S +      +  A   +  VY
Sbjct  1182  ETVSHVLIECKAARKIWD-LAPLIVQPSKDH---NQDFFSAIQEMWSRSSTAEAELMIVY  1237

Query  1542  TLWQIWKCRNNLIFN-NNSETPVHVAKLACTFASEARAFIIR--HGGTSQGCYNWVTWTP  1712
               W IW  RN  IF    S++    AK      +  R       HG   +G  +   W P
Sbjct  1238  C-WVIWSARNKFIFEGKKSDSRFLAAKADSVLKAYQRVSKPGNVHGAKDRGI-DQQKWKP  1295

Query  1713  PQPGWVKINIDGAMKSCTGLASAGGIVRDDHG  1808
             P    +K+N+D A+ +       G IVRD  G
Sbjct  1296  PSQNVLKLNVDAAVSTKDQKVGLGAIVRDAEG  1327


 Score = 28.9 bits (63),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (51%), Gaps = 4/53 (8%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNL-YDKKVSNFIKDDRSWNV  1041
             RWR+GDGK +  + D W+   +    +    PK L ++  V++ I  +  W V
Sbjct  1017  RWRIGDGKKVLVYKDKWIPRPATFQPIS---PKTLPHETVVADLIDSENKWRV  1066



>ref|XP_010676027.1| PREDICTED: uncharacterized protein LOC104891937 [Beta vulgaris 
subsp. vulgaris]
Length=1261

 Score = 77.8 bits (190),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 118/287 (41%), Gaps = 22/287 (8%)
 Frame = +3

Query  1053  LLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVAS----AYSLISCTVDE-NW  1217
             LL+ +   +V+ I +I +P      DTL W  ++ G + V S    A  LIS  +D   +
Sbjct  862   LLSLVPPNIVSHISSIYLPSSPQQ-DTLIWGLTSDGEYSVKSGALLAQGLISAELDTVEY  920

Query  1218  PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
              W+W L    K+K  LW      + T V   R H+     C  C +  ES+ HL   C F
Sbjct  921   KWIWNLIIPPKIKNFLWKACNDGLPTKVRLERSHVFLPQQCVFCSNASESIGHLCFACPF  980

Query  1398  ARECWEAIETYGGKTLKNHLLMNAWIES--NVHSKIVTNDGAPWSITFVYTLWQIWKCRN  1571
               + +  ++      L N  L +  + S  +     ++         F +  W IW  RN
Sbjct  981   TLDVFSHLKASFDWPLPNRCLASIDLTSFRSALEACLSLACKSEVTKFSFVWWFIWFFRN  1040

Query  1572  NLIFNNNSETPVHVAKLACTFA---SEARAFIIRHGGTSQGCYNWVT----------WTP  1712
              LIFNN   +    + +   +    S+A     RH  TS      ++          W+P
Sbjct  1041  KLIFNNEVVSSRKASAIIAKYYVDWSKALTSDTRHPSTSISHCPIISRSPRSGPASFWSP  1100

Query  1713  PQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDS  1853
             P   + K+N DG+  S    A  G ++R+  G  ++  +  +G + S
Sbjct  1101  PPQNYFKLNFDGSKLSSNSTA-LGFVIRNVAGEAMVAGSKSLGYSTS  1146


 Score = 30.4 bits (67),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 26/55 (47%), Gaps = 2/55 (4%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             RW++GDG  + FWSD W       LD  I       +  V + +  + +WN  L+
Sbjct  810   RWQIGDGSCVRFWSDNWAFQ--YPLDSIITPTPETINFLVKDCLTANGNWNTQLL  862



>gb|ABA97040.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1913

 Score = 77.4 bits (189),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 115/291 (40%), Gaps = 48/291 (16%)
 Frame = +3

Query  1080  VNKIRAIPVPVDDSTV-----------DTLTWQDSTSGTFFVASAYSLI---------SC  1199
             V K+  + +P+D   +           D L+W     G F V SAY L          S 
Sbjct  1547  VQKVSRVFLPIDADEILKIRTSVRLEEDFLSWHPDRLGQFSVRSAYKLAISLDYADESSS  1606

Query  1200  TVDEN----WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEES  1367
             +  +N    W  +WK N  +KVK   W      +     +++R+L     C  C +E E 
Sbjct  1607  SSGQNPQKIWDLIWKCNVPQKVKVFCWRAANNCLANQENKKKRNLERSEICCICGNETED  1666

Query  1368  LVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTL  1547
             + H    C  A   WEA++  G  +L  ++  NA   S    +I  N  A   +     L
Sbjct  1667  VSHALSRCPHAVHLWEAMKAAGSLSL--NVAGNATGGSWFFDQI-ENTPAEERMMLCMML  1723

Query  1548  WQIWKCRNNLIFNNNSETPVHVAKL----ACTFASEAR----AFIIRHGGTSQGCYNWVT  1703
             W+IW  RN L ++     P+ V+K      C+   E +    A ++R     Q      +
Sbjct  1724  WRIWFVRNEL-YHGKVPPPIAVSKRFLESYCSSLLEIKQHPHADVVRGKHVVQQPTRMRS  1782

Query  1704  ------------WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVI  1820
                         W  PQ GW+K+N+DG+  S +     G ++RD  G  + 
Sbjct  1783  EANHLRRVVPARWEKPQMGWMKLNVDGSYDSNSSKGGIGVVLRDSVGTVIF  1833


 Score = 30.8 bits (68),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 28/52 (54%), Gaps = 4/52 (8%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWV-NDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNV  1041
             WR+G+G+S+  W D W+  D S      I   +N   K VS+ +  D SW+V
Sbjct  1499  WRIGNGRSVRIWRDPWIPRDHSC---RPITTKRNCRVKWVSDLLGQDGSWDV  1547



>ref|XP_008382787.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=801

 Score = 80.5 bits (197),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 74/288 (26%), Positives = 118/288 (41%), Gaps = 41/288 (14%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS--------C  1199
             ++ LL FL +     I   P+  D S  D + W  S +G + V S Y  I         C
Sbjct  399   LNFLLPFLSDSDKQAIEDTPIG-DLSRKDRIIWGSSKNGIYSVKSGYRWIQSXSLARRDC  457

Query  1200  TVDEN-------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDE  1358
              +          W  +WKL    K++  LWL L   + T     RR      TC  C   
Sbjct  458   RLSXARRVPSVLWKAIWKLEVPPKLRHFLWLTLHNCLPTCEALFRRRSSLSXTCPXCLSH  517

Query  1359  EESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVH-------SKIVTNDGA  1517
             +E++ HLF  C +    W     +GG    N+ +  A I S V        S +V ++ A
Sbjct  518   DETIEHLFFTCPWVEPVW-----FGGAL--NYKIDRAAIHSWVEWLXAVWSSSLVPSNHA  570

Query  1518  PWSITFV-YTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFI-------IRHGG  1673
              W  +++ YT W IWK R + +FN   + P++ +K+    ++   +F+       +    
Sbjct  571   DWMRSYIAYTCWVIWKTRCDFVFN---KVPIYPSKVLFAISTAVGSFLAANVSLGVSRSA  627

Query  1674  TSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWV  1817
              + G      W  P     KIN+D +    + L  AG ++R   G +V
Sbjct  628   GAGGVDLGSRWCAPTSPLXKINVDASWSKVSKLGFAGVVIRAAEGRFV  675


 Score = 27.7 bits (60),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 13/61 (21%), Positives = 29/61 (48%), Gaps = 1/61 (2%)
 Frame = +1

Query  871   VEIRARWRVGDGKSLDFWSDWWVNDKSLGLDMEI-DIPKNLYDKKVSNFIKDDRSWNVTL  1047
             +++ + W++  G+ +  W D W+    +G  M +  +P  L  +  S    D R W++  
Sbjct  342   LKLGSHWQILGGQDVRVWVDKWLPSLPMGHPMPLGSVPVTLNLRVSSLICPDSRRWDLNF  401

Query  1048  M  1050
             +
Sbjct  402   L  402



>ref|XP_008237273.1| PREDICTED: uncharacterized protein LOC103336015 [Prunus mume]
Length=1765

 Score = 87.4 bits (215),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 108/270 (40%), Gaps = 36/270 (13%)
 Frame = +3

Query  1098  IPVPVDDSTVDTLTWQDSTSGTFFVASAY----------SLISCTVD-------ENWPWL  1226
             + +P+    +D   W  + +G + V S Y           L + TV        ++W  L
Sbjct  1387  LSIPLMGDNLDRRIWNFTKNGRYSVKSGYWAALEYKRLEELSAGTVAGPSSSSLKSWKHL  1446

Query  1227  WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARE  1406
             WKL   +K+  LLW + +  + +     RR +     C RC    E+ +H    C    +
Sbjct  1447  WKLKVPQKILHLLWRVAQDILPSKEVLFRRRITQGEVCCRCFAPRETTLHALVGCVVCLQ  1506

Query  1407  CWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSIT-------FVYTLWQIWKC  1565
              WEA++      L     +  W++            A WSI        F +T+W +W  
Sbjct  1507  VWEALDFPRDFLLPTVADVGTWMD------------AAWSIIPPDKQSLFAFTVWVLWNE  1554

Query  1566  RNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINID  1745
             RN ++F +       + + A  + +E + +   +  +       + W PP     K+N+D
Sbjct  1555  RNGVLFGSQPTPSGVLVQRAKDYDAEFKRYSAANHRSLSSLVRDIKWRPPTGNCFKLNVD  1614

Query  1746  GAMKSCTGLASAGGIVRDDHGCWVIGFATK  1835
             GA    TG   AG IVRD HG  V   A +
Sbjct  1615  GATDMETGARGAGAIVRDSHGNLVGALAMR  1644



>gb|AAQ19327.1| bZIP-like protein [Oryza sativa Japonica Group]
Length=2367

 Score = 79.0 bits (193),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 105/265 (40%), Gaps = 41/265 (15%)
 Frame = +3

Query  1119  STVDTLTWQDSTSGTFFVASAYSLISCTVD-------------ENWPWLWKLNCVEKVKT  1259
             S  D + W    +G F V SAY L +  V+             + W  +WK    +KVK 
Sbjct  1730  SEEDFIAWHPDKNGMFSVRSAYRLAAQLVNIEESSSSGTNNINKAWEMIWKCKVPQKVKI  1789

Query  1260  LLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGK  1439
               W +    + T V +++R L     C  C  E E   H  C C  A + W  +   G  
Sbjct  1790  FAWRVASNCLATMVNKKKRKLEQSDMCQICDRENEDDAHALCRCIQASQLWSCMHKSGSV  1849

Query  1440  T--LKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHV  1613
             +  +K  +L   W+  +   KI   + A     F+ TLW+ W  RN LI +  S  P   
Sbjct  1850  SVDIKASVLGRFWL-FDCLEKIPEYEQA----MFLMTLWRNWYVRNELI-HGKSAPPTET  1903

Query  1614  AK--------LACTFASEARAFIIR----------HGGTSQGCYN--WVTWTPPQPGWVK  1733
             ++        L        +A +++           GG      N     W  P+ GW+K
Sbjct  1904  SQRFIQSYVDLLFQIRQAPQADLVKGKHVVRTVPLKGGPKYRVLNNHQPCWERPKDGWMK  1963

Query  1734  INIDGAMKSCTGLASAGGIVRDDHG  1808
             +N+DG+  + +G    G I+R+  G
Sbjct  1964  LNVDGSFDASSGKGGLGMILRNSAG  1988


 Score = 28.9 bits (63),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (52%), Gaps = 4/52 (8%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWV-NDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNV  1041
             WRVG+G S+  W D W+  D S      I    N   K VS+ I +D SW+V
Sbjct  1658  WRVGNGNSIRIWRDSWLPRDHS---RRPITGKANCRLKWVSDLITEDGSWDV  1706



>ref|XP_009107025.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=459

 Score = 73.2 bits (178),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 96/237 (41%), Gaps = 14/237 (6%)
 Frame = +3

Query  1104  VPVDDSTVDTLTWQDSTSGTFFVASAYSLISCT----VDENWPW---LWKLNCVEKVKTL  1262
             VP      D L W  + SG +   S Y+L   +    + + +PW   +W LN   KV+T 
Sbjct  214   VPSSFDKQDELVWLPNASGDYTSKSGYALARLSTQSHIIDQFPWRKSVWNLNTPPKVQTF  273

Query  1263  LWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKT  1442
             LW  + G +        R L  ++ C RC  E ++ +HLF  C FA   W+ I       
Sbjct  274   LWRSMNGALPVGSVLLTRGLHAEAKCKRC-GELKTPLHLFLTCPFAARIWDRIPALFKPD  332

Query  1443  LKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKL  1622
                   ++  + SN+    +   G   S  + +  W +WK RN LIF + S T    A+L
Sbjct  333   ASTVTSVSNLLISNMRMINLPPTGLGTSPIYPWLYWHLWKARNKLIFEDRSWT---EAEL  389

Query  1623  ACTFASEARAFIIRHGGTSQGCYNWVTWTP-PQPGWVKIN--IDGAMKSCTGLASAG  1784
                   +AR +     G      N     P P P    +N   DGA    +G +  G
Sbjct  390   VLKIIKDARCWEEASQGKRHAQTNKSNPIPAPLPSLQYLNCFTDGAWDPNSGNSGQG  446


 Score = 34.7 bits (78),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 29/55 (53%), Gaps = 1/55 (2%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSN-FIKDDRSWNVTLM  1050
             W VG+G+S+  WS  W++  SL   M     +   D  VSN  + + + WNV L+
Sbjct  145   WTVGNGESIKVWSAPWLSTSSLITPMGPAPSRESQDMLVSNLLLPETKEWNVHLV  199



>ref|XP_008222895.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=605

 Score = 77.4 bits (189),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 112/284 (39%), Gaps = 38/284 (13%)
 Frame = +3

Query  1071  EELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVD--------------  1208
             ++ V  I  IP+ V  ++ D L W    +G + V S Y L     D              
Sbjct  253   DQEVEAILQIPL-VSLASHDCLIWNYERNGMYSVKSGYQLTRLEKDIMCGESSAGVNLSS  311

Query  1209  ENWPWLWKLNCVEKVKTLLW-----LLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLV  1373
               W  +W L    K+K  LW      L  G+   N     R +    +  +C  + ES++
Sbjct  312   RFWKKIWALKIPNKIKFFLWRCVWDFLPCGQTLFN-----RKIASTPSYPQCHRKSESVL  366

Query  1374  HLFCDCQFARECWEAIETYGG--KTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTL  1547
             H+   C+ A+E W     +G   +  + +     W    + S      G      F Y  
Sbjct  367   HVVWWCEAAKEVWRN-SAWGNVCEVWRVNSFRELWYAVQISS------GGEEQGLFAYLC  419

Query  1548  WQIWKCRNNLIFNNNSETPVHVAKLACTFASE----ARAFIIRHGGTSQGCYNWVTWTPP  1715
             W +W  R++LIF   SET   +     T A E      +    HG  S    +   W PP
Sbjct  420   WGLWNWRDSLIFEAKSETATQLLHRMHTLAQEFFDVNNSSHTSHGRQSSPQASLHVWRPP  479

Query  1716  QPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVT  1847
               G  KIN+DGA+KS   +   G +VR+++G ++     +I  +
Sbjct  480   AVGIYKINVDGALKSGDSIRGVGVVVRNENGDFMAACVRRIQAS  523


 Score = 30.4 bits (67),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 2/55 (4%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             RWRVG+G+S+  +++ W+   S    M    P+      V +       WNV L+
Sbjct  195   RWRVGNGESIQVYTNKWLPVPSFFKIM--SAPQLPLSTLVCDLFTSSGQWNVPLL  247



>ref|XP_008346916.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1007

 Score = 86.7 bits (213),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 76/283 (27%), Positives = 116/283 (41%), Gaps = 29/283 (10%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS----CTVD-  1208
             ++ L  F  +     IRA P+  D S  D L W  S +G + V S Y  I     C  D 
Sbjct  588   LNFLQPFXTDVEXETIRATPIG-DSSRRDRLIWAASKNGRYSVKSGYRWIQSRSLCLRDS  646

Query  1209  ----------ENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDE  1358
                       E W  LWK+    K++  LW  L   + T V   +R   +   C  C  +
Sbjct  647   RLPHARSVPEELWKCLWKIEVPPKIRHFLWSSLHNALATKVNLFKRGASNSPICPICLCD  706

Query  1359  EESLVHLFCDCQFARECW-EAIETY--GGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSI  1529
             +ES VH+F  C + +  W   + +Y   G  + +  L   W+++   S     D   W  
Sbjct  707   DESTVHIFLLCPWVKHVWFGGVLSYKVDGXAISSWFL---WLQAIFSSNFGAPDDGMWVR  763

Query  1530  TFV-YTLWQIWKCRNNLIFNNNSETPVHVAKLAC----TFASEARAFII--RHGGTSQGC  1688
             + V +T W IWK R + +FN     P  V         +F +  R+  +     G  Q  
Sbjct  764   SCVAFTCWFIWKARCDFVFNXVKIIPSRVVXAISSAMDSFLAAGRSXEVCGLRXGVGQAS  823

Query  1689  YNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWV  1817
                V WTPP P + KIN+D +    + +   G +VR   G ++
Sbjct  824   XPVVCWTPPDPPFSKINVDASWCRMSLVGFVGVVVRSAEGQFI  866


 Score = 20.8 bits (42),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 13/59 (22%), Positives = 26/59 (44%), Gaps = 5/59 (8%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDME---IDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
               W++  G+ +  W D W+    LG  +    + + +NL   K+  F    R W++  +
Sbjct  535   THWQILGGEDVRVWVDRWLPSLLLGHPVPLGXVAVTRNLRVCKL--FCPLSREWDLNFL  591



>ref|NP_187562.1| RNase H domain-containing protein [Arabidopsis thaliana]
 gb|AAF23283.1|AC016661_8 putative non-LTR reverse transcriptase [Arabidopsis thaliana]
 gb|AEE74775.1| RNase H domain-containing protein [Arabidopsis thaliana]
Length=484

 Score = 82.4 bits (202),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 64/247 (26%), Positives = 104/247 (42%), Gaps = 23/247 (9%)
 Frame = +3

Query  1128  DTLTWQDSTSGTFFVASAYSLISCTVDENWP-------------WLWKLNCVEKVKTLLW  1268
             D + W  +T+G + V S Y L++     N P              +W L  + K+K  LW
Sbjct  117   DKIIWNYNTTGEYTVRSGYWLLTHDPSTNIPAINPPHGSIDLKTRIWNLPIMPKLKHFLW  176

Query  1269  LLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLK  1448
               L   + T      R +  D +C RC  E ES+ H    C FA   W   ++     ++
Sbjct  177   RALSQALATTERLTTRGMRIDPSCPRCHRENESINHALFTCPFATMAWRLSDS---SLIR  233

Query  1449  NHLLMNAWIE--SNVHSKIVTNDGAPW-SITFVYTLWQIWKCRNNLIFNNNSETPVHVAK  1619
             N L+ N + E  SN+ + +     + +  +  V+ +W+IWK RNN++FN   E+P     
Sbjct  234   NQLMSNDFEENISNILNFVQDTTMSDFHKLLPVWLIWRIWKARNNVVFNKFRESPSKTVL  293

Query  1620  LACTFASE----ARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGG  1787
              A     +     ++       T Q   N + W  P   +VK N D         A+ G 
Sbjct  294   SAKAETHDWLNATQSHKKTPSPTRQIAENKIEWRNPPATYVKCNFDAGFDVQKLEATGGW  353

Query  1788  IVRDDHG  1808
             I+R+ +G
Sbjct  354   IIRNHYG  360


 Score = 25.4 bits (54),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 28/65 (43%), Gaps = 0/65 (0%)
 Frame = +2

Query  1889  KAQSRRVVNGLCSCGAVMNRGDHSEETVVTLVKDCLDLSRKFRKFKISHIMREGNRCADW  2068
             +  ++  + G C     +  G     ++   ++D    + KF   +   I R+GN+ A  
Sbjct  394   RGYTQVFMEGDCQTLINLINGISFHSSLANHLEDISFWANKFASIQFGFIRRKGNKLAHV  453

Query  2069  LANYG  2083
             LA YG
Sbjct  454   LAKYG  458



>ref|XP_006485451.1| PREDICTED: uncharacterized protein LOC102622884 [Citrus sinensis]
Length=1160

 Score = 87.0 bits (214),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 109/276 (39%), Gaps = 44/276 (16%)
 Frame = +3

Query  1071  EELVNK---------IRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI----------  1193
             EEL+ K         I  IP+P      D L W    SG + V S Y             
Sbjct  742   EELIYKHFDKMDADVITQIPLP-RRLREDELIWHFGKSGQYTVKSGYQRALKIRFPAMPS  800

Query  1194  -SCTVDENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESL  1370
              S +    W  +W L   +K++  +W   K  + +     +R ++ + TC  C+   E++
Sbjct  801   SSESSKNEWNIIWSLALPKKIRIFVWRAAKNLLPSAENLWKRKIVQEPTCQLCKMGIENV  860

Query  1371  VHLFCDCQFARECWEA------IETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSIT  1532
              H   DC+ A++ W        I+   G+ + + L     + SN    +           
Sbjct  861   FHALVDCKAAKKVWRLSLFYIDIQAAPGQDILSLLHGVKRMRSNADVDL-----------  909

Query  1533  FVYTLWQIWKCRNNLIFNNNSETPVHV-AKLACTFASEAR---AFIIRHGGTSQGCYNWV  1700
             F   LW  W  RN  +F    E P  V AK      +  R   +  + HG   Q     +
Sbjct  910   FAVMLWAKWNARNQWLFKGKRENPQSVVAKAEAVMEAYKRVQPSADVSHG--KQQKVAQL  967

Query  1701  TWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHG  1808
              W PPQ G+VKIN D A  S   LA  G ++RD++G
Sbjct  968   GWNPPQEGFVKINTDAATNSEKNLAGLGAVIRDENG  1003



>ref|XP_007207950.1| hypothetical protein PRUPE_ppa017250mg, partial [Prunus persica]
 gb|EMJ09149.1| hypothetical protein PRUPE_ppa017250mg, partial [Prunus persica]
Length=219

 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 88/192 (46%), Gaps = 22/192 (11%)
 Frame = +3

Query  1281  GRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLL  1460
             G++ +N +R RRHL  DS+C  C    E ++H+  DC   RE W      G         
Sbjct  1     GKILSNEQRVRRHLTLDSSCQCCGWPIECVLHILRDCFKVREVWFLFLKRGDAARFLQAD  60

Query  1461  MNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFAS  1640
               AW+ SN+ SK V     PW + FV+T W IWK RN  I       P  ++K       
Sbjct  61    FKAWLFSNLCSKSVYGH-QPWPVVFVFTCWFIWKWRN--ISEWLQACPNSISK-------  110

Query  1641  EARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVI  1820
               +  I+            + W PP  G  K+N+DG+ K   G   AGGI+RD  G W+ 
Sbjct  111   RTQVQIM------------LAWEPPVNGVFKLNVDGSRKGGIGCIGAGGIIRDSFGDWMC  158

Query  1821  GFATKIGVTDSF  1856
             GFA  +G+  + 
Sbjct  159   GFAVNLGIGQTL  170



>gb|EEC68446.1| hypothetical protein OsI_36656 [Oryza sativa Indica Group]
Length=314

 Score = 83.2 bits (204),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 64/258 (25%), Positives = 106/258 (41%), Gaps = 37/258 (14%)
 Frame = +3

Query  1134  LTWQDSTSGTFFVASAYSLI-------------SCTVDENWPWLWKLNCVEKVKTLLWLL  1274
             L W     G F V S Y L+                V+++W  +W  N  +KV+   W  
Sbjct  16    LAWHPDRLGKFSVRSVYHLVVSLAETGDCSSSTEVLVNKSWKRIWACNVPQKVRIFAWKA  75

Query  1275  LKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNH  1454
             +   + T   +++R+L   STC  C  EEE + H  C CQ AR  W A+  Y  + + +H
Sbjct  76    ISNSLPTMKNKKKRNLELLSTCCICGAEEEDVAHALCHCQQARNLWSAM--YSARAI-SH  132

Query  1455  LLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKL----  1622
              + +AW  ++    ++          F+  +W+IW  RN  I +  S  PV V++     
Sbjct  133   DVNSAWSGTDWILNLLEVLPKEEDAMFLMLMWRIWHNRNE-ITHGKSIAPVAVSQRFIFS  191

Query  1623  ----ACTFASEARAFIIRHGGTSQ------------GCYNWVTWTPPQPGWVKINIDGAM  1754
                   T     +A II+    +                +   W  P   W+K+N+DG+ 
Sbjct  192   YVSSLTTIKQYPQADIIKGKQVAHPDRIRLPSQAPPAVSSPRRWEKPSTRWMKLNVDGSF  251

Query  1755  KSCTGLASAGGIVRDDHG  1808
             ++  G    G ++RD  G
Sbjct  252   QASYGKGGIGAVLRDSSG  269



>ref|XP_007219414.1| hypothetical protein PRUPE_ppa021915mg, partial [Prunus persica]
 gb|EMJ20613.1| hypothetical protein PRUPE_ppa021915mg, partial [Prunus persica]
Length=509

 Score = 85.5 bits (210),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 80/288 (28%), Positives = 126/288 (44%), Gaps = 38/288 (13%)
 Frame = +3

Query  1062  FLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY-------SLISCTVDENWP  1220
             FL +E +  I ++P+ +  S  D   W  +++G + V S          ++S  V   W 
Sbjct  184   FLDQETIRCILSLPIGIS-SLPDRWIWPWTSNGEYSVKSGIVGPPQTSHVVSTQV---WK  239

Query  1221  WLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFA  1400
              LWKL  + K+K   W +L   + T +   +R +     C  C + EES+ HLF  C + 
Sbjct  240   GLWKLKSLPKIKFFCWRILSNAIATKLNLFKRKISQSPMCPVCENNEESVEHLFLLCPWT  299

Query  1401  RECWEA------IETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWK  1562
                W        +      T  N L  N+  + N+ S I+  +     I+F+  LW+IWK
Sbjct  300   AAVWFGSPLNYRVHNQSITTFDNWL--NSMFQLNLTS-ILDRNRLMTIISFI--LWEIWK  354

Query  1563  CRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCY-NWVT------WTPPQP  1721
              R   +       P+HV   A   A+E   FI      SQ  + ++VT      WTPP  
Sbjct  355   ARCKFVIEGRQLHPIHVLHQAMRAANE---FI--EANVSQSTHSDYVTLISTRAWTPPSD  409

Query  1722  GWVKINIDGAMKSCTGLASAGGIVRDD----HGCWVIGFATKIGVTDS  1853
             G+VK+N D A    +  ++ G ++RD      G    GF+  +  TDS
Sbjct  410   GFVKVNTDAAWIKESNRSAVGVVIRDSAGNVRGAKRKGFSKVMLETDS  457



>ref|XP_010424493.1| PREDICTED: uncharacterized protein LOC104709611 [Camelina sativa]
Length=777

 Score = 80.5 bits (197),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 68/236 (29%), Positives = 106/236 (45%), Gaps = 28/236 (12%)
 Frame = +3

Query  975   YSEEPLR*KS*QFYQR*P*LECYV-----DALLTFLREELVNKIRAIPVPVDDSTVDTLT  1139
             +S+ PL+  S Q       ++C++     D L      E V+ I AIP+       D+L 
Sbjct  370   FSKGPLKDSSLQISHL---IDCHMNTWRMDMLKEHFAPEDVDLIGAIPLE-SCRPQDSLG  425

Query  1140  WQDSTSGTF----------FVASAYSLISCTVDENWPWL---WKLNCVEKVKTLLWLLLK  1280
             W  + SG +          F AS  S +S +  E  P L   W  +C  K+K  +W +L 
Sbjct  426   WHFTKSGKYTVKSRYDTELFAASRLSTVSRSGLEITPLLAGVWGAHCPPKIKRFMWQVLT  485

Query  1281  GRMFTNVERRRRHLIDDSTCARCRDEEESLVH-LFCDCQFARECWEAIETYGGKTLKNHL  1457
             G +  +   RRR +  DS C RC  EEE++ H +FC C  AR+ W   +   G       
Sbjct  486   GCILVSANLRRRGIACDSGCVRCGAEEETINHAIFC-CPPARQVWALAQVPVGP----DS  540

Query  1458  LMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLA  1625
             L    + +NV   + + +       F + +W IWK RN  +F +  + P+ V +LA
Sbjct  541   LPTESVYANVDHFLDSTNPGSQIKNFPWLMWYIWKARNARVFEDVMDNPLDVVRLA  596


 Score = 26.2 bits (56),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +1

Query  892  RVGDGKSLDFWSDWWVNDKS  951
            RVG G+S+  W+D WV  +S
Sbjct  346  RVGSGESISIWTDPWVPAQS  365



>ref|XP_010507122.1| PREDICTED: uncharacterized protein LOC104783698 [Camelina sativa]
Length=1200

 Score = 82.8 bits (203),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 92/207 (44%), Gaps = 18/207 (9%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY----------SLI  1193
             +D L  F   E V+ I AIP+       D++ W  + SG + V S Y          +++
Sbjct  940   MDRLKEFFAPEDVDLIGAIPLG-SRRLDDSMGWHYTKSGKYAVKSGYEVERRFAPQLTMV  998

Query  1194  SCTVDENWPWL---WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEE  1364
                  E  P L   W ++C  K+K  +W +L G +      RRR +  DS C RC  +EE
Sbjct  999   PRVGPEITPLLAAVWDVSCPPKIKHFMWQVLSGCISVLANLRRRGIPCDSACVRCGADEE  1058

Query  1365  SLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYT  1544
             ++ H    C  AR+ W   +   G            I +NV   + +++ A     F + 
Sbjct  1059  TINHAIFSCPPARQAWALAQVPVGPG----SFPTESIYANVDHFLGSSNPASQVAAFPWL  1114

Query  1545  LWQIWKCRNNLIFNNNSETPVHVAKLA  1625
             +W IWK RN  +F +  E P+ V +LA
Sbjct  1115  MWYIWKARNARVFESVMENPMDVVRLA  1141


 Score = 24.3 bits (51),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 0/20 (0%)
 Frame = +1

Query  892  RVGDGKSLDFWSDWWVNDKS  951
            RV  G+S+  W+D WV  +S
Sbjct  891  RVSSGESISIWTDPWVPAQS  910



>ref|XP_007208821.1| hypothetical protein PRUPE_ppa025050mg [Prunus persica]
 gb|EMJ10020.1| hypothetical protein PRUPE_ppa025050mg [Prunus persica]
Length=241

 Score = 67.8 bits (164),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +3

Query  1518  PWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNW  1697
             PW + F  T+W  WK R    FN + E P +   +   FA E         G        
Sbjct  13    PWVLVFTATIWHCWKWRCISTFNPDYEPPPNPHHIILQFAKEWFDINKMVNGKLAREVIQ  72

Query  1698  VTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTD  1850
             + W+PP     K+N DG+ K+ +   + GG++RD HG W+ GF+  IG+ +
Sbjct  73    IHWSPPTAAISKLNADGSYKTTSWKITTGGLLRDSHGSWICGFSVNIGIGN  123


 Score = 38.9 bits (89),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = +2

Query  1934  AVMNRGDHSEETVVTLVKDCLDLSRKFRKFKISHIMREGNRCADWLANYGQNIT  2095
             ++M +       ++ L++DC  L  +    KISH+ RE NR AD LAN G  +T
Sbjct  158   SLMAKVSDQSHPLLCLIEDCKSLLNRDWSCKISHVYREQNRTADHLANLGYELT  211



>ref|XP_006492478.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X1 [Citrus sinensis]
 ref|XP_006492479.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X2 [Citrus sinensis]
Length=320

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 102/249 (41%), Gaps = 19/249 (8%)
 Frame = +3

Query  1098  IPVPVDDSTVDTLTWQDSTSGTFFVASAYSL-----------ISCTVDENWPWLWKLNCV  1244
             IP+P +    D L W     G + V S Y L            S +  + W  +WKL   
Sbjct  3     IPLPSEPKE-DELLWHYDKKGNYSVKSGYQLAFTIKFPNKPCYSNSDFQGWQTIWKLGNP  61

Query  1245  EKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIE  1424
             EKVK  LW   K  + T     +R ++ +  C  C+ E E++ H   D + A++ W    
Sbjct  62    EKVKIFLWRTTKNLLPTMENLWKRKVVQEPICQICKKELENISHALLDYKLAKKMWR--H  119

Query  1425  TYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNS-ET  1601
             T+    ++N  + +        +K +T      + +FV+  W +W  RN +I+     E 
Sbjct  120   THIAAEVQNEAIQDFLSMLQSLTKKLTTREIELA-SFVW--WGVWNARNKVIYERKKPEL  176

Query  1602  PVHVAKLACTFASEARAFIIRHGGTSQGCYNWV-TWTPPQPGWVKINIDGAMKSCTGLAS  1778
              + +AK+     +  R          Q        W PP  GW KIN+D  +     +A 
Sbjct  177   AISIAKVTAVMEAYQRVKEPEQQQLKQSEPRETHQWEPPPEGWHKINVDATIDKNQQIAG  236

Query  1779  AGGIVRDDH  1805
              G +++D +
Sbjct  237   LGIVIKDSY  245



>emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1357

 Score = 86.3 bits (212),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/248 (28%), Positives = 109/248 (44%), Gaps = 18/248 (7%)
 Frame = +3

Query  1089  IRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSL-ISCTVDEN---WPWLWKLNCVEKVK  1256
             I AIP+       D LTW  S  GT+ V +AY L     +D+    W  LW LN   KV+
Sbjct  994   ILAIPLSTR-CLQDELTWAYSKDGTYSVKTAYMLGKGGNLDDFHRVWNILWSLNVSPKVR  1052

Query  1257  TLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETY-G  1433
               LW      +      +RRHLID++ C  C  E+E+  HLF  C  + + WE + +Y  
Sbjct  1053  HFLWRACTSSLPVRKVLQRRHLIDEAGCPCCAREDETQFHLFYRCPMSLKLWEELGSYIL  1112

Query  1434  GKTLKNHLLMNAWIE-SNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVH  1610
                +++  + +  +  S + +K+V            Y LW +W  RN  +F + S+    
Sbjct  1113  LPGIEDEAMCDTLVRWSQMDAKVVQKG--------CYILWNVWVERNRRVFEHTSQPATV  1164

Query  1611  VAKLACTFASEARAFIIR-HGGT-SQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAG  1784
             V +       +   + ++ +GG  S    +   W  P  G +K+N D ++    G    G
Sbjct  1165  VGQRIMRQVEDFNNYAVKIYGGMRSSAALSPSRWYAPPVGAIKLNTDASLAE-EGWVGLG  1223

Query  1785  GIVRDDHG  1808
              I RD  G
Sbjct  1224  VIARDSEG  1231



>ref|XP_008378657.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=653

 Score = 83.6 bits (205),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 76/297 (26%), Positives = 117/297 (39%), Gaps = 30/297 (10%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY------SLISCTV  1205
             +D L  FL +  V  I  +    D    D L W     G++ V S Y      S + C  
Sbjct  227   LDFLKPFLADSEVEAILDLXTG-DPMLKDRLVWPFDKRGSYSVKSGYYWSLNRSQVRCQQ  285

Query  1206  DEN--------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEE  1361
                        W  +WKL    K++T LW  L   + T      R      TC  C   +
Sbjct  286   PTRLVSIPSTLWKNVWKLKVPPKIRTFLWKTLHAALATMKNLYIRRSSPSPTCPLCNSFD  345

Query  1362  ESLVHLFCDCQFARECWEAIETYGGK-TLKNHLLMNAWIESNVHSKIVTNDGAPW----S  1526
             ES+ HLF  C +    W     +GG+  L+ +    +   S +       +G+       
Sbjct  346   ESIEHLFLFCPWVEVVW-----FGGRLNLRPNRQQVSSXASWLXQMGAAENGSXEVRIDR  400

Query  1527  ITFV-YTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTS----QGCY  1691
             I+++ +T W IWK R +  FNN    P  V        S+ +  I+R    S        
Sbjct  401   ISYIAFTCWHIWKSRCDFQFNNQVIYPSRVVAAVSRSVSDYQGTILRQSSRSLLNHSSLG  460

Query  1692  NWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             + V W  P  G +KIN+D   ++ +G+   G + RD+ GC++     KI  T +  A
Sbjct  461   DGVKWXHPDHGVIKINVDANWEAKSGVGFTGVVARDEQGCFLAASRQKIKATGATMA  517


 Score = 22.7 bits (47),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 13/44 (30%), Positives = 19/44 (43%), Gaps = 3/44 (7%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDM---EIDIPKNLYDKKV  1005
             A W++ DG     W D W+    LG       + + KNL  K +
Sbjct  174   AHWQIMDGNDTRVWVDRWIPPIPLGRPSPLGSVQVSKNLKVKSL  217



>ref|XP_010418809.1| PREDICTED: uncharacterized protein LOC104704411 [Camelina sativa]
Length=792

 Score = 82.0 bits (201),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 92/204 (45%), Gaps = 23/204 (11%)
 Frame = +3

Query  1059  TFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCT---------VDE  1211
             TF+ E+ V  I A+P+ + D   D+L W  + SG + V S Y L+  +         V  
Sbjct  410   TFVPED-VALISALPLRLPDKP-DSLGWHFTKSGNYTVKSGYHLLQSSTAASVVLSVVGS  467

Query  1212  NW----PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHL  1379
             N+     ++WK+ C  K++  +W ++ G +      R+R +  D  C  C  EEE++ H 
Sbjct  468   NYVPLQAFVWKIRCPPKLRHFMWQVISGCVAVTANLRKRGISCDPVCGLCGFEEETINHA  527

Query  1380  FCDCQFARECW--EAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQ  1553
               +C  AR+ W      T  G      +L N          + + D  PW       LW 
Sbjct  528   LFECPPARQVWALSQFPTVQGAFPSESILTNIDFLFWRFKDVPSQDRFPW------ILWY  581

Query  1554  IWKCRNNLIFNNNSETPVHVAKLA  1625
             IWK RN+ +F+N    P+ + +LA
Sbjct  582   IWKARNDKLFSNLDSNPLAILRLA  605


 Score = 24.6 bits (52),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (47%), Gaps = 10/58 (17%)
 Frame = +1

Query  892   RVGDGKSLDFWSDWWVNDKS----LGLDMEIDIPKNLYDKKVSNFI-KDDRSWNVTLM  1050
             RVG G S+  W D W+  +S    +G  +  D     +   V N I +   SW++ L+
Sbjct  355   RVGSGVSISVWHDPWIPAQSPRPAIGTGLSSD-----HLLSVQNLINRSSNSWDMALL  407



>ref|XP_009145555.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=900

 Score = 85.5 bits (210),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 116/272 (43%), Gaps = 21/272 (8%)
 Frame = +3

Query  1053  LLTFLREELVNKIRAIPV-PVDDSTVDTLTWQDSTSGTFFVASAYSLIS------CTVDE  1211
             L   + +E V+KI A+ + PV  +  D L W  +  G + V S Y L +       T+  
Sbjct  508   LREMIIDEDVDKILALKISPV--AQQDLLGWHYNEDGIYTVKSGYWLGTHLPSNPPTIPT  565

Query  1212  NWPWL-----WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVH  1376
             + P +     WK     K+K  LW +L   + T    +RRH+I +  C RC    E+  H
Sbjct  566   HGPAVLKHKVWKTKAPAKLKHFLWRVLSRSLATGNNLKRRHIIQNDQCRRCCLAIETADH  625

Query  1377  LFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQI  1556
             +F +C +A+  W A          +   +   IE+ +   + T       + F + LW+I
Sbjct  626   IFFECPYAKIIWRASGVSNLIINNSSSTLEEKIEACLQCSLSTRLSHMQDLPF-WLLWRI  684

Query  1557  WKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIR------HGGTSQGCYNWVTWTPPQ  1718
             WK RN LIF         + + A   A E +    +          S      + W  P 
Sbjct  685   WKSRNTLIFRQKEIPWRSLLRYAREDAKEWKQLDNKGEEGHLRRRQSHHLTECLHWKKPM  744

Query  1719  PGWVKINIDGAMKSCTGLASAGGIVRDDHGCW  1814
              GW+K N DGA  S     SAG ++RD++G +
Sbjct  745   IGWIKCNTDGAYNSTQHQTSAGWVIRDENGIY  776



>ref|XP_007044601.1| Uncharacterized protein TCM_010295 [Theobroma cacao]
 gb|EOY00433.1| Uncharacterized protein TCM_010295 [Theobroma cacao]
Length=290

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/261 (25%), Positives = 111/261 (43%), Gaps = 22/261 (8%)
 Frame = +3

Query  1074  ELVNKIRAIPVPVDDSTV-DTLTWQDSTSGTFFVASAYSLISCTVDE----------NWP  1220
             EL+N  + + +P+    + D   W D+ +G++ V S Y  +  T+D           NW 
Sbjct  2     ELLNTQQILSIPLSIRQIPDCQVWFDTKNGSYTVKSGYKFLGSTLDNVTNTSSSVQGNWL  61

Query  1221  W--LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W  LW      K    +W ++   + T  E  +R +  +  C  C  E E+  H  C+CQ
Sbjct  62    WKKLWHCAVPRKTMLFMWKVIHDILPTRSELIKRGVNIELMCPLCEIEVETAFHCLCNCQ  121

Query  1395  FARECWEAIETYGGKTLKN-HLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRN  1571
             F+R  W   +  G + + N H  +  W++     +++  D       F+  LW IWK RN
Sbjct  122   FSRLVWLTTKC-GFRDISNFHDSIIDWLQGVF--EVLNKDETE---EFICLLWAIWKTRN  175

Query  1572  NLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGA  1751
              ++FN +  TP+ V ++      + R     HG +    Y   +    +    K+N D A
Sbjct  176   VVVFNQSRSTPMVVVEIGLDLIHQFRRASRAHGNSKDDGYENTSEVWGRLNSAKLNTDAA  235

Query  1752  MKSCTGLASAGG--IVRDDHG  1808
             +    G    G   IVR+ + 
Sbjct  236   LFHSGGECKLGARFIVRNQNA  256



>ref|XP_008356537.1| PREDICTED: uncharacterized protein LOC103420255 [Malus domestica]
Length=1251

 Score = 77.8 bits (190),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 72/293 (25%), Positives = 117/293 (40%), Gaps = 22/293 (8%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI--SCTVDENW  1217
             + ++ +    +L  +I  +P+P+D+   D L W+ STSG F  +  Y ++     V    
Sbjct  845   IPSIFSXXFXDLTKEILXMPLPIDEDK-DVLIWEXSTSGXFSFSDGYEIVRHXFPVKSXA  903

Query  1218  PWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
               +W+     +   L+W +L  ++ T    +RR +     C  C    ES  HLF  C F
Sbjct  904   SIIWRPFIPPRYSILVWKILFNKLPTEDXLQRRGIPLAPICZLCHKNSESXDHLFSXCXF  963

Query  1398  ARECWEAIET-YGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
             A+  W  + T +G          + W+   +  +   +    W  +  + L  IWK RN 
Sbjct  964   AQCAWXWLATQFGTIIXPXGSJSDLWLXF-LSKRFSPHLRNVWJASGFFLLMAIWKMRNK  1022

Query  1575  LIFNNNS--------ETPVHVAKLACTFASEARAFIIRHGGTSQGCYN---------WVT  1703
             + F             T   + ++        R  + R    S G             V 
Sbjct  1023  VKFEGKPPSXSRLCXSTSAWIRQVGALTPGHVRGXLDRQLLVSLGISPNXCKAPSIVPVL  1082

Query  1704  WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             W PP   W K+N DG  K   G A+ GG+ RD  G ++ GF+  +G   SF A
Sbjct  1083  WXPPPXSWXKVNTDGLAKGNPGPAACGGVFRDSXGYFLGGFSLSLGHRTSFYA  1135


 Score = 28.5 bits (62),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 22/46 (48%), Gaps = 0/46 (0%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIK  1020
              RW +G+G +   W D W++   + +     I  +    KVSN I+
Sbjct  794   CRWVIGNGSTTSLWVDKWLDKPIVDVXGATXIAXSXSRTKVSNIIR  839



>ref|XP_008223235.1| PREDICTED: uncharacterized protein LOC103323054 [Prunus mume]
Length=492

 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 109/263 (41%), Gaps = 24/263 (9%)
 Frame = +3

Query  1086  KIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSL---ISCTVDEN------------WP  1220
             KI+  P+    +T D L W    +G + V + Y     +S  V  +            W 
Sbjct  108   KIQTTPI-GSLATCDRLVWPAVKNGDYSVKTGYYHAINVSPPVSSDRASASHAVNTDVWK  166

Query  1221  WLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFA  1400
              +W+     K++  +W  L   + T+    R  L     C  C    E++ H+   C + 
Sbjct  167   VIWRACTTPKIRNFMWRALSNSIPTSANLFRMKLSQSPMCHLCGLFPETVEHMLLLCPWT  226

Query  1401  RECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSIT-FVYTLWQIWKCRNNL  1577
             R  W          L +   +++W    + S  V  D   W I+ F++  W+IWK R   
Sbjct  227   RAVWFGCPFGYAPDLASITTLDSWFSGFLSSSFVDGDQRDWGISLFMFCSWEIWKARCKE  286

Query  1578  IFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGW---VKINIDG  1748
             +FN+   +P+ V     ++  E     +R    +      +   P +P W   VKINIDG
Sbjct  287   VFNDLRPSPLLVLSRTMSYLEE----FLRVKALASNGPPIIQDAPTRPHWFPFVKINIDG  342

Query  1749  AMKSCTGLASAGGIVRDDHGCWV  1817
             A ++ TGL   G ++RD +G ++
Sbjct  343   AWEAKTGLGGIGVVIRDHNGSFI  365



>gb|EEE54600.1| hypothetical protein OsJ_01823 [Oryza sativa Japonica Group]
Length=639

 Score = 80.1 bits (196),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 109/291 (37%), Gaps = 28/291 (10%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI-----------  1193
             D L     EE V  I++IPV V+    D L W     G F V SAY +            
Sbjct  170   DLLSQTFWEEDVAAIKSIPVHVE--MEDVLAWHFDARGCFTVKSAYKVQREMERRASRNG  227

Query  1194  -------SCTVDENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCR  1352
                        D+ W  LWKL    K+K  LW +    +      + R +  D+ C  C 
Sbjct  228   CPGVSNWESGDDDFWKKLWKLGVPGKIKHFLWRMCHNTLALRANLQHRGMDVDTRCVMCG  287

Query  1353  DEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSIT  1532
                E   HLF  C+  ++ W+A+     +++         +  +++ +           +
Sbjct  288   RYNEDAGHLFFKCKPVKKVWQALNLEELRSMLEQQTSGKNVLQSIYCRPEIE-----RTS  342

Query  1533  FVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTP  1712
              +  LWQ WK RN +       +P  ++ L  + A E     ++      G      W  
Sbjct  343   AIVCLWQWWKERNEVREGGIPRSPAELSHLIMSQAGEFVRMNVKEKSPRTG--ECAVWRR  400

Query  1713  PQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWV-IGFATKIGVTDSFSA  1862
             P   +VKIN DGA  S       G ++RD  G  +  G      + D+F A
Sbjct  401   PPLNFVKINTDGAYSSNMKQGGWGFVIRDQTGAVLQAGAGPAAYLQDAFHA  451


 Score = 26.2 bits (56),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +1

Query  889  WRVGDGKSLDFWSDWWV  939
            WR+GDG  ++ W+D W+
Sbjct  120  WRMGDGSKINIWADPWI  136



>ref|XP_008794416.1| PREDICTED: uncharacterized protein LOC103710479 [Phoenix dactylifera]
Length=1252

 Score = 64.7 bits (156),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 99/262 (38%), Gaps = 16/262 (6%)
 Frame = +3

Query  1071  EELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENWP--WLWKLNCV  1244
             E+LV +I A+P+P   +  D L W  +          ++      +      W+W++   
Sbjct  876   EQLVERILALPIP-SRAEPDRLIWLPTGRSRVRARDIHAWTRREPERRIEGGWIWRMRVH  934

Query  1245  EKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIE  1424
              +V   LW +  G + T     RR +   S C  C D EE++ H+   C  A +CW    
Sbjct  935   PRVALFLWKVAWGCLPTRSVLARRGMRMGSLCEVCLDAEETVGHVLLRCPTAVQCWREAS  994

Query  1425  TYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETP  1604
                    +    M  ++  ++        G+       Y  + IW  RN+ +F     TP
Sbjct  995   ALLPPIWETVEDMLRFLSESIRRPSDAETGS----LVAYLAYHIWLARNDRLFEGGRPTP  1050

Query  1605  VHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAG  1784
               V + A   A+E  + +       +    W T T        +N DG M         G
Sbjct  1051  RVVMERALRQAAEI-SMMTALAPPGRTRETWGTCT-------AVNFDGGMAEDGASGGVG  1102

Query  1785  GIVRDDHGCWV-IGFATKIGVT  1847
              ++RD  G ++  G  +  GV+
Sbjct  1103  FVIRDHRGTFIAAGGRSTFGVS  1124


 Score = 33.9 bits (76),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 32/66 (48%), Gaps = 12/66 (18%)
 Frame = +2

Query  1901  RRVVNGLCSC------GAVMNRGDHSEETVVTLVKDCLDLSRKFRKFKISHIMREGNRCA  2062
             R V+ G CS       G  +   DHS      L++D   L ++    +++H  RE N  A
Sbjct  1148  RLVLEGDCSTVIDRLRGVDIYGDDHS------LIRDTRSLVQELISCQVAHAYREANSAA  1201

Query  2063  DWLANY  2080
             DW+A+Y
Sbjct  1202  DWVASY  1207


 Score = 26.9 bits (58),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 15/52 (29%), Positives = 25/52 (48%), Gaps = 1/52 (2%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLG-LDMEIDIPKNLYDKKVSNFIKDDRSWN  1038
             RW +GDG S+D   D WV +  +  L   +D  + L  +     +  + SW+
Sbjct  815   RWAIGDGMSVDVLEDSWVTELPISRLPALVDTSRLLGRRVGDLLVPGEGSWD  866



>gb|ABE80156.1| Ribonuclease H [Medicago truncatula]
Length=438

 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 111/264 (42%), Gaps = 26/264 (10%)
 Frame = +3

Query  1083  NKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYS-LISCTV-------DENWPWLWKLN  1238
             N I    +  +D+  D L W  + +GT+   S +  L++  V         +W W+W L 
Sbjct  68    NHINNFHIHFNDNIEDALIWSQNKNGTYSTKSGFHWLLTFRVPATDIIPHPSWSWIWNLQ  127

Query  1239  CVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEA  1418
               EK K L+WL  +  + T     RR++    TCARC +E+E+ +H   DC F+R  W+ 
Sbjct  128   VPEKYKFLIWLACQNVVPTLSLLHRRNIAPSPTCARCGEEDETFLHCVRDCHFSRSIWQK  187

Query  1419  IETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSE  1598
             I   G          + +  ++ H        +     F   LW  W+ RN +  NN + 
Sbjct  188   IGFTGN---------DFFTATSAHDWFKIGMSSSLPDIFFGGLWWAWRHRNLMCLNNETM  238

Query  1599  TPVHVAKLACTFASEARAFIIRHGGTSQGCYN----WVTWTPPQPGWVKINIDGAMKSCT  1766
             +   + +L     S A    I+    S+   N    +V W         +N+DG+     
Sbjct  239   S---LFRLCNNIVSAAT--YIKSAFDSEENVNHSDRFVKWNNRNHHDHILNVDGSCLGTP  293

Query  1767  GLASAGGIVRDDHGCWVIGFATKI  1838
                  GGI+R+  G ++ GF+  I
Sbjct  294   SRTGYGGILRNSAGLFISGFSGFI  317



>ref|XP_006478726.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=473

 Score = 79.0 bits (193),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 97/252 (38%), Gaps = 23/252 (9%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSL-ISCTVDEN---  1214
             D +     +E+  +I  +P+P      D L W+    GT+ V S Y L +     EN   
Sbjct  130   DKIAQLYPKEISERIVKLPLP-KTPQEDILIWRFDKHGTYTVKSGYQLAVQLKFPENPGC  188

Query  1215  -------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLV  1373
                    W  +W     EKVK  +W   K  + T     ++ ++    C RC  + E   
Sbjct  189   SDASKSQWKVIWSTEIPEKVKIFMWRAAKNLLPTANNLWKKKVVPSPICQRCFCKSEDPC  248

Query  1374  HLFCDCQFARECWEAIETYGG-KTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLW  1550
             H   DC+ AR+ W+    Y   K + +  +++A  E      +  + G      F+   W
Sbjct  249   HALLDCKAARKTWKLTTFYDDVKQMAHQDMLSALQE------LALSRGKEDLAQFIAVCW  302

Query  1551  QIWKCRNNLIFNNNSETPVHVAKLACTFASEARAF---IIRHGGTSQGCYNWVTWTPPQP  1721
              IW  RN  +   N  +P   A  A       R      I    T +   N   W PP  
Sbjct  303   AIWHERNLSVLEGNQNSPQITAARATAIVESYRRIKQPKIPAMLTHRQSEN-KNWKPPPK  361

Query  1722  GWVKINIDGAMK  1757
              W K+N+D A+K
Sbjct  362   NWFKVNVDAAVK  373


 Score = 26.9 bits (58),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 2/50 (4%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSW  1035
             RWR+G G  +   S  W+  +++G    I    +L D  V++ I D   W
Sbjct  80    RWRIGQGTKISACSKIWL--RNVGSCTSIPPSNSLKDVVVADLINDINQW  127



>ref|NP_001175214.1| Os07g0501200 [Oryza sativa Japonica Group]
 dbj|BAH93942.1| Os07g0501200 [Oryza sativa Japonica Group]
Length=620

 Score = 84.7 bits (208),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 111/284 (39%), Gaps = 45/284 (16%)
 Frame = +3

Query  1074  ELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN-------------  1214
             +++ KIR    P      D + W     G F V SAY L     + N             
Sbjct  226   DIILKIR----PSRSQEADFVAWHPDKHGIFSVRSAYHLAVSLANVNSSSSSSGHDLSKA  281

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W  +W  N  +KVK   W      + T   ++ R L   + C+ C  EEE + H  C C 
Sbjct  282   WKLVWNCNIPQKVKIFAWKAATNSLATLQNKKTRRLEPMAICSICGREEEDVAHALCRCP  341

Query  1395  FARECWEAIETYGGKTLKNHL--LMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCR  1568
              A   W ++ +    + +       + WI   +   I   +GA     F+  LW+IW  R
Sbjct  342   HATNLWLSLRSSKDISFEAGASWSGSGWILDQL-GLIAKEEGA----MFLMLLWRIWYNR  396

Query  1569  NNLIFNNNSETPVHVA-KLACTFASEAR-------------AFIIRHGGTSQGCYNWVT-  1703
             N  I++  S  PV V+ +   ++ S  R              F++ + G  +G       
Sbjct  397   NE-IYHGKSAPPVSVSHRFIVSYVSSLREIKQFPRADFAKGKFVVSNLGCMKGTSQVPDP  455

Query  1704  -----WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVI  1820
                  W  P PGW+K+N+DG+  +  G    G ++R+  G  + 
Sbjct  456   KVLNHWEKPNPGWMKLNVDGSFDARYGSGGIGAVLRNSAGSLIF  499



>ref|XP_008364397.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=342

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 74/288 (26%), Positives = 114/288 (40%), Gaps = 39/288 (14%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN---  1214
              D +L     + V  I +IP+       D L W  + +G + V S Y  ++  + EN   
Sbjct  15    ADLVLVGFNRDDVATILSIPLSRTGGH-DRLVWHYNVNGEYSVRSGYG-VAVDLIENGAL  72

Query  1215  -----------------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCA  1343
                              W  +WKLN   K+K  +W      +       RR +  D+ C 
Sbjct  73    GRKGQGAPSERQKNNQVWNQIWKLNVPNKIKIFIWRCCNRAVAVRQNLHRRRMRVDNVCG  132

Query  1344  RCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESN--VHSKIVTNDGA  1517
              C   EE+  HLF  C+F    W     +    L +H L+ A   +N  +  K V   G 
Sbjct  133   VCGAAEETENHLFFQCEFRHLFWFCSPLH----LNSHELIEADFLTNWELFHKSVKGRGE  188

Query  1518  PWSI--TFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAF---------IIR  1664
                I   F + LW++WK RN  +FN   + P+ V  +  +  +E R           ++R
Sbjct  189   VDEILQEFAFGLWRLWKNRNETVFNGTQQQPLEVLNIWRSSLAEFREATTRTADGDRLLR  248

Query  1665  HGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHG  1808
               GT +       WT P+ G++K+N D A    T     G + RD  G
Sbjct  249   DSGTLEVRRQGARWTKPEFGFIKVNTDAAWCMNTLRMGVGWVCRDFAG  296



>ref|XP_008353155.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=637

 Score = 82.4 bits (202),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 109/291 (37%), Gaps = 33/291 (11%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY-------------  1184
             +D L  FL EE +  I       D S+ D L W    +G + V S Y             
Sbjct  235   IDFLKPFLVEEEIKAIYETHSG-DPSSNDRLVWPFVKNGIYSVKSGYHWAMTRNIQQRIG  293

Query  1185  -----SLISCTVDENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARC  1349
                  +LI   V   W  +WKL    K+++  W  L+  + T V    R     + C  C
Sbjct  294   NPHRSALIPKQV---WKCVWKLEVQPKIRSFXWRSLQEAVATXVNLFMRRSSSSTLCPIC  350

Query  1350  RDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNV----HSKIVTNDGA  1517
                EESLVHLF  C +  E W       G           W+ S V        V ND  
Sbjct  351   NRYEESLVHLFLQCSWVEEVWIGXRLIRGLRRDAVTSWAXWLGSIVGLANGQSGVRNDML  410

Query  1518  PWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKL----ACTFASEARAFIIRHGGTSQG  1685
              +  T   T W IWK R   +FN     P  +  +       F    +A +     +  G
Sbjct  411   SYVAT---TCWFIWKARCXFLFNQQPIVPRQIIAVIXQSVAAFKEYXQATVCSLPISVNG  467

Query  1686  CYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKI  1838
               + V W+PP  G++KIN+D +          G + RDD G ++     ++
Sbjct  468   LXSDVQWSPPCVGFIKINVDASWLRSGAPGFVGVVARDDEGRFMAAIRRRV  518


 Score = 23.1 bits (48),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 18/67 (27%), Positives = 30/67 (45%), Gaps = 4/67 (6%)
 Frame = +1

Query  862   LMGVEI---RARWRVGDGKSLDFWSDWWVNDKSLGLDMEI-DIPKNLYDKKVSNFIKDDR  1029
             L+G EI    A W++ +GK +  W D W+     G    +  +P +L  +  S    D  
Sbjct  172   LVGREIIRGGAHWQIMNGKDVRVWVDKWLPSIPSGHPSPLGSVPVSLNLRVNSLLSTDYG  231

Query  1030  SWNVTLM  1050
             SW +  +
Sbjct  232   SWEIDFL  238



>gb|KHM99756.1| TMV resistance protein N [Glycine soja]
Length=1174

 Score = 85.1 bits (209),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/215 (27%), Positives = 101/215 (47%), Gaps = 14/215 (7%)
 Frame = +3

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             LW     EK+K LL  +  G + TN ERR RH   +++C  C   EE+ +H   DC    
Sbjct  852   LWSWVGPEKIKILLRNIADGALSTNAERRYRHNSVNTSCLSCDALEETCLHALRDCPKVA  911

Query  1404  ECWEAIETYGGK-TLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNL-  1577
               W ++     + T  N   +  W+E N+   +       W+  F + +  IW+ RN + 
Sbjct  912   AVWRSVLPLELEVTFFNIDEVTLWLERNLSFSV------GWATMFWFAVEVIWESRNEID  965

Query  1578  IFNNNSETPVHVAKLAC------TFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKIN  1739
             + +  + +P+++  +          A  +   ++R         +   W PP   W+K+N
Sbjct  966   LLDPKASSPIYMIMMIIIRYEDFIRADPSHKLMMRDHTQPCSSDHLFKWRPPVDPWLKLN  1025

Query  1740  IDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGV  1844
             +DGA+  C+  A+ GGI RD  G +V+GF+ K+ +
Sbjct  1026  MDGAIDPCSKTAACGGIFRDYSGRFVLGFSVKLDM  1060



>ref|XP_008228034.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=751

 Score = 84.7 bits (208),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 80/162 (49%), Gaps = 15/162 (9%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCTVDEN  1214
             +D L   L E+LV ++ ++PV    S  DT  W+ ST+G F V SAYSL      T D  
Sbjct  507   IDKLRGVLCEDLVQQVISVPVGFLGSLPDTQIWKGSTNGDFSVKSAYSLFFGGCSTPDSC  566

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W  LW LN   K++  +WL  +G++ +N +R RR L  D +C  C    E+++H+  DCQ
Sbjct  567   WKSLWSLNVPPKLQYFMWLASQGKILSNDQRVRRQLASDPSCGFCSWPTETVLHILRDCQ  626

Query  1395  -FARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGA  1517
                 E W     +G K           IE  + S I+  D A
Sbjct  627   VLEAEIWGLF--FGLKLA---------IEKGISSLIIEMDSA  657



>ref|XP_009130050.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1128

 Score = 84.7 bits (208),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 78/289 (27%), Positives = 122/289 (42%), Gaps = 43/289 (15%)
 Frame = +3

Query  1083  NKIRAIPVPVDDSTV-----------DTLTWQDSTSGTFFVASAYSLIS--CTVDENWPW  1223
              K+RA+ V  D   V           D L W     G + V S Y L +   T +   P 
Sbjct  732   QKVRAVIVDEDIPKVLALKLSTTAKQDLLGWHYKDDGIYTVKSGYWLSTHLPTRERMEPT  791

Query  1224  L---------WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVH  1376
             L         W      K+   +W +L   + +    +RRH++ D+ C RC + +E+  H
Sbjct  792   LGNPSLKKKIWNTKLPSKIHHFIWKVLSRSIASGANLKRRHIMPDAQCRRCCNGDETDKH  851

Query  1377  LFCDCQFARECWEA------IETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFV  1538
             L  DC +A++ W A      I T    +L+  + +     +++H + +TN      + F 
Sbjct  852   LLFDCIYAQQIWRASGISNTILTDPRASLEEKIEVCLQCCTSIHLRHLTN------LPF-  904

Query  1539  YTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASE---ARAFIIRHG----GTSQGCYNW  1697
             + LW+IWK RN LIF N      HV + A   A E        +  G     + Q     
Sbjct  905   WLLWRIWKSRNLLIFQNKQIDGRHVLQQARRDAQEWSTHSTLNVSSGRPNISSQQTLMQN  964

Query  1698  VTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGV  1844
               W  P  GW+K N+D +  +    + AG I+RD++G +  G    IGV
Sbjct  965   QRWKRPPVGWLKCNVDASFVNAETPSKAGWIIRDENGTYK-GAGQGIGV  1012



>emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1389

 Score = 73.2 bits (178),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 120/302 (40%), Gaps = 49/302 (16%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI----SCTVDE  1211
             +  LLT +   +V  I ++ +P   S  D L W  + +G + V S  SLI      T+++
Sbjct  988   IPKLLTLVPPNIVKAISSVFIP-SSSQQDRLLWGLTPTGQYSVKSGASLIREVNGGTIEK  1046

Query  1212  -NWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCD  1388
               + W+W ++   K+K  LW      + T     R H+     C  C    E++ HL   
Sbjct  1047  VEFNWIWGIHAPPKIKNFLWKACNDGLATTSRLERSHIFVPQNCCFCDCPSETICHLCFQ  1106

Query  1389  CQFARECWEAIET----------YGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFV  1538
             C F  + +  +E           +    L +   +      N+  + +T     W     
Sbjct  1107  CPFTLDIYSHLEDKFQWPAYPSWFSTLQLSSFRSVLEACHINLTLEYLTKLSIVW-----  1161

Query  1539  YTLWQIWKCRNNLIFNNNSETPVHVAKLACTFAS-------EARAF----------IIRH  1667
                W +W  RN LIFNN S +    + +  +F         E  +F           +R 
Sbjct  1162  ---WHVWYFRNKLIFNNESTSFSQASFIIHSFMGKWEKANLEIPSFNTPLPKDCKLPVRS  1218

Query  1668  GGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVT  1847
             G         + W+PP    +K+N DG+ K   G A+ G ++R+ +G  ++  A  +GV 
Sbjct  1219  GKN-------LIWSPPNEDVLKVNFDGS-KLDNGQAAYGFVIRNSNGEVLMARAKALGVY  1270

Query  1848  DS  1853
              S
Sbjct  1271  PS  1272


 Score = 32.0 bits (71),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 9/18 (50%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +1

Query  886  RWRVGDGKSLDFWSDWWV  939
            RW +GDG+ + FW+D W+
Sbjct  939  RWLIGDGQDISFWTDNWI  956



>ref|XP_010480729.1| PREDICTED: uncharacterized protein LOC104759515 [Camelina sativa]
Length=1240

 Score = 75.9 bits (185),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/198 (28%), Positives = 87/198 (44%), Gaps = 16/198 (8%)
 Frame = +3

Query  1065  LREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENWP--------  1220
              + E V  I A+P+   DS  D L W  + +G + V S Y+ +      + P        
Sbjct  728   FKPEDVAIISALPIGKPDSP-DMLGWHLTKTGLYTVKSGYNALRQNQVASAPAFGPNIIP  786

Query  1221  ---WLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDC  1391
                ++WK+ C  K++  LW  + G + T    RRR +  D  C RC   EE++ H    C
Sbjct  787   LQAFVWKIRCPPKIRHFLWQAITGCIATTANLRRRGMTCDPECGRCGCPEETINHALFLC  846

Query  1392  QFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRN  1571
               A + W A+ ++        L     I +N+      +   P +  F + LW IWK RN
Sbjct  847   PPAWQVW-ALSSFPTSL---DLFPTESIYTNMDYLFWRSQRNPSADIFPWILWYIWKARN  902

Query  1572  NLIFNNNSETPVHVAKLA  1625
             + I NN    P+ + +LA
Sbjct  903   DKILNNLDSNPLAILQLA  920


 Score = 29.3 bits (64),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 0/53 (0%)
 Frame = +1

Query  892   RVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             RVG G S+  WSD W+  +     +    P +   +  +   +  RSWN+ L+
Sbjct  672   RVGSGDSISVWSDPWIPAQPPRPALRSGSPIDPTLRVETLIDRSSRSWNLALL  724



>ref|XP_010026542.1| PREDICTED: uncharacterized protein LOC104416906 [Eucalyptus grandis]
Length=870

 Score = 81.6 bits (200),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 69/291 (24%), Positives = 115/291 (40%), Gaps = 29/291 (10%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPV-PVDDSTVDTLTWQDSTSGTFFVASAYSLI---SCT---  1202
             V  L  F  +  V +I  + + P+  ST D L W  +  G + V S Y+++   +C    
Sbjct  478   VALLHRFFDDPTVQQIIQLKIWPL--STTDKLIWTGTHDGIYSVKSGYNVLHQFTCQQVH  535

Query  1203  --------VDENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDE  1358
                       + W  +WK     K++   W + +  + T     RR +  D  C  C   
Sbjct  536   PHASSYQPPKQVWKQIWKAQTAPKIRNFRWSVYQNALPTKDNLFRRRITPDLVCVLCSST  595

Query  1359  E-ESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITF  1535
               E+  HLF  C   +  W   +        +   M++W+ + ++     N G P     
Sbjct  596   SLETTEHLFLHCPRTQCIWNHSQVQLNVYAFSPNRMDSWLANLINQ----NRGLPDFEQV  651

Query  1536  VYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWV----T  1703
                LW+IWK RN+ +F     +P  +   A   A+  +     H     G  +W+    +
Sbjct  652   AGLLWEIWKARNHFVFRCFWISPDQIVDSAFALANLQKRI---HQKDFTGHSSWLNPNRS  708

Query  1704  WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSF  1856
             W PPQ G +KIN+DG+  +     S   I RD  G  + G    I  + + 
Sbjct  709   WQPPQQGTLKINLDGSFPTANQRGSIASIARDHSGRLLGGLTRSISASPAL  759


 Score = 23.5 bits (49),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 17/61 (28%), Positives = 27/61 (44%), Gaps = 6/61 (10%)
 Frame = +1

Query  871   VEIRARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDD-RSWNVTL  1047
             +  + +W VG+G+S+    D W+    LG     D P       V+  I     +WNV L
Sbjct  426   ISPKLQWSVGNGQSIKVREDKWLPVGILGGPALRDEPPT-----VAGLICPSLNNWNVAL  480

Query  1048  M  1050
             +
Sbjct  481   L  481



>ref|XP_008233455.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=407

 Score = 72.4 bits (176),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 109/265 (41%), Gaps = 53/265 (20%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENWPW-  1223
             D L   + ++++ KI  IP+P+     D L W  + +G F + SA+ L     +++ P  
Sbjct  91    DKLSQVIDDDVIEKILTIPLPLS-PLHDKLIWGPAPNGNFSIKSAHDL-QLQDEQSHPKA  148

Query  1224  -----LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLID-----DSTCARCRDEEESLV  1373
                  +W L    KVK   WLL++ R+     + R HL       +  C  C++  E++ 
Sbjct  149   PLLKKMWSLTLPPKVKLFSWLLIRKRL-----QVRSHLYKFLPNINPECPLCKNHMETIN  203

Query  1374  HLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQ  1553
             HLF +CQFA   W    TY            ++I  N        D   W  +  +T   
Sbjct  204   HLFFECQFAVNIWRC--TY---------FFPSYISQNF-------DSIEWLASLPHT---  242

Query  1554  IWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVK  1733
                          ++ P+ V  +A     +           S G  N + W PP   WVK
Sbjct  243   -----------KAADGPIRVLNVAGRIGLDYWKINSCPPQKSFGKVN-IKWEPPPLDWVK  290

Query  1734  INIDGAMKSCTGLASAGGIVRDDHG  1808
             +N DG+M+    LA+   ++RD +G
Sbjct  291   VNFDGSMRG--NLAATCFVIRDWNG  313


 Score = 32.7 bits (73),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 4/53 (8%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNL--YDKKVSNFIKDDRSWN  1038
             RW VG+G+S+ FW+  WV    L LD+     +N+   + KVS+FI+ +++WN
Sbjct  39    RWIVGNGQSIPFWTANWVFPFPL-LDLIPVFFRNILNLNAKVSDFIQ-NQTWN  89



>ref|XP_008385035.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=992

 Score = 82.4 bits (202),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 111/297 (37%), Gaps = 30/297 (10%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY------SLISCTV  1205
             +D L  FL +  V  I  +    D +  D L W     G++ V S Y      S + C  
Sbjct  591   LDFLKPFLADSEVEXILDLHTG-DPTLKDRLVWPFEKRGSYSVKSGYYWSLNRSQVRCQQ  649

Query  1206  DEN--------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEE  1361
                        W  +WKL    K++T +W  L   + T      R      TC  C   +
Sbjct  650   SIRLVSIPSTLWKTVWKLKVPPKIRTFMWKTLHAALATMKNLYIRRSSPSPTCXLCNSFD  709

Query  1362  ESLVHLFCDCQFARECWEAIETYGGK--TLKNHLLMNAWIESNVHSKIVTNDGAPWSITF  1535
             ES+ HLF  C      W     +GG+     N   +++W    V      N  A   I  
Sbjct  710   ESIEHLFLFCPXVEVVW-----FGGRLNLRPNRQQVSSWASWLVQMGEAENGSAEVRIDR  764

Query  1536  V----YTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTS----QGCY  1691
             +    +T W  WK R    FNN    P  V         + +  I R    S        
Sbjct  765   ISYIAFTCWHXWKSRCEFQFNNQVIYPSRVVAXVXRSVXDYQGTIFRXSSRSLLNQSSLG  824

Query  1692  NWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
               V W+PP  G +KIN+  + ++ +G+   G + RD+ GC++     KI  T +  A
Sbjct  825   AGVQWSPPDHGVIKINVXASWEAKSGVGFTGVVARDEQGCFLAASRHKIKATGAXMA  881


 Score = 22.3 bits (46),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 13/44 (30%), Positives = 19/44 (43%), Gaps = 3/44 (7%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDM---EIDIPKNLYDKKV  1005
             A W++ DG     W D W+    LG       + + KNL  K +
Sbjct  538   AHWQIMDGNDTRVWVDRWIPPIPLGRPSPLGSVXVSKNLKVKSL  581



>gb|EMS67416.1| Protein argonaute 1D [Triticum urartu]
Length=1573

 Score = 77.8 bits (190),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 67/282 (24%), Positives = 102/282 (36%), Gaps = 66/282 (23%)
 Frame = +3

Query  1116  DSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN-----------------WPWLWKLNCV  1244
             +   D + W    SG F V SAY L + T+ +N                 W  +WK N  
Sbjct  1234  NGEADFVAWHYEKSGLFSVRSAYKL-ALTLKDNKEDEGQSNEAVGTERKIWNIIWKANIP  1292

Query  1245  EKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIE  1424
             +K++   W +    +   V R   H    STC+ C  E+E+  H    C  AR    A+ 
Sbjct  1293  QKIRIFAWRVASNSLAVQVNRVAHHQASVSTCSICGMEDENTFHALVLCPKARALRMAMR  1352

Query  1425  TYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITF------------VYTLWQIWKCR  1568
                          N W   +   ++    G  W I              ++  W+    R
Sbjct  1353  -------------NIWALPD--EEVFRYTGYDWFIVLLSQLNPVMRDQIIFLFWRTCHLR  1397

Query  1569  NNLIFNNNSETPVHVAKLAC------------------TFASEARAFIIRHGGTSQGCYN  1694
             N+LIF    E+   V+  AC                   F ++ +  +IR  G       
Sbjct  1398  NDLIFGKGKES---VSASACFVDSYWAYFGAYHSPTPVNFQNKGKGPLIRISGVPNSLDA  1454

Query  1695  WVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVI  1820
                W+PP  GW KIN+D +       AS G +VRD+ G  ++
Sbjct  1455  SSGWSPPPAGWFKINVDASFMESIREASVGVVVRDEEGEGIV  1496


 Score = 26.9 bits (58),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 25/56 (45%), Gaps = 5/56 (9%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSN--FIKDDRSWNVTLM  1050
             WRV DG ++  W D W+   S    ++I   KN    K     F   +R W+  L+
Sbjct  1162  WRVCDGANIHIWRDNWLPRAS---GLKISAKKNRTRVKWVEDLFTSGERRWDEELV  1214



>ref|XP_004293049.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=677

 Score = 74.7 bits (182),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 119/286 (42%), Gaps = 28/286 (10%)
 Frame = +3

Query  1035  ECYVDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY----------  1184
             E  +D L  FLR+   N I+AIP+    S  D L W  S S  + V S Y          
Sbjct  347   EWQIDHLKPFLRDSDFNSIKAIPIGAA-SERDVLVWPHSKSENYSVRSGYYKTLSAWVPK  405

Query  1185  -SLISCTVDENWPWLWKL----NCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARC  1349
              S+ + T  +  P +WK+        KV    W  L   + T     +R++ +   C  C
Sbjct  406   ASIKASTSHKVDPHVWKIAWGSKLAPKVSNFTWKALANALPTCENLHKRNIGNSPLCKIC  465

Query  1350  RDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLL--MNAWI-ESNVHSKIVTNDGAP  1520
                 E++ H    C++    W    +  G +L    +  +  W+ E++     + +D   
Sbjct  466   GLFPETIEHCLLLCEWTELVW--FGSLAGYSLNKQSITTLEKWLLETDKKGAFLADDKQF  523

Query  1521  WSITFVYTLWQIWKCRNNLIFNNNSETP-VHVAKLACTF----ASEARAFIIRHGGTSQG  1685
                  ++ LW+IWK R  ++ ++    P V + K+   F    A++       +  +SQ 
Sbjct  524   CLQLILWHLWEIWKHRYEIVMSHGKPNPKVVIEKIKHNFGEWGAAQVSNLKSLNMTSSQS  583

Query  1686  CYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIG  1823
               N   W PP    VK+N+DGA    T ++  G ++R+  G  + G
Sbjct  584   ASN--DWCPPPNHVVKVNMDGAWDDQTKISGIGIVIRNHRGACLAG  627


 Score = 29.6 bits (65),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 0/53 (0%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNV  1041
             A W+V + +S++ W D WV +   G  + ID         V+  I ++R W +
Sbjct  298   AFWQVRNRQSIEVWKDRWVPNSIGGSIIPIDTSNRFTPLLVAEVIDENREWQI  350



>ref|XP_008243410.1| PREDICTED: uncharacterized protein LOC103341644 [Prunus mume]
Length=383

 Score = 82.0 bits (201),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 70/293 (24%), Positives = 125/293 (43%), Gaps = 28/293 (10%)
 Frame = +3

Query  1050  ALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN-----  1214
             AL  ++ ++ +  IR +P+  +    D + W  + SG + V S Y+L+  +   +     
Sbjct  56    ALAQYVSQDTIKLIREVPIG-NLHRDDRIVWPWNKSGLYSVKSGYNLMVVSSSSSGGNNR  114

Query  1215  ---------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEES  1367
                      W  +W    + K+K  LW ++   + T +   RR +I  S C  C   +ES
Sbjct  115   SSHVIERGVWKDIWASPTLPKIKFFLWRMMVRALPTKLNLYRRRIISTSLCPICNQYDES  174

Query  1368  LVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFV-YT  1544
               H    C + +  W           ++    + W    ++S++ +     W ++ V + 
Sbjct  175   EEHAIFLCPWTQAVWFGSPLNYRVNPQSLTTFDRWFNGLLNSQMFSKSDRVWVLSLVSFI  234

Query  1545  LWQIWKCRNNLIFNNNSETPVHVAKLACTFASE-----ARAFIIRHGG--TSQGCYNWVT  1703
              W+IWK R   +F + +  P  V + A + A E       AF  R+G    SQ       
Sbjct  235   SWEIWKARCKFLFEDITIDPRSVVERAASAAEEFGALRHHAFSTRNGAGVLSQPAG---I  291

Query  1704  WTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
             W PP  G +KIN D A K+    A  G ++R+ +  +  GFA+K    ++ +A
Sbjct  292   WKPPVNGAIKINFDAAWKNHE--AGLGVVMRNQNKDFCYGFASKRCCNNALNA  342



>ref|XP_002462720.1| hypothetical protein SORBIDRAFT_02g030860 [Sorghum bicolor]
 gb|EER99241.1| hypothetical protein SORBIDRAFT_02g030860 [Sorghum bicolor]
Length=438

 Score = 74.7 bits (182),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 99/254 (39%), Gaps = 20/254 (8%)
 Frame = +3

Query  1107  PVDDSTVDTLTWQDSTSGTFFVASAYSLISCTV---DEN----------WPWLWKLNCVE  1247
             P+  ++ D   W    +G + V SAY L+       ++N          W  LWKL    
Sbjct  139   PIGRNSQDFWAWNSEKTGVYSVRSAYKLLYNKKFGWNQNLAPGSSSVGLWKMLWKLQVPP  198

Query  1248  KVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIET  1427
             KV+   W +    +       ++H+   + C  C D EES+ H+  D   AR  W  +  
Sbjct  199   KVRVFWWRVANDFLPARQVLFKKHIEPVAFCEDCGDPEESIRHVLVDGSIARIFWHQVRL  258

Query  1428  YGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPV  1607
               G  +   L    W    +     T D A      +  +W +W  RN       S + V
Sbjct  259   GTGVKIPT-LNPVTWTNDLISGICTTKDTA----LILCGMWALWMMRNKRRHGEKSMS-V  312

Query  1608  HVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGG  1787
             H A +     +    + I      +     + W PP+PGWVK+N D + +S   + +   
Sbjct  313   HQA-VVWARDTALDLWQISQATRREKPQIELKWRPPEPGWVKVNADASFQSDGKVGATAC  371

Query  1788  IVRDDHGCWVIGFA  1829
             +VRD  G + +  A
Sbjct  372   VVRDHRGAFRVAQA  385


 Score = 30.0 bits (66),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (4%)
 Frame = +1

Query  892   RVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             RVGDG S + WS  W+++   G    I    NL    VS+ +     WN  ++
Sbjct  73    RVGDGVSTNIWSHKWISNHFAG--QPITPRANLQILNVSDLLTASGEWNTEII  123



>gb|EEC81662.1| hypothetical protein OsI_25211 [Oryza sativa Indica Group]
Length=561

 Score = 78.6 bits (192),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 69/291 (24%), Positives = 108/291 (37%), Gaps = 28/291 (10%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI-----------  1193
             D L     EE V  I++IPV V+    D L W     G F V SAY +            
Sbjct  170   DLLSQTFWEEDVAAIKSIPVHVE--MEDVLAWHFDARGCFTVKSAYKVQREMERRASRNG  227

Query  1194  -------SCTVDENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCR  1352
                        D+ W  LWKL    K+K  LW +    +        R +  D+ C  C 
Sbjct  228   CPGVSNWESGDDDFWKKLWKLGVPGKIKHFLWRMCHNTLALRANLHHRGMDVDTRCVMCG  287

Query  1353  DEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSIT  1532
                E   HLF  C+  ++ W+A+     +++         +  +++ +           +
Sbjct  288   RYNEDAGHLFFKCKPVKKVWQALNLEELRSMLKQQTSGKNVLQSIYCRPENE-----RTS  342

Query  1533  FVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTP  1712
              +  LWQ WK RN +       +P  ++ L  + A E     ++      G      W  
Sbjct  343   AIVCLWQWWKERNEVREGGIPRSPAELSHLIMSQAGEFVRMNVKEKSPRTG--ECAVWRR  400

Query  1713  PQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWV-IGFATKIGVTDSFSA  1862
             P   +VKIN DGA  S       G +++D  G  +  G      + D+F A
Sbjct  401   PPLNFVKINTDGAYSSNMKQGGWGFVIKDQTGAVLQAGAGPAAYLQDAFHA  451


 Score = 26.2 bits (56),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +1

Query  889  WRVGDGKSLDFWSDWWV  939
            WR+GDG  ++ W+D W+
Sbjct  120  WRMGDGSKINIWADPWI  136



>ref|XP_008780552.1| PREDICTED: putative ribonuclease H protein At1g65750, partial 
[Phoenix dactylifera]
Length=285

 Score = 80.5 bits (197),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 96/241 (40%), Gaps = 19/241 (8%)
 Frame = +3

Query  1071  EELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDE--NWPWLWKLNCV  1244
             E+LV +I A+P+P   +  D L W  +          ++ I    +   +  W+W++   
Sbjct  34    EQLVERILALPIP-SRAEPDRLVWLPTGRSRVRARDIHAWIRREPERRIDGGWIWRMRVH  92

Query  1245  EKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIE  1424
              +V   LW +  G + T     RR +   S C  C D EE++ H+   C  A +CW    
Sbjct  93    PRVALFLWKVAWGCLPTRSVLARRGMRMGSLCEVCLDAEETVGHVLLRCPVAMQCWRLAS  152

Query  1425  TYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETP  1604
                    ++   M  ++  ++ S      G+       Y  + IW  RN+ +F     TP
Sbjct  153   ALLPPLWESVEDMLRFLSESIRSPRDAEIGS----IVAYLAYHIWLARNDRLFEGGRSTP  208

Query  1605  VHVAKLACTFASEARAFIIRHG------------GTSQGCYNWVTWTPPQPGWVKINIDG  1748
               V + A   A+E                       S   +++ +W PP PG++K+N DG
Sbjct  209   RAVMERALRQAAEISMMTTSEPPGRTRDIWGTCTAVSASRFSYFSWVPPPPGYLKVNFDG  268

Query  1749  A  1751
              
Sbjct  269   G  269



>ref|XP_008352230.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=775

 Score = 82.0 bits (201),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 111/297 (37%), Gaps = 30/297 (10%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAY------SLISCTV  1205
             +D L  FL +  V  I  +    D +  D L W     G++ V S Y      S + C  
Sbjct  307   LDFLKPFLADSEVEXILDLHTG-DPTLKDRLVWPFEKRGSYSVKSGYYWSLNRSQVRCQQ  365

Query  1206  DEN--------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEE  1361
                        W  +WKL    K++T +W  L   + T      R      TC  C   +
Sbjct  366   SIRLVSIPSTLWKTVWKLKVPPKIRTFMWKTLHAALATMKNLYIRRSSPSPTCXLCNSFD  425

Query  1362  ESLVHLFCDCQFARECWEAIETYGGK--TLKNHLLMNAWIESNVHSKIVTNDGAPWSITF  1535
             ES+ HLF  C      W     +GG+     N   +++W    V      N  A   I  
Sbjct  426   ESIEHLFLFCPXVEVVW-----FGGRLNLRPNRQQVSSWASWLVQMGEAENGSAEVRIDR  480

Query  1536  V----YTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFIIRHGGTS----QGCY  1691
             +    +T W  WK R    FNN    P  V         + +  I R    S        
Sbjct  481   ISYIAFTCWHXWKSRCEFQFNNQVIYPSRVVAXVXRSVXDYQGTIFRXSSRSLLNQXSLG  540

Query  1692  NWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
               V W+PP  G +KIN+  + ++ +G+   G + RD+ GC++     KI  T +  A
Sbjct  541   AGVXWSPPDHGVIKINVXASWEAKSGVGFTGVVARDEQGCFLAASRHKIKXTGAXMA  597


 Score = 22.3 bits (46),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 13/44 (30%), Positives = 19/44 (43%), Gaps = 3/44 (7%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDM---EIDIPKNLYDKKV  1005
             A W++ DG     W D W+    LG       + + KNL  K +
Sbjct  254   AHWQIMDGNDTRVWVDRWIPPIPLGRPSPLGSVXVSKNLKVKSL  297



>ref|NP_680382.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 gb|AED94885.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=258

 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 80/186 (43%), Gaps = 3/186 (2%)
 Frame = +3

Query  1290  FTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNA  1469
              T+ ER RRHL   +         ES++H+F DC      W        +       +  
Sbjct  1     MTDEERHRRHLSASNVSQVYIGGVESVLHVFRDCPAQLGIWVRFVPRRRQQGFFSKSLFE  60

Query  1470  WIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEAR  1649
             W+  N+  +    D  PWS  F   +W  WK R + IF  N++    V  +        R
Sbjct  61    WLYDNLCDRSSCED-IPWSTIFAVIIWWGWKWRCSNIFGENTKCRDRVKFVKEWVVEVYR  119

Query  1650  AFIIRH--GGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIG  1823
             A +     G T       + W  P  GWVK+N DGA +   GLASAGG++RD  G W  G
Sbjct  120   AHLGNALVGSTQPRVERLIGWVLPCVGWVKVNTDGASRGNPGLASAGGVLRDCEGAWCGG  179

Query  1824  FATKIG  1841
             F+  IG
Sbjct  180   FSLNIG  185



>ref|XP_009151515.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=488

 Score = 82.8 bits (203),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 62/208 (30%), Positives = 95/208 (46%), Gaps = 17/208 (8%)
 Frame = +3

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             +WK     K++  LW L    + T    RRRH+  +  C RC   EE+  HLF +C +A 
Sbjct  163   IWKTKVPAKLQHFLWRLSSRCLATGSNLRRRHITRNGQCKRCCMAEETEEHLFFECPYAM  222

Query  1404  ECWEAIE----TYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRN  1571
               W A      T    T      ++A ++ ++ +++      P     ++ LW+IWK RN
Sbjct  223   GIWRASGVSNITINSPTTSLEEKIDACLQYSLSTRLTHFQDLP-----IWILWRIWKGRN  277

Query  1572  NLIFNNNSETP-VHVAKLACTFASEAR----AFIIRHGGTSQGCYNW--VTWTPPQPGWV  1730
              L+F    ETP   + + A   A E +    A    +    +  YN   V WT P  GW 
Sbjct  278   VLVFQQR-ETPWRSIIRYAKEDAKEWKQNDVAATTSYRERRRCIYNSSNVKWTRPPQGWK  336

Query  1731  KINIDGAMKSCTGLASAGGIVRDDHGCW  1814
             K NIDG+        +AG I+RD++G +
Sbjct  337   KCNIDGSYHQSRATGTAGWIIRDENGVY  364



>ref|XP_008238071.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=502

 Score = 82.8 bits (203),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 104/268 (39%), Gaps = 23/268 (9%)
 Frame = +3

Query  1083  NKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLIS----------------CTVDEN  1214
              +I+A+PV    S  D L W  S SG + V S Y+LI                     + 
Sbjct  111   RRIKAMPVG-GGSESDRLIWPFSVSGCYSVKSGYNLIHPCHSPSQKLLKASGSHFVSKKV  169

Query  1215  WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQ  1394
             W  +W      K+K  LW  +KG + T     RRHL     C  C +E E++ HL   C 
Sbjct  170   WKLIWCSPLTPKIKNFLWRAVKGCLPTRALLFRRHLGLSPLCPVCENELETIEHLLFFCN  229

Query  1395  FARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNN  1574
             +    W           ++   ++ W+   V      N    W     +  W +W+ R  
Sbjct  230   WTASVWFGSVLCYRVDRQSITTIDEWLLGVVSKLDKENFNWVW-FHISFLCWSLWRSRCA  288

Query  1575  LIFNNNSETPVHVAKLACTFASEARAFII--RHGG---TSQGCYNWVTWTPPQPGWVKIN  1739
              +F   +  P        T A E    +   RHG    +S+G  +   W PP    +K+N
Sbjct  289   FVFEGKNVCPKQTIAWGRTLAVELLEVVKLHRHGAEEPSSRGSESIQRWLPPHQATLKLN  348

Query  1740  IDGAMKSCTGLASAGGIVRDDHGCWVIG  1823
             +D +    T     G ++RD+HG ++ G
Sbjct  349   VDASWDKKTLFTGLGAVIRDEHGAFIRG  376



>ref|XP_007022459.1| RNase H family protein [Theobroma cacao]
 gb|EOY13984.1| RNase H family protein [Theobroma cacao]
Length=429

 Score = 64.3 bits (155),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/274 (21%), Positives = 108/274 (39%), Gaps = 29/274 (11%)
 Frame = +3

Query  1047  DALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENWPW-  1223
             DALL    E++V +I  + +P+D+S +    W  ++ G F   SA+ ++      N+ + 
Sbjct  64    DALL----EDVVTEI--MKIPIDESRIYEAYWAPTSDGKFTTKSAWEIVRQRHSINFVFY  117

Query  1224  -LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFA  1400
              +W  +    +   LW L +  +  ++  + +       C  C + +ESL H+  +C  A
Sbjct  118   SIWHRSIPLSISFFLWRLFQDWIPVDLRLKSKGFQLVFKCQHC-NSKESLFHVMWECPLA  176

Query  1401  RECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLI  1580
              + W     +    + +   +   I + + S   T  G    +  ++  W +W  RN+  
Sbjct  177   SQVWNYFAKFFQIYIIHRKSIYQIIWAWLFSSDYTKKGHIHILIPLFIFWFLWVERNDAK  236

Query  1581  FNNNSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKS  1760
               N    P     L      + + F               +W  P  G  K+N+DG  K 
Sbjct  237   HRNLGMYPNRKPSLP-----KPKVF---------------SWQKPLTGEFKLNVDGGSKY  276

Query  1761  CTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
                 A+ G ++RD  G  +  F    G  +S  A
Sbjct  277   DCQSAAGGRLLRDHTGTLIFSFVENFGPYNSLQA  310


 Score = 33.9 bits (76),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 4/47 (9%)
 Frame = +2

Query  1943  NRGDHSEETVVTLVKDCLDLSRKFRKFKISHIMREGNRCADWLANYG  2083
             ++G      ++  ++ CL +      F+ISHI REGN+ AD L+N G
Sbjct  347   HKGSAQIRYLLASIRKCLSVI----SFRISHIHREGNQAADLLSNQG  389


 Score = 25.8 bits (55),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (54%), Gaps = 7/39 (18%)
 Frame = +1

Query  838  ASSSTTIRLMGVEIRARWRVGDGKSLDFWSDWWVNDKSL  954
            AS S T      E   R R+G G+ L FW D+W+ D+ L
Sbjct  3    ASCSVT------EQHIRGRIGRGE-LFFWHDYWMGDEPL  34



>dbj|BAI67988.1| hypothetical protein [Oryza sativa Indica Group]
 gb|AEZ03754.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AEZ03765.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
Length=317

 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 69/293 (24%), Positives = 120/293 (41%), Gaps = 47/293 (16%)
 Frame = +3

Query  1032  LECYVDALLTFLREELVNKIRAIPVPVDDSTV-----------DTLTWQDSTSGTFFVAS  1178
             ++   D +L    +  V K++ I  P+D + +           D   W    +G F V S
Sbjct  12    VQLVADLMLQNTNQWDVEKVQRIFFPLDAAAILNMPRPRTEQDDFWAWAWDRTGIFTVRS  71

Query  1179  AYSLI------------SCTVDE-NWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRH  1319
             AY  +            S T DE  W  LW+L  + K++   W ++K  +    E RR H
Sbjct  72    AYRELIQRCGLSEPATGSSTGDEATWKALWRLRIMPKIRVFWWRVVKNLLPCAAELRRSH  131

Query  1320  LIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKI  1499
             + + S C  C ++ E+  H   +C+ A+  W A +      +   L    W    + + I
Sbjct  132   MKEISNCPLCGNDNETKFHALVECEHAKLFWSAAQDLFDLKMP-RLNPATWSRDVLDADI  190

Query  1500  VTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTF-------ASEARAFI  1658
             ++   A  +++    +W IW  RN+    +    P+   +L           A E  + +
Sbjct  191   MSKREAAIAVS---VMWTIWGSRNSYNHGDVKYQPLRSVELVDELIKSLEIPAQEDPSAV  247

Query  1659  IRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWV  1817
             ++             W  P  GW+K+N DGA+    G+A AG + RD+ G +V
Sbjct  248   VQK------------WARPALGWMKLNTDGALNLQDGVAGAGIVARDNTGNFV  288



>ref|XP_008808028.1| PREDICTED: uncharacterized protein LOC103720203 [Phoenix dactylifera]
Length=418

 Score = 73.9 bits (180),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 105/267 (39%), Gaps = 31/267 (12%)
 Frame = +3

Query  1053  LLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENWP--WL  1226
             L     E LV ++RAIP+P   +  D   W  +   +  +     ++   +       W+
Sbjct  62    LGQLFGEHLVERVRAIPLP-GSAGPDVRVWSTTCRASAGIGEVSRVLQLGLQSGLDCGWV  120

Query  1227  WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARE  1406
             W+    ++V   LW +   R+ T     RR +     C  C    ES+ H+   C+ AR 
Sbjct  121   WRFGLHQRVALFLWKVAWERLPTCSVLSRRGMSLSPLCLVC-GVAESVDHVLFHCERARG  179

Query  1407  CWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTN-DGAPW----SITFVYTLWQIWKCRN  1571
              W   E  G          +AW    +  +IV +  G P     +I    T +QIW  RN
Sbjct  180   VWRLTEIQG----------DAWSSRVIFLEIVRHWAGDPHMRRSAIRASCTAYQIWLARN  229

Query  1572  NLIFNNNSETPVHVAKLACTFASEA-------RAFIIR-----HGGTSQGCYNWVTWTPP  1715
               +F     +   V + AC  A E        R  I R     H  ++     + TW PP
Sbjct  230   ARVFGERRLSQRFVMERACAQADEIIHVESAHRPLIARDTWGSHIASAAPHRVFFTWEPP  289

Query  1716  QPGWVKINIDGAMKSCTGLASAGGIVR  1796
              P ++K+N DG++        AG IV+
Sbjct  290   PPSFLKVNFDGSVLDGGRRGGAGFIVK  316


 Score = 30.0 bits (66),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = +1

Query  880  RARWRVGDGKSLDFWSDWWVNDKSLGL  960
             +RWR+GDG+S+D   D WV+   L L
Sbjct  5    HSRWRIGDGQSIDVLEDPWVDALPLSL  31



>ref|XP_010474601.1| PREDICTED: uncharacterized protein LOC104754160 [Camelina sativa]
Length=1368

 Score = 77.0 bits (188),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 99/258 (38%), Gaps = 31/258 (12%)
 Frame = +3

Query  1107  PVDDSTVDTLTWQDSTSGTFFVASAY--------------SLISCTVDENWPWLWKLNCV  1244
             P   +T D   W  S SG + V S Y               ++  ++D  +  +WKL+  
Sbjct  993   PGSATTKDVYAWDYSRSGHYSVKSGYWVATQVIKGKDQPQFVLQPSLDLLYQQIWKLDAP  1052

Query  1245  EKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECW--EA  1418
              K+   +W  +   +         H+  +++C RC +  ES  HL   C  +R  W    
Sbjct  1053  PKLHHFIWRCISNNLSVAGNLYHPHISREASCIRCPNARESTNHLLFTCPLSRLVWAISP  1112

Query  1419  IETYGGKTLKNHLLMNAWIESNVHSKIVTNDG----APWSITFVYTLWQIWKCRNNLIFN  1586
             I         N +  N +   N H ++ + +     +PW       LW+IWK RNNLIF 
Sbjct  1113  IPAPPEGDWSNSIYANLFWVFNYHKELPSQENLSSLSPW------ILWRIWKNRNNLIFK  1166

Query  1587  NNSETPVHVAKLACTFASEARAFI----IRHGGTSQGCYNWVTWTPPQPGWVKINIDGAM  1754
                   + +   A   A E    +    I+H     G  N   W  P   WVK N DGA 
Sbjct  1167  GREYEAISLINKAKEDAEEWSQRLELRGIKHPNPP-GSLNRNKWIKPSQDWVKCNSDGAW  1225

Query  1755  KSCTGLASAGGIVRDDHG  1808
                      G ++RD+ G
Sbjct  1226  PHDGDTGGLGWVLRDNRG  1243


 Score = 26.9 bits (58),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 30/63 (48%), Gaps = 7/63 (11%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDK-SLGLDMEIDIPKNLYDKKVS-NFIKD-----DRSWNV  1041
             AR  +G+G S++ W   WV +K S G+     IP        S N ++D      + WN 
Sbjct  914   ARAVIGNGASVNIWQHQWVEEKPSRGISRMKVIPPQFQRIASSVNSVQDLLLPSGKDWNE  973

Query  1042  TLM  1050
             TL+
Sbjct  974   TLL  976



>gb|AAF79490.1|AC022492_34 F1L3.4 [Arabidopsis thaliana]
Length=253

 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 69/132 (52%), Gaps = 3/132 (2%)
 Frame = +3

Query  1455  LLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTF  1634
             ++   WI +N+  +I  N G PW++TF   +W  WK R   IF  N +    V  +    
Sbjct  1     MVSKEWIYANLGEEIEIN-GCPWAVTFSQAIWWGWKWRYGNIFGENKKCRDRVRFIKDRA  59

Query  1635  ASEARAFIIRHGGTSQGCYN--WVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHG  1808
                 +A + + G T++       + W+PP+ GW K+N DGA +    LA+AGG+VRD  G
Sbjct  60    LDVWKAHVHKMGVTTRTAREERLIAWSPPRVGWFKLNTDGASRGNPRLATAGGVVRDGDG  119

Query  1809  CWVIGFATKIGV  1844
              W  GF+  IG+
Sbjct  120   NWCYGFSLNIGI  131



>ref|XP_010446251.1| PREDICTED: uncharacterized protein LOC104729051 [Camelina sativa]
Length=786

 Score = 77.0 bits (188),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 91/214 (43%), Gaps = 23/214 (11%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPV---PVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN  1214
             +D LL     E    I A+P+   P +DS    L W  + SG + V S Y  +     E+
Sbjct  378   IDLLLQHFSPEDAALIGALPLGSTPREDS----LGWHFTKSGKYSVKSGYDTVRLAKQES  433

Query  1215  W---------PWL---WKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDE  1358
                       P L   W++ C  K+K  +W +L G +      RR  +  D+ CARC  +
Sbjct  434   QVPRLGPDINPLLAGVWRVACPPKIKHFMWQVLSGCISVTAILRRWGIACDAGCARCGAD  493

Query  1359  EESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFV  1538
             EE++ H    C  AR+ W   +   G            + +NV   + +++       F 
Sbjct  494   EETVNHALFRCPSARQTWALAQVLVGSV----SFPTDSLYANVDHFLGSDNPGSRVEAFP  549

Query  1539  YTLWQIWKCRNNLIFNNNSETPVHVAKLACTFAS  1640
             + +W IWK RN  +F N  + P  V +LA   A+
Sbjct  550   WIMWYIWKARNAYVFENIRDKPDEVVRLALGEAA  583


 Score = 26.9 bits (58),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 2/54 (4%)
 Frame = +1

Query  892   RVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFI-KDDRSWNVTLM  1050
             RVG+G+S+  W+D WV  +S    M    P      K+S+ I     SW + L+
Sbjct  329   RVGNGESISIWTDPWVPAQSPRPAMSKG-PSLDSSLKISHLIDHQTNSWCIDLL  381



>ref|XP_008366311.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=812

 Score = 79.7 bits (195),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 65/272 (24%), Positives = 112/272 (41%), Gaps = 45/272 (17%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI-----SCTV-  1205
             VD +     EE  N I  IP  ++    D + W  +++G + V + Y ++     +C + 
Sbjct  544   VDLVKGCFEEEESNIILGIPTSLEGCN-DRIIWHHTSNGDYTVKTGYGIVMEMQENCELG  602

Query  1206  -------------DENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCAR  1346
                          D+ W  +W+L    K+K  +W      +       RR +  ++TC  
Sbjct  603   RKRTRGCSRRDEPDKCWMEIWRLKVPNKMKYFIWRCCTSSLAARGNLHRRRMRVNTTCVL  662

Query  1347  CRDEEESLVHLFCDCQFARECWEA------IETYGGKTLKN--HLLMNAWIESNVHSKIV  1502
             C D +E+  HLF +C+F+R  W +      I+    K   +  + L N + +   H  I+
Sbjct  663   CGDAKETEHHLFFECEFSRVFWFSCPLQLDIKLATRKDFGDCWYSLCNRFRKEKNHELIL  722

Query  1503  TNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEAR---------AF  1655
                        V+ +W+IWKCRN+L+F      P+    +  +   E R         A 
Sbjct  723   QE--------CVFIMWRIWKCRNDLLFKGTEANPMESVNVVRSQIMEYRASHDPAKMSAI  774

Query  1656  IIRHGGTSQGCYNWVTWTPPQPGWVKINIDGA  1751
             +   G       + V W  P+ G +K+N DGA
Sbjct  775   VGVMGEAVSYAGHPVRWKSPKFGVIKVNCDGA  806


 Score = 24.3 bits (51),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = +1

Query  886  RWRVGDGKSLDFWSDWWV  939
            RWRVGDG S+    D W+
Sbjct  495  RWRVGDGSSIRVKYDPWL  512



>gb|EAZ40370.1| hypothetical protein OsJ_24816 [Oryza sativa Japonica Group]
Length=613

 Score = 82.8 bits (203),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 78/289 (27%), Positives = 109/289 (38%), Gaps = 39/289 (13%)
 Frame = +3

Query  1071  EELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDEN------------  1214
             EE V  I AIPV   +   D   W     G F V SAY  +    D              
Sbjct  226   EEDVKNILAIPV--HNGYSDVAAWHFDPRGIFSVKSAYHTLEYQRDRQAIRQTGESSSGK  283

Query  1215  -------WPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLV  1373
                    W  LW+LN + KVK  LW L    +       +R +  D+ C  C   +E+  
Sbjct  284   TSSAALQWEKLWRLNHLPKVKHFLWRLAHNSLPLRQNISKRGMEIDTRCPVCLRLDENGG  343

Query  1374  HLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHS--KIVTNDGAPWSITFVYTL  1547
             H F  C+F + CW  +          H+     ++++     K + N      +T V  L
Sbjct  344   HCFFKCKFVKPCWRMLNF-------EHIRQELSLQTSTLDVCKHILNLREDIMLTTVILL  396

Query  1548  WQIWKCRNNLIFNNNSETPVHVAKLACTFASEARAFI---IRHGGTSQGCYNWVTWTPPQ  1718
             W  W  RN +    +  T   V        SE         R   +SQ      TW PP 
Sbjct  397   WNWWDARNKVNAGEDRRTHEEVYSRVIRMVSENSLLFRDKARGNPSSQS-----TWCPPP  451

Query  1719  PGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIG-VTDSFSA  1862
                +K+NIDGA ++       G I+RD  G  V+  A +I  V D+ SA
Sbjct  452   QCVLKLNIDGAFQAANLSGGWGFILRDHEGNGVLARAGRIELVHDALSA  500



>ref|XP_006494016.1| PREDICTED: uncharacterized protein LOC102608298 [Citrus sinensis]
Length=1570

 Score = 74.3 bits (181),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 62/253 (25%), Positives = 103/253 (41%), Gaps = 25/253 (10%)
 Frame = +3

Query  1128  DTLTWQDSTSGTFFVASAYSLI-----------SCTVDENWPWLWKLNCVEKVKTLLWLL  1274
             D + W       + V S Y +            S T +  W  +W L   EK++   W  
Sbjct  913   DEVIWHYDRKCQYSVKSGYQIALNLKFPAKPTSSATSENQWNAIWLLTLPEKIRIFAWRA  972

Query  1275  LKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNH  1454
              K  + +     +R +I +  C  C  + E++ H    C+  ++ W+   T     LK+ 
Sbjct  973   AKNLLPSAENLWKRKVIQEPLCQFCNKKLETIFHALVGCKVVKKIWKI--TRFEDDLKDS  1030

Query  1455  L---LMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETP-VHVAKL  1622
             +   +++  IE  +     + D     +T    LW IW  +N+ IF    ++P V V+K 
Sbjct  1031  VEQDMLSLLIELKLRR---SKDDIELLVTI---LWMIWNAQNSWIFKGVKDSPHVTVSKA  1084

Query  1623  ACTFASEARAFIIRHGGTS-QGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRD  1799
                  +  R  +        Q       W PPQ G  K+N+D A  S   +AS G ++RD
Sbjct  1085  EAVLEAFRRTQLPAATHIDIQSSSKLKAWKPPQRGHFKVNVDAATNSEKQIASLGAVIRD  1144

Query  1800  DHGCWVIGFATKI  1838
             + G  VI  A K+
Sbjct  1145  EAGN-VIAAAVKV  1156


 Score = 29.3 bits (64),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 29/56 (52%), Gaps = 2/56 (4%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNVTLM  1050
             +RWR+G+G+S+    + W+  + L     I  P    D  V+  I ++ +WN  L+
Sbjct  836   SRWRIGNGQSIMLHKENWL-PRPLTFK-PISKPSLPADALVAELINEEHTWNEGLI  889



>ref|XP_007019466.1| Polynucleotidyl transferase, putative [Theobroma cacao]
 gb|EOY16691.1| Polynucleotidyl transferase, putative [Theobroma cacao]
Length=389

 Score = 81.3 bits (199),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = +3

Query  1461  MNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFAS  1640
             +  W+  N+    V  DG PWS  FVYT+W +W  R+ LIF+++   P +  +   T   
Sbjct  184   LQQWMLKNIQDNTVI-DGLPWSYIFVYTIWLLWCWRSLLIFDSSFTWPHNPQQQIWTKTK  242

Query  1641  EARAFIIRHGGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVI  1820
             +A   + +     +   + ++W  P   +VK++ DG+ +   G A+ GGI+RDD G W++
Sbjct  243   KAFDILNKTQQRVKRDVS-ISWKKPNKTFVKLSADGSARGQPGGAATGGIIRDDKGEWML  301

Query  1821  GFATKIGVTDSFSA  1862
             GF  KIG+T S +A
Sbjct  302   GFIHKIGITFSLNA  315



>dbj|BAB09192.1| non-LTR retroelement reverse transcriptase-like protein [Arabidopsis 
thaliana]
Length=308

 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 80/186 (43%), Gaps = 3/186 (2%)
 Frame = +3

Query  1290  FTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKNHLLMNA  1469
              T+ ER RRHL   +         ES++H+F DC      W        +       +  
Sbjct  1     MTDEERHRRHLSASNVSQVYIGGVESVLHVFRDCPAQLGIWVRFVPRRRQQGFFSKSLFE  60

Query  1470  WIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEAR  1649
             W+  N+  +    D  PWS  F   +W  WK R + IF  N++    V  +        R
Sbjct  61    WLYDNLCDRSSCED-IPWSTIFAVIIWWGWKWRCSNIFGENTKCRDRVKFVKEWVVEVYR  119

Query  1650  AFIIRH--GGTSQGCYNWVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIG  1823
             A +     G T       + W  P  GWVK+N DGA +   GLASAGG++RD  G W  G
Sbjct  120   AHLGNALVGSTQPRVERLIGWVLPCVGWVKVNTDGASRGNPGLASAGGVLRDCEGAWCGG  179

Query  1824  FATKIG  1841
             F+  IG
Sbjct  180   FSLNIG  185



>emb|CAB39638.1| RNA-directed DNA polymerase-like protein [Arabidopsis thaliana]
 emb|CAB78094.1| RNA-directed DNA polymerase-like protein [Arabidopsis thaliana]
Length=1274

 Score = 76.3 bits (186),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 82/182 (45%), Gaps = 12/182 (7%)
 Frame = +3

Query  1071  EELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI------SCTVDENWPW-LW  1229
             E+ + KI    +P+ DS    L W    SG +   + Y+L       +  +D NW   +W
Sbjct  920   EDQIRKITINALPLQDS----LVWLPVKSGEYTTKTGYALAKLNSFPASQLDFNWQKNIW  975

Query  1230  KLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAREC  1409
             K++   KVK  LW  +KG +       RR++  + TC RC   E SL HL   C +A++ 
Sbjct  976   KIHTSPKVKHFLWKAMKGALPVGEALSRRNIEAEVTCKRCGQTESSL-HLMLLCPYAKKV  1034

Query  1410  WEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNN  1589
             WE        +   H  +   +        +   G   +  + + LW +WK RN LIF+N
Sbjct  1035  WELAPVLFNPSEATHSSVALLLVDAKRMVALPPTGLGSAPLYPWLLWHLWKARNRLIFDN  1094

Query  1590  NS  1595
             +S
Sbjct  1095  HS  1096


 Score = 27.3 bits (59),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 26/52 (50%), Gaps = 2/52 (4%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDD-RSWNV  1041
             W +G G S++ W++ W++  S    +      N  D  V + I  D +SWNV
Sbjct  859   WSIGQGDSINVWTEAWLSPSSPQTPIGPPTETN-KDLSVHDLICHDVKSWNV  909



>ref|XP_006485449.1| PREDICTED: uncharacterized protein LOC102621413 [Citrus sinensis]
Length=2303

 Score = 72.4 bits (176),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 65/284 (23%), Positives = 110/284 (39%), Gaps = 30/284 (11%)
 Frame = +3

Query  1062  FLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI-----------SCTVD  1208
             F++E+    I  IP+P     VD + W     G + V S Y +            S +  
Sbjct  956   FMQED-TEAILKIPLP-RSQKVDEMMWHYDKHGEYSVKSGYQIALKLKAPDEPSNSGSNS  1013

Query  1209  ENWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCD  1388
             + W  +W +   EK+K  +W   +  + T     +R  + D  C  C  E E++ H   D
Sbjct  1014  KRWKAVWSMELPEKMKIFMWRAARNLLPTAENLWKRKCLKDPICQGCNREVETVRHALLD  1073

Query  1389  CQFARECW-EAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKC  1565
             C+ AR+ W  A  +      +N  ++    E      + +  G   +   +   W IW  
Sbjct  1074  CKAARKIWYHATSSVQISNAQNQDILEFIYE------VWSTWGKTKAEQTIAFCWAIWFA  1127

Query  1566  RNNLIFNNNSETP-VHVAKLACTFASEARAFIIRHGGTSQGCYN-----WVTWTPPQPGW  1727
             RN  IF      P    AK      +  RA   R    S   +N        W PP   +
Sbjct  1128  RNKRIFEGKKSDPRASAAKAESLLEAYHRA---RKPDASH-IHNVKRIVQKKWEPPPGNF  1183

Query  1728  VKINIDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFS  1859
             +K+N+D A+ +   +A  G +++D  G  V     ++ + +  S
Sbjct  1184  LKVNVDAAINNRDQVAGLGAVIKDPSGKIVAAGTKQVPLREGVS  1227


 Score = 31.2 bits (69),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (4%)
 Frame = +1

Query  883   ARWRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSNFIKDDRSWNV  1041
             ARWR+G+G ++  + D W+          I  P    D  V   + D+ +WNV
Sbjct  899   ARWRIGNGSNILVYKDNWIPRPDTF--KPISPPTLPIDTTVGELMDDENNWNV  949



>gb|AAF97302.1|AC007843_5 Hypothetical protein [Arabidopsis thaliana]
 gb|AAV68820.1| hypothetical protein AT1G17390 [Arabidopsis thaliana]
Length=272

 Score = 79.7 bits (195),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (53%), Gaps = 3/127 (2%)
 Frame = +3

Query  1470  WIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACTFASEAR  1649
             WI +N+  +I  N G PW++TF   +W  WK R   IF  N +    V  +        +
Sbjct  25    WIYANLGEEIEIN-GCPWAVTFSQAIWWGWKWRYGNIFGENKKCRDRVRFIKDRALDVWK  83

Query  1650  AFIIRHGGTSQGCYN--WVTWTPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWVIG  1823
             A + + G T++       + W+PP+ GW K+N DGA +    LA+AGG+VRD  G W  G
Sbjct  84    AHVHKMGVTTRTAREERLIAWSPPRVGWFKLNTDGASRGNPRLATAGGVVRDGDGNWCYG  143

Query  1824  FATKIGV  1844
             F+  IG+
Sbjct  144   FSLNIGI  150



>ref|XP_010495165.1| PREDICTED: uncharacterized protein LOC104772227 [Camelina sativa]
Length=1148

 Score = 79.3 bits (194),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 66/247 (27%), Positives = 103/247 (42%), Gaps = 20/247 (8%)
 Frame = +3

Query  1128  DTLTWQDSTSGTFFVASAYSLISCTVDENW----PW--------LWKLNCVEKVKTLLWL  1271
             D L W  + +G + V S Y L +   ++ +    P+        +W+ N   K K  LW 
Sbjct  776   DYLGWHYTENGLYSVKSGYWLATHLPNQEFQARPPYGNLQTKTNIWRTNLPLKFKHFLWR  835

Query  1272  LLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECWEAIETYGGKTLKN  1451
             L    + T  E  RRH+  DS C RC  E E+  HLF  C  + + W          L  
Sbjct  836   LSSRALATGAELERRHITPDSLCKRCVSEVETSEHLFFTCPHSSQIWRGSHIPLRSLLNP  895

Query  1452  HLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNLIFNNNSETPVHVAKLACT  1631
             +  ++  I++ +      +     SI   + LW+IW  RN L F   + +     + A  
Sbjct  896   NDSIDTKIKAILEFSKQRDRNDRLSILPFWILWKIWTSRNKLTFRKITHSWQRDLREAKQ  955

Query  1632  FASEARAFI-------IRHGGTSQGC-YNWVTWTPPQPGWVKINIDGAMKSCTGLASAGG  1787
              A E  A +       ++  GTS+        W  P  GWVK N DG+  +    A++  
Sbjct  956   EADEWLASLPPPTTQTLQSTGTSRNRDRENAIWIRPPLGWVKCNYDGSYINGNSHATSAW  1015

Query  1788  IVRDDHG  1808
             ++RDD G
Sbjct  1016  LIRDDQG  1022


 Score = 23.9 bits (50),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 15/61 (25%), Positives = 30/61 (49%), Gaps = 12/61 (20%)
 Frame = +1

Query  886   RWRVGDGKSLDFWSDWWV-----NDKSLGLDMEIDIPKNLYDKKVSNFIKDDR-SWNVTL  1047
             R+ +G+G+ ++ W+D W+           +D + DI        V++F+  +R  WN  L
Sbjct  698   RFTIGNGECINTWTDPWLPVHPPRPPRQAIDQQPDI------STVNSFLLPNRGGWNEAL  751

Query  1048  M  1050
             +
Sbjct  752   L  752



>ref|XP_008804236.1| PREDICTED: putative ribonuclease H protein At1g65750 [Phoenix 
dactylifera]
Length=471

 Score = 78.6 bits (192),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 61/267 (23%), Positives = 102/267 (38%), Gaps = 21/267 (8%)
 Frame = +3

Query  1044  VDALLTFLREELVNKIRAIPVPVDDSTVDTLTWQDSTSGTFFVASAYSLISCTVDENWP-  1220
             VD +     ++L  ++ A P+P++  T D   W  +      V+   +++          
Sbjct  167   VDRIHLLFGDDLAERVLATPIPLEGIT-DRRVWGPTGRARATVSDLQAIVDIGSAHRLEG  225

Query  1221  -WLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQF  1397
              W+W+L    +V   LW +  G + T     RR L   + C  C  EEE+  H+   C +
Sbjct  226   RWIWRLRVHPRVALFLWRVAWGILPTRGILARRGLPIPADCEGCPGEEETTGHVLFTCPW  285

Query  1398  ARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNL  1577
             AR+ W  + T     +     +     S V       D A   + + +  + IW  RN  
Sbjct  286   ARQVWGLVATRRQSFISTEAFL-----SQVRDSARRFDMADRGVVWAHVAYHIWLDRNAR  340

Query  1578  IFNNNSETP--------VHVAKLACTFASEARAFIIRHGGTSQGCYNW-----VTWTPPQ  1718
             IF      P         H A+L    A  +        G     + +     V+W PP 
Sbjct  341   IFEGRGFYPRLVVTRAYAHAAELVSATADSSSGDDRDTWGAFSSPHRYAMIPLVSWAPPP  400

Query  1719  PGWVKINIDGAMKSCTGLASAGGIVRD  1799
             PG +K+N DG++         G ++RD
Sbjct  401   PGSLKVNFDGSVAEGGSRCGVGFVIRD  427


 Score = 25.0 bits (53),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 25/52 (48%), Gaps = 1/52 (2%)
 Frame = +1

Query  889   WRVGDGKSLDFWSDWWVNDKSLGLDMEIDIPKNLYDKKVSN-FIKDDRSWNV  1041
             W VGDG+S+D   D W+   SL     +  P      +VS+  +  +  W+V
Sbjct  116   WAVGDGRSIDVVEDRWLARLSLSRWPTMFDPGATAGSRVSDLLVSGEPRWDV  167



>ref|XP_007227248.1| hypothetical protein PRUPE_ppa018001mg [Prunus persica]
 gb|EMJ28447.1| hypothetical protein PRUPE_ppa018001mg [Prunus persica]
Length=541

 Score = 82.0 bits (201),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 68/277 (25%), Positives = 111/277 (40%), Gaps = 31/277 (11%)
 Frame = +3

Query  1098  IPVPVDDSTVDTLTWQDSTSGTFFVASAYSLI--------------SCTVD-ENWPWLWK  1232
             +PVPVD             SG F V S Y+ I              S T+  + W  +W+
Sbjct  146   LPVPVDAPV---------KSGNFTVKSGYNWIVNQNIRCPLANAQSSHTISLDTWKIIWE  196

Query  1233  LNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFARECW  1412
                + KVK  LW  +   + + +   +R L     C  C +  ES+ H+   C +    W
Sbjct  197   SKTLPKVKQFLWRAVSNILPSFLNLYKRRLSSLHLCPICLESPESIEHMLVLCPWTACVW  256

Query  1413  EAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFV-YTLWQIWKCRNNLIFNN  1589
               I       L+N   ++ W+ S +  + + +  + W ++ V +T W IW+ R   ++N+
Sbjct  257   FGIAIGYRVDLQNFTSLDRWLGSLLRGESMFSLNSRWILSVVAFTCWHIWEARCKFVYND  316

Query  1590  NSETPVHVAKLACTFASEARAFIIRHGGTSQGCYNWVT------WTPPQPGWVKINIDGA  1751
                 P      AC   SE      +    S G    ++      W PP   +VKIN DG+
Sbjct  317   IPIVPAATRSRACLAVSEFWNVTKKPVLGSVGMPIQISSPHPSHWLPPISSYVKINTDGS  376

Query  1752  MKSCTGLASAGGIVRDDHGCWVIGFATKIGVTDSFSA  1862
              KS + +   G I+R   G  + G A ++       A
Sbjct  377   WKSGSAMVGVGVIIRKIAGSCIGGLAAQVPAQSPLMA  413



>ref|XP_006587415.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=503

 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/215 (26%), Positives = 99/215 (46%), Gaps = 14/215 (7%)
 Frame = +3

Query  1224  LWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEESLVHLFCDCQFAR  1403
             LW     E++K LL  +  G + TN ERR  H   +++C  C   EE+ +H   DC    
Sbjct  181   LWSWVGPERIKILLRNIADGALSTNAERRYMHNSVNTSCLSCDALEETCLHALRDCPKVA  240

Query  1404  ECWEAIETYGGKT-LKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTLWQIWKCRNNL-  1577
               W ++     +    N   +  W+E N+   +       W+  F + +  IW+ RN + 
Sbjct  241   AVWRSVLPLELEVKFFNIDEVTLWLERNLSFSV------DWATKFGFAVEVIWESRNEID  294

Query  1578  IFNNNSETPVHVAKLACTF------ASEARAFIIRHGGTSQGCYNWVTWTPPQPGWVKIN  1739
             + +  + +P+++  +          A  +   ++R         +   W PP   W+K+N
Sbjct  295   LLDPRASSPIYMIMMIIIRYEDFIRAHPSHKLMMRDHIQPCSSDHLFKWRPPVDPWLKLN  354

Query  1740  IDGAMKSCTGLASAGGIVRDDHGCWVIGFATKIGV  1844
             +DGA+  C+  A+ GGI RD  G +V+GF+ K+ +
Sbjct  355   VDGAIDPCSKTAACGGIFRDYSGRFVLGFSVKLDM  389



>gb|ABA99231.1| hypothetical protein LOC_Os12g34030 [Oryza sativa Japonica Group]
Length=346

 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 114/277 (41%), Gaps = 47/277 (17%)
 Frame = +3

Query  1080  VNKIRAIPVPVDDSTV-----------DTLTWQDSTSGTFFVASAYSLI-----------  1193
             V K++ I  P+D + +           D   W    +G F V SAY  +           
Sbjct  57    VEKVQRIFFPLDAAAILNMPRPRTEQDDFWAWAWDRTGIFTVRSAYRELIQRCGLSEPAT  116

Query  1194  -SCTVDE-NWPWLWKLNCVEKVKTLLWLLLKGRMFTNVERRRRHLIDDSTCARCRDEEES  1367
              S T DE  W  LW+L  + K++   W ++K  +    E RR H+ + S C  C ++ E+
Sbjct  117   GSSTGDEATWKALWRLRIMPKIRVFWWRVVKNLLPCAAELRRSHMKEISNCPLCGNDNET  176

Query  1368  LVHLFCDCQFARECWEAIETYGGKTLKNHLLMNAWIESNVHSKIVTNDGAPWSITFVYTL  1547
               H   +C+ A+  W A +      +   L    W    + + I++   A  +++    +
Sbjct  177   KFHALVECEHAKLFWSAAQDLFDLKMP-RLNPATWSRDVLDADIMSKREAAIAVS---VM  232

Query  1548  WQIWKCRNNLIFNNNSETPVHVAKLACTF-------ASEARAFIIRHGGTSQGCYNWVTW  1706
             W IW  RN+    +    P+   +L           A E  + +++             W
Sbjct  233   WTIWGSRNSYNHGDVKYQPLRSVELVDELIKSLEIPAQEDPSAVVQK------------W  280

Query  1707  TPPQPGWVKINIDGAMKSCTGLASAGGIVRDDHGCWV  1817
               P  GW+K+N DGA+    G+A AG + RD+ G +V
Sbjct  281   ARPALGWMKLNTDGALNLQDGVAGAGIVARDNTGNFV  317



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8262020802624