BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84245_g1_i1 len=1719 path=[1697:0-1718]

Length=1719
                                                                      Score     E

ref|XP_006352922.1|  PREDICTED: phosphoribulokinase, chloroplasti...    740   0.0      
ref|XP_009613160.1|  PREDICTED: phosphoribulokinase, chloroplasti...    740   0.0      
ref|XP_009783382.1|  PREDICTED: phosphoribulokinase, chloroplasti...    738   0.0      
gb|KHG06063.1|  hypothetical protein F383_32050                         736   0.0      
ref|XP_011018451.1|  PREDICTED: phosphoribulokinase, chloroplasti...    734   0.0      
ref|XP_010276766.1|  PREDICTED: phosphoribulokinase, chloroplasti...    734   0.0      
ref|XP_002303455.1|  Phosphoribulokinase family protein                 731   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002519002.1|  phosphoribulose kinase, putative                   730   0.0      Ricinus communis
ref|XP_011028086.1|  PREDICTED: phosphoribulokinase, chloroplastic      729   0.0      
ref|XP_006368325.1|  Phosphoribulokinase family protein                 728   0.0      
ref|XP_004245935.1|  PREDICTED: phosphoribulokinase, chloroplastic      728   0.0      
ref|XP_010261622.1|  PREDICTED: phosphoribulokinase, chloroplastic      726   0.0      
ref|XP_002263724.1|  PREDICTED: phosphoribulokinase, chloroplastic      726   0.0      Vitis vinifera
ref|XP_007040771.1|  Phosphoribulokinase                                725   0.0      
ref|XP_010056208.1|  PREDICTED: phosphoribulokinase, chloroplastic      724   0.0      
emb|CAN78901.1|  hypothetical protein VITISV_011191                     724   0.0      Vitis vinifera
gb|KDP40430.1|  hypothetical protein JCGZ_03845                         723   0.0      
ref|XP_007158206.1|  hypothetical protein PHAVU_002G133100g             723   0.0      
ref|XP_009788785.1|  PREDICTED: phosphoribulokinase, chloroplasti...    721   0.0      
ref|XP_003516852.1|  PREDICTED: phosphoribulokinase, chloroplasti...    719   0.0      
gb|ACU23619.1|  unknown                                                 719   0.0      Glycine max [soybeans]
ref|XP_009609042.1|  PREDICTED: phosphoribulokinase, chloroplasti...    718   0.0      
gb|EYU29073.1|  hypothetical protein MIMGU_mgv1a007276mg                716   0.0      
ref|XP_003534305.1|  PREDICTED: phosphoribulokinase, chloroplasti...    716   0.0      
ref|XP_010110407.1|  Phosphoribulokinase                                716   0.0      
ref|XP_004300170.1|  PREDICTED: phosphoribulokinase, chloroplasti...    714   0.0      
ref|XP_011082329.1|  PREDICTED: phosphoribulokinase, chloroplasti...    713   0.0      
ref|XP_008465108.1|  PREDICTED: phosphoribulokinase, chloroplasti...    710   0.0      
ref|XP_007210511.1|  hypothetical protein PRUPE_ppa006386mg             709   0.0      
ref|XP_004144412.1|  PREDICTED: phosphoribulokinase, chloroplasti...    709   0.0      
gb|KHN40404.1|  Phosphoribulokinase, chloroplastic                      709   0.0      
ref|XP_006432646.1|  hypothetical protein CICLE_v10001344mg             706   0.0      
ref|XP_004512451.1|  PREDICTED: phosphoribulokinase, chloroplasti...    706   0.0      
ref|XP_010920032.1|  PREDICTED: phosphoribulokinase, chloroplastic      704   0.0      
ref|XP_003612664.1|  Phosphoribulokinase                                700   0.0      
ref|XP_008238129.1|  PREDICTED: phosphoribulokinase, chloroplastic      700   0.0      
gb|ACJ84919.1|  unknown                                                 698   0.0      Medicago truncatula
ref|XP_009114920.1|  PREDICTED: phosphoribulokinase, chloroplasti...    697   0.0      
ref|XP_009399432.1|  PREDICTED: phosphoribulokinase, chloroplasti...    697   0.0      
emb|CDY22582.1|  BnaC05g24200D                                          696   0.0      
emb|CDX84108.1|  BnaC08g07850D                                          695   0.0      
gb|KCW72818.1|  hypothetical protein EUGRSUZ_E01261                     694   0.0      
ref|XP_010933400.1|  PREDICTED: phosphoribulokinase, chloroplasti...    695   0.0      
ref|XP_006415259.1|  hypothetical protein EUTSA_v10007801mg             694   0.0      
ref|XP_010518928.1|  PREDICTED: phosphoribulokinase, chloroplastic      694   0.0      
ref|XP_008788584.1|  PREDICTED: phosphoribulokinase, chloroplastic      693   0.0      
ref|NP_001047825.1|  Os02g0698000                                       692   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CDY41745.1|  BnaA08g07000D                                          692   0.0      
ref|XP_009397815.1|  PREDICTED: phosphoribulokinase, chloroplasti...    691   0.0      
ref|XP_003570158.1|  PREDICTED: phosphoribulokinase, chloroplastic      691   0.0      
sp|P26302.1|KPPR_WHEAT  RecName: Full=Phosphoribulokinase, chloro...    690   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_006647733.1|  PREDICTED: phosphoribulokinase, chloroplasti...    689   0.0      
ref|XP_010054105.1|  PREDICTED: phosphoribulokinase, chloroplasti...    690   0.0      
ref|XP_008373501.1|  PREDICTED: phosphoribulokinase, chloroplastic      689   0.0      
gb|KFK44965.1|  hypothetical protein AALP_AA1G326600                    689   0.0      
gb|EMS51337.1|  Phosphoribulokinase, chloroplastic                      689   0.0      
dbj|BAJ98572.1|  predicted protein                                      689   0.0      
ref|XP_011074792.1|  PREDICTED: phosphoribulokinase, chloroplastic      688   0.0      
ref|XP_002890967.1|  hypothetical protein ARALYDRAFT_890765             688   0.0      
ref|NP_174486.1|  phosphoribulokinase                                   687   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478623.1|  PREDICTED: phosphoribulokinase, chloroplastic      687   0.0      
emb|CAA41020.1|  phosphoribulokinase                                    687   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_004953549.1|  PREDICTED: phosphoribulokinase, chloroplasti...    686   0.0      
ref|XP_009373513.1|  PREDICTED: phosphoribulokinase, chloroplastic      686   0.0      
gb|EMT24657.1|  Phosphoribulokinase, chloroplastic                      684   0.0      
ref|NP_001149223.1|  LOC100282845                                       684   0.0      Zea mays [maize]
ref|XP_010677417.1|  PREDICTED: phosphoribulokinase, chloroplastic      682   0.0      
ref|XP_009145215.1|  PREDICTED: phosphoribulokinase, chloroplastic      681   0.0      
ref|XP_009347088.1|  PREDICTED: phosphoribulokinase, chloroplasti...    681   0.0      
ref|XP_008809216.1|  PREDICTED: phosphoribulokinase, chloroplasti...    681   0.0      
ref|XP_006854101.1|  hypothetical protein AMTR_s00048p00138890          680   0.0      
ref|NP_001146247.1|  uncharacterized protein LOC100279820               679   0.0      Zea mays [maize]
ref|XP_010461025.1|  PREDICTED: phosphoribulokinase, chloroplasti...    678   0.0      
gb|EPS63825.1|  phosphoribulokinase                                     676   0.0      
gb|ACG42204.1|  phosphoribulokinase                                     676   0.0      Zea mays [maize]
ref|XP_010499750.1|  PREDICTED: phosphoribulokinase, chloroplasti...    676   0.0      
ref|XP_006304993.1|  hypothetical protein CARUB_v10009359mg             676   0.0      
gb|AFW63506.1|  phosphoribulokinase                                     679   0.0      
emb|CAA72118.1|  phosphoribulokinase                                    669   0.0      Pisum sativum [garden pea]
ref|XP_010538353.1|  PREDICTED: phosphoribulokinase, chloroplasti...    670   0.0      
sp|P27774.1|KPPR_MESCR  RecName: Full=Phosphoribulokinase, chloro...    669   0.0      Mesembryanthemum crystallinum
sp|P09559.1|KPPR_SPIOL  RecName: Full=Phosphoribulokinase, chloro...    661   0.0      Spinacia oleracea
ref|XP_002986864.1|  hypothetical protein SELMODRAFT_182694             659   0.0      
ref|XP_008448619.1|  PREDICTED: phosphoribulokinase, chloroplasti...    655   0.0      
gb|KDO58810.1|  hypothetical protein CISIN_1g048274mg                   652   0.0      
ref|XP_004146110.1|  PREDICTED: phosphoribulokinase, chloroplasti...    655   0.0      
ref|XP_001781269.1|  predicted protein                                  654   0.0      
ref|XP_002990046.1|  hypothetical protein SELMODRAFT_184990             654   0.0      
gb|AAA34036.1|  phosphoribulokinase precursor (EC 2.7.1.19)             652   0.0      Spinacia oleracea
ref|XP_001756013.1|  predicted protein                                  651   0.0      
gb|KHG26827.1|  Phosphoribulokinase, chloroplastic                      649   0.0      
gb|ABK24583.1|  unknown                                                 646   0.0      Picea sitchensis
ref|XP_010943454.1|  PREDICTED: phosphoribulokinase, chloroplasti...    646   0.0      
gb|ACN40637.1|  unknown                                                 645   0.0      Picea sitchensis
gb|ACN40656.1|  unknown                                                 643   0.0      Picea sitchensis
gb|ACN40495.1|  unknown                                                 643   0.0      Picea sitchensis
ref|XP_004976668.1|  PREDICTED: phosphoribulokinase, chloroplasti...    640   0.0      
ref|XP_008813156.1|  PREDICTED: phosphoribulokinase, chloroplasti...    632   0.0      
dbj|BAL03266.1|  chloroplast phosphoribulokinase                        630   0.0      
dbj|BAL03267.1|  chloroplast phosphoribulokinase                        630   0.0      
gb|ABR16489.1|  unknown                                                 615   0.0      Picea sitchensis
ref|XP_002448449.1|  hypothetical protein SORBIDRAFT_06g027270          613   0.0      Sorghum bicolor [broomcorn]
gb|EAY95389.1|  hypothetical protein OsI_17227                          607   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_009415222.1|  PREDICTED: phosphoribulokinase, chloroplasti...    605   0.0      
ref|XP_006652740.1|  PREDICTED: phosphoribulokinase, chloroplasti...    603   0.0      
ref|NP_001174075.1|  Os04g0595700                                       603   0.0      
ref|NP_001148258.1|  LOC100281866                                       602   0.0      Zea mays [maize]
ref|XP_001771011.1|  predicted protein                                  598   0.0      
ref|XP_005847700.1|  phosphoribulokinase precursor                      594   0.0      
emb|CAE05477.1|  OSJNBa0006A01.23                                       588   0.0      Oryza sativa [red rice]
ref|XP_005651008.1|  phosphoribulokinase                                578   0.0      
ref|XP_001694038.1|  phosphoribulokinase                                573   0.0      Chlamydomonas reinhardtii
ref|XP_002949322.1|  hypothetical protein VOLCADRAFT_104265             571   0.0      
ref|XP_003058071.1|  predicted protein                                  569   0.0      
gb|KFM26811.1|  Phosphoribulokinase, chloroplastic                      568   0.0      
ref|XP_002508184.1|  phosphoribulokinase chloroplast precursor          569   0.0      Micromonas commoda
ref|XP_007512393.1|  phosphoribulokinase                                568   0.0      
ref|XP_001417260.1|  predicted protein                                  568   0.0      Ostreococcus lucimarinus CCE9901
emb|CEF97598.1|  P-loop containing nucleoside triphosphate hydrolase    567   0.0      
ref|XP_003078808.1|  KPPR_CHLRE Phosphoribulokinase, chloroplast ...    558   0.0      
gb|EEE61597.1|  hypothetical protein OsJ_16006                          555   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AAD55057.1|  phosphoribulokinase                                     522   2e-180   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK95585.1|  unknown                                                 516   5e-178   Populus trichocarpa [western balsam poplar]
emb|CBI23277.3|  unnamed protein product                                515   6e-178   
emb|CDP11724.1|  unnamed protein product                                508   4e-175   
emb|CBN76689.1|  Phosphoribulokinase                                    513   2e-174   
ref|XP_002274133.2|  PREDICTED: phosphoribulokinase, chloroplasti...    506   4e-173   Vitis vinifera
ref|WP_035984555.1|  phosphoribulokinase                                503   9e-172   
ref|WP_026072248.1|  phosphoribulokinase                                501   2e-171   
ref|WP_017295158.1|  phosphoribulokinase                                499   3e-170   
ref|WP_006455960.1|  phosphoribulokinase                                498   4e-170   
gb|AAK21910.1|AF336986_1  phosphoribulokinase                           501   4e-170   Vaucheria litorea
ref|WP_015185887.1|  uridine kinase                                     495   8e-169   
ref|WP_015223383.1|  phosphoribulokinase                                494   1e-168   
ref|WP_008318786.1|  uridine kinase                                     494   1e-168   
ref|WP_006515551.1|  uridine kinase                                     493   3e-168   
ref|WP_012629603.1|  phosphoribulokinase                                493   4e-168   
ref|WP_017715709.1|  phosphoribulokinase                                492   9e-168   
ref|WP_017662489.1|  phosphoribulokinase                                491   2e-167   
ref|WP_039727294.1|  phosphoribulokinase                                491   2e-167   
ref|WP_012597129.1|  MULTISPECIES: phosphoribulokinase                  491   3e-167   
ref|WP_015179263.1|  phosphoribulokinase                                491   3e-167   
ref|WP_015123780.1|  uridine kinase                                     491   3e-167   
ref|WP_036002848.1|  phosphoribulokinase                                491   4e-167   
ref|WP_011242879.1|  MULTISPECIES: phosphoribulokinase                  491   4e-167   
ref|WP_011613049.1|  phosphoribulokinase                                491   4e-167   
ref|WP_002783281.1|  Phosphoribulokinase                                490   4e-167   
ref|WP_015145549.1|  uridine kinase                                     490   5e-167   
ref|WP_006527577.1|  uridine kinase                                     490   5e-167   
ref|WP_015171442.1|  phosphoribulokinase                                490   6e-167   
dbj|GAL95813.1|  phosphoribulokinase                                    490   7e-167   
ref|WP_024545168.1|  phosphoribulokinase                                489   9e-167   
ref|WP_006632794.1|  phosphoribulokinase                                489   2e-166   
ref|WP_015192029.1|  Phosphoribulokinase                                488   5e-166   
ref|XP_005707300.1|  phosphoribulokinase                                492   5e-166   
emb|CAC80070.1|  phosphoribulokinase                                    492   6e-166   Galdieria sulphuraria
ref|WP_010477991.1|  phosphoribulokinase                                487   9e-166   
ref|WP_015219287.1|  phosphoribulokinase                                487   9e-166   
ref|WP_009556309.1|  uridine kinase                                     487   1e-165   
ref|WP_002768058.1|  phosphoribulokinase                                486   1e-165   
ref|WP_012266619.1|  phosphoribulokinase                                486   2e-165   
ref|WP_023075025.1|  phosphoribulokinase                                487   2e-165   
ref|WP_006099100.1|  phosphoribulokinase                                486   2e-165   
ref|WP_009787964.1|  phosphoribulokinase                                486   2e-165   
ref|WP_008055552.1|  phosphoribulokinase                                486   2e-165   
gb|ABQ42600.1|  chloroplast phosphoribulokinase precursor               488   2e-165   Heterosigma akashiwo
ref|WP_015229416.1|  uridine kinase                                     485   4e-165   
ref|WP_006625041.1|  phosphoribulokinase                                485   6e-165   
ref|WP_006616865.1|  phosphoribulokinase                                485   6e-165   
ref|WP_023065306.1|  phosphoribulokinase                                484   8e-165   
ref|WP_015224638.1|  phosphoribulokinase                                484   9e-165   
ref|WP_009627590.1|  phosphoribulokinase                                484   1e-164   
ref|WP_022609417.1|  uridine kinase                                     484   2e-164   
ref|WP_015168312.1|  uridine kinase                                     484   2e-164   
ref|WP_012308260.1|  MULTISPECIES: phosphoribulokinase                  483   4e-164   
ref|WP_002750016.1|  MULTISPECIES: phosphoribulokinase                  483   5e-164   
ref|WP_009547106.1|  MULTISPECIES: phosphoribulokinase                  483   5e-164   
ref|WP_002740086.1|  phosphoribulokinase                                483   6e-164   
ref|WP_002797047.1|  phosphoribulokinase                                482   6e-164   
ref|WP_006511669.1|  uridine kinase                                     482   7e-164   
ref|WP_012165158.1|  phosphoribulokinase                                482   7e-164   
ref|WP_024124948.1|  phosphoribulokinase Prk                            482   8e-164   
ref|WP_008179669.1|  phosphoribulokinase                                482   8e-164   
ref|WP_017303295.1|  phosphoribulokinase                                482   9e-164   
dbj|BAA96253.1|  phosphoribulokinase                                    482   1e-163   Synechococcus elongatus PCC 7942
ref|WP_016517207.1|  Uridine kinase                                     481   1e-163   
ref|WP_011434422.1|  phosphoribulokinase                                481   1e-163   
ref|WP_010873078.1|  phosphoribulokinase                                481   2e-163   
ref|WP_007353376.1|  MULTISPECIES: phosphoribulokinase                  481   2e-163   
ref|WP_019498279.1|  phosphoribulokinase                                481   3e-163   
ref|WP_026786374.1|  phosphoribulokinase                                481   3e-163   
sp|P37101.1|KPPR_SYNY3  RecName: Full=Phosphoribulokinase; Short=...    480   4e-163   Synechocystis sp. PCC 6803
ref|WP_018399211.1|  phosphoribulokinase                                480   4e-163   
ref|WP_002776450.1|  phosphoribulokinase                                480   4e-163   
gb|KEI66144.1|  Prk                                                     480   5e-163   
ref|WP_028947748.1|  phosphoribulokinase                                480   5e-163   
ref|WP_015957128.1|  phosphoribulokinase                                479   1e-162   
dbj|BAP18282.1|  phosphoribulokinase                                    479   1e-162   
ref|WP_015135454.1|  phosphoribulokinase                                479   1e-162   
ref|WP_026794224.1|  MULTISPECIES: phosphoribulokinase                  479   1e-162   
ref|WP_011057751.1|  phosphoribulokinase                                478   3e-162   
ref|WP_017711931.1|  phosphoribulokinase                                478   3e-162   
ref|WP_007311685.1|  phosphoribulokinase                                478   3e-162   
ref|WP_015146554.1|  uridine kinase                                     478   4e-162   
ref|WP_008276485.1|  phosphoribulokinase                                478   4e-162   
ref|WP_017651923.1|  phosphoribulokinase                                478   5e-162   
ref|WP_009344599.1|  phosphoribulokinase                                476   2e-161   
ref|WP_019504595.1|  phosphoribulokinase                                475   3e-161   
ref|WP_006275609.1|  phosphoribulokinase                                475   5e-161   
ref|WP_013320530.1|  phosphoribulokinase                                475   6e-161   
ref|WP_011317639.1|  phosphoribulokinase                                474   8e-161   
ref|WP_010998262.1|  phosphoribulokinase                                474   8e-161   
ref|WP_017287228.1|  phosphoribulokinase                                474   2e-160   
ref|WP_013193002.1|  phosphoribulokinase                                472   9e-160   
ref|WP_015163401.1|  phosphoribulokinase                                471   2e-159   
ref|WP_026733812.1|  phosphoribulokinase                                471   2e-159   
ref|WP_015189197.1|  phosphoribulokinase                                471   3e-159   
ref|WP_040932417.1|  phosphoribulokinase                                471   3e-159   
ref|WP_017316736.1|  phosphoribulokinase                                471   3e-159   
ref|WP_012409283.1|  phosphoribulokinase                                470   4e-159   
ref|WP_039713238.1|  phosphoribulokinase                                470   5e-159   
ref|WP_015118896.1|  uridine kinase                                     469   6e-159   
ref|WP_015111866.1|  phosphoribulokinase                                469   1e-158   
ref|WP_039741864.1|  phosphoribulokinase                                469   1e-158   
ref|WP_015137356.1|  uridine kinase                                     469   1e-158   
ref|WP_016876433.1|  phosphoribulokinase                                469   1e-158   
ref|WP_015153059.1|  phosphoribulokinase                                469   1e-158   
ref|WP_017328005.1|  phosphoribulokinase                                468   4e-158   
ref|WP_026720815.1|  phosphoribulokinase                                468   5e-158   
ref|WP_011430121.1|  phosphoribulokinase                                467   5e-158   
ref|WP_015208881.1|  uridine kinase                                     467   6e-158   
ref|WP_039203945.1|  phosphoribulokinase                                467   8e-158   
ref|WP_009459579.1|  MULTISPECIES: phosphoribulokinase                  466   1e-157   
ref|WP_036533346.1|  phosphoribulokinase                                466   1e-157   
ref|WP_035158114.1|  phosphoribulokinase                                466   2e-157   
ref|WP_016869826.1|  phosphoribulokinase                                466   2e-157   
ref|WP_017312088.1|  phosphoribulokinase                                465   4e-157   
gb|KIJ82542.1|  phosphoribulokinase                                     465   4e-157   
ref|WP_015129088.1|  phosphoribulokinase                                465   5e-157   
ref|WP_016860626.1|  phosphoribulokinase                                465   5e-157   
ref|WP_036477080.1|  phosphoribulokinase                                464   6e-157   
ref|WP_041040515.1|  phosphoribulokinase                                464   8e-157   
ref|WP_029635046.1|  phosphoribulokinase [                              464   9e-157   
ref|WP_015080196.1|  phosphoribulokinase                                464   1e-156   
ref|WP_017322257.1|  phosphoribulokinase                                464   1e-156   
ref|WP_028083118.1|  phosphoribulokinase                                464   1e-156   
ref|WP_015214457.1|  phosphoribulokinase                                464   1e-156   
ref|WP_027838886.1|  phosphoribulokinase                                464   1e-156   
gb|AFK48786.1|  unknown                                                 462   2e-156   
ref|WP_028089692.1|  phosphoribulokinase                                463   2e-156   
ref|WP_027403287.1|  phosphoribulokinase                                463   2e-156   
gb|KIE10320.1|  phosphoribulokinase                                     462   4e-156   
ref|WP_017745122.1|  phosphoribulokinase                                462   5e-156   
ref|WP_016951275.1|  phosphoribulokinase                                462   9e-156   
ref|WP_037222658.1|  phosphoribulokinase                                461   9e-156   
ref|WP_006196140.1|  phosphoribulokinase                                460   4e-155   
ref|WP_019493252.1|  phosphoribulokinase                                459   1e-154   
ref|WP_015160798.1|  uridine kinase                                     459   1e-154   
ref|WP_008231892.1|  Phosphoribulokinase                                459   1e-154   
ref|WP_015199409.1|  phosphoribulokinase                                458   2e-154   
ref|WP_009631218.1|  uridine kinase                                     457   3e-154   
emb|CAA69902.2|  phosphoribulokinase                                    452   4e-151   Odontella sinensis
ref|XP_002186456.1|  phosphoribulokinase                                452   4e-151   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005535773.1|  phosphoribulokinase                                453   7e-151   
gb|ACO92720.1|  phosphoribulokinase                                     443   3e-150   Physaria fendleri
gb|ACO92701.1|  phosphoribulokinase                                     442   6e-150   Crucihimalaya mollissima
gb|AAX13959.1|  chloroplast phosphoribulokinase                         448   7e-150   Pavlova lutheri
gb|ACO92718.1|  phosphoribulokinase                                     442   1e-149   Physaria fendleri
gb|ACO92685.1|  phosphoribulokinase                                     441   2e-149   Olimarabidopsis cabulica
gb|ACO92721.1|  phosphoribulokinase                                     441   2e-149   Physaria fendleri
gb|ACO92719.1|  phosphoribulokinase                                     441   3e-149   Physaria fendleri
gb|ACO92707.1|  phosphoribulokinase                                     440   4e-149   Boechera holboellii
gb|ACO92722.1|  phosphoribulokinase                                     440   6e-149   Physaria fendleri
gb|ACO92681.1|  phosphoribulokinase                                     439   2e-148   Arabidopsis lyrata subsp. lyrata
gb|ACO92690.1|  phosphoribulokinase                                     438   2e-148   Capsella bursa-pastoris
gb|ACO92715.1|  phosphoribulokinase                                     438   2e-148   Lepidium apetalum
gb|ACO92687.1|  phosphoribulokinase                                     438   2e-148   Olimarabidopsis cabulica
gb|ACO92698.1|  phosphoribulokinase                                     438   3e-148   Crucihimalaya mollissima
gb|AAX13965.1|  chloroplast phosphoribulokinase                         444   5e-148   Chondrus crispus [carageen]
gb|ACO92717.1|  phosphoribulokinase                                     437   8e-148   
gb|ACO92706.1|  phosphoribulokinase                                     437   9e-148   
ref|XP_005716677.1|  phosphoribulokinase                                442   2e-147   
gb|ACO92694.1|  phosphoribulokinase                                     436   2e-147   
gb|ACO92713.1|  phosphoribulokinase                                     436   2e-147   
gb|ACO92686.1|  phosphoribulokinase                                     436   2e-147   
gb|ACO92680.1|  phosphoribulokinase                                     436   3e-147   
gb|ACO92689.1|  phosphoribulokinase                                     436   3e-147   
gb|ACO92709.1|  phosphoribulokinase                                     435   5e-147   
gb|ACO92714.1|  phosphoribulokinase                                     434   1e-146   
emb|CBI26527.3|  unnamed protein product                                436   1e-146   
gb|ACO92695.1|  phosphoribulokinase                                     432   4e-146   
ref|XP_002289281.1|  phosphoribulokinase                                435   1e-144   
ref|XP_005827680.1|  phosphoribulokinase                                428   3e-141   
gb|AAX13960.1|  chloroplast phosphoribulokinase                         425   9e-141   
gb|EWM21954.1|  phosphoribulokinase                                     424   2e-139   
dbj|BAL03262.1|  phosphoribulokinase                                    414   2e-137   
ref|WP_007306562.1|  phosphoribulokinase                                409   3e-136   
gb|AAX13964.1|  chloroplast phosphoribulokinase                         412   1e-134   
gb|ACJ84727.1|  unknown                                                 402   3e-134   
dbj|BAL03263.1|  phosphoribulokinase                                    403   3e-133   
gb|ABK32883.1|  phosphoribulokinase                                     395   9e-132   
gb|ABK33038.1|  phosphoribulokinase                                     394   2e-131   
gb|ABK32903.1|  phosphoribulokinase                                     394   3e-131   
gb|ABK32996.1|  phosphoribulokinase                                     393   4e-131   
gb|ABK32893.1|  phosphoribulokinase                                     392   8e-131   
gb|ABK32882.1|  phosphoribulokinase                                     392   1e-130   
gb|ABK32949.1|  phosphoribulokinase                                     391   3e-130   
ref|XP_005767208.1|  hypothetical protein EMIHUDRAFT_432636             394   5e-129   
gb|AAX13966.1|  chloroplast phosphoribulokinase                         394   8e-129   
gb|ABK32930.1|  phosphoribulokinase                                     382   8e-127   
gb|AAW79322.1|  chloroplast phosphoribulokinase                         387   5e-126   
emb|CCC15103.1|  phosphoribulokinase                                    385   8e-125   
gb|ABK32931.1|  phosphoribulokinase                                     374   2e-123   
gb|ABK32976.1|  phosphoribulokinase                                     363   1e-119   
gb|ABK32963.1|  phosphoribulokinase                                     359   4e-118   
gb|ABK32961.1|  phosphoribulokinase                                     357   2e-117   
ref|XP_009626327.1|  PREDICTED: phosphoribulokinase, chloroplastic      357   4e-117   
ref|WP_023171245.1|  phosphoribulokinase                                347   3e-111   
gb|ABN43423.1|  phosphoribulokinase                                     337   5e-109   
gb|AAX13967.1|  chloroplast phosphoribulokinase                         345   1e-108   
gb|AAP79209.1|  phosphoribulokinase                                     345   4e-108   
gb|AFK43330.1|  unknown                                                 334   3e-107   
ref|XP_010463062.1|  PREDICTED: phosphoribulokinase, chloroplasti...    331   5e-107   
gb|ABK55696.1|  chloroplast phosphoribulokinase                         328   4e-106   
ref|WP_011142293.1|  phosphoribulokinase                                334   5e-106   
dbj|BAL03261.1|  phosphoribulokinase                                    330   2e-104   
gb|ACO92704.1|  phosphoribulokinase                                     318   2e-102   
tpg|DAA36215.1|  TPA: hypothetical protein ZEAMMB73_584099              321   3e-102   
emb|CDY35538.1|  BnaA05g16480D                                          322   2e-101   
gb|ACO92703.1|  phosphoribulokinase                                     313   1e-100   
gb|ACO92712.1|  phosphoribulokinase                                     308   2e-98    
gb|AAX13962.1|  chloroplast phosphoribulokinase                         317   4e-98    
gb|ACO92711.1|  phosphoribulokinase                                     306   5e-98    
dbj|BAL03264.1|  phosphoribulokinase                                    311   2e-97    
gb|AHF54997.1|  phosphoribulokinase                                     305   3e-97    
gb|AAX13963.1|  chloroplast phosphoribulokinase 2                       314   3e-97    
gb|ACO92710.1|  phosphoribulokinase                                     304   4e-97    
gb|AHF54998.1|  phosphoribulokinase                                     303   2e-96    
gb|AHF55028.1|  phosphoribulokinase                                     302   2e-96    
gb|AAX13961.1|  chloroplast phosphoribulokinase                         311   3e-96    
gb|AHF55010.1|  phosphoribulokinase                                     302   3e-96    
gb|AHF55022.1|  phosphoribulokinase                                     302   4e-96    
dbj|BAL03265.1|  phosphoribulokinase                                    308   4e-96    
gb|AHF55040.1|  phosphoribulokinase                                     301   6e-96    
gb|AHF55034.1|  phosphoribulokinase                                     299   5e-95    
gb|AHF55041.1|  phosphoribulokinase                                     298   5e-95    
gb|AHF55049.1|  phosphoribulokinase                                     298   1e-94    
gb|AHF55060.1|  phosphoribulokinase                                     288   5e-91    
gb|AAW79321.1|  chloroplast phosphoribulokinase                         294   2e-89    
gb|ABA55537.1|  chloroplast phosphoribulokinase                         292   1e-88    
gb|AHF55009.1|  phosphoribulokinase                                     280   8e-88    
gb|ACN85353.1|  phosphoribulokinase-like protein                        278   6e-87    
gb|AHF55042.1|  phosphoribulokinase                                     276   2e-86    
gb|AHK23661.1|  chloroplast phosphoribulokinase                         283   2e-85    
gb|ACN85375.1|  phosphoribulokinase-like protein                        267   4e-83    
gb|ACN85362.1|  phosphoribulokinase-like protein                        266   1e-82    
gb|ACN85356.1|  phosphoribulokinase-like protein                        266   2e-82    
gb|ACN85376.1|  phosphoribulokinase-like protein                        266   2e-82    
gb|ACN85379.1|  phosphoribulokinase-like protein                        266   2e-82    
gb|ACN85349.1|  phosphoribulokinase-like protein                        265   2e-82    
gb|ACN85377.1|  phosphoribulokinase-like protein                        265   2e-82    
gb|ACN85374.1|  phosphoribulokinase-like protein                        265   4e-82    
gb|ACN85350.1|  phosphoribulokinase-like protein                        265   5e-82    
gb|ACN85357.1|  phosphoribulokinase-like protein                        264   9e-82    
gb|ACN85370.1|  phosphoribulokinase-like protein                        263   1e-81    
gb|ACN85373.1|  phosphoribulokinase-like protein                        263   2e-81    
gb|ACN85369.1|  phosphoribulokinase-like protein                        263   2e-81    
gb|ACN85345.1|  phosphoribulokinase-like protein                        262   3e-81    
gb|ACN85387.1|  phosphoribulokinase-like protein                        262   4e-81    
gb|ACN85358.1|  phosphoribulokinase-like protein                        262   5e-81    
gb|ACN85360.1|  phosphoribulokinase-like protein                        262   5e-81    
gb|ACN85359.1|  phosphoribulokinase-like protein                        261   1e-80    
gb|ACN85372.1|  phosphoribulokinase-like protein                        261   1e-80    
gb|ACN85364.1|  phosphoribulokinase-like protein                        261   1e-80    
gb|ACN85347.1|  phosphoribulokinase-like protein                        260   2e-80    
gb|ACN85363.1|  phosphoribulokinase-like protein                        260   2e-80    
gb|ACN85386.1|  phosphoribulokinase-like protein                        260   3e-80    
gb|ACN85367.1|  phosphoribulokinase-like protein                        260   3e-80    
gb|ACN85354.1|  phosphoribulokinase-like protein                        259   4e-80    
gb|ACN85346.1|  phosphoribulokinase-like protein                        259   5e-80    
gb|ACN85385.1|  phosphoribulokinase-like protein                        259   5e-80    
gb|ACN85381.1|  phosphoribulokinase-like protein                        258   1e-79    
gb|ACN85384.1|  phosphoribulokinase-like protein                        258   1e-79    
gb|ACN85351.1|  phosphoribulokinase-like protein                        258   1e-79    
gb|AAX92708.1|  phosphoribulokinase                                     258   2e-79    
gb|ACN85371.1|  phosphoribulokinase-like protein                        258   2e-79    
gb|ACN85380.1|  phosphoribulokinase-like protein                        257   4e-79    
gb|ACN85352.1|  phosphoribulokinase-like protein                        257   4e-79    
gb|ACN85388.1|  phosphoribulokinase-like protein                        256   1e-78    
ref|WP_015203028.1|  Phosphoribulokinase                                249   2e-75    
gb|AGG36408.1|  phosphoribulokinase                                     239   1e-72    
gb|ACN27238.1|  unknown                                                 230   4e-69    
gb|EJK69871.1|  hypothetical protein THAOC_08831                        232   6e-69    
gb|ADV03591.1|  phosphoribulokinase                                     215   1e-63    
gb|ADV03631.1|  phosphoribulokinase                                     213   9e-63    
gb|ABD58897.1|  chloroplast phosphoribulokinase                         209   6e-61    
gb|AIE44321.1|  putative phosphoribulose kinase                         197   1e-56    
gb|AIE44312.1|  putative phosphoribulose kinase                         196   2e-56    
ref|WP_013328598.1|  uridine kinase                                     199   1e-54    
gb|AEC47254.1|  phosphoribulokinase-like protein 2                      188   2e-53    
gb|AEC47252.1|  phosphoribulokinase-like protein 2                      185   2e-52    
gb|AEC47255.1|  phosphoribulokinase-like protein 2                      185   2e-52    
gb|AEC47265.1|  phosphoribulokinase-like protein 2                      185   3e-52    
emb|CAJ97446.1|  phosphoribulokinase                                    184   5e-52    
gb|AEC47249.1|  phosphoribulokinase-like protein 2                      184   6e-52    
gb|AAV54005.1|  phosphoribulokinase-like protein 2                      184   6e-52    
gb|AAV53998.1|  phosphoribulokinase-like protein 2                      183   1e-51    
gb|AAV53982.1|  phosphoribulokinase-like protein 2                      183   1e-51    
gb|AAV54000.1|  phosphoribulokinase-like protein 2                      182   1e-51    
gb|ACH91016.1|  phosphoribulokinase                                     182   2e-51    
gb|AAV73949.1|  phosphoribulokinase-like protein 2                      182   3e-51    
gb|AAV54024.1|  phosphoribulokinase-like protein 2                      181   4e-51    
ref|WP_004039732.1|  uridine kinase                                     189   6e-51    
gb|AAV53983.1|  phosphoribulokinase-like protein 2                      181   6e-51    
gb|AEC47241.1|  phosphoribulokinase-like protein 2                      180   1e-50    
gb|AAV65717.2|  phosphoribulokinase-like protein 2                      180   1e-50    
gb|AAV54021.1|  phosphoribulokinase-like protein 2                      180   2e-50    
gb|AAV53988.1|  phosphoribulokinase-like protein 2                      179   2e-50    
gb|AEC47258.1|  phosphoribulokinase-like protein 2                      179   3e-50    
gb|ACH91017.1|  phosphoribulokinase                                     179   3e-50    
gb|AAV54020.1|  phosphoribulokinase-like protein 2                      179   3e-50    
ref|WP_014866231.1|  uridine kinase                                     187   4e-50    
gb|AAV54016.1|  phosphoribulokinase-like protein 2                      178   9e-50    
gb|AAV54022.1|  phosphoribulokinase-like protein 2                      178   1e-49    
gb|AAV53971.1|  phosphoribulokinase-like protein 2                      177   1e-49    
gb|AEC47259.1|  phosphoribulokinase-like protein 2                      177   1e-49    
gb|ABD51963.1|  chloroplast phosphoribulokinase                         180   1e-49    
gb|AEC47242.1|  phosphoribulokinase-like protein 2                      176   4e-49    
gb|AAV54003.1|  phosphoribulokinase-like protein 2                      176   6e-49    
gb|AAV53970.1|  phosphoribulokinase-like protein 2                      175   8e-49    
gb|AEC47247.1|  phosphoribulokinase-like protein 2                      175   9e-49    
gb|AAX62796.1|  phosphoribulokinase-like protein 2                      174   1e-48    
gb|AAV54009.1|  phosphoribulokinase-like protein 2                      174   2e-48    
gb|AAV53977.1|  phosphoribulokinase-like protein 2                      174   2e-48    
gb|AAV54002.1|  phosphoribulokinase-like protein 2                      174   2e-48    
gb|AEC47240.1|  phosphoribulokinase-like protein 2                      174   3e-48    
gb|AAV53967.1|  phosphoribulokinase-like protein 2                      173   4e-48    
gb|AAV54023.1|  phosphoribulokinase-like protein 2                      172   8e-48    
gb|AAV54013.1|  phosphoribulokinase-like protein 2                      172   1e-47    
gb|AEC47244.1|  phosphoribulokinase-like protein 2                      171   2e-47    
gb|AEC47230.1|  phosphoribulokinase-like protein 2                      171   2e-47    
gb|AAV53995.1|  phosphoribulokinase-like protein 2                      171   2e-47    
gb|AAV53994.1|  phosphoribulokinase-like protein 2                      171   2e-47    
gb|AEC47238.1|  phosphoribulokinase-like protein 2                      171   2e-47    
gb|AEC47264.1|  phosphoribulokinase-like protein 2                      171   3e-47    
gb|AAV53999.1|  phosphoribulokinase-like protein 2                      170   6e-47    
ref|WP_022604256.1|  uridine kinase                                     177   6e-47    
ref|WP_011696613.1|  uridine kinase                                     177   1e-46    
gb|ADD60148.1|  phosphoribulokinase                                     170   1e-46    
gb|ADD60144.1|  phosphoribulokinase                                     169   1e-46    
gb|AAV53996.1|  phosphoribulokinase-like protein 2                      169   1e-46    
ref|WP_013719525.1|  uridine kinase                                     177   2e-46    
gb|AEC47267.1|  phosphoribulokinase-like protein 2                      168   2e-46    
gb|AEC47257.1|  phosphoribulokinase-like protein 2                      168   3e-46    
gb|AAV53963.1|  phosphoribulokinase-like protein 2                      168   3e-46    
gb|KDE55592.1|  uridine kinase                                          176   3e-46    
gb|AEC47266.1|  phosphoribulokinase-like protein 2                      167   8e-46    
gb|AAV53987.1|  phosphoribulokinase-like protein 2                      166   2e-45    
ref|WP_007358510.1|  MULTISPECIES: phosphoribulokinase                  173   2e-45    
ref|WP_014585763.1|  uridine kinase                                     172   6e-45    
gb|AEC47231.1|  phosphoribulokinase-like protein 2                      164   6e-45    
ref|WP_011844769.1|  uridine kinase                                     173   6e-45    
ref|WP_008083905.1|  uridine kinase                                     172   9e-45    
gb|AAV53974.1|  phosphoribulokinase-like protein 2                      163   1e-44    
gb|AAV53980.1|  phosphoribulokinase-like protein 2                      163   2e-44    
ref|WP_008083176.1|  uridine kinase                                     170   3e-44    
gb|ABY21477.1|  phosphoribulokinase-like protein 2                      162   3e-44    
gb|ACN85361.1|  phosphoribulokinase-like protein                        162   4e-44    
ref|WP_037913595.1|  phosphoribulokinase                                166   4e-44    
gb|ABY21458.1|  phosphoribulokinase-like protein 2                      161   7e-44    
gb|ABY21476.1|  phosphoribulokinase-like protein 2                      160   1e-43    
ref|WP_015286790.1|  uridine kinase                                     168   2e-43    
ref|WP_006198589.1|  phosphoribulokinase                                168   2e-43    
ref|WP_027843939.1|  phosphoribulokinase                                168   2e-43    
gb|AEC47243.1|  phosphoribulokinase-like protein 2                      160   2e-43    
emb|CAP16667.1|  phosphoribulokinase-like protein 2                     160   3e-43    
gb|ABY21460.1|  phosphoribulokinase-like protein 2                      160   3e-43    
gb|ABY21462.1|  phosphoribulokinase-like protein 2                      160   3e-43    
gb|AAV73948.1|  phosphoribulokinase-like protein 2                      160   3e-43    
gb|ABY21471.1|  phosphoribulokinase-like protein 2                      159   3e-43    
gb|ABY21469.1|  phosphoribulokinase-like protein 2                      159   4e-43    
ref|WP_018399954.1|  phosphoribulokinase                                167   5e-43    
ref|WP_039887089.1|  phosphoribulokinase                                166   5e-43    
gb|ABY21457.1|  phosphoribulokinase-like protein 2                      159   5e-43    
ref|WP_013076786.1|  phosphoribulokinase                                166   6e-43    
gb|ABY21481.1|  phosphoribulokinase-like protein 2                      158   9e-43    
ref|WP_036531482.1|  phosphoribulokinase                                165   2e-42    
ref|WP_016950339.1|  phosphoribulokinase                                165   2e-42    
ref|WP_015189651.1|  phosphoribulokinase                                165   2e-42    
ref|WP_015139485.1|  uridine kinase                                     165   2e-42    
gb|ABY21482.1|  phosphoribulokinase-like protein 2                      157   2e-42    
gb|EGK87970.1|  Phosphoribulokinase                                     166   2e-42    
gb|ABY21463.1|  phosphoribulokinase-like protein 2                      157   3e-42    
ref|WP_015080601.1|  phosphoribulokinase                                164   3e-42    
gb|ABY21466.1|  phosphoribulokinase-like protein 2                      157   3e-42    
ref|WP_015122615.1|  uridine kinase                                     164   4e-42    
ref|WP_015129529.1|  phosphoribulokinase/uridine kinase                 164   5e-42    
ref|WP_015179311.1|  Phosphoribulokinase                                164   5e-42    
gb|ABY21484.1|  phosphoribulokinase-like protein 2                      156   5e-42    
gb|ABY21465.1|  phosphoribulokinase-like protein 2                      155   8e-42    



>ref|XP_006352922.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Solanum tuberosum]
Length=405

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/403 (89%), Positives = 379/403 (94%), Gaps = 8/403 (2%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKK----SARKVGISCAAAGGDGKT  392
             MAVCTVYT QSL+S+CSISTP+K+H    Q+QV  + K     +R   I+C+A+  + KT
Sbjct  1     MAVCTVYTAQSLNSSCSISTPSKSHLGFHQKQVIFFTKRSTNKSRNTVITCSASDAE-KT  59

Query  393   VVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRT  572
             VVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRT
Sbjct  60    VVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRT  119

Query  573   GRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIE  752
             GRKEKGVTALDPRANDFDLMYEQVKA+K+G AVDKPIYNHV+GLLDPPE+ KPPKILVIE
Sbjct  120   GRKEKGVTALDPRANDFDLMYEQVKAIKDGVAVDKPIYNHVSGLLDPPEVIKPPKILVIE  179

Query  753   GLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAY  932
             GLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAY
Sbjct  180   GLHPMYDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAY  239

Query  933   IDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCG  1112
             IDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+F+PVYLFDEGSTISWIPCG
Sbjct  240   IDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKNFNPVYLFDEGSTISWIPCG  299

Query  1113  RKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQ  1292
             RKLTCSYPGIKFTYGPDTYFG+EVSVLEMDGQFDRLDELIYVESHLS+LS+KFYGEVTQQ
Sbjct  300   RKLTCSYPGIKFTYGPDTYFGNEVSVLEMDGQFDRLDELIYVESHLSNLSSKFYGEVTQQ  359

Query  1293  MLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             MLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVA+RA APV A
Sbjct  360   MLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVASRAGAPVTA  402



>ref|XP_009613160.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=406

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/405 (88%), Positives = 378/405 (93%), Gaps = 11/405 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVY------KKSARKVGISCAAAGGDG  386
             MAV TVYT QSL+STCSISTP+K+H    Q+QV  Y      ++S+    I+C++A  D 
Sbjct  1     MAVSTVYTAQSLNSTCSISTPSKSHLGFHQKQVIFYTKLRTNRRSSSTSVITCSSA--DE  58

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD
Sbjct  59    KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  118

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             RTGRKEKGVTALDPRANDFDLMYEQVKA+KEG AV+KPIYNHV+GLLDPPEL KPPKILV
Sbjct  119   RTGRKEKGVTALDPRANDFDLMYEQVKAIKEGIAVEKPIYNHVSGLLDPPELIKPPKILV  178

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHPMYD RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD
Sbjct  179   IEGLHPMYDERVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  238

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGV +F+PVYLFDEGSTISWIP
Sbjct  239   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVNNFNPVYLFDEGSTISWIP  298

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI F+YGPDTYFG+EVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEVT
Sbjct  299   CGRKLTCSYPGINFSYGPDTYFGNEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVT  358

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVA+RAA PV+A
Sbjct  359   QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVASRAATPVQA  403



>ref|XP_009783382.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Nicotiana 
sylvestris]
Length=407

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/408 (88%), Positives = 379/408 (93%), Gaps = 11/408 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKKSARKVG-------ISCAAAGGD  383
             MAV TVYT+QSL+STCSIST TKT+    Q+QV  Y  S +K         I+C++A  +
Sbjct  1     MAVSTVYTIQSLNSTCSISTSTKTNLGFHQKQVIFYTTSTKKYSTQKFNTFITCSSAD-E  59

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL
Sbjct  60    TKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  119

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKEKGVTALDPRANDFDLMYEQVKALK G AV+KPIYNHV+GLLDPPEL KPPKIL
Sbjct  120   DRTGRKEKGVTALDPRANDFDLMYEQVKALKSGIAVEKPIYNHVSGLLDPPELIKPPKIL  179

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPM+D RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF
Sbjct  180   VIEGLHPMFDERVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  239

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+F+PVYLFDEGSTISWI
Sbjct  240   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFNPVYLFDEGSTISWI  299

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKF+YGPDTYFG+EVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV
Sbjct  300   PCGRKLTCSYPGIKFSYGPDTYFGNEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  359

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             TQQMLKHADFPGS+NGTGFFQTIVGLKIRDLYEQIVA++AA PV AKA
Sbjct  360   TQQMLKHADFPGSSNGTGFFQTIVGLKIRDLYEQIVASKAAEPVAAKA  407



>gb|KHG06063.1| hypothetical protein F383_32050 [Gossypium arboreum]
Length=408

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/407 (88%), Positives = 375/407 (92%), Gaps = 13/407 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKKSAR--KVG------ISCAAAGG  380
             MAVC VYT QSL+STCSISTP+KTHF      +  Y+ S R  K G      I+C+A  G
Sbjct  1     MAVCPVYTTQSLNSTCSISTPSKTHFSSHHNHLVFYRTSKRTSKRGGSSSCVITCSA--G  58

Query  381   DGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  560
             D +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS
Sbjct  59    DSQTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  118

Query  561   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKI  740
             LDRTGRKEKGVTALDPRANDFDLMYEQVKALK G AVDKPIYNHVTGLLDPPEL KPPKI
Sbjct  119   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKSGIAVDKPIYNHVTGLLDPPELIKPPKI  178

Query  741   LVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  920
             LVIEGLHPM+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD
Sbjct  179   LVIEGLHPMFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  238

Query  921   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             FDA+IDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGV+HFSPVYLFDEGSTISW
Sbjct  239   FDAFIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVEHFSPVYLFDEGSTISW  298

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
             IPCGRKLTCSYPGIKF+YGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGE
Sbjct  299   IPCGRKLTCSYPGIKFSYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGE  358

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             VTQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQI A + AAP++A
Sbjct  359   VTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQITAIKTAAPLQA  405



>ref|XP_011018451.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Populus euphratica]
Length=405

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/402 (88%), Positives = 372/402 (93%), Gaps = 6/402 (1%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVY---KKSARKVGISCAAAGGDGKTV  395
             MAVCTVYT QSL+STCSISTPTKTH    Q+ V  Y   KK++++   +      D +TV
Sbjct  1     MAVCTVYTTQSLNSTCSISTPTKTHLGFNQKHVVFYSSNKKTSKRASSAVITCSADTQTV  60

Query  396   VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTG  575
             VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSLDRTG
Sbjct  61    VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTG  120

Query  576   RKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEG  755
             RKEKGVTALDPRANDFDLMY+QVKA+K+G AV+KPIYNHVTGLLDPPEL KPPKILVIEG
Sbjct  121   RKEKGVTALDPRANDFDLMYDQVKAIKDGIAVEKPIYNHVTGLLDPPELIKPPKILVIEG  180

Query  756   LHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI  935
             LHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI
Sbjct  181   LHPMYDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI  240

Query  936   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGR  1115
             DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK FSPVYLFDEGS ISWIPCGR
Sbjct  241   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKFFSPVYLFDEGSAISWIPCGR  300

Query  1116  KLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQM  1295
             KLTCSYPGIKF+YGPDTY+GHEVS+LEMDGQFDRLDELIYVESHLS+LSTKFYGEVTQQM
Sbjct  301   KLTCSYPGIKFSYGPDTYYGHEVSILEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQM  360

Query  1296  LKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             LKHADFPGSNNGTG FQTIVGLKIRDL+EQI+A+RA  PVEA
Sbjct  361   LKHADFPGSNNGTGLFQTIVGLKIRDLFEQIIASRAKTPVEA  402



>ref|XP_010276766.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Nelumbo nucifera]
Length=407

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/407 (88%), Positives = 379/407 (93%), Gaps = 14/407 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVY---KKSARKVG-----ISCAAAGG  380
             MA+CTVYT  SL+S+CSISTPTKT     Q+QVF Y   KK++R+       I+C+A   
Sbjct  1     MAMCTVYTAHSLNSSCSISTPTKTQLGFHQKQVFFYSTVKKTSRRGSSNSSEITCSA---  57

Query  381   DGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  560
             + KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS
Sbjct  58    ESKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  117

Query  561   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKI  740
             LDRTGRKEKGVTALDP+AN+FDLMYEQVKALKEG AV+KPIYNHVTGLLDPPEL KPPKI
Sbjct  118   LDRTGRKEKGVTALDPKANNFDLMYEQVKALKEGIAVEKPIYNHVTGLLDPPELIKPPKI  177

Query  741   LVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  920
             LVIEGLHPM+D RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD
Sbjct  178   LVIEGLHPMFDPRVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  237

Query  921   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK FSPVYLFDEGSTISW
Sbjct  238   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKFFSPVYLFDEGSTISW  297

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
             IPCGRKLTCSYPGIKF YGP+TY+GHEVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGE
Sbjct  298   IPCGRKLTCSYPGIKFFYGPETYYGHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGE  357

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             VTQQMLKHADFPGSNNGTG FQTI+GLKIRDL+EQIVA++AAAP+EA
Sbjct  358   VTQQMLKHADFPGSNNGTGLFQTIIGLKIRDLFEQIVASKAAAPLEA  404



>ref|XP_002303455.1| Phosphoribulokinase family protein [Populus trichocarpa]
 gb|EEE78434.1| Phosphoribulokinase family protein [Populus trichocarpa]
Length=405

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/402 (87%), Positives = 371/402 (92%), Gaps = 6/402 (1%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVY---KKSARKVGISCAAAGGDGKTV  395
             MAVCTVYT QSL+STCSISTPTKTH    QR V  Y   KK+ ++   +      D +TV
Sbjct  1     MAVCTVYTTQSLNSTCSISTPTKTHLGFNQRHVVFYSTNKKTTKRASSAVITCSADTQTV  60

Query  396   VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTG  575
             VIGLAADSGCGKSTFMRRLTSVFGGAAEPP+GGNPDSNTLISD TTVICLDDYHSLDRTG
Sbjct  61    VIGLAADSGCGKSTFMRRLTSVFGGAAEPPRGGNPDSNTLISDTTTVICLDDYHSLDRTG  120

Query  576   RKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEG  755
             RKEKGVTALDPRAN+FDLMYEQVKA+K+G AV+KPIYNHVTGLLDPPEL KPPKILVIEG
Sbjct  121   RKEKGVTALDPRANNFDLMYEQVKAIKDGTAVEKPIYNHVTGLLDPPELIKPPKILVIEG  180

Query  756   LHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI  935
             LHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI
Sbjct  181   LHPMYDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI  240

Query  936   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGR  1115
             DPQKQYADAVIEVLPTQLIPDDNEGKVLRV+LIMKEGV+ FSPVYLFDEGS+ISWIPCGR
Sbjct  241   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVKLIMKEGVEFFSPVYLFDEGSSISWIPCGR  300

Query  1116  KLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQM  1295
             KLTCSYPGIKF+YGPD Y+GHEVSVLEMDGQFDRLDELIYVESHLS++STKFYGEVTQQM
Sbjct  301   KLTCSYPGIKFSYGPDAYYGHEVSVLEMDGQFDRLDELIYVESHLSNISTKFYGEVTQQM  360

Query  1296  LKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             LKHADFPGSNNGTG FQTIVGLKIRDL+EQIVA+RA  PVEA
Sbjct  361   LKHADFPGSNNGTGLFQTIVGLKIRDLFEQIVASRAKTPVEA  402



>ref|XP_002519002.1| phosphoribulose kinase, putative [Ricinus communis]
 gb|EEF43535.1| phosphoribulose kinase, putative [Ricinus communis]
Length=403

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/406 (88%), Positives = 374/406 (92%), Gaps = 11/406 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKKSARKVG-----ISCAAAGGDGK  389
             MA+CTVYT QSL+STCSISTP KTH    Q+QV  Y K   K       I+C+A   D +
Sbjct  1     MAICTVYTTQSLNSTCSISTPGKTHLGFNQKQVVFYSKRTNKRATSTSVITCSA--DDSQ  58

Query  390   TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDR  569
             TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSLDR
Sbjct  59    TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDR  118

Query  570   TGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVI  749
             TGRKEKGVTALDPRANDFDLMYEQVKA+K+G AV+KPIYNHVTGLLDPPEL KPPKILVI
Sbjct  119   TGRKEKGVTALDPRANDFDLMYEQVKAIKDGVAVEKPIYNHVTGLLDPPELIKPPKILVI  178

Query  750   EGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA  929
             EGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA
Sbjct  179   EGLHPMYDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA  238

Query  930   YIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPC  1109
             YIDPQKQYADAVIEVLPTQLIPDD EGKVLRVRLIMKEGVK+F+PVYLFDEGSTISWIPC
Sbjct  239   YIDPQKQYADAVIEVLPTQLIPDD-EGKVLRVRLIMKEGVKNFNPVYLFDEGSTISWIPC  297

Query  1110  GRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQ  1289
             GRKLTCSYPGIKF YGP+TYFGHEVSVLEMDGQFDRLDELIYVESHLS++STKFYGEVTQ
Sbjct  298   GRKLTCSYPGIKFFYGPETYFGHEVSVLEMDGQFDRLDELIYVESHLSNISTKFYGEVTQ  357

Query  1290  QMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             QMLKHADFPGSNNGTG FQTIVGLKIRDLYEQI+A++A  PVEAKA
Sbjct  358   QMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIIASKAKTPVEAKA  403



>ref|XP_011028086.1| PREDICTED: phosphoribulokinase, chloroplastic [Populus euphratica]
Length=405

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/402 (87%), Positives = 370/402 (92%), Gaps = 6/402 (1%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVY---KKSARKVGISCAAAGGDGKTV  395
             MAVCTVYT  SL+STCSISTPTKTH    QR V  Y   KK+ ++   +      D +TV
Sbjct  1     MAVCTVYTTPSLNSTCSISTPTKTHLGFNQRHVVFYSTNKKTTKRASSAVITCSTDTQTV  60

Query  396   VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTG  575
             VIGLAADSGCGKSTFMRRLTSVFGGAAEPP+GGNPDSNTLISD TTVICLDDYHSLDRTG
Sbjct  61    VIGLAADSGCGKSTFMRRLTSVFGGAAEPPRGGNPDSNTLISDTTTVICLDDYHSLDRTG  120

Query  576   RKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEG  755
             RKEKGVTALDPRAN+FDLMYEQVKA+K+G AV+KPIYNHVTGLLDPPEL KPPKILVIEG
Sbjct  121   RKEKGVTALDPRANNFDLMYEQVKAIKDGTAVEKPIYNHVTGLLDPPELIKPPKILVIEG  180

Query  756   LHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI  935
             LHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI
Sbjct  181   LHPMYDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI  240

Query  936   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGR  1115
             DPQKQYADAVIEVLPTQLIPDDNEGKVLRV+LIMKEGVK FSPVYLFDEGS+ISWIPCGR
Sbjct  241   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVKLIMKEGVKFFSPVYLFDEGSSISWIPCGR  300

Query  1116  KLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQM  1295
             KLTCSYPGIKF+YGPD Y+GHEVSVLEMDGQFDRLDELIYVESHLS++STKFYGEVTQQM
Sbjct  301   KLTCSYPGIKFSYGPDAYYGHEVSVLEMDGQFDRLDELIYVESHLSNISTKFYGEVTQQM  360

Query  1296  LKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             LKHADFPGSNNGTG FQTIVGLKIRDL+EQIVA+RA  PVEA
Sbjct  361   LKHADFPGSNNGTGLFQTIVGLKIRDLFEQIVASRAKTPVEA  402



>ref|XP_006368325.1| Phosphoribulokinase family protein [Populus trichocarpa]
 gb|ERP64894.1| Phosphoribulokinase family protein [Populus trichocarpa]
Length=405

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/402 (87%), Positives = 370/402 (92%), Gaps = 6/402 (1%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVY---KKSARKVGISCAAAGGDGKTV  395
             MAVCTVYT QSL+STCSISTPTKT     Q+ +  Y   KK++++   +      D +TV
Sbjct  1     MAVCTVYTTQSLNSTCSISTPTKTRLGFNQKHLVFYSSNKKTSKRASSAVITCSADTQTV  60

Query  396   VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTG  575
             VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSLDRTG
Sbjct  61    VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTG  120

Query  576   RKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEG  755
             RKEKGVTALDPRANDFDLMY+QVKA+K+G AV+KPIYNHVTGLLDPPEL KPPKILVIEG
Sbjct  121   RKEKGVTALDPRANDFDLMYDQVKAIKDGIAVEKPIYNHVTGLLDPPELIKPPKILVIEG  180

Query  756   LHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI  935
             LHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI
Sbjct  181   LHPMYDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI  240

Query  936   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGR  1115
             DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK FSPVYLFDEGS ISWIPCGR
Sbjct  241   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKFFSPVYLFDEGSAISWIPCGR  300

Query  1116  KLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQM  1295
             KLTCSYPGIKF+Y PDTY+GHEVS+LEMDGQFDRLDELIYVESHLS+LSTKFYGEVTQQM
Sbjct  301   KLTCSYPGIKFSYSPDTYYGHEVSILEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQM  360

Query  1296  LKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             LKHADFPGSNNGTG FQTIVGLKIRDL+EQI+A+RA  PVEA
Sbjct  361   LKHADFPGSNNGTGLFQTIVGLKIRDLFEQIIASRAKTPVEA  402



>ref|XP_004245935.1| PREDICTED: phosphoribulokinase, chloroplastic [Solanum lycopersicum]
Length=400

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/392 (90%), Positives = 370/392 (94%), Gaps = 5/392 (1%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKKSARKVGISCAAAGGDGKTVVIG  404
             MAVCTVYT QSL+S+CSISTP+K H    Q+QV    K  RK  ++C+A+    KTVVIG
Sbjct  1     MAVCTVYTAQSLNSSCSISTPSKPHLRFHQKQVIFLTKRPRK--MTCSASSDGEKTVVIG  58

Query  405   LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKE  584
             LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKE
Sbjct  59    LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKE  118

Query  585   KGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHP  764
             KGVTALDPRANDFDLMYEQVKA+K+G  VDKPIYNHV+GLLDPPE+ KPPKILVIEGLHP
Sbjct  119   KGVTALDPRANDFDLMYEQVKAIKDGVPVDKPIYNHVSGLLDPPEVIKPPKILVIEGLHP  178

Query  765   MYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQ  944
             MYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQ
Sbjct  179   MYDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQ  238

Query  945   KQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLT  1124
             KQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+F+PVYLFDEGSTISWIPCGRKLT
Sbjct  239   KQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKNFNPVYLFDEGSTISWIPCGRKLT  298

Query  1125  CSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKH  1304
             CSYPGIKFTYGPDTYFG+EVSVLEMDGQFDRLDELIYVESHLS+LS+KFYGEVTQQMLKH
Sbjct  299   CSYPGIKFTYGPDTYFGNEVSVLEMDGQFDRLDELIYVESHLSNLSSKFYGEVTQQMLKH  358

Query  1305  ADFPGSNNGTGFFQTIVGLKIRDLYEQIVATR  1400
             ADFPGSNNGTGFFQTIVGLKIRDLYEQIVA+R
Sbjct  359   ADFPGSNNGTGFFQTIVGLKIRDLYEQIVASR  390



>ref|XP_010261622.1| PREDICTED: phosphoribulokinase, chloroplastic [Nelumbo nucifera]
Length=407

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/407 (87%), Positives = 373/407 (92%), Gaps = 14/407 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVY---KKSARKVG-----ISCAAAGG  380
             MA+CTVYT  SL+STCSISTPTKT+    QRQVF Y   KK++R+       I+C+    
Sbjct  1     MAICTVYTTHSLNSTCSISTPTKTNLGFHQRQVFFYSTSKKTSRRGSANSSEITCSV---  57

Query  381   DGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  560
             + KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS
Sbjct  58    ESKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  117

Query  561   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKI  740
             LDRTGRKEKGVTALDPRAN+FDLMYEQVKALKEG AVDKPIYNHVTGLLDPPEL KPPKI
Sbjct  118   LDRTGRKEKGVTALDPRANNFDLMYEQVKALKEGIAVDKPIYNHVTGLLDPPELIKPPKI  177

Query  741   LVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  920
             LVIEGLHPMYD RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIE RKPD
Sbjct  178   LVIEGLHPMYDPRVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIETRKPD  237

Query  921   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             FD YIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK FSPVYLFDEGSTISW
Sbjct  238   FDTYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKFFSPVYLFDEGSTISW  297

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
             IPCGRKLTCSYPGIKF YGPDTYF +EVSVLEMDGQFDRLDEL+YVESHLS+LSTKFYGE
Sbjct  298   IPCGRKLTCSYPGIKFIYGPDTYFDNEVSVLEMDGQFDRLDELVYVESHLSNLSTKFYGE  357

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             VTQQMLKHADFPGS+NGTG FQTI+GLKIRDLYEQI +++AA  +EA
Sbjct  358   VTQQMLKHADFPGSSNGTGLFQTIIGLKIRDLYEQITSSQAAVSLEA  404



>ref|XP_002263724.1| PREDICTED: phosphoribulokinase, chloroplastic [Vitis vinifera]
Length=408

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/405 (86%), Positives = 374/405 (92%), Gaps = 9/405 (2%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKKSARKVGIS-CAAA-----GGDG  386
             MA+CTVYT QSL+STCS+S P K      Q+QV  + KS R+ G+S C ++      G+ 
Sbjct  1     MAICTVYTTQSLNSTCSVSKPAKPQLGFHQKQVVFFTKSRRRSGMSSCGSSVITCSAGEQ  60

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPP+GGNPDSNTLISD TTVICLDDYHSLD
Sbjct  61    RTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPRGGNPDSNTLISDTTTVICLDDYHSLD  120

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             RTGRKEKGVTALDPRANDFDLMYEQVKA+K+G AV+KPIYNHVTGLLDPPE  KPPKILV
Sbjct  121   RTGRKEKGVTALDPRANDFDLMYEQVKAIKDGIAVEKPIYNHVTGLLDPPETIKPPKILV  180

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHPMYDARVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD
Sbjct  181   IEGLHPMYDARVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  240

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGV +FSPVYLFDEGSTISWIP
Sbjct  241   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVTYFSPVYLFDEGSTISWIP  300

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI F+YGPDTY+GHEVSVLEMDGQFDRLDELIYVESHLS++STKFYGE+T
Sbjct  301   CGRKLTCSYPGINFSYGPDTYYGHEVSVLEMDGQFDRLDELIYVESHLSNISTKFYGEIT  360

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             QQ+LKH+DFPGSNNGTG FQTIVGLKIRDL+EQIVA+RAA P+EA
Sbjct  361   QQLLKHSDFPGSNNGTGLFQTIVGLKIRDLFEQIVASRAATPLEA  405



>ref|XP_007040771.1| Phosphoribulokinase [Theobroma cacao]
 gb|EOY25272.1| Phosphoribulokinase [Theobroma cacao]
Length=411

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/410 (86%), Positives = 375/410 (91%), Gaps = 16/410 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVY---KKSARKVG--------ISCAA  371
             MAVCTVYT QSL+STCSISTPTKTH    Q+QV  Y   K+++++          I+C+A
Sbjct  1     MAVCTVYTTQSLNSTCSISTPTKTHLGFHQKQVVFYSTGKRTSKRGSSSSGGPCVITCSA  60

Query  372   AGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDD  551
                D +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPP+GGNPDSNTLISDMTTVICLDD
Sbjct  61    V--DSQTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPRGGNPDSNTLISDMTTVICLDD  118

Query  552   YHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKP  731
             YHSLDRTGRKEKGVTALDPRAN+FDLMYEQVKALK G AVDKPIYNHVTGLLDPPEL KP
Sbjct  119   YHSLDRTGRKEKGVTALDPRANNFDLMYEQVKALKSGVAVDKPIYNHVTGLLDPPELIKP  178

Query  732   PKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR  911
             PKILVIEGLHPM+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR
Sbjct  179   PKILVIEGLHPMFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR  238

Query  912   KPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGST  1091
             KPDFDA+IDPQKQYADAVIEVLPTQLIP DNEGKVLRVRLIMKEGVKHFSPVYLFDEGST
Sbjct  239   KPDFDAFIDPQKQYADAVIEVLPTQLIPGDNEGKVLRVRLIMKEGVKHFSPVYLFDEGST  298

Query  1092  ISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKF  1271
             +SWIPCGRKLTCSYPGIKF YGPDTYFG+EVS+LEMDGQFDRLDELIYVESHLS++STKF
Sbjct  299   LSWIPCGRKLTCSYPGIKFHYGPDTYFGNEVSILEMDGQFDRLDELIYVESHLSNISTKF  358

Query  1272  YGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             YGEVTQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQI  ++ A P+EA
Sbjct  359   YGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQITTSKTATPLEA  408



>ref|XP_010056208.1| PREDICTED: phosphoribulokinase, chloroplastic [Eucalyptus grandis]
 gb|KCW72819.1| hypothetical protein EUGRSUZ_E01261 [Eucalyptus grandis]
Length=407

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/404 (86%), Positives = 372/404 (92%), Gaps = 8/404 (2%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKKSARKVGISCAAA-----GGDGK  389
             MAV TVYT QS HSTCSISTP+KTH    Q++  ++  S +KV     AA        G 
Sbjct  1     MAVSTVYTTQSFHSTCSISTPSKTHLGFNQKKQILFYNSGKKVTNRGIAAVPYVIRCSGD  60

Query  390   TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDR  569
             T+VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSLDR
Sbjct  61    TLVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDR  120

Query  570   TGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVI  749
             TGRKEKGVTALDPRANDFDLMYEQVKA+KEGKAVDKPIYNHVTGLLDPPEL KPPKILVI
Sbjct  121   TGRKEKGVTALDPRANDFDLMYEQVKAMKEGKAVDKPIYNHVTGLLDPPELIKPPKILVI  180

Query  750   EGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA  929
             EGLHPM+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF+A
Sbjct  181   EGLHPMFDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFEA  240

Query  930   YIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPC  1109
             YIDPQKQYADAVIEVLPTQLIP DNEGK+LRVRLIMKEGVK+F+PVYLFDEGSTISWIPC
Sbjct  241   YIDPQKQYADAVIEVLPTQLIPGDNEGKILRVRLIMKEGVKYFNPVYLFDEGSTISWIPC  300

Query  1110  GRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQ  1289
             GRKLTCSYPGIKFTYGP++YFGHEVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEVTQ
Sbjct  301   GRKLTCSYPGIKFTYGPESYFGHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQ  360

Query  1290  QMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             QMLKH++FPGSNNGTG FQTIVGLKIRDLYEQI A++AAAP++A
Sbjct  361   QMLKHSEFPGSNNGTGLFQTIVGLKIRDLYEQITASKAAAPLQA  404



>emb|CAN78901.1| hypothetical protein VITISV_011191 [Vitis vinifera]
Length=408

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/405 (85%), Positives = 373/405 (92%), Gaps = 9/405 (2%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKKSARKVGIS-CAAA-----GGDG  386
             MA+CTVYT QSL+STCS+S P K      Q+QV  + KS R+ G+S C ++      G+ 
Sbjct  1     MAICTVYTTQSLNSTCSVSKPAKPQLGFHQKQVVFFTKSRRRSGMSSCGSSVITCSAGEQ  60

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPP+GGNPDSNTLISD TTVICLDDYHSLD
Sbjct  61    RTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPRGGNPDSNTLISDTTTVICLDDYHSLD  120

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             RTGRKEKGVTALDPRANDFDLMYEQVKA+K+G AV+KPIYNHVTGLLDPPE  KPPKILV
Sbjct  121   RTGRKEKGVTALDPRANDFDLMYEQVKAIKDGIAVEKPIYNHVTGLLDPPETIKPPKILV  180

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEG HPMYDARVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD
Sbjct  181   IEGXHPMYDARVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  240

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGV +FSPVYLFDEGSTISWIP
Sbjct  241   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVTYFSPVYLFDEGSTISWIP  300

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI F+YGPDTY+GHEVSVLEMDGQFDRLDELIYVESHLS++STKFYGE+T
Sbjct  301   CGRKLTCSYPGINFSYGPDTYYGHEVSVLEMDGQFDRLDELIYVESHLSNISTKFYGEIT  360

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             QQ+LKH+DFPGSNNGTG FQTIVGLKIRDL+EQIVA+RAA P+EA
Sbjct  361   QQLLKHSDFPGSNNGTGLFQTIVGLKIRDLFEQIVASRAATPLEA  405



>gb|KDP40430.1| hypothetical protein JCGZ_03845 [Jatropha curcas]
Length=407

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/407 (87%), Positives = 375/407 (92%), Gaps = 9/407 (2%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTH--FQRQVFVY------KKSARKVGISCAAAGGDG-  386
             MA+CTVYT QSL+STC+ISTP KTH  F ++  V+      K+++++   S  +   +G 
Sbjct  1     MAICTVYTTQSLNSTCTISTPGKTHLGFNQKHVVFLNSSCGKRNSKRGSSSFISCSSEGS  60

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSLD
Sbjct  61    ETVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLD  120

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             RTGRKEKGVTALDPRANDFDLMYEQVKA+KEG  V+KPIYNHVTGLLDPPEL KPPKILV
Sbjct  121   RTGRKEKGVTALDPRANDFDLMYEQVKAIKEGIPVEKPIYNHVTGLLDPPELIKPPKILV  180

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD
Sbjct  181   IEGLHPMYDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  240

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTISWIP
Sbjct  241   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIP  300

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIKF Y PDTYFGHEVSVLEMDGQFDRLDELIYVESHLS++STKFYGEVT
Sbjct  301   CGRKLTCSYPGIKFAYAPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSNISTKFYGEVT  360

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             QQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQIVA++A  PVEAKA
Sbjct  361   QQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIVASKAKTPVEAKA  407



>ref|XP_007158206.1| hypothetical protein PHAVU_002G133100g [Phaseolus vulgaris]
 gb|ESW30200.1| hypothetical protein PHAVU_002G133100g [Phaseolus vulgaris]
Length=409

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/411 (85%), Positives = 374/411 (91%), Gaps = 15/411 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVY----------KKSARKVGISCAAA  374
             MA CTVY+ QSL + CSISTP+KT F   Q+QV  Y            S R   I+CAA+
Sbjct  1     MAACTVYSTQSLSTNCSISTPSKTQFSFHQKQVVFYTTGRRNSKRGSNSGRSYVITCAAS  60

Query  375   GGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDY  554
               D +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDY
Sbjct  61    --DQQTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDY  118

Query  555   HSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPP  734
             HSLDRTGRKEKGVTALDPRANDFDLMYEQVKA+K+G +V+KPIYNHVTGLLDPPEL KPP
Sbjct  119   HSLDRTGRKEKGVTALDPRANDFDLMYEQVKAIKDGISVEKPIYNHVTGLLDPPELIKPP  178

Query  735   KILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARK  914
             KILVIEGLHPM+D+RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARK
Sbjct  179   KILVIEGLHPMFDSRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARK  238

Query  915   PDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTI  1094
             PDF+AYIDPQKQYADAVIEVLPTQLIPDDNEGK+LRVRLI KEGVK+FSPVYLFD+GSTI
Sbjct  239   PDFEAYIDPQKQYADAVIEVLPTQLIPDDNEGKILRVRLIQKEGVKNFSPVYLFDDGSTI  298

Query  1095  SWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFY  1274
             SWIPCGRKLTCSYPGIKF+YGPDTY+G+EVS++EMDGQFDRLDELIYVESHLS+LSTKFY
Sbjct  299   SWIPCGRKLTCSYPGIKFSYGPDTYYGNEVSIVEMDGQFDRLDELIYVESHLSNLSTKFY  358

Query  1275  GEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             GEVTQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQI+A+RA  PV AKA
Sbjct  359   GEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIIASRAETPVAAKA  409



>ref|XP_009788785.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Nicotiana 
sylvestris]
Length=407

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/399 (88%), Positives = 371/399 (93%), Gaps = 12/399 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKK-------SARKVGISCAAAGGD  383
             MAV TVYT QSL+STCSIST +K+H    Q QV  Y K       S+    I+C++A  D
Sbjct  1     MAVSTVYTAQSLNSTCSISTRSKSHLGFHQNQVIFYTKLRSTNRRSSSTSVITCSSA--D  58

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPP+GGNPDSNTLISDMTTVICLDDYHSL
Sbjct  59    EKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPRGGNPDSNTLISDMTTVICLDDYHSL  118

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKEKGVTALDPRANDFDLMYEQVKA+KEG AV+KPIYNHV+GLLDPPEL KPPKIL
Sbjct  119   DRTGRKEKGVTALDPRANDFDLMYEQVKAIKEGIAVEKPIYNHVSGLLDPPELIKPPKIL  178

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF
Sbjct  179   VIEGLHPMYDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  238

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVR+IMKEGVK+F+PVYLFDEGSTISWI
Sbjct  239   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRMIMKEGVKNFNPVYLFDEGSTISWI  298

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKFTYGPDTYFG+EVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEV
Sbjct  299   PCGRKLTCSYPGIKFTYGPDTYFGNEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEV  358

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATR  1400
             TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVA+R
Sbjct  359   TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVASR  397



>ref|XP_003516852.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Glycine max]
Length=407

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/409 (85%), Positives = 373/409 (91%), Gaps = 13/409 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF----QRQVFVYKKSA-------RKVGISCAAAGG  380
             MA CTVY+ QSL + CSISTP+KT      Q+QV  ++ S        R   I+CAA  G
Sbjct  1     MAACTVYSTQSLSTNCSISTPSKTQLSFFHQKQVVFWRNSKKGSCSSRRSYVITCAA--G  58

Query  381   DGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  560
             D +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHS
Sbjct  59    DSQTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHS  118

Query  561   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKI  740
             LDRTGRKEKGVTALDPRANDFDLMYEQVKALK+G AV+KPIYNHVTGLLDPPEL KPPKI
Sbjct  119   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKDGIAVEKPIYNHVTGLLDPPELIKPPKI  178

Query  741   LVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  920
             LVIEGLHPM+D+RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD
Sbjct  179   LVIEGLHPMFDSRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  238

Query  921   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             F+AYIDPQKQYADAVIEVLPTQLIPDDNEGK+LRVRLI KEGVK+FSPVYLFD+GSTISW
Sbjct  239   FEAYIDPQKQYADAVIEVLPTQLIPDDNEGKILRVRLIQKEGVKYFSPVYLFDDGSTISW  298

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
             IPCGRKLTCSYPGIKF YGP+TY+G+EVSV+EMDGQFDRLDELIYVESHLS+LSTKFYGE
Sbjct  299   IPCGRKLTCSYPGIKFFYGPETYYGNEVSVVEMDGQFDRLDELIYVESHLSNLSTKFYGE  358

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             VTQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQ++A++A  PV AKA
Sbjct  359   VTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQLIASKAETPVAAKA  407



>gb|ACU23619.1| unknown [Glycine max]
Length=407

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/409 (85%), Positives = 373/409 (91%), Gaps = 13/409 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF----QRQVFVYKKSA-------RKVGISCAAAGG  380
             MA CTVY+ QSL + CSISTP+KT      Q+QV  ++ S        R   I+CAA  G
Sbjct  1     MAACTVYSTQSLSTNCSISTPSKTQLSFFHQKQVVFWRNSKKGSCSSRRSYVITCAA--G  58

Query  381   DGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  560
             D +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHS
Sbjct  59    DSQTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHS  118

Query  561   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKI  740
             LDRTGRKEKGVTALDPRANDFDLMYEQVKALK+G AV+KPIYNHVTGLLDPPEL KPPKI
Sbjct  119   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKDGIAVEKPIYNHVTGLLDPPELIKPPKI  178

Query  741   LVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  920
             LVIEGLHPM+D+RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD
Sbjct  179   LVIEGLHPMFDSRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  238

Query  921   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             F+AYIDPQKQYADAVIEVLPTQLIPDDNEGK+LRVRLI KEGVK+FSPVYLFD+GSTISW
Sbjct  239   FEAYIDPQKQYADAVIEVLPTQLIPDDNEGKILRVRLIQKEGVKYFSPVYLFDDGSTISW  298

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
             IPCGRKLTCSYPGIKF YGP+TY+G+EV V+EMDGQFDRLDELIYVESHLS+LSTKFYGE
Sbjct  299   IPCGRKLTCSYPGIKFFYGPETYYGNEVLVVEMDGQFDRLDELIYVESHLSNLSTKFYGE  358

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQ++A++A  PV AKA
Sbjct  359   VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQLIASKAETPVAAKA  407



>ref|XP_009609042.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=407

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/395 (88%), Positives = 367/395 (93%), Gaps = 11/395 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKKSARKVG-------ISCAAAGGD  383
             MAV TVY +QSL+STCSIST TKT+    Q+QV  Y  S +K         I+C++A  +
Sbjct  1     MAVSTVYKIQSLNSTCSISTSTKTNLGFHQKQVIFYTTSTKKYSTRKFNTFITCSSAD-E  59

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL
Sbjct  60    TKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  119

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKE+GVTALDP+ANDFDLMYEQVKALK G AV+KPIYNHV+GLLDPPEL KPPKIL
Sbjct  120   DRTGRKERGVTALDPKANDFDLMYEQVKALKSGIAVEKPIYNHVSGLLDPPELIKPPKIL  179

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPM+D RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF
Sbjct  180   VIEGLHPMFDERVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  239

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+F+PVYLFDEGSTISWI
Sbjct  240   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFNPVYLFDEGSTISWI  299

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKF+YGPDTYFG+EVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV
Sbjct  300   PCGRKLTCSYPGIKFSYGPDTYFGNEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  359

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQI  1388
             TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQI
Sbjct  360   TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQI  394



>gb|EYU29073.1| hypothetical protein MIMGU_mgv1a007276mg [Erythranthe guttata]
Length=412

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/412 (85%), Positives = 376/412 (91%), Gaps = 19/412 (5%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSIST-PTKTHF-----QRQVFVY----KKSARKVG------ISC  365
             MAVCTVYTVQSL+ST SIST P K +      Q+Q  V+      +A + G      ISC
Sbjct  1     MAVCTVYTVQSLNSTYSISTTPAKKNNLLGFNQKQAVVFYSRKTTTATRSGRPGAAVISC  60

Query  366   AAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICL  545
             +AA    KT+VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICL
Sbjct  61    SAAD---KTIVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICL  117

Query  546   DDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELT  725
             DDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKA+K+G AVDKPIYNHV+GLLDPPEL 
Sbjct  118   DDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKAIKDGVAVDKPIYNHVSGLLDPPELI  177

Query  726   KPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIE  905
             KPPKILVIEGLHPMYD+RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIE
Sbjct  178   KPPKILVIEGLHPMYDSRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIE  237

Query  906   ARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEG  1085
             ARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEG+K F+PVYLFDEG
Sbjct  238   ARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGIKFFNPVYLFDEG  297

Query  1086  STISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLST  1265
             STISW+PCGRKLTCSYPGIKFTYGPDTY+G+EVSVLEMDGQFDRLDELIYVESHLS++ST
Sbjct  298   STISWVPCGRKLTCSYPGIKFTYGPDTYYGNEVSVLEMDGQFDRLDELIYVESHLSNIST  357

Query  1266  KFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             KFYGE+TQQMLK +DFPGSNNGTG FQTIVGLKIRDLYEQI+ATRAAAP+EA
Sbjct  358   KFYGEITQQMLKLSDFPGSNNGTGLFQTIVGLKIRDLYEQIIATRAAAPLEA  409



>ref|XP_003534305.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Glycine max]
Length=407

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/409 (85%), Positives = 373/409 (91%), Gaps = 13/409 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF----QRQVFVYKKSARKVG-------ISCAAAGG  380
             MA CTVY+ QSL + CSISTP+KT      Q+QV  ++ S R          I+CAA  G
Sbjct  1     MAACTVYSTQSLSTNCSISTPSKTQLSFFHQKQVVFWRNSNRGSSSSRRSYVITCAA--G  58

Query  381   DGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  560
             D +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHS
Sbjct  59    DSQTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHS  118

Query  561   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKI  740
             LDRTGRKEKGVTALDPRANDFDLMYEQVKALK+G AV+KPIYNHVTGLLDPPEL KPPKI
Sbjct  119   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKDGIAVEKPIYNHVTGLLDPPELIKPPKI  178

Query  741   LVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  920
             LVIEGLHPMYD+RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD
Sbjct  179   LVIEGLHPMYDSRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  238

Query  921   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             F+AYIDPQKQYADAVIEVLPTQLIPDDNEGK+LRVRLI KEGVK+FSPVYLFD+GSTISW
Sbjct  239   FEAYIDPQKQYADAVIEVLPTQLIPDDNEGKILRVRLIQKEGVKYFSPVYLFDDGSTISW  298

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
             IPCGRKLTCSYPGIKF YGP+TY+G+EVSV+EMDGQFDRLDELIYVESHLS+LSTKFYGE
Sbjct  299   IPCGRKLTCSYPGIKFFYGPETYYGNEVSVVEMDGQFDRLDELIYVESHLSNLSTKFYGE  358

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             VTQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQ++AT+A  PV AKA
Sbjct  359   VTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQLIATKAETPVAAKA  407



>ref|XP_010110407.1| Phosphoribulokinase [Morus notabilis]
 gb|EXC26239.1| Phosphoribulokinase [Morus notabilis]
Length=411

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/416 (84%), Positives = 377/416 (91%), Gaps = 23/416 (6%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCS-ISTPTKTHF---QRQVFVYKKSA------RKVG--------I  359
             MA+CTVYT Q L+ TCS IS P+K+H    QRQV +YK+++      R  G        I
Sbjct  1     MAICTVYTTQ-LNPTCSSISKPSKSHLGFHQRQVVLYKRNSTNTYRPRSSGFSRPSYSII  59

Query  360   SCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVI  539
             +CAA     +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPP+GGNPDSNTLISD TTVI
Sbjct  60    TCAA----DQTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPRGGNPDSNTLISDTTTVI  115

Query  540   CLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPE  719
             CLDDYHSLDRTGRKEKGVTALDPRAN+FDLMYEQVK +KEG AV+KPIYNHVTGLLDPPE
Sbjct  116   CLDDYHSLDRTGRKEKGVTALDPRANNFDLMYEQVKTIKEGVAVEKPIYNHVTGLLDPPE  175

Query  720   LTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKAS  899
             L KPPKILVIEGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKAS
Sbjct  176   LIKPPKILVIEGLHPMYDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKAS  235

Query  900   IEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFD  1079
             IEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRV+LIMKEGV++FSPVYLFD
Sbjct  236   IEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVKLIMKEGVQYFSPVYLFD  295

Query  1080  EGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSL  1259
             EGSTISWIPCGRKLTCSYPGIKFTYGPD+Y+GHEVSVLEMDGQFDRLDELIYVESHLS++
Sbjct  296   EGSTISWIPCGRKLTCSYPGIKFTYGPDSYYGHEVSVLEMDGQFDRLDELIYVESHLSNI  355

Query  1260  STKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             STKFYGEVTQQMLKH+DFPGSNNGTG FQTI+GLKIRDLYEQIVA+R+  PVEAKA
Sbjct  356   STKFYGEVTQQMLKHSDFPGSNNGTGLFQTIIGLKIRDLYEQIVASRSQTPVEAKA  411



>ref|XP_004300170.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=408

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/409 (85%), Positives = 376/409 (92%), Gaps = 12/409 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCS-ISTPTKTHF---QRQ--VFVYKKSARK-----VGISCAAAGG  380
             MA+C V+T    + TCS ISTP+K+H    QRQ  VF  K+++++     VG+   AAGG
Sbjct  1     MAICAVHTSTQFNPTCSSISTPSKSHLGFCQRQQVVFYTKRTSKRSSTPYVGLIACAAGG  60

Query  381   DGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  560
               +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHS
Sbjct  61    Q-ETVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHS  119

Query  561   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKI  740
             LDRTGRKEKGVTALDPRANDFDLMYEQVKA+K+GKAV+KPIYNHV+GLLDPPEL KPPKI
Sbjct  120   LDRTGRKEKGVTALDPRANDFDLMYEQVKAIKDGKAVEKPIYNHVSGLLDPPELIKPPKI  179

Query  741   LVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  920
             LVIEGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD
Sbjct  180   LVIEGLHPMYDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  239

Query  921   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             FDAYIDPQKQYADAVIEVLPTQLIP DNEGKVLRVRLIMKEGVK F+PVYLFDEGSTISW
Sbjct  240   FDAYIDPQKQYADAVIEVLPTQLIPGDNEGKVLRVRLIMKEGVKFFNPVYLFDEGSTISW  299

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
             IPCGRKLTCSYPGIKFTYGPDTY+G EVSVLEMDGQFDRLDELIYVESHLS++STKFYGE
Sbjct  300   IPCGRKLTCSYPGIKFTYGPDTYYGQEVSVLEMDGQFDRLDELIYVESHLSNISTKFYGE  359

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             VTQQMLKH+DFPGS+NGTG FQTIVGLKIRDLYEQ++A++A +PVEAKA
Sbjct  360   VTQQMLKHSDFPGSSNGTGLFQTIVGLKIRDLYEQLIASKAKSPVEAKA  408



>ref|XP_011082329.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Sesamum indicum]
Length=398

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/399 (87%), Positives = 368/399 (92%), Gaps = 7/399 (2%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVY---KKSARKVGISCAAAGGDGKTVVIG  404
             MAV TVYTVQ + S  SISTP+K+H      +Y   KK+ R   ISC+A   + KTVVIG
Sbjct  1     MAVSTVYTVQ-IQSLNSISTPSKSHLGFNQLLYSSGKKTRRATHISCSA--DNDKTVVIG  57

Query  405   LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKE  584
             LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDR GRKE
Sbjct  58    LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRNGRKE  117

Query  585   KGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHP  764
             KGVTALDP+ANDFDLMYEQVKA+KEG AVDKPIYNHVTGL+DPPEL KPPKI VIEGLHP
Sbjct  118   KGVTALDPKANDFDLMYEQVKAVKEGIAVDKPIYNHVTGLIDPPELIKPPKIFVIEGLHP  177

Query  765   MYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQ  944
             MYDARVRELLDFSIYLDIS EVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQ
Sbjct  178   MYDARVRELLDFSIYLDISPEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQ  237

Query  945   KQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLT  1124
             KQYADAVIEVLPTQLIPDD EGKVLRVRLIMKEGVK+F+PVYLFDEGSTISW+PCGRKLT
Sbjct  238   KQYADAVIEVLPTQLIPDD-EGKVLRVRLIMKEGVKYFNPVYLFDEGSTISWVPCGRKLT  296

Query  1125  CSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKH  1304
             CSYPGIKF YGP+TYFGHEVSVLEMDGQFDRLDELIYVESHLS++STKFYGEVTQQMLKH
Sbjct  297   CSYPGIKFAYGPETYFGHEVSVLEMDGQFDRLDELIYVESHLSNISTKFYGEVTQQMLKH  356

Query  1305  ADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             ADFPGSNNGTG FQTIVGLKIRDLYEQIVA++ AAP+EA
Sbjct  357   ADFPGSNNGTGLFQTIVGLKIRDLYEQIVASKVAAPLEA  395



>ref|XP_008465108.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Cucumis melo]
Length=418

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/417 (83%), Positives = 371/417 (89%), Gaps = 23/417 (6%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQR---QVFVYKKSARKVG----------------  356
             MAVCTVYT QSL+ST S ST +   F +   Q+  +  + +K G                
Sbjct  1     MAVCTVYTTQSLNSTFSSSTKSHLGFHQKNQQLVFFSSNGKKWGSGNKRDGHNTVTNNNP  60

Query  357   --ISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMT  530
               I+C+AA  D +T+VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD T
Sbjct  61    YLITCSAA--DQQTIVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTT  118

Query  531   TVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLD  710
             TVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKA+K G +VDKPIYNHVTGLLD
Sbjct  119   TVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKAIKSGVSVDKPIYNHVTGLLD  178

Query  711   PPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESI  890
             PPEL KPPKILVIEGLHPMYD+RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESI
Sbjct  179   PPELIKPPKILVIEGLHPMYDSRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESI  238

Query  891   KASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVY  1070
             KASIEARKPDFDAYIDPQKQYADAVIEVLPT+LIPDDNEGKVLRVRLIMKEGV+ F+PVY
Sbjct  239   KASIEARKPDFDAYIDPQKQYADAVIEVLPTKLIPDDNEGKVLRVRLIMKEGVEFFNPVY  298

Query  1071  LFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHL  1250
             LFD+GSTISWIPCGRKLTCSYPGIKF+YGP+TY+GHEVSVLEMDGQFDRLDELIYVESHL
Sbjct  299   LFDQGSTISWIPCGRKLTCSYPGIKFSYGPETYYGHEVSVLEMDGQFDRLDELIYVESHL  358

Query  1251  SSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             S+LSTKFYGEVTQQMLKH+DFPGSNNGTGFFQTIVGLKIRDLYEQI A+R  APVEA
Sbjct  359   SNLSTKFYGEVTQQMLKHSDFPGSNNGTGFFQTIVGLKIRDLYEQITASRVKAPVEA  415



>ref|XP_007210511.1| hypothetical protein PRUPE_ppa006386mg [Prunus persica]
 gb|EMJ11710.1| hypothetical protein PRUPE_ppa006386mg [Prunus persica]
Length=414

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/413 (84%), Positives = 371/413 (90%), Gaps = 19/413 (5%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTP-TKTHFQ----------RQVFVYKKS---ARKVGIS---  362
             MA+C VYT   L+ TCS STP +KT  Q          +QV  YK+S   +R+  +S   
Sbjct  1     MAICAVYTTTQLNPTCSFSTPASKTQTQLGFGLGFCQKQQVVFYKRSQSNSRRASVSLIT  60

Query  363   CAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVIC  542
             C+A G +  TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVIC
Sbjct  61    CSAGGQE--TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVIC  118

Query  543   LDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPEL  722
             LDDYHSLDRTGRKEKGVTALDPRAN+FDLMYEQVKA+KEGKAVDKPIYNHV+GLLDPPEL
Sbjct  119   LDDYHSLDRTGRKEKGVTALDPRANNFDLMYEQVKAIKEGKAVDKPIYNHVSGLLDPPEL  178

Query  723   TKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI  902
              KPPKILVIEGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI
Sbjct  179   IKPPKILVIEGLHPMYDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI  238

Query  903   EARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDE  1082
             EARKPDFDAYIDPQKQYADAVIEVLPTQLIP DNEGKVLRVRLIMKEGVK F+PVYLFDE
Sbjct  239   EARKPDFDAYIDPQKQYADAVIEVLPTQLIPGDNEGKVLRVRLIMKEGVKFFNPVYLFDE  298

Query  1083  GSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLS  1262
             GSTISWIPCGRKLTCSYPGIKFTYGPDTYFG+EVSVLEMDGQFDRLDELIYVESHLS++S
Sbjct  299   GSTISWIPCGRKLTCSYPGIKFTYGPDTYFGNEVSVLEMDGQFDRLDELIYVESHLSNIS  358

Query  1263  TKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TKFYGEVTQQMLK +DFPGSNNGTG FQTIVGLKIRDL+EQ++A++A  PVEA
Sbjct  359   TKFYGEVTQQMLKLSDFPGSNNGTGLFQTIVGLKIRDLFEQLIASKAKTPVEA  411



>ref|XP_004144412.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Cucumis sativus]
 ref|XP_004160995.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Cucumis sativus]
 gb|KGN58408.1| hypothetical protein Csa_3G638540 [Cucumis sativus]
Length=418

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/420 (84%), Positives = 374/420 (89%), Gaps = 24/420 (6%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF----QRQVFV------YKKSARKVG---------  356
             MAVCTVYT QSL+ST S S  +   F    Q+ VF+      +  S +K G         
Sbjct  1     MAVCTVYTTQSLNSTFSSSIKSHLGFHQKNQQLVFLSSNGKKWGSSNKKDGHNTVTNNNS  60

Query  357   --ISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMT  530
               I+C+AA  D +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPP+GGNPDSNTLISD T
Sbjct  61    YLITCSAA--DQQTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPRGGNPDSNTLISDTT  118

Query  531   TVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLD  710
             TVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKA+K G  VDKPIYNHVTGLLD
Sbjct  119   TVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKAIKSGVTVDKPIYNHVTGLLD  178

Query  711   PPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESI  890
             PPEL KPPKILVIEGLHPMYD+RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESI
Sbjct  179   PPELIKPPKILVIEGLHPMYDSRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESI  238

Query  891   KASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVY  1070
             KASIEARKPDFDAYIDPQKQYADAVIEVLPT+LIPDDNEGKVLRVRLIMKEGV+ F+PVY
Sbjct  239   KASIEARKPDFDAYIDPQKQYADAVIEVLPTKLIPDDNEGKVLRVRLIMKEGVEFFNPVY  298

Query  1071  LFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHL  1250
             LFDEGSTISWIPCGRKLTCSYPGIKF+YGP+TY+GHEVSVLEMDGQFDRLDELIYVESHL
Sbjct  299   LFDEGSTISWIPCGRKLTCSYPGIKFSYGPETYYGHEVSVLEMDGQFDRLDELIYVESHL  358

Query  1251  SSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVE-AKA  1427
             S+LSTKFYGEVTQQMLKH+DFPGSNNGTGFFQTIVGLKIRDLYEQI A+RA APVE AKA
Sbjct  359   SNLSTKFYGEVTQQMLKHSDFPGSNNGTGFFQTIVGLKIRDLYEQISASRAKAPVEVAKA  418



>gb|KHN40404.1| Phosphoribulokinase, chloroplastic [Glycine soja]
Length=453

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/405 (85%), Positives = 370/405 (91%), Gaps = 13/405 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF----QRQVFVYKKSARKVG-------ISCAAAGG  380
             MA CTVY+ QSL + CSISTP+KT      Q+QV  ++ S +          I+CAA  G
Sbjct  1     MAACTVYSTQSLSTNCSISTPSKTQLSFFHQKQVVFWRNSKKGSSSSRRSYVITCAA--G  58

Query  381   DGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  560
             D +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHS
Sbjct  59    DSQTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHS  118

Query  561   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKI  740
             LDRTGRKEKGVTALDPRANDFDLMYEQVKALK+G AV+KPIYNHVTGLLDPPEL KPPKI
Sbjct  119   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKDGIAVEKPIYNHVTGLLDPPELIKPPKI  178

Query  741   LVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  920
             LVIEGLHPM+D+RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD
Sbjct  179   LVIEGLHPMFDSRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  238

Query  921   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             F+AYIDPQKQYADAVIEVLPTQLIPDDNEGK+LRVRLI KEGVK+FSPVYLFD+GSTISW
Sbjct  239   FEAYIDPQKQYADAVIEVLPTQLIPDDNEGKILRVRLIQKEGVKYFSPVYLFDDGSTISW  298

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
             IPCGRKLTCSYPGIKF YGP+TY+G+EVSV+EMDGQFDRLDELIYVESHLS+LSTKFYGE
Sbjct  299   IPCGRKLTCSYPGIKFFYGPETYYGNEVSVVEMDGQFDRLDELIYVESHLSNLSTKFYGE  358

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPV  1415
             VTQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQ++A++A  PV
Sbjct  359   VTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQLIASKAETPV  403



>ref|XP_006432646.1| hypothetical protein CICLE_v10001344mg [Citrus clementina]
 ref|XP_006471453.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Citrus sinensis]
 gb|ESR45886.1| hypothetical protein CICLE_v10001344mg [Citrus clementina]
Length=407

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/406 (84%), Positives = 367/406 (90%), Gaps = 20/406 (5%)
 Frame = +3

Query  264   SLHSTCSISTPTKTHF-----QRQVFVY-------------KKSARKVGISCAAAGGDGK  389
             SL+S CS+ +PTKTH      QRQ+ V+              K    + I+C+A  GD +
Sbjct  4     SLNSPCSLYSPTKTHLGFFNNQRQLAVFYNKRSSSSSSSSSSKQRGCLVITCSA--GDSQ  61

Query  390   TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDR  569
             T+VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLIS+ TTVICLDDYHSLDR
Sbjct  62    TIVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISETTTVICLDDYHSLDR  121

Query  570   TGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVI  749
             TGRKEKGVTALDPRAN+FDLMYEQVKA+K+G +V+KPIYNHVTGLLDPPEL KPPKILVI
Sbjct  122   TGRKEKGVTALDPRANNFDLMYEQVKAMKDGVSVEKPIYNHVTGLLDPPELIKPPKILVI  181

Query  750   EGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA  929
             EGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDM ERGHSLESIKASIEARKPDFDA
Sbjct  182   EGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMTERGHSLESIKASIEARKPDFDA  241

Query  930   YIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPC  1109
             YIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTI WIPC
Sbjct  242   YIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTIEWIPC  301

Query  1110  GRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQ  1289
             GRKLTCSYPGIKF+YGPD YFGHEVS+LEMDG+FDRLDELIYVESHLS+LSTKFYGEVTQ
Sbjct  302   GRKLTCSYPGIKFSYGPDAYFGHEVSILEMDGKFDRLDELIYVESHLSNLSTKFYGEVTQ  361

Query  1290  QMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             QMLKHADFPGSNNGTG FQTIVGLKIRDLYEQI+ ++AAAPVEAKA
Sbjct  362   QMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIITSKAAAPVEAKA  407



>ref|XP_004512451.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Cicer arietinum]
Length=409

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/408 (84%), Positives = 369/408 (90%), Gaps = 14/408 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSI--STPTKTHF---QRQVFVYKKSAR-------KVGISCAAAG  377
             MA CTVY+ QSL +  SI  S+ +KTH    Q+QV  Y  S +       +  I+C A  
Sbjct  1     MAACTVYSTQSLRTNISIPTSSSSKTHLGFNQKQVVFYTTSKKSRTNNNKRYLITCKA--  58

Query  378   GDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYH  557
             GD +T+VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYH
Sbjct  59    GDSQTIVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYH  118

Query  558   SLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPK  737
             SLDRTGRKEKGVTALDPRANDFDLMY+QVKA+K+G +V+KPIYNHVTGLLDPPEL KPPK
Sbjct  119   SLDRTGRKEKGVTALDPRANDFDLMYQQVKAIKDGISVEKPIYNHVTGLLDPPELIKPPK  178

Query  738   ILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKP  917
             ILVIEGLHPMYD+RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKP
Sbjct  179   ILVIEGLHPMYDSRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKP  238

Query  918   DFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTIS  1097
             DFDA+IDPQKQYADAVIEVLPTQLIPDDNEGK+LRVRLI KEGVK+FSPVYLFDEGSTIS
Sbjct  239   DFDAFIDPQKQYADAVIEVLPTQLIPDDNEGKILRVRLIQKEGVKYFSPVYLFDEGSTIS  298

Query  1098  WIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYG  1277
             WIPCGRKLTCSYPGIKF YGPDTYFG+EVSV+EMDGQFDRLDELIYVESHLS+LS+KFYG
Sbjct  299   WIPCGRKLTCSYPGIKFFYGPDTYFGNEVSVVEMDGQFDRLDELIYVESHLSNLSSKFYG  358

Query  1278  EVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             EVTQQMLKHADFPGSNNGTG FQTIVGLKIRDL+EQIVA+RA  PV A
Sbjct  359   EVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLFEQIVASRAETPVGA  406



>ref|XP_010920032.1| PREDICTED: phosphoribulokinase, chloroplastic [Elaeis guineensis]
Length=409

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/399 (86%), Positives = 363/399 (91%), Gaps = 16/399 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVY--------KKSARKV--GISCAAA  374
             MAVCTVYT  SLHS CS+S PTKT F   QRQ  ++        ++  +K+   + C+A 
Sbjct  1     MAVCTVYTTPSLHSPCSVSNPTKTSFGFNQRQQVIFYTSGRGSRRRGGKKISEALYCSA-  59

Query  375   GGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDY  554
               + KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDY
Sbjct  60    --EAKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDY  117

Query  555   HSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPP  734
             HSLDRTGRKEKGVTALDPRAN+FDLMYEQVKALKEG AVDKPIYNHVTGLLDPPEL +PP
Sbjct  118   HSLDRTGRKEKGVTALDPRANNFDLMYEQVKALKEGVAVDKPIYNHVTGLLDPPELIQPP  177

Query  735   KILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARK  914
             KILVIEGLHPM+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARK
Sbjct  178   KILVIEGLHPMFDPRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARK  237

Query  915   PDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTI  1094
             PDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEG K+FSPVYLFDEGSTI
Sbjct  238   PDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGSKYFSPVYLFDEGSTI  297

Query  1095  SWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFY  1274
             SWIPCGRKLTCSYPGIKF YGPDTYF HEVSVLEMDGQFDRLDELIYVESHLS++STKFY
Sbjct  298   SWIPCGRKLTCSYPGIKFFYGPDTYFSHEVSVLEMDGQFDRLDELIYVESHLSNISTKFY  357

Query  1275  GEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIV  1391
             GEVTQQ+LKHADFPGSNNGTG FQTIVGLKIRDLYEQIV
Sbjct  358   GEVTQQLLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIV  396



>ref|XP_003612664.1| Phosphoribulokinase [Medicago truncatula]
 gb|AES95622.1| phosphoribulokinase [Medicago truncatula]
Length=411

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/410 (83%), Positives = 365/410 (89%), Gaps = 16/410 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKKSARKVG-----------ISCAA  371
             MA CTVY+ Q L +  SI T +KTH    Q+QV  Y  + +              I+C A
Sbjct  1     MAACTVYSTQPLRTNISIPTSSKTHVGFNQKQVVFYTTTKKSSNRRTNSNNRRYLITCGA  60

Query  372   AGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDD  551
               GD +T+VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDD
Sbjct  61    --GDSQTIVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDD  118

Query  552   YHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKP  731
             YHSLDRTGRKEKGVTALDPRANDFDLMYEQVKA+KEG +V KPIYNHVTGLLDPPEL KP
Sbjct  119   YHSLDRTGRKEKGVTALDPRANDFDLMYEQVKAIKEGVSVQKPIYNHVTGLLDPPELIKP  178

Query  732   PKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR  911
             PKILVIEGLHPMYD+RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR
Sbjct  179   PKILVIEGLHPMYDSRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR  238

Query  912   KPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGST  1091
             KPDF+AYIDPQKQYADAVIEVLPTQLIPDDNEGK+LRVRLI KEGVK+FSPVYLFD+GST
Sbjct  239   KPDFEAYIDPQKQYADAVIEVLPTQLIPDDNEGKILRVRLIQKEGVKYFSPVYLFDDGST  298

Query  1092  ISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKF  1271
             ISWIPCGRKLTCSYPGIKF+YGP+TY G+EVSV+EMDGQFDRLDELIYVESHLS+LS+KF
Sbjct  299   ISWIPCGRKLTCSYPGIKFSYGPETYKGNEVSVVEMDGQFDRLDELIYVESHLSNLSSKF  358

Query  1272  YGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             YGEVTQQMLKHADFPGSNNGTG FQTIVGLKIRDL+EQIVA+RA  PV A
Sbjct  359   YGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLFEQIVASRAETPVGA  408



>ref|XP_008238129.1| PREDICTED: phosphoribulokinase, chloroplastic [Prunus mume]
Length=413

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/413 (84%), Positives = 369/413 (89%), Gaps = 20/413 (5%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTP-TKTHFQ----------RQVFVYKKSARKVG------IS  362
             MA+C VYT Q L+ TCS STP +KT  Q          +QV  YK+S           I+
Sbjct  1     MAICAVYTTQ-LNPTCSFSTPASKTQTQLGFGFGFCQKQQVVFYKRSQSSSRRASVSLIT  59

Query  363   CAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVIC  542
             C+A G +  TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVIC
Sbjct  60    CSAGGQE--TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVIC  117

Query  543   LDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPEL  722
             LDDYHSLDRTGRKEKGVTALDPRAN+FDLMYEQVKA+KEGKAVDKPIYNHV+GLLDPPEL
Sbjct  118   LDDYHSLDRTGRKEKGVTALDPRANNFDLMYEQVKAIKEGKAVDKPIYNHVSGLLDPPEL  177

Query  723   TKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI  902
              KPPKILVIEGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI
Sbjct  178   IKPPKILVIEGLHPMYDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI  237

Query  903   EARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDE  1082
             EARKPDFDAYIDPQKQYADAVIEVLPTQLIP DNEGKVLRVRLIMKEGVK F+PVYLFDE
Sbjct  238   EARKPDFDAYIDPQKQYADAVIEVLPTQLIPGDNEGKVLRVRLIMKEGVKFFNPVYLFDE  297

Query  1083  GSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLS  1262
             GSTISWIPCGRKLTCSYPGIKFTYGPDTYFG+EVSVLEMDGQFDRLDELIYVESHLS++S
Sbjct  298   GSTISWIPCGRKLTCSYPGIKFTYGPDTYFGNEVSVLEMDGQFDRLDELIYVESHLSNIS  357

Query  1263  TKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TKFYGEVTQQMLK +DFPGSNNGTG FQTIVGLKIRDL+EQ++A++A  PVEA
Sbjct  358   TKFYGEVTQQMLKLSDFPGSNNGTGLFQTIVGLKIRDLFEQLIASKAKTPVEA  410



>gb|ACJ84919.1| unknown [Medicago truncatula]
Length=411

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/410 (82%), Positives = 365/410 (89%), Gaps = 16/410 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKKSARKVG-----------ISCAA  371
             MA CTVY+ Q L +  SI T +KTH    Q+QV  Y  + +              I+C A
Sbjct  1     MAACTVYSTQPLRTNISIPTSSKTHVGFNQKQVVFYTTTKKSSNRRTNSNNRRYLITCGA  60

Query  372   AGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDD  551
               GD +T+VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDD
Sbjct  61    --GDSQTIVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDD  118

Query  552   YHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKP  731
             YHSLDRTGRKEKGVTALDPRANDFDLMYEQVKA+KEG +V KPIYNHVTGLLDPPEL KP
Sbjct  119   YHSLDRTGRKEKGVTALDPRANDFDLMYEQVKAIKEGVSVQKPIYNHVTGLLDPPELIKP  178

Query  732   PKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR  911
             PKILVIEGLHP+YD+RVR+LLDFS+YLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR
Sbjct  179   PKILVIEGLHPLYDSRVRDLLDFSVYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR  238

Query  912   KPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGST  1091
             KPDF+AYIDPQKQYADAVIEVLPTQLIPDDNEGK+LRVRLI KEGVK+FSPVYLFD+GST
Sbjct  239   KPDFEAYIDPQKQYADAVIEVLPTQLIPDDNEGKILRVRLIQKEGVKYFSPVYLFDDGST  298

Query  1092  ISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKF  1271
             ISWIPCGRKLTCSYPGIKF+YGP+TY G+EVSV+EMDGQFDRLDELIYVESHLS+LS+KF
Sbjct  299   ISWIPCGRKLTCSYPGIKFSYGPETYKGNEVSVVEMDGQFDRLDELIYVESHLSNLSSKF  358

Query  1272  YGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             YGEVTQQMLKHADFPGSNNGTG FQTIVGLKIRDL+EQIVA+RA  PV A
Sbjct  359   YGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLFEQIVASRAETPVGA  408



>ref|XP_009114920.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Brassica 
rapa]
 emb|CDY59208.1| BnaA09g54020D [Brassica napus]
Length=397

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/399 (85%), Positives = 363/399 (91%), Gaps = 8/399 (2%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARK---VGISCAAAGGDGKTVVIG  404
             MAV T+Y+ Q+L+ST  + T + +   +QVF Y++   +     I+CAA     +TVVIG
Sbjct  1     MAVSTIYSTQALNSTHFL-TSSPSSSSKQVFFYRRQTNRRFNTIITCAAQ----QTVVIG  55

Query  405   LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKE  584
             LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKE
Sbjct  56    LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKE  115

Query  585   KGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHP  764
             KGVTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLD PEL +PPKILVIEGLHP
Sbjct  116   KGVTALDPRANDFDLMYEQVKALKSGIAVEKPIYNHVTGLLDAPELIQPPKILVIEGLHP  175

Query  765   MYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQ  944
             M+D RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA+IDPQ
Sbjct  176   MFDERVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFIDPQ  235

Query  945   KQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLT  1124
             KQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTISWIPCGRKLT
Sbjct  236   KQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGRKLT  295

Query  1125  CSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKH  1304
             CSYPGIKF Y PD+YF +EVSV+EMDGQFDRLDELIYVESHLS+LSTKFYGEVTQQMLKH
Sbjct  296   CSYPGIKFNYQPDSYFDNEVSVVEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQMLKH  355

Query  1305  ADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             ADFPGSNNGTG FQTIVGLKIRDLYEQ++A +A AP EA
Sbjct  356   ADFPGSNNGTGLFQTIVGLKIRDLYEQLIANKANAPTEA  394



>ref|XP_009399432.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=407

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/396 (86%), Positives = 356/396 (90%), Gaps = 14/396 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKKSARKVG--------ISCAAAGG  380
             MA CTVY   SLHS+CS   P KT+    QRQV  +    R           ISC+A   
Sbjct  1     MATCTVYPAPSLHSSCSFPGPAKTYLGFHQRQVIFFTGGRRSGSRGGRSSSEISCSA---  57

Query  381   DGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  560
             + KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHS
Sbjct  58    EAKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHS  117

Query  561   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKI  740
             LDRTGRKEKGVTALDPRANDFDLMY+QVKALKEG AVDKPIYNHVTGLLDPPEL  PPKI
Sbjct  118   LDRTGRKEKGVTALDPRANDFDLMYDQVKALKEGVAVDKPIYNHVTGLLDPPELINPPKI  177

Query  741   LVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  920
             LVIEGLHPM+DARVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD
Sbjct  178   LVIEGLHPMFDARVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  237

Query  921   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             FDAYIDPQKQYADAVIEVLPT LIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW
Sbjct  238   FDAYIDPQKQYADAVIEVLPTLLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  297

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
             IPCGRKLTCSYPGI+F+YGPDTY+ +EVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGE
Sbjct  298   IPCGRKLTCSYPGIQFSYGPDTYYSNEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGE  357

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQI  1388
             VTQQMLKHADFPGSNNGTG FQTI+GLKIRDLYEQI
Sbjct  358   VTQQMLKHADFPGSNNGTGLFQTIIGLKIRDLYEQI  393



>emb|CDY22582.1| BnaC05g24200D [Brassica napus]
Length=397

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/399 (84%), Positives = 363/399 (91%), Gaps = 8/399 (2%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARK---VGISCAAAGGDGKTVVIG  404
             MAV T+Y+ Q+L+ST  + T + +   +QVF Y++   +     I+CAA     +TVVIG
Sbjct  1     MAVSTIYSTQALNSTHFL-TSSPSSSSKQVFFYRRQTNRRFNTIITCAAQ----QTVVIG  55

Query  405   LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKE  584
             LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKE
Sbjct  56    LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKE  115

Query  585   KGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHP  764
             KGVTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLD PEL +PPKILVIEGLHP
Sbjct  116   KGVTALDPRANDFDLMYEQVKALKSGIAVEKPIYNHVTGLLDAPELIQPPKILVIEGLHP  175

Query  765   MYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQ  944
             M+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA+IDPQ
Sbjct  176   MFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFIDPQ  235

Query  945   KQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLT  1124
             KQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTISWIPCGRKLT
Sbjct  236   KQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGRKLT  295

Query  1125  CSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKH  1304
             CSYPGIKF Y PD+YF +EVSV+EMDGQFDRLDELIYVESHLS+LSTKFYGEVTQQMLKH
Sbjct  296   CSYPGIKFNYQPDSYFDNEVSVVEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQMLKH  355

Query  1305  ADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             ADFPGSNNGTG FQTIVGLKIRDLYEQ++A +A AP EA
Sbjct  356   ADFPGSNNGTGLFQTIVGLKIRDLYEQLIANKANAPTEA  394



>emb|CDX84108.1| BnaC08g07850D [Brassica napus]
Length=401

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/405 (83%), Positives = 363/405 (90%), Gaps = 11/405 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARKVG------ISCAAAGGDGKTV  395
             MAV T+Y+ ++L+ST  +++   +   +QVF Y++   +        I+CAA     +TV
Sbjct  1     MAVSTIYSTRALNSTHFLTSSPSSSTSKQVFFYRRHQSQTNRRFNTIITCAAQ----QTV  56

Query  396   VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTG  575
             VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTG
Sbjct  57    VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTG  116

Query  576   RKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEG  755
             RKEKGVTALDPRANDFDLMYEQVKALK   AV+KPIYNHVTGLLD PEL +PPKILVIEG
Sbjct  117   RKEKGVTALDPRANDFDLMYEQVKALKSSIAVEKPIYNHVTGLLDAPELIQPPKILVIEG  176

Query  756   LHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI  935
             LHPM+D RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA+I
Sbjct  177   LHPMFDERVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFI  236

Query  936   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGR  1115
             DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTISWIPCGR
Sbjct  237   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGR  296

Query  1116  KLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQM  1295
             KLTCSYPGIK  Y PDTYF HEVSVLEMDGQFDRLDELIYVESHLS+LS+KFYGEVTQQM
Sbjct  297   KLTCSYPGIKLNYEPDTYFDHEVSVLEMDGQFDRLDELIYVESHLSNLSSKFYGEVTQQM  356

Query  1296  LKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVE-AKA  1427
             LKHADFPGSNNGTG FQTIVGLKIRDLYEQ++A +A AP E AKA
Sbjct  357   LKHADFPGSNNGTGLFQTIVGLKIRDLYEQLIANKATAPAEIAKA  401



>gb|KCW72818.1| hypothetical protein EUGRSUZ_E01261 [Eucalyptus grandis]
Length=375

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/400 (84%), Positives = 355/400 (89%), Gaps = 32/400 (8%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF----QRQVFVYKKSARKVGISCAAAGGDGKTVVI  401
             MAV TVYT QS HSTCSISTP+KTH     ++Q+  Y                       
Sbjct  1     MAVSTVYTTQSFHSTCSISTPSKTHLGFNQKKQILFY-----------------------  37

Query  402   GLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRK  581
                  + CGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSLDRTGRK
Sbjct  38    -----NSCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRK  92

Query  582   EKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLH  761
             EKGVTALDPRANDFDLMYEQVKA+KEGKAVDKPIYNHVTGLLDPPEL KPPKILVIEGLH
Sbjct  93    EKGVTALDPRANDFDLMYEQVKAMKEGKAVDKPIYNHVTGLLDPPELIKPPKILVIEGLH  152

Query  762   PMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDP  941
             PM+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF+AYIDP
Sbjct  153   PMFDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFEAYIDP  212

Query  942   QKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKL  1121
             QKQYADAVIEVLPTQLIP DNEGK+LRVRLIMKEGVK+F+PVYLFDEGSTISWIPCGRKL
Sbjct  213   QKQYADAVIEVLPTQLIPGDNEGKILRVRLIMKEGVKYFNPVYLFDEGSTISWIPCGRKL  272

Query  1122  TCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLK  1301
             TCSYPGIKFTYGP++YFGHEVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEVTQQMLK
Sbjct  273   TCSYPGIKFTYGPESYFGHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQMLK  332

Query  1302  HADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             H++FPGSNNGTG FQTIVGLKIRDLYEQI A++AAAP++A
Sbjct  333   HSEFPGSNNGTGLFQTIVGLKIRDLYEQITASKAAAPLQA  372



>ref|XP_010933400.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Elaeis guineensis]
Length=409

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/400 (85%), Positives = 358/400 (90%), Gaps = 18/400 (5%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVY-----------KKSARKVGISCAA  371
             MA+CTV T  SLHS   +S PTKT F   QRQ  ++            K+  +V   CA 
Sbjct  1     MALCTVSTTPSLHSPFCVSNPTKTCFGFSQRQQVIFYTSGRRSSRRGGKNNSEVFYCCAE  60

Query  372   AGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDD  551
             A    KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDD
Sbjct  61    A----KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDD  116

Query  552   YHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKP  731
             YHSLDRTGRKEKGVTALDPRAN+FDLMYEQVKA+KEG AV+KPIYNHVTGLLDPPEL +P
Sbjct  117   YHSLDRTGRKEKGVTALDPRANNFDLMYEQVKAIKEGVAVEKPIYNHVTGLLDPPELIQP  176

Query  732   PKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR  911
             PKILVIEGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR
Sbjct  177   PKILVIEGLHPMYDPRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR  236

Query  912   KPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGST  1091
             KPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEG+KHFSPVYLFDEGST
Sbjct  237   KPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGLKHFSPVYLFDEGST  296

Query  1092  ISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKF  1271
             ISWIPCGRKLTCSYPGIKF YGPDTYF HEVSVLEMDGQFD+LDELIYVESHLS++STKF
Sbjct  297   ISWIPCGRKLTCSYPGIKFFYGPDTYFSHEVSVLEMDGQFDKLDELIYVESHLSNISTKF  356

Query  1272  YGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIV  1391
             YGEVTQQMLKHADFPGSNNGTG FQTI+GLKIRDLYEQI+
Sbjct  357   YGEVTQQMLKHADFPGSNNGTGLFQTIIGLKIRDLYEQII  396



>ref|XP_006415259.1| hypothetical protein EUTSA_v10007801mg [Eutrema salsugineum]
 gb|ESQ33612.1| hypothetical protein EUTSA_v10007801mg [Eutrema salsugineum]
Length=400

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/401 (83%), Positives = 362/401 (90%), Gaps = 9/401 (2%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSAR-----KVGISCAAAGGDGKTVV  398
             MAV T+Y+ Q+L+ST  +++   +   +QVF Y++ ++        I+CAA     +T+V
Sbjct  1     MAVSTIYSTQALNSTHFLTSSPSSSSSKQVFFYRRQSQTNRRFNTIITCAAQ----QTIV  56

Query  399   IGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGR  578
             IGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSLDRTGR
Sbjct  57    IGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGR  116

Query  579   KEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGL  758
             KEKGVTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLD PEL +PPKILVIEGL
Sbjct  117   KEKGVTALDPRANDFDLMYEQVKALKSGVAVEKPIYNHVTGLLDAPELIQPPKILVIEGL  176

Query  759   HPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYID  938
             HPM+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA+ID
Sbjct  177   HPMFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFID  236

Query  939   PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRK  1118
             PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTISWIPCGRK
Sbjct  237   PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGRK  296

Query  1119  LTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQML  1298
             LTCSYPGIKF Y PD+YF HEVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEVTQQML
Sbjct  297   LTCSYPGIKFNYEPDSYFDHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQML  356

Query  1299  KHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             KHADFPGSNNGTG FQTIVGLKIRDLYEQ++A++A    EA
Sbjct  357   KHADFPGSNNGTGLFQTIVGLKIRDLYEQLIASKATTRAEA  397



>ref|XP_010518928.1| PREDICTED: phosphoribulokinase, chloroplastic [Tarenaya hassleriana]
Length=405

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/402 (85%), Positives = 360/402 (90%), Gaps = 6/402 (1%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQ---RQVFVYKK---SARKVGISCAAAGGDGKTV  395
             MAV TVYT QSL+ST  +S+ T        + VF Y++   + R+       + GD +TV
Sbjct  1     MAVSTVYTSQSLNSTHFLSSSTSPSSSLVSKHVFFYRRRSPTCRRSTTVITCSAGDSQTV  60

Query  396   VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTG  575
             VIGLAADSGCGK        SVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTG
Sbjct  61    VIGLAADSGCGKXXXXXXXXSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTG  120

Query  576   RKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEG  755
             RKEKGVTALDPRANDFDLMYEQVKALK G AVDKPIYNHVTGLLDPPELTKPPKILVIEG
Sbjct  121   RKEKGVTALDPRANDFDLMYEQVKALKSGVAVDKPIYNHVTGLLDPPELTKPPKILVIEG  180

Query  756   LHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI  935
             LHPM+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI
Sbjct  181   LHPMFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI  240

Query  936   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGR  1115
             DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTI+WIPCGR
Sbjct  241   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKNFSPVYLFDEGSTINWIPCGR  300

Query  1116  KLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQM  1295
             KLTCSYPGIKF+YGPDTYF HEVSVLEMDGQFDRLDELIYVESHLS+LS+KFYGEVTQQM
Sbjct  301   KLTCSYPGIKFSYGPDTYFDHEVSVLEMDGQFDRLDELIYVESHLSNLSSKFYGEVTQQM  360

Query  1296  LKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             LKHADFPGSNNGTG FQTIVGLKIRDLYEQIVA +A+APVEA
Sbjct  361   LKHADFPGSNNGTGLFQTIVGLKIRDLYEQIVAAKASAPVEA  402



>ref|XP_008788584.1| PREDICTED: phosphoribulokinase, chloroplastic [Phoenix dactylifera]
Length=409

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/401 (85%), Positives = 359/401 (90%), Gaps = 20/401 (5%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVY------------KKSARKVGISCA  368
             MAVCTVYT  SLHS CS+S PTKT F   QRQ  ++            KK +      C+
Sbjct  1     MAVCTVYTTPSLHSPCSVSNPTKTCFGFNQRQQVIFYTSGRGSSRRGGKKYSET--FYCS  58

Query  369   AAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLD  548
             A   + KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLD
Sbjct  59    A---EAKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLD  115

Query  549   DYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTK  728
             D+HSLDRTGRKEKGVTALDPRAN+FDLMYEQVKALKEG AV+KPIYNHVTGLLDPPEL +
Sbjct  116   DFHSLDRTGRKEKGVTALDPRANNFDLMYEQVKALKEGVAVEKPIYNHVTGLLDPPELIQ  175

Query  729   PPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEA  908
             PP+ILVIEGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEA
Sbjct  176   PPRILVIEGLHPMYDPRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEA  235

Query  909   RKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGS  1088
             RKPDFDAYIDPQKQYADAVIEVLPTQLIP DNEG VLRVRLIMKEG+K+FSPVYLFDEGS
Sbjct  236   RKPDFDAYIDPQKQYADAVIEVLPTQLIPGDNEGTVLRVRLIMKEGLKYFSPVYLFDEGS  295

Query  1089  TISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTK  1268
             TISWIPCGRKLTCSYPGIKF YGPDTYF HEVS+LEMDGQFDRLDELIYVESHLS++STK
Sbjct  296   TISWIPCGRKLTCSYPGIKFFYGPDTYFSHEVSILEMDGQFDRLDELIYVESHLSNISTK  355

Query  1269  FYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIV  1391
             FYGEVTQQMLKHADFPGSNNGTG FQTI+GLKIRDLYEQI+
Sbjct  356   FYGEVTQQMLKHADFPGSNNGTGLFQTIIGLKIRDLYEQIL  396



>ref|NP_001047825.1| Os02g0698000 [Oryza sativa Japonica Group]
 gb|AAM94337.2| phosphoribulokinase precursor [Oryza sativa Indica Group]
 gb|AAN17353.1| phosphoribulokinase precursor [Oryza sativa Indica Group]
 dbj|BAD07865.1| phosphoribulokinase precursor [Oryza sativa Japonica Group]
 dbj|BAF09739.1| Os02g0698000 [Oryza sativa Japonica Group]
 gb|EAY87173.1| hypothetical protein OsI_08574 [Oryza sativa Indica Group]
 gb|EAZ24281.1| hypothetical protein OsJ_08032 [Oryza sativa Japonica Group]
 dbj|BAG96997.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGT38449.1| phosphoribulokinase [Oryza sativa Japonica Group]
Length=403

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/407 (82%), Positives = 360/407 (88%), Gaps = 18/407 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKK-----------SARKVGISCAAAGG  380
             MA+ +++   SLHS C+ +T  +   Q QV  +              AR   +SC+    
Sbjct  1     MAISSLHATTSLHSPCTTNTSFR---QNQVIFFTTRSNRRGSTRYGGARTFQVSCSV---  54

Query  381   DGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  560
               K VVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHS
Sbjct  55    -DKPVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHS  113

Query  561   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKI  740
             LDRTGRKEKGVTALDPRANDFDLMYEQVKA+KEGKA++KPIYNHVTGLLDPPEL +PPKI
Sbjct  114   LDRTGRKEKGVTALDPRANDFDLMYEQVKAIKEGKAIEKPIYNHVTGLLDPPELIQPPKI  173

Query  741   LVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  920
              VIEGLHPM+D RVR+LLDFSIYLDIS+EVKFAWKIQRDMAERGHSLESIKASIEARKPD
Sbjct  174   FVIEGLHPMFDERVRDLLDFSIYLDISDEVKFAWKIQRDMAERGHSLESIKASIEARKPD  233

Query  921   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             FDA+IDPQKQYADAVIEVLPTQLIPDDNEGKVLRV+LIMKEGVK+F+PVYLFDEGS+I+W
Sbjct  234   FDAFIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVKLIMKEGVKNFNPVYLFDEGSSITW  293

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
             +PCGRKLTCSYPGIKF YGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGE
Sbjct  294   VPCGRKLTCSYPGIKFAYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGE  353

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             VTQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQI+A RA AP EA
Sbjct  354   VTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIIAERAGAPTEA  400



>emb|CDY41745.1| BnaA08g07000D [Brassica napus]
Length=401

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/395 (85%), Positives = 358/395 (91%), Gaps = 10/395 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARKVG------ISCAAAGGDGKTV  395
             MAV T+Y+ Q+L+ST  +++   +   +QVF Y++   +        I+CAA     +TV
Sbjct  1     MAVSTIYSTQALNSTHFLTSSPSSSTSKQVFFYRRHQSQTNRRFNTIITCAAQ----QTV  56

Query  396   VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTG  575
             VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTG
Sbjct  57    VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTG  116

Query  576   RKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEG  755
             RKEKGVTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLD PEL +PPKILVIEG
Sbjct  117   RKEKGVTALDPRANDFDLMYEQVKALKSGIAVEKPIYNHVTGLLDAPELIQPPKILVIEG  176

Query  756   LHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI  935
             LHPM+D RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA+I
Sbjct  177   LHPMFDERVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFI  236

Query  936   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGR  1115
             DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTISWIPCGR
Sbjct  237   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGR  296

Query  1116  KLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQM  1295
             KLTCSYPGIKF Y PDTYF HEVSVLEMDGQFDRLDELIYVESHLS+LS+KFYGEVTQQM
Sbjct  297   KLTCSYPGIKFNYEPDTYFDHEVSVLEMDGQFDRLDELIYVESHLSNLSSKFYGEVTQQM  356

Query  1296  LKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATR  1400
             LKHADFPGSNNGTG FQTIVGLKIRDLYEQ++A +
Sbjct  357   LKHADFPGSNNGTGLFQTIVGLKIRDLYEQLIANK  391



>ref|XP_009397815.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/395 (85%), Positives = 358/395 (91%), Gaps = 14/395 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVY------KKSARKVG-ISCAAAGGD  383
             MA C VYT  SLHS CSI++P KT     QRQV  +      K+  R    ++C+A   +
Sbjct  1     MATCAVYTTPSLHS-CSITSPAKTSLGFHQRQVIFFTSRRITKRGGRSTSEVTCSA---E  56

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSL
Sbjct  57    AKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSL  116

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKEKGVTALDPRAN+FDLMYEQVKALK+G AVDKPIYNHVTGLLDPPEL +PPKIL
Sbjct  117   DRTGRKEKGVTALDPRANNFDLMYEQVKALKDGVAVDKPIYNHVTGLLDPPELIRPPKIL  176

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPM+D RVRELLDFSIYLDIS+EVKFAWKIQRDMAERGHSLESIKASIEARKPDF
Sbjct  177   VIEGLHPMFDPRVRELLDFSIYLDISDEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  236

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DAYIDPQKQ+ADAV+EVLPTQLIPDDNEGKVLRVRLIMKEG+KHFSPVYLFDEGSTISWI
Sbjct  237   DAYIDPQKQHADAVVEVLPTQLIPDDNEGKVLRVRLIMKEGLKHFSPVYLFDEGSTISWI  296

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKF Y PDTY+ +EVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEV
Sbjct  297   PCGRKLTCSYPGIKFAYAPDTYYSNEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEV  356

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQI  1388
             TQQMLKH+DFPGSNNGTG FQTIVGLKIRDL+EQI
Sbjct  357   TQQMLKHSDFPGSNNGTGLFQTIVGLKIRDLFEQI  391



>ref|XP_003570158.1| PREDICTED: phosphoribulokinase, chloroplastic [Brachypodium distachyon]
Length=404

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/406 (82%), Positives = 358/406 (88%), Gaps = 15/406 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVY----------KKSARKVGISCAAAGGD  383
             MA+C+ +T  SL S C+  + T    Q QV ++          +  AR   +SC A    
Sbjct  1     MAICSAHTTTSLRSPCTTISNTGLR-QNQVILFTTRSSRRGSTRHGARTFQVSCTAE---  56

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              K ++IGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSL
Sbjct  57    -KPIIIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSL  115

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKEKGVTALDP+ANDFDLMYEQVKA+KEGKA++KPIYNHVTGLLDP EL +PPKI 
Sbjct  116   DRTGRKEKGVTALDPKANDFDLMYEQVKAIKEGKAIEKPIYNHVTGLLDPAELIQPPKIF  175

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF
Sbjct  176   VIEGLHPMYDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  235

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DAYIDPQKQYADAVIEVLPT LIPDDNEGKVLRV+LIMKEGVK+F+PVYLFDEGS+ISWI
Sbjct  236   DAYIDPQKQYADAVIEVLPTLLIPDDNEGKVLRVKLIMKEGVKYFNPVYLFDEGSSISWI  295

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKF+YGPDTYFG EVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEV
Sbjct  296   PCGRKLTCSYPGIKFSYGPDTYFGQEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEV  355

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TQQMLKH+DFPGSNNGTG FQTIVGLKIRDLYEQI+A RA  P EA
Sbjct  356   TQQMLKHSDFPGSNNGTGLFQTIVGLKIRDLYEQIIAERAGVPAEA  401



>sp|P26302.1|KPPR_WHEAT RecName: Full=Phosphoribulokinase, chloroplastic; Short=PRK; 
Short=PRKase; AltName: Full=Phosphopentokinase; Flags: Precursor 
[Triticum aestivum]
 pir||S15743 phosphoribulokinase (EC 2.7.1.19) - wheat
 emb|CAB56544.1| phosphoribulokinase [Triticum aestivum]
Length=404

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/406 (82%), Positives = 356/406 (88%), Gaps = 15/406 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVY----------KKSARKVGISCAAAGGD  383
             MA C+ +T  SL S C+ + P     Q QV  +          +  AR   +SCA     
Sbjct  1     MAFCSPHTTTSLRSPCT-TIPNSGFRQNQVIFFTTRSSRRSNTRHGARTFQVSCAVE---  56

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              + +VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSL
Sbjct  57    -QPIVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSL  115

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKEKGVTALDP+ANDFDLMYEQVKA+KEGKA++KPIYNHVTGLLDP EL +PPKI 
Sbjct  116   DRTGRKEKGVTALDPKANDFDLMYEQVKAIKEGKAIEKPIYNHVTGLLDPAELIQPPKIF  175

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPMYD RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF
Sbjct  176   VIEGLHPMYDERVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  235

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DA+IDPQKQYADAVIEVLPTQLIPDDNEGKVLRV+LIMKEG+K F+PVYLFDEGSTI+WI
Sbjct  236   DAFIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVKLIMKEGIKFFNPVYLFDEGSTINWI  295

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKF+YGPDTYFG EVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEV
Sbjct  296   PCGRKLTCSYPGIKFSYGPDTYFGQEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEV  355

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQI+A RA  P EA
Sbjct  356   TQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIIAERAGVPAEA  401



>ref|XP_006647733.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Oryza brachyantha]
Length=403

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/407 (82%), Positives = 360/407 (88%), Gaps = 18/407 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKK-----------SARKVGISCAAAGG  380
             MA+ +++   SLHS C+ +T  +   Q QV  +              AR   +SC+    
Sbjct  1     MAISSLHATTSLHSPCTTNTSFR---QNQVIFFTTRSSRRGSTRHGGARTFQVSCSV---  54

Query  381   DGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  560
               K VVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHS
Sbjct  55    -DKPVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHS  113

Query  561   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKI  740
             LDRTGRKEKGVTALDPRANDFDLMYEQVKA+KEGKA++KPIYNHVTGLLDPPEL +PPKI
Sbjct  114   LDRTGRKEKGVTALDPRANDFDLMYEQVKAIKEGKAIEKPIYNHVTGLLDPPELIQPPKI  173

Query  741   LVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  920
              VIEGLHPM+D RVR+LLDFSIYLDIS+EVKFAWKIQRDMAERGHSLESIKASIEARKPD
Sbjct  174   FVIEGLHPMFDERVRDLLDFSIYLDISDEVKFAWKIQRDMAERGHSLESIKASIEARKPD  233

Query  921   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             FDA+IDPQKQYADAVIEVLPTQLIPDDNEGKVLRV+LIMKEGVK+F+PVYLFDEGS+I+W
Sbjct  234   FDAFIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVKLIMKEGVKNFNPVYLFDEGSSITW  293

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
             +PCGRKLTCSYPGIKF YGPDTYFG+EVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGE
Sbjct  294   VPCGRKLTCSYPGIKFAYGPDTYFGNEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGE  353

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             VTQQMLKHADFPGSNNGTG FQTI+GLKIRDLYEQI+A RA AP EA
Sbjct  354   VTQQMLKHADFPGSNNGTGLFQTIIGLKIRDLYEQIIAERAGAPTEA  400



>ref|XP_010054105.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW78481.1| hypothetical protein EUGRSUZ_D02625 [Eucalyptus grandis]
Length=410

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/410 (82%), Positives = 359/410 (88%), Gaps = 17/410 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARKV--------------GISCAA  371
             MAVCTV+T Q L+ TCS      +  ++QV      +R                G+   +
Sbjct  1     MAVCTVHTTQLLNPTCS---SIASFHKKQVLFCTYGSRATKRGGVIIQSHPSSPGVVICS  57

Query  372   AGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDD  551
             A G G T+VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDD
Sbjct  58    AAGRGDTLVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDD  117

Query  552   YHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKP  731
             YH+LDRTGRK KGV+ALDPRANDFDLMYEQVKALKEGKAV+KPIYNHVTGLLDPPEL  P
Sbjct  118   YHALDRTGRKGKGVSALDPRANDFDLMYEQVKALKEGKAVEKPIYNHVTGLLDPPELIVP  177

Query  732   PKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR  911
             PKILVIEGLHPM+D RVRELLDFSIYLDIS+EVKFAWKIQRDMAERGHSLESIKASIEAR
Sbjct  178   PKILVIEGLHPMFDQRVRELLDFSIYLDISSEVKFAWKIQRDMAERGHSLESIKASIEAR  237

Query  912   KPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGST  1091
             KPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEG+K+F PVYLFDEGST
Sbjct  238   KPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGLKYFKPVYLFDEGST  297

Query  1092  ISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKF  1271
             ISWIPCGRKLTCSYPGIKF YGPDTYFGHEV VLEMDGQFDRL ELIYVESHLS++STKF
Sbjct  298   ISWIPCGRKLTCSYPGIKFFYGPDTYFGHEVFVLEMDGQFDRLAELIYVESHLSNISTKF  357

Query  1272  YGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             YGEVTQQMLKH+DFPGSNNGTG FQTI+GLKIRDL+EQIVAT+  AP+EA
Sbjct  358   YGEVTQQMLKHSDFPGSNNGTGLFQTIIGLKIRDLWEQIVATKTGAPLEA  407



>ref|XP_008373501.1| PREDICTED: phosphoribulokinase, chloroplastic [Malus domestica]
Length=404

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/406 (83%), Positives = 357/406 (88%), Gaps = 15/406 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPT--KTHFQRQVFVYKKSARKVG--------ISCAAAGGD  383
             MA+C V+T   L+ TC  S+        Q+QV V+ K              I C     +
Sbjct  1     MAICAVHTSGQLNPTCXFSSSLGLSGQKQQQVAVFYKQRSSSSRRSVGVSVIRC-----E  55

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              +T+VIGLAADSGCGKSTFMRRLTSVFGG AEPPKGGNPDSNTLISD TTVICLDDYHSL
Sbjct  56    QETIVIGLAADSGCGKSTFMRRLTSVFGGGAEPPKGGNPDSNTLISDTTTVICLDDYHSL  115

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKEKGVTALDPRANDFDLMYEQVKA+KEGKAV KPIYNHV+GLLDPPEL KPPKIL
Sbjct  116   DRTGRKEKGVTALDPRANDFDLMYEQVKAIKEGKAVQKPIYNHVSGLLDPPELIKPPKIL  175

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF
Sbjct  176   VIEGLHPMYDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  235

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DAYIDPQKQYADAVIEVLPTQLIP DNEGKVLRVRLIMKEGVK+F+PVYLFDEGSTISWI
Sbjct  236   DAYIDPQKQYADAVIEVLPTQLIPGDNEGKVLRVRLIMKEGVKYFNPVYLFDEGSTISWI  295

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKF YGPDTYFG+EVS+LEMDGQFDRLDELIYVESHLS++STKFYGEV
Sbjct  296   PCGRKLTCSYPGIKFNYGPDTYFGNEVSLLEMDGQFDRLDELIYVESHLSNISTKFYGEV  355

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TQQMLKH+DFPGSNNGTG FQTIVGLKIRDLYEQ++A RA  PVEA
Sbjct  356   TQQMLKHSDFPGSNNGTGLFQTIVGLKIRDLYEQLIAARAKTPVEA  401



>gb|KFK44965.1| hypothetical protein AALP_AA1G326600 [Arabis alpina]
Length=402

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/406 (82%), Positives = 363/406 (89%), Gaps = 12/406 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARKVG-------ISCAAAGGDGKT  392
             MAV T+Y+ QSL+ST  +++ + +   + VF Y+++  +         I+CA      +T
Sbjct  1     MAVSTIYSTQSLNSTHFLTSSSSSSTSKHVFFYRRNQSQTNRRFNTTIITCAQQ----QT  56

Query  393   VVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRT  572
             +VIGLAADSGCGKSTFMRRLTSVFGGAAEPP+GGNPDSNTLISD TTVICLDDYHSLDRT
Sbjct  57    IVIGLAADSGCGKSTFMRRLTSVFGGAAEPPRGGNPDSNTLISDTTTVICLDDYHSLDRT  116

Query  573   GRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIE  752
             GRKEKGVTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLD PEL +PPKILVIE
Sbjct  117   GRKEKGVTALDPRANDFDLMYEQVKALKSGVAVEKPIYNHVTGLLDAPELIQPPKILVIE  176

Query  753   GLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAY  932
             GLHPM+D RVR LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA+
Sbjct  177   GLHPMFDERVRSLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAF  236

Query  933   IDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCG  1112
             IDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTISWIPCG
Sbjct  237   IDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCG  296

Query  1113  RKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQ  1292
             RKLTCSYPGIKF Y PD+YF +EVS+LEMDGQFDRLDELIYVESHLS+LS+KFYGEVTQQ
Sbjct  297   RKLTCSYPGIKFNYEPDSYFDNEVSILEMDGQFDRLDELIYVESHLSNLSSKFYGEVTQQ  356

Query  1293  MLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVE-AKA  1427
             MLKHADFPGSNNGTG FQTIVGLKIRDLYEQ++A +A AP E AKA
Sbjct  357   MLKHADFPGSNNGTGLFQTIVGLKIRDLYEQLIANKATAPAETAKA  402



>gb|EMS51337.1| Phosphoribulokinase, chloroplastic [Triticum urartu]
Length=404

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/406 (82%), Positives = 357/406 (88%), Gaps = 15/406 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVY----------KKSARKVGISCAAAGGD  383
             MA C+ ++  SL S C+ + P     Q QV ++          +  AR   +SCA     
Sbjct  1     MAFCSPHSTTSLSSPCT-TIPNSGFRQNQVILFTTRSSRRSNTRHGARTFQVSCAVE---  56

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              + +VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSL
Sbjct  57    -QPIVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSL  115

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKEKGVTALDP+ANDFDLMYEQVKA+KEGKA++KPIYNHVTGLLDP EL +PPKI 
Sbjct  116   DRTGRKEKGVTALDPKANDFDLMYEQVKAIKEGKAIEKPIYNHVTGLLDPAELIQPPKIF  175

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPMYD RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF
Sbjct  176   VIEGLHPMYDERVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  235

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DA+IDPQKQYADAVIEVLPTQLIPDDNEGKVLRV+LIMKEG+K F+PVYLFDEGSTI+WI
Sbjct  236   DAFIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVKLIMKEGIKFFNPVYLFDEGSTINWI  295

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKF+YGPDTYFG EVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEV
Sbjct  296   PCGRKLTCSYPGIKFSYGPDTYFGQEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEV  355

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQI+A RA  P EA
Sbjct  356   TQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIIAERAGVPAEA  401



>dbj|BAJ98572.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93040.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=404

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/406 (83%), Positives = 356/406 (88%), Gaps = 15/406 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKK----------SARKVGISCAAAGGD  383
             MA C+ +T  SL S C+ + P     Q QV ++             AR   +SCA     
Sbjct  1     MAFCSPHTTTSLRSPCT-TIPNSGFRQNQVILFTTRSSRRSTTRHGARTFQVSCAVE---  56

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              K +VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSL
Sbjct  57    -KPIVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSL  115

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKEKGVTALDP+ANDFDLMYEQVKA+KEGKA++KPIYNHVTGLLDP EL +PPKI 
Sbjct  116   DRTGRKEKGVTALDPKANDFDLMYEQVKAIKEGKAIEKPIYNHVTGLLDPAELIQPPKIF  175

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF
Sbjct  176   VIEGLHPMYDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  235

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DA+IDPQKQYADAVIEVLPTQLIPDDNEGKVLRV+LIMKEGVK F+PVYLFDEGSTI+WI
Sbjct  236   DAFIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVKLIMKEGVKFFNPVYLFDEGSTINWI  295

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKF+YGPDTYFG EVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEV
Sbjct  296   PCGRKLTCSYPGIKFSYGPDTYFGQEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEV  355

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQI+A RA  P EA
Sbjct  356   TQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIIAERAGVPAEA  401



>ref|XP_011074792.1| PREDICTED: phosphoribulokinase, chloroplastic [Sesamum indicum]
Length=399

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/385 (87%), Positives = 353/385 (92%), Gaps = 11/385 (3%)
 Frame = +3

Query  291   TPTKTHF----QRQVFVYKKS----ARKVGISCAAAGGDGKTVVIGLAADSGCGKSTFMR  446
             TP KTH     Q QV +Y K+     R+  ISC+A   + KTVVIGLAADSGCGKSTFMR
Sbjct  15    TPPKTHLGLFNQNQVVLYGKTTTTTCRRRFISCSA---EDKTVVIGLAADSGCGKSTFMR  71

Query  447   RLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGVTALDPRANDFD  626
             RLTSVFGGAAEPPKGGNPDSNTLIS+MTTVICLDDYHSLDRTGRKEKGVTALDPRANDFD
Sbjct  72    RLTSVFGGAAEPPKGGNPDSNTLISEMTTVICLDDYHSLDRTGRKEKGVTALDPRANDFD  131

Query  627   LMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSI  806
             LMY QVKA+KEG  VDKPIYNHV+GLLDPPEL KPPKILVIEGLHPMYDARVRELLDFSI
Sbjct  132   LMYHQVKAIKEGIPVDKPIYNHVSGLLDPPELIKPPKILVIEGLHPMYDARVRELLDFSI  191

Query  807   YLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQ  986
             YLDISNEVKFAWKIQRDMAERGHSLESIKASI+ARK DFDAYIDPQKQYADAVI+VLPTQ
Sbjct  192   YLDISNEVKFAWKIQRDMAERGHSLESIKASIDARKSDFDAYIDPQKQYADAVIQVLPTQ  251

Query  987   LIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDT  1166
             LIPDDNEG VLRVRLIMKEGVK+F PVYLFDEGSTISWIPCGRKLTCSYPGIKFTY PDT
Sbjct  252   LIPDDNEGNVLRVRLIMKEGVKYFDPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYCPDT  311

Query  1167  YFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQ  1346
             Y+GHEVSVLEMDGQFDRLDELIYVESHLS++STKFYGEVTQQMLKHADFPGSNNGTG FQ
Sbjct  312   YYGHEVSVLEMDGQFDRLDELIYVESHLSNISTKFYGEVTQQMLKHADFPGSNNGTGLFQ  371

Query  1347  TIVGLKIRDLYEQIVATRAAAPVEA  1421
             TI+GLKIRDLYEQI  T+ AAP+EA
Sbjct  372   TIIGLKIRDLYEQITRTKTAAPLEA  396



>ref|XP_002890967.1| hypothetical protein ARALYDRAFT_890765 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67226.1| hypothetical protein ARALYDRAFT_890765 [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/403 (83%), Positives = 364/403 (90%), Gaps = 13/403 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKK---SARKVG--ISCAAAGGDGKTVV  398
             MAV T+Y+ Q+L+ST  +++ + +   +QVF+Y++   + R+    I+CA      +T+V
Sbjct  1     MAVSTIYSTQALNSTHFLTSSSSS---KQVFLYRRQPQTNRRFNTLITCAQ-----ETIV  52

Query  399   IGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGR  578
             IGLAADSGCGKSTFMRRLTSVFGGAA+PPKGGNPDSNTLISD TTVICLDDYHSLDR GR
Sbjct  53    IGLAADSGCGKSTFMRRLTSVFGGAAKPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGR  112

Query  579   KEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGL  758
             KE+ VTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLDPPEL +PPKILVIEGL
Sbjct  113   KEQKVTALDPRANDFDLMYEQVKALKSGVAVEKPIYNHVTGLLDPPELIQPPKILVIEGL  172

Query  759   HPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYID  938
             HPM+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA+ID
Sbjct  173   HPMFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFID  232

Query  939   PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRK  1118
             PQKQYADAVIEVLPT LIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTISWIPCGRK
Sbjct  233   PQKQYADAVIEVLPTTLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGRK  292

Query  1119  LTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQML  1298
             LTCSYPGIKF Y PD+YF HEVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEVTQQML
Sbjct  293   LTCSYPGIKFNYEPDSYFDHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQML  352

Query  1299  KHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             KHADFPGSNNGTG FQTIVGLKIRDLYEQ++A +A A  EAKA
Sbjct  353   KHADFPGSNNGTGLFQTIVGLKIRDLYEQLIANKATARAEAKA  395



>ref|NP_174486.1| phosphoribulokinase [Arabidopsis thaliana]
 sp|P25697.1|KPPR_ARATH RecName: Full=Phosphoribulokinase, chloroplastic; Short=PRK; 
Short=PRKase; AltName: Full=Phosphopentokinase; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG50797.1|AC074309_14 phosphoribulokinase precursor [Arabidopsis thaliana]
 emb|CAA41155.1| Ribulose-5-phosphate kinase [Arabidopsis thaliana]
 gb|AAK73276.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM61142.1| phosphoribulokinase precursor [Arabidopsis thaliana]
 gb|AAM91558.1| phosphoribulokinase precursor [Arabidopsis thaliana]
 gb|AAN15338.1| phosphoribulokinase precursor [Arabidopsis thaliana]
 gb|AEE31430.1| phosphoribulokinase [Arabidopsis thaliana]
Length=395

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/403 (83%), Positives = 364/403 (90%), Gaps = 13/403 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKK---SARKVG--ISCAAAGGDGKTVV  398
             MAV T+Y+ Q+L+ST  +++ + +   +QVF+Y++   + R+    I+CA      +T+V
Sbjct  1     MAVSTIYSTQALNSTHFLTSSSSS---KQVFLYRRQPQTNRRFNTLITCAQ-----ETIV  52

Query  399   IGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGR  578
             IGLAADSGCGKSTFMRRLTSVFGGAA+PPKGGNPDSNTLISD TTVICLDDYHSLDR GR
Sbjct  53    IGLAADSGCGKSTFMRRLTSVFGGAAKPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGR  112

Query  579   KEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGL  758
             KE+ VTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLDPPEL +PPKILVIEGL
Sbjct  113   KEQKVTALDPRANDFDLMYEQVKALKNGIAVEKPIYNHVTGLLDPPELIQPPKILVIEGL  172

Query  759   HPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYID  938
             HPM+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA+ID
Sbjct  173   HPMFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFID  232

Query  939   PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRK  1118
             PQKQYADAVIEVLPT LIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTISWIPCGRK
Sbjct  233   PQKQYADAVIEVLPTTLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGRK  292

Query  1119  LTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQML  1298
             LTCSYPGIKF Y PD+YF HEVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEVTQQML
Sbjct  293   LTCSYPGIKFNYEPDSYFDHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQML  352

Query  1299  KHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             KHADFPGSNNGTG FQTIVGLKIRDLYEQ++A +A A  EAKA
Sbjct  353   KHADFPGSNNGTGLFQTIVGLKIRDLYEQLIANKATARAEAKA  395



>ref|XP_010478623.1| PREDICTED: phosphoribulokinase, chloroplastic [Camelina sativa]
Length=395

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/403 (82%), Positives = 364/403 (90%), Gaps = 13/403 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKK---SARKVG--ISCAAAGGDGKTVV  398
             MAV T+Y+ Q+L+ST  +++ + +   +QVF+Y++   + R+    I+C+      +T+V
Sbjct  1     MAVSTIYSTQALNSTHFLTSSSSS---KQVFLYRRQPQTNRRFNTLITCSQ-----ETIV  52

Query  399   IGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGR  578
             IGLAADSGCGKSTFMRRLTSVFGGAA+PPKGGNPDSNTLISD TTVICLDDYHSLDR GR
Sbjct  53    IGLAADSGCGKSTFMRRLTSVFGGAAKPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGR  112

Query  579   KEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGL  758
             KE+ VTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLD PEL +PPKILVIEGL
Sbjct  113   KEQKVTALDPRANDFDLMYEQVKALKSGVAVEKPIYNHVTGLLDAPELIQPPKILVIEGL  172

Query  759   HPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYID  938
             HPM+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA+ID
Sbjct  173   HPMFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFID  232

Query  939   PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRK  1118
             PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTISWIPCGRK
Sbjct  233   PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGRK  292

Query  1119  LTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQML  1298
             LTCSYPGIKF Y PD+YF HEVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEVTQQML
Sbjct  293   LTCSYPGIKFNYEPDSYFDHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQML  352

Query  1299  KHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             KHADFPGSNNGTG FQTIVGLKIRDLYEQ++A +A A  EAKA
Sbjct  353   KHADFPGSNNGTGLFQTIVGLKIRDLYEQLIANKATARAEAKA  395



>emb|CAA41020.1| phosphoribulokinase [Triticum aestivum]
Length=404

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/406 (82%), Positives = 356/406 (88%), Gaps = 15/406 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVY----------KKSARKVGISCAAAGGD  383
             MA C+ ++  SL S C+ + P     Q QV ++          +  AR   +SCA     
Sbjct  1     MAFCSPHSTTSLRSPCT-TIPNSGFRQNQVILFTTRSSRRSNTRHGARTFQVSCAVE---  56

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              + +VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSL
Sbjct  57    -QPIVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSL  115

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKEKGVTALDP+ANDFDLMYEQVKA+KEGKA++KPIYNHVTGLLDP EL +PPKI 
Sbjct  116   DRTGRKEKGVTALDPKANDFDLMYEQVKAIKEGKAIEKPIYNHVTGLLDPAELIQPPKIF  175

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPMYD RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF
Sbjct  176   VIEGLHPMYDERVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  235

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DA+I PQKQYADAVIEVLPTQLIPDDNEGKVLRV+LIMKEG+K F+PVYLFDEGSTI+WI
Sbjct  236   DAFIGPQKQYADAVIEVLPTQLIPDDNEGKVLRVKLIMKEGIKFFNPVYLFDEGSTINWI  295

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKF+YGPDTYFG EVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEV
Sbjct  296   PCGRKLTCSYPGIKFSYGPDTYFGQEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEV  355

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQI+A RA  P EA
Sbjct  356   TQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIIAERAGVPAEA  401



>ref|XP_004953549.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Setaria italica]
Length=403

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/406 (82%), Positives = 359/406 (88%), Gaps = 16/406 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF-QRQVFVYKKSARKVG---------ISCAAAGGD  383
             MA+ + +T  SLHS C+  T +   F Q+QV  +  + R            ISC+     
Sbjct  1     MAISSAHTTTSLHSPCT--TVSNAGFRQKQVIFFTSNRRGGRRHGGARTFQISCSVE---  55

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              K VVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSL
Sbjct  56    -KPVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSL  114

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKEKGVTALDPRAN+FDLMYEQVKA+KEG+ ++KPIYNHVTGLLDPPE+  PPKI 
Sbjct  115   DRTGRKEKGVTALDPRANNFDLMYEQVKAIKEGQTIEKPIYNHVTGLLDPPEVITPPKIF  174

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPM+D RVR+LLDFSIYLDIS+EVKFAWKIQRDMAERGHSLESI+ASIEARKPDF
Sbjct  175   VIEGLHPMFDERVRDLLDFSIYLDISDEVKFAWKIQRDMAERGHSLESIQASIEARKPDF  234

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DA+IDPQKQYADAVIEVLPTQLIPDDNEGKVLRV+LIMKEGVKHF+PVYLFDEGS+ISW+
Sbjct  235   DAFIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVKLIMKEGVKHFNPVYLFDEGSSISWV  294

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKF YGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEV
Sbjct  295   PCGRKLTCSYPGIKFAYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEV  354

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQIVA RA AP E+
Sbjct  355   TQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIVAERAGAPAES  400



>ref|XP_009373513.1| PREDICTED: phosphoribulokinase, chloroplastic [Pyrus x bretschneideri]
Length=404

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/406 (83%), Positives = 358/406 (88%), Gaps = 15/406 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQ--VFVYKKSARKVG--------ISCAAAGGD  383
             MA+C V+T   L+ T S S+      Q+Q  V V+ K              I C     +
Sbjct  1     MAICAVHTSGQLNPTYSFSSSLGFSGQKQQQVAVFYKQRSSSSRRSVGVSVIRC-----E  55

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              +T+VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSL
Sbjct  56    QETIVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSL  115

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKEKGVTALDPRANDFDLMYEQVKA+KEGKAV+KPIYNHV+GLLDPPEL KPPKIL
Sbjct  116   DRTGRKEKGVTALDPRANDFDLMYEQVKAIKEGKAVEKPIYNHVSGLLDPPELIKPPKIL  175

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF
Sbjct  176   VIEGLHPMYDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  235

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DAYIDPQKQYADAVIEVLPTQLIP DNEGKVLRVRLIMKEGVK+F+PVYLFDEGSTISWI
Sbjct  236   DAYIDPQKQYADAVIEVLPTQLIPGDNEGKVLRVRLIMKEGVKYFNPVYLFDEGSTISWI  295

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKF YGPDTYF HEVS+LEMDGQFDRLDELIYVESHLS++STKFYGEV
Sbjct  296   PCGRKLTCSYPGIKFNYGPDTYFSHEVSLLEMDGQFDRLDELIYVESHLSNISTKFYGEV  355

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TQQMLKH+DFPGSNNGTG FQTIVGLKIRDLYEQ++A RA  PVEA
Sbjct  356   TQQMLKHSDFPGSNNGTGLFQTIVGLKIRDLYEQLIAARAKTPVEA  401



>gb|EMT24657.1| Phosphoribulokinase, chloroplastic [Aegilops tauschii]
Length=401

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/403 (82%), Positives = 354/403 (88%), Gaps = 15/403 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVY----------KKSARKVGISCAAAGGD  383
             MA C+ +T  SL S C+ + P     Q QV  +          +  AR   +SCA     
Sbjct  1     MAFCSPHTTTSLRSPCT-TIPNSGFRQNQVIFFTTRSSRRSNTRHGARTFQVSCAVE---  56

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              + +VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSL
Sbjct  57    -QPIVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSL  115

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKEKGVTALDP+ANDFDLMYEQVKA+KEGKA++KPIYNHVTGLLDP EL +PPKI 
Sbjct  116   DRTGRKEKGVTALDPKANDFDLMYEQVKAIKEGKAIEKPIYNHVTGLLDPAELIQPPKIF  175

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPMYD RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF
Sbjct  176   VIEGLHPMYDERVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  235

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DA+IDPQKQYADAVIEVLPTQLIPDDNEGKVLRV+LIMKEG+K F+PVYLFDEGSTI+WI
Sbjct  236   DAFIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVKLIMKEGIKFFNPVYLFDEGSTINWI  295

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKF+YGPDTYFG EVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEV
Sbjct  296   PCGRKLTCSYPGIKFSYGPDTYFGQEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEV  355

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAP  1412
             TQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQI+A RA  P
Sbjct  356   TQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIIAERAGVP  398



>ref|NP_001149223.1| LOC100282845 [Zea mays]
 gb|ACF84252.1| unknown [Zea mays]
 gb|ACF86479.1| unknown [Zea mays]
 gb|ACG34613.1| phosphoribulokinase [Zea mays]
 gb|AFW72928.1| phosphoribulokinase [Zea mays]
Length=405

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/406 (81%), Positives = 355/406 (87%), Gaps = 14/406 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSAR----------KVGISCAAAGGD  383
             MA+C+ +T  SL S C+  +      ++ +FV                   +SC+     
Sbjct  1     MAICSAHTTTSLRSPCTTVSNAGLRQKQVIFVTSNRRSGGGRRHGGARSFQVSCSV----  56

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              K VVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSL
Sbjct  57    DKPVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSL  116

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DR GRKEKGVTALDPRAN+FDLMYEQVKA+KEG+AV+KPIYNHVTGLLDPPEL  PPKI 
Sbjct  117   DRNGRKEKGVTALDPRANNFDLMYEQVKAIKEGQAVEKPIYNHVTGLLDPPELIAPPKIF  176

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPM+D RVR+LLDFSIYLDIS+EVKFAWKIQRDMAERGHSLESIKASIEARKPDF
Sbjct  177   VIEGLHPMFDERVRDLLDFSIYLDISDEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  236

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DA+IDPQKQYADAVIEVLPTQLIPDDNEGKVLRV+LIMKEGVK+F+PVYLFDEGSTISW+
Sbjct  237   DAFIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVKLIMKEGVKNFNPVYLFDEGSTISWV  296

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKF+YGPDTYFG+EVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEV
Sbjct  297   PCGRKLTCSYPGIKFSYGPDTYFGNEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEV  356

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TQQMLKHADFPGSNNGTG FQTI+GLKIRDLYEQIVA RA  P EA
Sbjct  357   TQQMLKHADFPGSNNGTGLFQTIIGLKIRDLYEQIVAERAGVPAEA  402



>ref|XP_010677417.1| PREDICTED: phosphoribulokinase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=403

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/413 (81%), Positives = 358/413 (87%), Gaps = 30/413 (7%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF----QRQVFVYKKSARKVG-------------IS  362
             MAVCTVYT+           PT TH     + QV+ Y                     I+
Sbjct  1     MAVCTVYTI-----------PTTTHLGFNQKNQVYFYNNKTYNYKRANNFFTRPYPYVIT  49

Query  363   CAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVIC  542
             C+A  GD +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVIC
Sbjct  50    CSA--GDSQTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVIC  107

Query  543   LDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPEL  722
             LDD+HSLDRTGRKEKGVTALDPRANDFDLMY+QVKALK+GK VDKPIYNHV+GLLDPPE+
Sbjct  108   LDDFHSLDRTGRKEKGVTALDPRANDFDLMYDQVKALKQGKPVDKPIYNHVSGLLDPPEV  167

Query  723   TKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI  902
              +PPKILVIEGLHPMYDARVRELLDFS+YLDISNEVKFAWKIQRDM ERGHSLESIKASI
Sbjct  168   IQPPKILVIEGLHPMYDARVRELLDFSLYLDISNEVKFAWKIQRDMKERGHSLESIKASI  227

Query  903   EARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDE  1082
             EARKPDFDAYIDPQKQYAD VIEVLPTQLIPDD+EGKVLRVR+I KEGVK F+PVYLFDE
Sbjct  228   EARKPDFDAYIDPQKQYADVVIEVLPTQLIPDDDEGKVLRVRMIQKEGVKFFNPVYLFDE  287

Query  1083  GSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLS  1262
             GSTISWIPCGRKLTCSYPGIKF+YGPDTYFG+EV+VLEMDG FDRLDELIYVESHLS+LS
Sbjct  288   GSTISWIPCGRKLTCSYPGIKFSYGPDTYFGNEVTVLEMDGIFDRLDELIYVESHLSNLS  347

Query  1263  TKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TKFYGEVTQQMLKH DFPGSNNGTGFFQTI+GLKIRDL+EQ+VA+R+ AP  A
Sbjct  348   TKFYGEVTQQMLKHQDFPGSNNGTGFFQTIIGLKIRDLFEQLVASRSGAPAAA  400



>ref|XP_009145215.1| PREDICTED: phosphoribulokinase, chloroplastic [Brassica rapa]
Length=395

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/392 (84%), Positives = 358/392 (91%), Gaps = 10/392 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARK---VGISCAAAGGDGKTVVIG  404
             MAV T+Y+ Q+L+ST   ++ + +   +QVF Y++   +     I+CAA     +TVVIG
Sbjct  1     MAVSTIYSTQALNSTHFFTSSSSS---KQVFFYRRQNNRRFNTIITCAAQ----QTVVIG  53

Query  405   LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKE  584
             LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKE
Sbjct  54    LAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKE  113

Query  585   KGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHP  764
             KGVTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLD PEL +PPKILVIEGLHP
Sbjct  114   KGVTALDPRANDFDLMYEQVKALKSGIAVEKPIYNHVTGLLDAPELIQPPKILVIEGLHP  173

Query  765   MYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQ  944
             M+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF+A+IDPQ
Sbjct  174   MFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFEAFIDPQ  233

Query  945   KQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLT  1124
             KQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTISWIPCGRKLT
Sbjct  234   KQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGRKLT  293

Query  1125  CSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKH  1304
             CSYPGIKF Y PD+YF HEVSV+EMDGQFDRLDELIYVESHLS+LSTKFYGEVTQQMLKH
Sbjct  294   CSYPGIKFNYAPDSYFDHEVSVVEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQMLKH  353

Query  1305  ADFPGSNNGTGFFQTIVGLKIRDLYEQIVATR  1400
             ADFPGSNNGTG FQTIVGLKIRDLYEQ++A +
Sbjct  354   ADFPGSNNGTGLFQTIVGLKIRDLYEQLIANK  385



>ref|XP_009347088.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Pyrus x bretschneideri]
Length=403

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/408 (82%), Positives = 359/408 (88%), Gaps = 15/408 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQ--VFVYKKSARKVG--------ISCAAAGGD  383
             MA+C V+T   L+ T S S+      Q+Q  V V+ K              I C     +
Sbjct  1     MAICAVHTSGQLNPTYSFSSSLGFSGQKQQQVAVFYKQRSSSSRRSVGVSVIRC-----E  55

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              +T+VIGLAADSGCGKSTFMRRLTSVFGGAA+PPKGGNPDSNTLISD TTVICLDDYHSL
Sbjct  56    QETIVIGLAADSGCGKSTFMRRLTSVFGGAAKPPKGGNPDSNTLISDTTTVICLDDYHSL  115

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKEKGVTALDPRANDFDLMYEQVKA+KEGKAV+KPIYNHV+GLLDPPEL KPPKIL
Sbjct  116   DRTGRKEKGVTALDPRANDFDLMYEQVKAIKEGKAVEKPIYNHVSGLLDPPELIKPPKIL  175

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF
Sbjct  176   VIEGLHPMYDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  235

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DAYIDPQKQYADAVIEVLPT+LIP DNEGKVLRVRLIMKEGVK+F+PVYLFDEGSTISWI
Sbjct  236   DAYIDPQKQYADAVIEVLPTELIPGDNEGKVLRVRLIMKEGVKYFNPVYLFDEGSTISWI  295

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             P GRKLTCSYPGIKF YGPDTYFG+EVSVLEMDGQFDRLDELIYVESHLS++STKFYGEV
Sbjct  296   PWGRKLTCSYPGIKFNYGPDTYFGNEVSVLEMDGQFDRLDELIYVESHLSNISTKFYGEV  355

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             TQQMLKH+DFPGSNNGTG FQTIVGLKIRDLYEQ++A RA  P EAKA
Sbjct  356   TQQMLKHSDFPGSNNGTGLFQTIVGLKIRDLYEQLIAARAKTPAEAKA  403



>ref|XP_008809216.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Phoenix dactylifera]
Length=409

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/396 (83%), Positives = 348/396 (88%), Gaps = 10/396 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVY-------KKSARKVGISCAAAGGD  383
             MAVC   T  SL S C  S PTKT+F   QRQ  ++            K          +
Sbjct  1     MAVCAASTTPSLRSPCCASNPTKTYFGFSQRQQVIFYTGGRRSSGRGGKNNSQAFYCSAE  60

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              +TVVIGLAADSGCGKSTFMRR+TSVFGGAAEPP+GGNPDSNTLISD TTVICLDDYHSL
Sbjct  61    AQTVVIGLAADSGCGKSTFMRRMTSVFGGAAEPPRGGNPDSNTLISDTTTVICLDDYHSL  120

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DRTGRKEKGVTALDPRAN+FDLMYEQVKALKEG  V+KPIYNHVTGLLDPPEL +PPKIL
Sbjct  121   DRTGRKEKGVTALDPRANNFDLMYEQVKALKEGVPVEKPIYNHVTGLLDPPELIQPPKIL  180

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHPMYD RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIE+RKPDF
Sbjct  181   VIEGLHPMYDPRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIESRKPDF  240

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DAYIDPQKQYADAVI+VLPTQLIPDDNEGKVLRVRLIMKEG K+FSPVYLFDEGSTISWI
Sbjct  241   DAYIDPQKQYADAVIDVLPTQLIPDDNEGKVLRVRLIMKEGSKYFSPVYLFDEGSTISWI  300

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTCSYPGIKF YGPD YF HEVSVLEMDGQFD+LDELIYVESHLS++STKFYGEV
Sbjct  301   PCGRKLTCSYPGIKFFYGPDAYFSHEVSVLEMDGQFDKLDELIYVESHLSNISTKFYGEV  360

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIV  1391
             TQQMLKHADFPGSNNGTG FQTI+GLKIRDLYEQI+
Sbjct  361   TQQMLKHADFPGSNNGTGLFQTIIGLKIRDLYEQII  396



>ref|XP_006854101.1| hypothetical protein AMTR_s00048p00138890 [Amborella trichopoda]
 gb|ERN15568.1| hypothetical protein AMTR_s00048p00138890 [Amborella trichopoda]
Length=409

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/407 (82%), Positives = 357/407 (88%), Gaps = 14/407 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF--------QRQVFVYKKSARKVG----ISCAAAG  377
             MA CTVYT  SL S+ +IS  T   F        + Q+   K++ ++      I+C+   
Sbjct  1     MASCTVYTTHSLSSSGTISK-TSIGFLHQSPLRPENQIIFCKRTTKRPNSLSTITCSVPE  59

Query  378   GDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYH  557
                KTVVIGLAADSGCGKSTFMRRLTSVFGG A PPKGGNPDSNTLISD TTVICLDDYH
Sbjct  60    YP-KTVVIGLAADSGCGKSTFMRRLTSVFGGDAAPPKGGNPDSNTLISDTTTVICLDDYH  118

Query  558   SLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPK  737
             SLDR GRK KGVTALDPRANDFDLMY QVKALKEGKAV+KPIYNHV+GLLDPPEL +PPK
Sbjct  119   SLDRNGRKVKGVTALDPRANDFDLMYTQVKALKEGKAVEKPIYNHVSGLLDPPELIQPPK  178

Query  738   ILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKP  917
             ILVIEGLHPMYD RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKP
Sbjct  179   ILVIEGLHPMYDERVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKP  238

Query  918   DFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTIS  1097
             DFDAYIDPQKQYADAVIEVLPTQLIPDDNEGK+LRV+L+MKEGVK+FSPVYLFDEGSTIS
Sbjct  239   DFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKILRVKLVMKEGVKYFSPVYLFDEGSTIS  298

Query  1098  WIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYG  1277
             WIPCGRKLTCSYPGIKF YGPD YF +EVS+LEMDGQFDRLDELIYVESHLS+LSTKFYG
Sbjct  299   WIPCGRKLTCSYPGIKFFYGPDAYFSNEVSILEMDGQFDRLDELIYVESHLSNLSTKFYG  358

Query  1278  EVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVE  1418
             EVTQQMLKH DFPGSNNGTG FQTIVGLKIRDLYEQIVA+RA A +E
Sbjct  359   EVTQQMLKHVDFPGSNNGTGLFQTIVGLKIRDLYEQIVASRAGATLE  405



>ref|NP_001146247.1| uncharacterized protein LOC100279820 [Zea mays]
 gb|ACL53563.1| unknown [Zea mays]
Length=415

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/413 (81%), Positives = 357/413 (86%), Gaps = 19/413 (5%)
 Frame = +3

Query  234   MAVCTVYTVQ-SLHSTCS--ISTPTKTHFQRQVFVYKK--------------SARKVGIS  362
             MA+C+ +T   SL S C+  +S       Q+QV                   S   + +S
Sbjct  2     MAICSAHTTTISLRSPCTTTVSNAAAGLVQKQVIFLTSINRRSGSRRRGGGVSRTLLQVS  61

Query  363   CAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVIC  542
             C+A G   K VVIGLAADSGCGKSTFMRRLTSVFGGAAEPP+GGNPDSNTLISD TTVIC
Sbjct  62    CSADGN--KPVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPRGGNPDSNTLISDTTTVIC  119

Query  543   LDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPEL  722
             LDDYHSLDRTGRKEKGVTALDPRAN+FDLMYEQVKA+K+G+AV KPIYNHVTGLLDPPEL
Sbjct  120   LDDYHSLDRTGRKEKGVTALDPRANNFDLMYEQVKAIKQGQAVQKPIYNHVTGLLDPPEL  179

Query  723   TKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI  902
               PPKI VIEGLHPM+D RVR+LLDFSIYLDIS+EVKFAWKIQRDMAERGHSLESIKASI
Sbjct  180   ITPPKIFVIEGLHPMFDERVRDLLDFSIYLDISDEVKFAWKIQRDMAERGHSLESIKASI  239

Query  903   EARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDE  1082
             EARKPDFDAYIDPQKQYADAVIEVLPTQLIPDD+EGKVLRV+LIMKEGV  F+PVYLFDE
Sbjct  240   EARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDDEGKVLRVKLIMKEGVDKFNPVYLFDE  299

Query  1083  GSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLS  1262
             GSTISW+PCGRKLTCSYPGIKF YGPD YFG+EVSVLEMDGQFDRLDELIYVESHLS+LS
Sbjct  300   GSTISWVPCGRKLTCSYPGIKFAYGPDIYFGNEVSVLEMDGQFDRLDELIYVESHLSNLS  359

Query  1263  TKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TKFYGEVTQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQIVA RA APVEA
Sbjct  360   TKFYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIVAERAGAPVEA  412



>ref|XP_010461025.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Camelina 
sativa]
Length=396

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/394 (83%), Positives = 359/394 (91%), Gaps = 13/394 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKK---SARKVG--ISCAAAGGDGKTVV  398
             MAV T+Y+ Q+L+ST  +++ + +   +QVF+Y++   + R+    I+C+      +T+V
Sbjct  1     MAVSTIYSTQALNSTHFLTSSSSS---KQVFLYRRQPQTNRRFNTLITCSQ-----ETIV  52

Query  399   IGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGR  578
             IGLAADSGCGKSTFMRRLTSVFGGAA+PPKGGNPDSNTLISD TTVICLDDYHSLDR GR
Sbjct  53    IGLAADSGCGKSTFMRRLTSVFGGAAKPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGR  112

Query  579   KEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGL  758
             KE+ VTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLDPPEL +PPKILVIEGL
Sbjct  113   KEQKVTALDPRANDFDLMYEQVKALKSGVAVEKPIYNHVTGLLDPPELIQPPKILVIEGL  172

Query  759   HPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYID  938
             HPM+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA+ID
Sbjct  173   HPMFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFID  232

Query  939   PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRK  1118
             PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTISWIPCGRK
Sbjct  233   PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGRK  292

Query  1119  LTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQML  1298
             LTCSYPGIKF Y PD+YF HEVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEVTQQML
Sbjct  293   LTCSYPGIKFNYEPDSYFDHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQML  352

Query  1299  KHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATR  1400
             KHADFPGSNNGTG FQTIVGLKIRDLYEQ++A +
Sbjct  353   KHADFPGSNNGTGLFQTIVGLKIRDLYEQLIANK  386



>gb|EPS63825.1| phosphoribulokinase, partial [Genlisea aurea]
Length=377

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/355 (91%), Positives = 342/355 (96%), Gaps = 3/355 (1%)
 Frame = +3

Query  345   RKVGISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD  524
             R++  SC+A   + KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPP+GGNPDSNTL+SD
Sbjct  21    RRIITSCSA---EDKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPRGGNPDSNTLVSD  77

Query  525   MTTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGL  704
              TTVICLDDYHSLDRTGRKEKGVTALDPRAN+FDLMYEQVKALK+G AVDKPIYNHV+GL
Sbjct  78    TTTVICLDDYHSLDRTGRKEKGVTALDPRANNFDLMYEQVKALKDGVAVDKPIYNHVSGL  137

Query  705   LDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLE  884
             LDPPEL KPPKILVIEGLHPM+D+RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLE
Sbjct  138   LDPPELIKPPKILVIEGLHPMFDSRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLE  197

Query  885   SIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSP  1064
             SIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEG+VLRVRLIMKEGVK+FSP
Sbjct  198   SIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGRVLRVRLIMKEGVKYFSP  257

Query  1065  VYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVES  1244
             VYLFDEGSTISWIPCGRKLTCSYPGIKF YGPDTYF +EVSVLEMDGQFDRLDELIYVES
Sbjct  258   VYLFDEGSTISWIPCGRKLTCSYPGIKFGYGPDTYFDNEVSVLEMDGQFDRLDELIYVES  317

Query  1245  HLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             HLS++STKFYGEVTQQMLKH+DFPGSNNGTG FQTIVGLKIRDLYEQI A+RA+A
Sbjct  318   HLSNISTKFYGEVTQQMLKHSDFPGSNNGTGLFQTIVGLKIRDLYEQISASRASA  372



>gb|ACG42204.1| phosphoribulokinase [Zea mays]
Length=415

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/413 (80%), Positives = 357/413 (86%), Gaps = 19/413 (5%)
 Frame = +3

Query  234   MAVCTVYTVQ-SLHSTCS--ISTPTKTHFQRQVFVYKK--------------SARKVGIS  362
             MA+C+ +T   SL S C+  +S       Q+QV                   S   + +S
Sbjct  2     MAICSAHTTTISLRSPCTTTVSNAAAGLVQKQVIFLTSINRRSGSRRRGGGVSRTLLQVS  61

Query  363   CAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVIC  542
             C+A G   K VVIGLAADSGCGKSTFMRRLTSVFGGAAEPP+GGNPDSNTLISD TTVIC
Sbjct  62    CSADGN--KPVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPRGGNPDSNTLISDTTTVIC  119

Query  543   LDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPEL  722
             LDDYHSLDRTGRKEKGVTALDPRAN+FDLMYEQVKA+K+G+AV KPIYNHVTGLLDPPEL
Sbjct  120   LDDYHSLDRTGRKEKGVTALDPRANNFDLMYEQVKAIKQGQAVQKPIYNHVTGLLDPPEL  179

Query  723   TKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI  902
               PPKI VIEGLHPM+D RVR+LLDFSIYLDIS+EVKFAWKIQRDMAERGHSLESIKASI
Sbjct  180   ITPPKIFVIEGLHPMFDERVRDLLDFSIYLDISDEVKFAWKIQRDMAERGHSLESIKASI  239

Query  903   EARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDE  1082
             EARKPDFDAYIDPQKQYADAVIEVLPTQLIP+D+EGKVLRV+LIMKEGV +F+PVYLFDE
Sbjct  240   EARKPDFDAYIDPQKQYADAVIEVLPTQLIPNDDEGKVLRVKLIMKEGVDNFNPVYLFDE  299

Query  1083  GSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLS  1262
             GSTISW+PCGRKLTCSYPGIKF YGPD YFG+EVSVLEMDGQFDRLDELIYVESHLS+LS
Sbjct  300   GSTISWVPCGRKLTCSYPGIKFAYGPDIYFGNEVSVLEMDGQFDRLDELIYVESHLSNLS  359

Query  1263  TKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TKFYGEVTQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQIVA RA AP EA
Sbjct  360   TKFYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIVAERAGAPAEA  412



>ref|XP_010499750.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Camelina 
sativa]
Length=396

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/394 (83%), Positives = 358/394 (91%), Gaps = 13/394 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKK---SARKVG--ISCAAAGGDGKTVV  398
             MAV T+Y+ Q+L+ST  +++ + +   +QVF+Y++   + R+    I+C+      +T+V
Sbjct  1     MAVSTIYSTQALNSTHFLTSSSSS---KQVFLYRRQPQTNRRFNTLITCSQ-----ETIV  52

Query  399   IGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGR  578
             IGLAADSGCGKSTFMRRLTSVFGGAA+PPKGGNPDSNTLISD TTVICLDDYHSLDR GR
Sbjct  53    IGLAADSGCGKSTFMRRLTSVFGGAAKPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGR  112

Query  579   KEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGL  758
             KE+ VTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLD PEL +PPKILVIEGL
Sbjct  113   KEQKVTALDPRANDFDLMYEQVKALKSGVAVEKPIYNHVTGLLDAPELIQPPKILVIEGL  172

Query  759   HPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYID  938
             HPM+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA+ID
Sbjct  173   HPMFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFID  232

Query  939   PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRK  1118
             PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTISWIPCGRK
Sbjct  233   PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGRK  292

Query  1119  LTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQML  1298
             LTCSYPGIKF Y PD+YF HEVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEVTQQML
Sbjct  293   LTCSYPGIKFNYEPDSYFDHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQML  352

Query  1299  KHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATR  1400
             KHADFPGSNNGTG FQTIVGLKIRDLYEQ++A +
Sbjct  353   KHADFPGSNNGTGLFQTIVGLKIRDLYEQLIANK  386



>ref|XP_006304993.1| hypothetical protein CARUB_v10009359mg [Capsella rubella]
 gb|EOA37891.1| hypothetical protein CARUB_v10009359mg [Capsella rubella]
Length=396

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/394 (83%), Positives = 358/394 (91%), Gaps = 13/394 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKK---SARKVG--ISCAAAGGDGKTVV  398
             MAV T+Y+ Q+L+ST  +++ + +   +QVF+Y++   + R+    I+C+      +T+V
Sbjct  1     MAVSTIYSTQALNSTHFLTSSSSS---KQVFLYRRQPQTNRRFNTLITCSQ-----ETIV  52

Query  399   IGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGR  578
             IGLAADSGCGKSTFMRRLTSVFGGAA+PPKGGNPDSNTLISD TTVICLDDYHSLDR GR
Sbjct  53    IGLAADSGCGKSTFMRRLTSVFGGAAKPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGR  112

Query  579   KEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGL  758
             KE+ VTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLD PEL +PPKILVIEGL
Sbjct  113   KEQKVTALDPRANDFDLMYEQVKALKNGIAVEKPIYNHVTGLLDAPELIQPPKILVIEGL  172

Query  759   HPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYID  938
             HPM+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA+ID
Sbjct  173   HPMFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFID  232

Query  939   PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRK  1118
             PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTISWIPCGRK
Sbjct  233   PQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGRK  292

Query  1119  LTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQML  1298
             LTCSYPGIKF Y PD+YF HEVSVLEMDGQFDRLDELIYVESHLS+LSTKFYGEVTQQML
Sbjct  293   LTCSYPGIKFNYEPDSYFDHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQML  352

Query  1299  KHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATR  1400
             KHADFPGSNNGTG FQTIVGLKIRDLYEQ++A +
Sbjct  353   KHADFPGSNNGTGLFQTIVGLKIRDLYEQLIANK  386



>gb|AFW63506.1| phosphoribulokinase [Zea mays]
Length=582

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/413 (81%), Positives = 357/413 (86%), Gaps = 19/413 (5%)
 Frame = +3

Query  234   MAVCTVYTVQ-SLHSTCS--ISTPTKTHFQRQVFVYKK--------------SARKVGIS  362
             MA+C+ +T   SL S C+  +S       Q+QV                   S   + +S
Sbjct  169   MAICSAHTTTISLRSPCTTTVSNAAAGLVQKQVIFLTSINRRSGSRRRGGGVSRTLLQVS  228

Query  363   CAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVIC  542
             C+A G   K VVIGLAADSGCGKSTFMRRLTSVFGGAAEPP+GGNPDSNTLISD TTVIC
Sbjct  229   CSADGN--KPVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPRGGNPDSNTLISDTTTVIC  286

Query  543   LDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPEL  722
             LDDYHSLDRTGRKEKGVTALDPRAN+FDLMYEQVKA+K+G+AV KPIYNHVTGLLDPPEL
Sbjct  287   LDDYHSLDRTGRKEKGVTALDPRANNFDLMYEQVKAIKQGQAVQKPIYNHVTGLLDPPEL  346

Query  723   TKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI  902
               PPKI VIEGLHPM+D RVR+LLDFSIYLDIS+EVKFAWKIQRDMAERGHSLESIKASI
Sbjct  347   ITPPKIFVIEGLHPMFDERVRDLLDFSIYLDISDEVKFAWKIQRDMAERGHSLESIKASI  406

Query  903   EARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDE  1082
             EARKPDFDAYIDPQKQYADAVIEVLPTQLIPDD+EGKVLRV+LIMKEGV  F+PVYLFDE
Sbjct  407   EARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDDEGKVLRVKLIMKEGVDKFNPVYLFDE  466

Query  1083  GSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLS  1262
             GSTISW+PCGRKLTCSYPGIKF YGPD YFG+EVSVLEMDGQFDRLDELIYVESHLS+LS
Sbjct  467   GSTISWVPCGRKLTCSYPGIKFAYGPDIYFGNEVSVLEMDGQFDRLDELIYVESHLSNLS  526

Query  1263  TKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TKFYGEVTQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQIVA RA APVEA
Sbjct  527   TKFYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIVAERAGAPVEA  579



>emb|CAA72118.1| phosphoribulokinase [Pisum sativum]
Length=352

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/349 (91%), Positives = 335/349 (96%), Gaps = 0/349 (0%)
 Frame = +3

Query  375   GGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDY  554
              GD +T+VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDY
Sbjct  1     AGDSQTIVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDY  60

Query  555   HSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPP  734
             HSLDRTGRKEKGVTALDP+ANDFDLMYEQVKA+K+GK+V KPIYNHVTGLLD PEL KPP
Sbjct  61    HSLDRTGRKEKGVTALDPKANDFDLMYEQVKAIKDGKSVQKPIYNHVTGLLDAPELIKPP  120

Query  735   KILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARK  914
             KILVIEGLHPMYD+RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARK
Sbjct  121   KILVIEGLHPMYDSRVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARK  180

Query  915   PDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTI  1094
             PDF+AYIDPQKQYADAVIEVLPTQLIPDDNEGK+LRVRLI K GVK+FSPVYLFDEGSTI
Sbjct  181   PDFEAYIDPQKQYADAVIEVLPTQLIPDDNEGKILRVRLIQKAGVKYFSPVYLFDEGSTI  240

Query  1095  SWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFY  1274
             SWIPCGRKLTCSYPGIKF YGP+TY G+EVSV+EMDGQFDRLDELIYVESHLS+LS+KFY
Sbjct  241   SWIPCGRKLTCSYPGIKFFYGPETYKGNEVSVVEMDGQFDRLDELIYVESHLSNLSSKFY  300

Query  1275  GEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             GEVTQQMLKHADFPGSNNGTG FQTIVGLKIRDL+EQIVA+RA  PV A
Sbjct  301   GEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLFEQIVASRAETPVGA  349



>ref|XP_010538353.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Tarenaya 
hassleriana]
Length=407

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/404 (80%), Positives = 359/404 (89%), Gaps = 8/404 (2%)
 Frame = +3

Query  234   MAVCTVYTVQSLHS-----TCSISTPTKTHFQRQVFVYKK---SARKVGISCAAAGGDGK  389
             MAV T+YT QSL+S     + S S  +     + V  Y++   S R++      + GD +
Sbjct  1     MAVSTIYTTQSLNSPHFLSSSSSSPSSTPLSSKHVLFYRRRSPSNRRLTTVVTCSAGDPQ  60

Query  390   TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDR  569
             TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDR
Sbjct  61    TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDR  120

Query  570   TGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVI  749
             TGRKEKGVTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLDPPE+ + PKIL I
Sbjct  121   TGRKEKGVTALDPRANDFDLMYEQVKALKNGVAVEKPIYNHVTGLLDPPEVIRSPKILFI  180

Query  750   EGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA  929
             EGLHPM+D RVR+LLD SIYLDISNEVKFAWKIQRDMAERGHS ESIKASIEARKPDFDA
Sbjct  181   EGLHPMFDERVRDLLDLSIYLDISNEVKFAWKIQRDMAERGHSPESIKASIEARKPDFDA  240

Query  930   YIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPC  1109
             YIDPQKQYADAVIEVLPTQLI DD+EGKVLRVRLIMKEG+KHFSPVYLFDEGST++WIPC
Sbjct  241   YIDPQKQYADAVIEVLPTQLIRDDDEGKVLRVRLIMKEGIKHFSPVYLFDEGSTVNWIPC  300

Query  1110  GRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQ  1289
             GRKLTCSYPGI F+YGPD+YFG EVSVLEMDGQF+RL+EL+YVESHLS+LSTKFYGEVTQ
Sbjct  301   GRKLTCSYPGINFSYGPDSYFGQEVSVLEMDGQFERLEELVYVESHLSNLSTKFYGEVTQ  360

Query  1290  QMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             QML+HADFPG++NGTG FQTI+GLKIR LY+QI++++A+APVE 
Sbjct  361   QMLRHADFPGTSNGTGLFQTIIGLKIRHLYDQIISSKASAPVEG  404



>sp|P27774.1|KPPR_MESCR RecName: Full=Phosphoribulokinase, chloroplastic; Short=PRK; 
Short=PRKase; AltName: Full=Phosphopentokinase; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA33034.1| phosphoribulokinase [Mesembryanthemum crystallinum]
Length=397

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/385 (84%), Positives = 349/385 (91%), Gaps = 14/385 (4%)
 Frame = +3

Query  273   STCSISTPTKTHF----QRQVFVYKKSA--------RKVGISCAAAGGDGKTVVIGLAAD  416
             +  + + PT +H     ++Q+F   KSA        R   I+C A  GD +T+VIGLAAD
Sbjct  2     AVSAYTVPTTSHLGFNQKKQLFFCNKSAYKRVSFSSRPCVITCLA--GDSQTIVIGLAAD  59

Query  417   SGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGVT  596
             SGCGKSTFMRRLTSVFGGAAEPP+GGNPDSNTLISD TTVICLDDYHSLDRTGRKEKGVT
Sbjct  60    SGCGKSTFMRRLTSVFGGAAEPPRGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVT  119

Query  597   ALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDA  776
             ALDPRANDFDLMYEQVKALKEGKAV+KPIYNHVTGLLD PEL KPPKILVIEGLHPM+D+
Sbjct  120   ALDPRANDFDLMYEQVKALKEGKAVEKPIYNHVTGLLDAPELIKPPKILVIEGLHPMFDS  179

Query  777   RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYA  956
             RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYA
Sbjct  180   RVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYA  239

Query  957   DAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYP  1136
             DAVIEVLPTQLIP DNEGKVLRVRLI KEGV++FSPVYLFDEGS+I+WIPCGRKLTCSYP
Sbjct  240   DAVIEVLPTQLIPGDNEGKVLRVRLIQKEGVQYFSPVYLFDEGSSITWIPCGRKLTCSYP  299

Query  1137  GIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFP  1316
             GIKF YGPDTYFG+EV+VLEMDGQFDRLDELIYVESHLS+LSTKFYGEVTQQMLKH DFP
Sbjct  300   GIKFFYGPDTYFGNEVTVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHQDFP  359

Query  1317  GSNNGTGFFQTIVGLKIRDLYEQIV  1391
             GSNNGTG FQTIVGLKIRDL+EQ++
Sbjct  360   GSNNGTGLFQTIVGLKIRDLFEQLI  384



>sp|P09559.1|KPPR_SPIOL RecName: Full=Phosphoribulokinase, chloroplastic; Short=PRK; 
Short=PRKase; AltName: Full=Phosphopentokinase; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA30499.1| phosphoribulokinase [Spinacia oleracea]
 prf||1410321A phosphoribulokinase
Length=402

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/408 (79%), Positives = 354/408 (87%), Gaps = 33/408 (8%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF-------QRQVFV-YKKSARKVG----------I  359
             MAVCTVYT+           PT TH         +QVF  YK+S+              I
Sbjct  1     MAVCTVYTI-----------PTTTHLGSSFNQNNKQVFFNYKRSSSSNNTLFTTRPSYVI  49

Query  360   SCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVI  539
             +C+      +T+VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVI
Sbjct  50    TCSQQ----QTIVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVI  105

Query  540   CLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPE  719
             CLDD+HSLDR GRK + VTALDP+ANDFDLMYEQVKALKEGKAVDKPIYNHV+GLLDPPE
Sbjct  106   CLDDFHSLDRNGRKVEKVTALDPKANDFDLMYEQVKALKEGKAVDKPIYNHVSGLLDPPE  165

Query  720   LTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKAS  899
             L +PPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDM ERGHSLESIKAS
Sbjct  166   LIQPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMKERGHSLESIKAS  225

Query  900   IEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFD  1079
             IE+RKPDFDAYIDPQKQ+AD VIEVLPT+LIPDD+EGKVLRVR+I KEGVK F+PVYLFD
Sbjct  226   IESRKPDFDAYIDPQKQHADVVIEVLPTELIPDDDEGKVLRVRMIQKEGVKFFNPVYLFD  285

Query  1080  EGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSL  1259
             EGSTISWIPCGRKLTCSYPGIKF+YGPDT++G+EV+V+EMDG FDRLDELIYVESHLS+L
Sbjct  286   EGSTISWIPCGRKLTCSYPGIKFSYGPDTFYGNEVTVVEMDGMFDRLDELIYVESHLSNL  345

Query  1260  STKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             STKFYGEVTQQMLKH +FPGSNNGTGFFQTI+GLKIRDL+EQ+VA+R+
Sbjct  346   STKFYGEVTQQMLKHQNFPGSNNGTGFFQTIIGLKIRDLFEQLVASRS  393



>ref|XP_002986864.1| hypothetical protein SELMODRAFT_182694 [Selaginella moellendorffii]
 gb|EFJ11946.1| hypothetical protein SELMODRAFT_182694 [Selaginella moellendorffii]
Length=433

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/355 (88%), Positives = 335/355 (94%), Gaps = 1/355 (0%)
 Frame = +3

Query  363   CAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVIC  542
             C AAGGDGKT+VIGLAADSGCGKSTFMRRLTSVFGGAA PPKGGNPDSNTLISD TTVIC
Sbjct  75    CCAAGGDGKTIVIGLAADSGCGKSTFMRRLTSVFGGAASPPKGGNPDSNTLISDTTTVIC  134

Query  543   LDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPEL  722
             LDDYHSLDRTGRKEKGVTALDP+AN+FDLMYEQVKALKEGKAV KPIYNHV+GLLDPPEL
Sbjct  135   LDDYHSLDRTGRKEKGVTALDPKANNFDLMYEQVKALKEGKAVQKPIYNHVSGLLDPPEL  194

Query  723   TKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI  902
              +PPKILVIEGLHPM+D+RVRELLDFSIYLDIS+ VKFAWKIQRDMAERGHSLESIKASI
Sbjct  195   IQPPKILVIEGLHPMFDSRVRELLDFSIYLDISDAVKFAWKIQRDMAERGHSLESIKASI  254

Query  903   EARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDE  1082
              ARKPDFDAYID QKQYAD VI+VLPTQLIPDDNEGKVLRVR+IMKEGV +F PVYLFDE
Sbjct  255   AARKPDFDAYIDTQKQYADVVIQVLPTQLIPDDNEGKVLRVRMIMKEGVDNFEPVYLFDE  314

Query  1083  GSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLS  1262
             GSTISWIPCGRKLTCSYPGIKF YGPDTY+ +EVSVLEMDGQFD+LDELIYVESHLS++S
Sbjct  315   GSTISWIPCGRKLTCSYPGIKFFYGPDTYYDNEVSVLEMDGQFDKLDELIYVESHLSNIS  374

Query  1263  TKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             T+FYGE+TQQMLKHADFPGSNNGTG FQTIVGLKIRD++E+I  ++  +PV A A
Sbjct  375   TRFYGEITQQMLKHADFPGSNNGTGLFQTIVGLKIRDVFERIT-SKQGSPVGAAA  428



>ref|XP_008448619.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Cucumis melo]
Length=408

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/407 (77%), Positives = 358/407 (88%), Gaps = 15/407 (4%)
 Frame = +3

Query  240   VCTVYTVQSL-HSTCSISTPTKT---HFQRQVFVY---------KKSARKVGISCAAAGG  380
             + TV T +SL ++  S+ + +KT   H Q Q+  +         K +     I+C+A  G
Sbjct  1     MATVSTAKSLIYTHYSVYSSSKTSLGHHQEQIVFFASGKKSKSGKANTNPWLITCSA--G  58

Query  381   DGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  560
             D +TVVIGLAADSGCGKSTFMRRLTSVFGGAA+PP+GGNPDSNTLISD TTVICLDDYHS
Sbjct  59    DQQTVVIGLAADSGCGKSTFMRRLTSVFGGAAKPPRGGNPDSNTLISDTTTVICLDDYHS  118

Query  561   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKI  740
             LDRTGRK+KGVTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLDPPEL KPPKI
Sbjct  119   LDRTGRKQKGVTALDPRANDFDLMYEQVKALKNGIAVEKPIYNHVTGLLDPPELIKPPKI  178

Query  741   LVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  920
             LVIEGLHPMYD+RVR+LLDFSIYLDIS+EVKFAWKIQRDMAERGHSLESIKASIEARKPD
Sbjct  179   LVIEGLHPMYDSRVRDLLDFSIYLDISDEVKFAWKIQRDMAERGHSLESIKASIEARKPD  238

Query  921   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             FDAYIDPQKQYADAV+EVLPT+LIP+DNEGK+LRVRLIMKEG+++F+PVYLFDEGSTISW
Sbjct  239   FDAYIDPQKQYADAVMEVLPTRLIPNDNEGKILRVRLIMKEGIENFNPVYLFDEGSTISW  298

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
             IPCGRKLTCSYPGI+ +  P TYFGHEV+VLEMDGQFD+LDELIYVESHLS++STK+YGE
Sbjct  299   IPCGRKLTCSYPGIRLSCSPQTYFGHEVTVLEMDGQFDKLDELIYVESHLSNISTKYYGE  358

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             +TQQ+L H+DFPGSNNGTG FQTI+GLKIR LY QI+AT   +P ++
Sbjct  359   ITQQILMHSDFPGSNNGTGLFQTILGLKIRHLYHQIIATTQLSPTQS  405



>gb|KDO58810.1| hypothetical protein CISIN_1g048274mg [Citrus sinensis]
Length=329

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/329 (94%), Positives = 321/329 (98%), Gaps = 0/329 (0%)
 Frame = +3

Query  441   MRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGVTALDPRAND  620
             MRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSLDRTGRKEKGVTALDPRAN+
Sbjct  1     MRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDPRANN  60

Query  621   FDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDARVRELLDF  800
             FDLMYEQVKA+K+G +V+KPIYNHVTGLLDPPEL KPPKILVIEGLHPMYDARVRELLDF
Sbjct  61    FDLMYEQVKAMKDGVSVEKPIYNHVTGLLDPPELIKPPKILVIEGLHPMYDARVRELLDF  120

Query  801   SIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLP  980
             SIYLDISNEVKFAWKIQRDM ERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLP
Sbjct  121   SIYLDISNEVKFAWKIQRDMTERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLP  180

Query  981   TQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGP  1160
             TQLIPDDNEGKVLRVRLIMKEGVK+FSPVYLFDEGSTI WIPCGRKLTCSYPGIKF+YGP
Sbjct  181   TQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTIEWIPCGRKLTCSYPGIKFSYGP  240

Query  1161  DTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGF  1340
             D YFGHEVS+LEMDG+FDRLDELIYVESHLS+LSTKFYGEVTQQMLKHADFPGSNNGTG 
Sbjct  241   DAYFGHEVSILEMDGKFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGL  300

Query  1341  FQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             FQTIVGLKIRDLYEQI+ ++AAAPVEAKA
Sbjct  301   FQTIVGLKIRDLYEQIITSKAAAPVEAKA  329



>ref|XP_004146110.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Cucumis sativus]
 ref|XP_004164185.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Cucumis sativus]
 gb|KGN55708.1| hypothetical protein Csa_3G006690 [Cucumis sativus]
Length=408

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/407 (77%), Positives = 359/407 (88%), Gaps = 15/407 (4%)
 Frame = +3

Query  240   VCTVYTVQSL-HSTCSISTPTKT----HFQRQVFVYKKSARKVG--------ISCAAAGG  380
             + TV T +SL ++  S+ + +KT    H +  VF       K G        I+C+A  G
Sbjct  1     MATVSTAKSLIYTHYSVYSSSKTSLGHHQEHIVFFASGKKSKSGKANTNPWLITCSA--G  58

Query  381   DGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  560
             D +TVVIGLAADSGCGKSTFMRRLTSVFGGAA+PP+GGNPDSNTLISD TTVICLDDYHS
Sbjct  59    DQQTVVIGLAADSGCGKSTFMRRLTSVFGGAAKPPRGGNPDSNTLISDTTTVICLDDYHS  118

Query  561   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKI  740
             LDRTGRK+KGVTALDPRANDFDLMYEQVKALK G AV+KPIYNHVTGLLDPPEL KPPKI
Sbjct  119   LDRTGRKQKGVTALDPRANDFDLMYEQVKALKSGIAVEKPIYNHVTGLLDPPELIKPPKI  178

Query  741   LVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  920
             LVIEGLHPMYD+RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD
Sbjct  179   LVIEGLHPMYDSRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  238

Query  921   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             FDAYIDPQKQYADAV+EVLPT+LIP+D+EGK+LRVRLIMKEG+++FSPVYLFDEGSTISW
Sbjct  239   FDAYIDPQKQYADAVMEVLPTRLIPNDDEGKILRVRLIMKEGIENFSPVYLFDEGSTISW  298

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
             IPCGRKL+CSYPGI+ + GP TYFGHEV+V+EMDGQFD+LDELIYVESHLS++STK+YGE
Sbjct  299   IPCGRKLSCSYPGIRLSCGPQTYFGHEVTVMEMDGQFDKLDELIYVESHLSNISTKYYGE  358

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             +TQQ+L H+DFPGSNNGTG FQTI+GLKIR LY QI+AT+  + +++
Sbjct  359   ITQQILMHSDFPGSNNGTGLFQTIIGLKIRHLYHQIIATKQLSNIQS  405



>ref|XP_001781269.1| predicted protein [Physcomitrella patens]
 gb|EDQ53885.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/395 (79%), Positives = 342/395 (87%), Gaps = 4/395 (1%)
 Frame = +3

Query  249   VYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARKVGISCAAAGGDGKTVVIGLAADSGCG  428
             V+   + H     S      F+     Y+ + R+  + C AA  DG+TVVIGLAADSGCG
Sbjct  31    VHLTSAFHGQSVASVSQVAGFESSGVKYRSAGRRAVVVCKAA--DGQTVVIGLAADSGCG  88

Query  429   KSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGVTALDP  608
             KSTFMRRLTSVFGGAA PPKGGNPDSNTLISD TTVICLDDYHSLDR GRKEK VTALDP
Sbjct  89    KSTFMRRLTSVFGGAASPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGRKEKAVTALDP  148

Query  609   RANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDARVRE  788
             +AN+FDLMYEQVKALKEGK+V+KPIYNHVTGLLD PE   PPKILVIEGLHPM+D RVRE
Sbjct  149   KANNFDLMYEQVKALKEGKSVEKPIYNHVTGLLDAPETIHPPKILVIEGLHPMFDERVRE  208

Query  789   LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVI  968
             LLDFSIYLDIS++VKFAWKIQRDMAERGHSLESIKASI ARKPDFDAYIDPQKQYAD VI
Sbjct  209   LLDFSIYLDISDDVKFAWKIQRDMAERGHSLESIKASIAARKPDFDAYIDPQKQYADVVI  268

Query  969   EVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKF  1148
             +VLPTQLIPDDNEGKVLRVR++MKEGV  F PVYLFDEGSTISWIPCGRKLTCSYPGIKF
Sbjct  269   QVLPTQLIPDDNEGKVLRVRMVMKEGVPFFEPVYLFDEGSTISWIPCGRKLTCSYPGIKF  328

Query  1149  TYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNN  1328
              YGPDTY+G+EVSVLEMDGQFD+LDELIYVESHLS++STKFYGE+TQQMLKHADFPGSNN
Sbjct  329   FYGPDTYYGNEVSVLEMDGQFDKLDELIYVESHLSNISTKFYGEITQQMLKHADFPGSNN  388

Query  1329  GTGFFQTIVGLKIRDLYEQIVATR--AAAPVEAKA  1427
             GTG FQTI GLKIR +YE+I+A +  AA    AKA
Sbjct  389   GTGLFQTICGLKIRSVYERILANQKNAATLQSAKA  423



>ref|XP_002990046.1| hypothetical protein SELMODRAFT_184990 [Selaginella moellendorffii]
 gb|EFJ08869.1| hypothetical protein SELMODRAFT_184990 [Selaginella moellendorffii]
Length=432

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/355 (87%), Positives = 333/355 (94%), Gaps = 1/355 (0%)
 Frame = +3

Query  363   CAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVIC  542
             C AAGGDGKT+VIGLAADSGCGKSTFMRRLTSVFGGAA PPKGGNPDSNTLISD TTVIC
Sbjct  74    CCAAGGDGKTIVIGLAADSGCGKSTFMRRLTSVFGGAASPPKGGNPDSNTLISDTTTVIC  133

Query  543   LDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPEL  722
             LDDYHSLDRTGRKEKGVTALDP+AN+FDLMYEQVKALKEGKAV KPIYNHV+GLLDPPEL
Sbjct  134   LDDYHSLDRTGRKEKGVTALDPKANNFDLMYEQVKALKEGKAVQKPIYNHVSGLLDPPEL  193

Query  723   TKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI  902
              + PKILVIEGLHPM+D+RVRELLDFSIYLDIS+ VKFAWKIQRDMAERGHSLESIKASI
Sbjct  194   IQSPKILVIEGLHPMFDSRVRELLDFSIYLDISDAVKFAWKIQRDMAERGHSLESIKASI  253

Query  903   EARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDE  1082
              ARKPDFDAYID QKQYAD VI+VLPTQLIPDDNEGKVLRVR+IMKEGV +F PVYLFDE
Sbjct  254   AARKPDFDAYIDTQKQYADVVIQVLPTQLIPDDNEGKVLRVRMIMKEGVDNFEPVYLFDE  313

Query  1083  GSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLS  1262
             GSTISWIPCGRKLTCSYPGIKF YGPD Y+ +EVSVLEMDGQFD+LDELIYVESHLS++S
Sbjct  314   GSTISWIPCGRKLTCSYPGIKFFYGPDIYYDNEVSVLEMDGQFDKLDELIYVESHLSNIS  373

Query  1263  TKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             T+FYGE+TQQMLKHADFPGSNNGTG FQTIVGLKIRD++E+I  ++  +PV A A
Sbjct  374   TRFYGEITQQMLKHADFPGSNNGTGLFQTIVGLKIRDVFERIT-SKQGSPVGAAA  427



>gb|AAA34036.1| phosphoribulokinase precursor (EC 2.7.1.19), partial [Spinacia 
oleracea]
Length=407

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/390 (81%), Positives = 346/390 (89%), Gaps = 22/390 (6%)
 Frame = +3

Query  288   STPTKTHF-------QRQVFV-YKKSARKVG----------ISCAAAGGDGKTVVIGLAA  413
             + PT TH         +QVF  YK+S+              I+C+      +T+VIGLAA
Sbjct  13    TIPTTTHLGSSFNQNNKQVFFNYKRSSSSNNTLFTTRPSYVITCSQQ----QTIVIGLAA  68

Query  414   DSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGV  593
             DSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDD+HSLDR GRK + V
Sbjct  69    DSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDFHSLDRNGRKVEKV  128

Query  594   TALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYD  773
             TALDP+ANDFDLMYEQVKALKEGKAVDKPIYNHV+GLLDPPEL +PPKILVIEGLHPMYD
Sbjct  129   TALDPKANDFDLMYEQVKALKEGKAVDKPIYNHVSGLLDPPELIQPPKILVIEGLHPMYD  188

Query  774   ARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQY  953
             ARVRELLDFSIYLDISNEVKFAWKIQRDM ERGHSLESIKASIE+RKPDFDAYIDPQKQ+
Sbjct  189   ARVRELLDFSIYLDISNEVKFAWKIQRDMKERGHSLESIKASIESRKPDFDAYIDPQKQH  248

Query  954   ADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSY  1133
             AD VIEVLPT+LIPDD+EGKVLRVR+I KEGVK F+PVYLFDEGSTISWIPCGRKLTCSY
Sbjct  249   ADVVIEVLPTELIPDDDEGKVLRVRMIQKEGVKFFNPVYLFDEGSTISWIPCGRKLTCSY  308

Query  1134  PGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADF  1313
             PGIKF+YGPDT++G+EV+V+EMDG FDRLDELIYVESHLS+LSTKFYGEVTQQMLKH +F
Sbjct  309   PGIKFSYGPDTFYGNEVTVVEMDGMFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHQNF  368

Query  1314  PGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             PGSNNGTGFFQTI+GLKIRDL+EQ+VA+R+
Sbjct  369   PGSNNGTGFFQTIIGLKIRDLFEQLVASRS  398



>ref|XP_001756013.1| predicted protein [Physcomitrella patens]
 gb|EDQ79298.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/376 (82%), Positives = 337/376 (90%), Gaps = 2/376 (1%)
 Frame = +3

Query  282   SISTPTKTHFQRQVFVYKKSARKVGISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSV  461
             S+S+ +     +     K+S R+  + C AA  DG+TVVIGLAADSGCGKSTFMRRLTSV
Sbjct  42    SVSSVSHVAALKAAVTSKRSGRRAVVVCKAA--DGQTVVIGLAADSGCGKSTFMRRLTSV  99

Query  462   FGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQ  641
             FGGAA PPKGGNPDSNTLISD TTVICLDDYHSLDR GRKEK VTALDPRAN+FDLMYEQ
Sbjct  100   FGGAATPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGRKEKAVTALDPRANNFDLMYEQ  159

Query  642   VKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDIS  821
             VKALKEGK+V+KPIYNHVTGLLD PE   PPKILVIEGLHPMYD RVRELLDFSIYLDIS
Sbjct  160   VKALKEGKSVEKPIYNHVTGLLDAPETIHPPKILVIEGLHPMYDERVRELLDFSIYLDIS  219

Query  822   NEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDD  1001
             ++VKFAWKIQRDMAERGHSLESIKASI +RKPDFDAYIDPQKQYAD VI+VLPTQLIPDD
Sbjct  220   DDVKFAWKIQRDMAERGHSLESIKASIASRKPDFDAYIDPQKQYADVVIQVLPTQLIPDD  279

Query  1002  NEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHE  1181
             NEGKVLRVR++MKEGV  F PVYLFDEGSTISWIPCGRKLTCSYPGIKF YGPDTY+G+E
Sbjct  280   NEGKVLRVRMVMKEGVPFFEPVYLFDEGSTISWIPCGRKLTCSYPGIKFFYGPDTYYGNE  339

Query  1182  VSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGL  1361
             VSVLEMDGQFD+LDELIYVESHLS++STKFYGE+TQQMLKHADFPGSNNGTG FQTI GL
Sbjct  340   VSVLEMDGQFDKLDELIYVESHLSNISTKFYGEITQQMLKHADFPGSNNGTGLFQTICGL  399

Query  1362  KIRDLYEQIVATRAAA  1409
             KIR++YE+I+  +  A
Sbjct  400   KIREVYERILEKQKNA  415



>gb|KHG26827.1| Phosphoribulokinase, chloroplastic [Gossypium arboreum]
Length=367

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/366 (87%), Positives = 339/366 (93%), Gaps = 14/366 (4%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKKSARKVG---------ISCAAAG  377
             MAVC+ YT QSLHSTCSISTP KTH    Q+QV  Y++S+++ G         I+C+A  
Sbjct  1     MAVCSAYTTQSLHSTCSISTPAKTHLGFHQKQVVFYRRSSKRGGSGSSSGPCVITCSA--  58

Query  378   GDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYH  557
             GD +TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYH
Sbjct  59    GDSQTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYH  118

Query  558   SLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPK  737
             SLDRTGRKEKGVTALDPRANDFDLMYEQVKA+K G AVDKPIYNHVTGLLDPPEL KPPK
Sbjct  119   SLDRTGRKEKGVTALDPRANDFDLMYEQVKAIKSGVAVDKPIYNHVTGLLDPPELIKPPK  178

Query  738   ILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKP  917
             ILVIEGLHPM+D RVR+LLDFSIYLDISNEVKFAWKIQRDMAERGHSLESI+ASIEARKP
Sbjct  179   ILVIEGLHPMFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIRASIEARKP  238

Query  918   DFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTIS  1097
             DFDAYIDPQK+YADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTIS
Sbjct  239   DFDAYIDPQKKYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTIS  298

Query  1098  WIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYG  1277
             WIPCGRKLTCSYPGIKF YGPDTYFG+EVS+LEMDGQFDRLDELIYVESHLS++STKFYG
Sbjct  299   WIPCGRKLTCSYPGIKFHYGPDTYFGNEVSILEMDGQFDRLDELIYVESHLSNISTKFYG  358

Query  1278  EVTQQM  1295
             EVTQQ+
Sbjct  359   EVTQQI  364



>gb|ABK24583.1| unknown [Picea sitchensis]
 gb|ABR16904.1| unknown [Picea sitchensis]
Length=400

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/395 (79%), Positives = 345/395 (87%), Gaps = 5/395 (1%)
 Frame = +3

Query  237   AVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARKVGISCAAAGGDGKTVVIGLAAD  416
             A  T  TV+S +S    ++P  +          +  R+  + C+   G  KTVVIGLAAD
Sbjct  8     ATSTPATVRSWNSQFCSNSPLASFSLAHT---TRRPRRALVVCSV--GPEKTVVIGLAAD  62

Query  417   SGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGVT  596
             SGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSLDR GRK+KGVT
Sbjct  63    SGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGRKDKGVT  122

Query  597   ALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDA  776
             ALDPRAN+FDLMYEQVKALKEGK+V KPIYNHVTG+LDP E   PPKILVIEGLHPM+DA
Sbjct  123   ALDPRANNFDLMYEQVKALKEGKSVMKPIYNHVTGILDPAEQINPPKILVIEGLHPMFDA  182

Query  777   RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYA  956
             RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI+ARKPDFDA+IDPQKQYA
Sbjct  183   RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIQARKPDFDAFIDPQKQYA  242

Query  957   DAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYP  1136
             D VI+VLPT+LIP++NEGKVLRVR++MKEGV  F+PVYLFDEGSTISWIPCGRKLTCSYP
Sbjct  243   DVVIQVLPTELIPEENEGKVLRVRMVMKEGVNFFNPVYLFDEGSTISWIPCGRKLTCSYP  302

Query  1137  GIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFP  1316
             GIKF YGPD Y+ +EVSVLEMDGQFDRL+ELIYVESHLS++STKFYGEVTQQMLKHADFP
Sbjct  303   GIKFFYGPDIYYDNEVSVLEMDGQFDRLEELIYVESHLSNISTKFYGEVTQQMLKHADFP  362

Query  1317  GSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             GSNNGTG FQTIVGLKIRD+YEQ+++    A +EA
Sbjct  363   GSNNGTGLFQTIVGLKIRDVYEQLISQTTGASLEA  397



>ref|XP_010943454.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Elaeis guineensis]
Length=414

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/408 (76%), Positives = 347/408 (85%), Gaps = 11/408 (3%)
 Frame = +3

Query  231   TMAVCTVYTVQSLHSTCSISTPTKTH-------FQRQVFV---YKKSARKVGISCA-AAG  377
             T  +CT+ +  S H  C IS  T           QRQ      ++K  R  G+SC  +  
Sbjct  3     TFTLCTLSSSSSSHLPCCISNSTTEEVHLGSPLLQRQFIFNTNWRKGRRGRGVSCGISCS  62

Query  378   GDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYH  557
              + KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPP+GGNP+SNTL+SD TTVICLDDYH
Sbjct  63    AEAKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPRGGNPESNTLLSDTTTVICLDDYH  122

Query  558   SLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPK  737
              LDR GRKEKGVTALDPRAN+FDLMYEQVKALK G AV+KPIYNHVTGLLDPPEL  PPK
Sbjct  123   LLDREGRKEKGVTALDPRANNFDLMYEQVKALKAGVAVEKPIYNHVTGLLDPPELILPPK  182

Query  738   ILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKP  917
             IL IEGLHP++D+RVR+LLDFSIYLDIS+EVKFAWK +RDMAERGHSL SIKASIEARK 
Sbjct  183   ILFIEGLHPIFDSRVRDLLDFSIYLDISDEVKFAWKTKRDMAERGHSLHSIKASIEARKL  242

Query  918   DFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTIS  1097
             DFDAY+DPQKQYAD VIEVLPTQLIPDDNE KVLRVRL+MKEGVK+F+PVYLFDEGST+S
Sbjct  243   DFDAYVDPQKQYADVVIEVLPTQLIPDDNERKVLRVRLVMKEGVKYFNPVYLFDEGSTLS  302

Query  1098  WIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYG  1277
             WIPCGRKL+CSYPGIKF YGPDTY  HEVSVLEMDGQFDRLDEL+YVESHL++LSTK+YG
Sbjct  303   WIPCGRKLSCSYPGIKFFYGPDTYVAHEVSVLEMDGQFDRLDELMYVESHLNNLSTKYYG  362

Query  1278  EVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             E T+QMLKH DFPGSNNGTG FQTI+GLKIR+LYE IVA ++  P+EA
Sbjct  363   EATEQMLKHGDFPGSNNGTGLFQTIIGLKIRELYECIVAEKSVTPLEA  410



>gb|ACN40637.1| unknown [Picea sitchensis]
Length=400

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/395 (79%), Positives = 344/395 (87%), Gaps = 5/395 (1%)
 Frame = +3

Query  237   AVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARKVGISCAAAGGDGKTVVIGLAAD  416
             A  T  TV+S +S    ++P  +          +  R+  + C+   G  KTVVIGLAAD
Sbjct  8     ATSTPATVRSWNSQFCSNSPLASFSLAHT---TRRPRRALVVCSV--GPEKTVVIGLAAD  62

Query  417   SGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGVT  596
             SGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSLDR GRK+KGVT
Sbjct  63    SGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGRKDKGVT  122

Query  597   ALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDA  776
             ALDPRAN+FDLMYEQVKALKEGK V KPIYNHVTG+LDP E   PPKILVIEGLHPM+DA
Sbjct  123   ALDPRANNFDLMYEQVKALKEGKPVMKPIYNHVTGILDPAEQINPPKILVIEGLHPMFDA  182

Query  777   RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYA  956
             RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI+ARKPDFDA+IDPQKQYA
Sbjct  183   RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIQARKPDFDAFIDPQKQYA  242

Query  957   DAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYP  1136
             D VI+VLPT+LIP++NEGKVLRVR++MKEGV  F+PVYLFDEGSTISWIPCGRKLTCSYP
Sbjct  243   DVVIQVLPTELIPEENEGKVLRVRMVMKEGVNFFNPVYLFDEGSTISWIPCGRKLTCSYP  302

Query  1137  GIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFP  1316
             GIKF YGPD Y+ +EVSVLEMDGQFDRL+ELIYVESHLS++STKFYGEVTQQMLKHADFP
Sbjct  303   GIKFFYGPDIYYDNEVSVLEMDGQFDRLEELIYVESHLSNISTKFYGEVTQQMLKHADFP  362

Query  1317  GSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             GSNNGTG FQTIVGLKIRD+YEQ+++    A +EA
Sbjct  363   GSNNGTGLFQTIVGLKIRDVYEQLISQTTGASLEA  397



>gb|ACN40656.1| unknown [Picea sitchensis]
Length=400

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/395 (79%), Positives = 344/395 (87%), Gaps = 5/395 (1%)
 Frame = +3

Query  237   AVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARKVGISCAAAGGDGKTVVIGLAAD  416
             A  T  TV+S +S    ++P  +          +  R+  + C+   G  KTVVIGLAAD
Sbjct  8     ATSTPATVRSWNSQFCSNSPLASFSLAHT---TRRPRRALVVCSV--GPEKTVVIGLAAD  62

Query  417   SGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGVT  596
             SGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSLDR GRK+KGVT
Sbjct  63    SGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGRKDKGVT  122

Query  597   ALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDA  776
             ALDPRAN+FDLMYEQVKALKEGK+  KPIYNHVTG+LDP E   PPKILVIEGLHPM+DA
Sbjct  123   ALDPRANNFDLMYEQVKALKEGKSDMKPIYNHVTGILDPAEQINPPKILVIEGLHPMFDA  182

Query  777   RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYA  956
             RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI+ARKPDFDA+IDPQKQYA
Sbjct  183   RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIQARKPDFDAFIDPQKQYA  242

Query  957   DAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYP  1136
             D VI+VLPT+LIP++NEGKVLRVR++MKEGV  F+PVYLFDEGSTISWIPCGRKLTCSYP
Sbjct  243   DVVIQVLPTELIPEENEGKVLRVRMVMKEGVNFFNPVYLFDEGSTISWIPCGRKLTCSYP  302

Query  1137  GIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFP  1316
             GIKF YGPD Y+ +EVSVLEMDGQFDRL+ELIYVESHLS++STKFYGEVTQQMLKHADFP
Sbjct  303   GIKFFYGPDIYYDNEVSVLEMDGQFDRLEELIYVESHLSNISTKFYGEVTQQMLKHADFP  362

Query  1317  GSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             GSNNGTG FQTIVGLKIRD+YEQ+++    A +EA
Sbjct  363   GSNNGTGLFQTIVGLKIRDVYEQLISQTTGASLEA  397



>gb|ACN40495.1| unknown [Picea sitchensis]
Length=400

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/395 (79%), Positives = 343/395 (87%), Gaps = 5/395 (1%)
 Frame = +3

Query  237   AVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARKVGISCAAAGGDGKTVVIGLAAD  416
             A  T  TV+S +S    ++P  +          +  R+  + C+   G  KTVVIGLAAD
Sbjct  8     ATSTPATVRSWNSQFCSNSPLASFSLAHT---TRRPRRALVVCSV--GPEKTVVIGLAAD  62

Query  417   SGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGVT  596
             SGCGKSTFMRRLT VFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSLDR GRK+KGVT
Sbjct  63    SGCGKSTFMRRLTGVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGRKDKGVT  122

Query  597   ALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDA  776
             ALDPRAN+FDLMYEQVKALKEGK V KPIYNHVTG+LDP E   PPKILVIEGLHPM+DA
Sbjct  123   ALDPRANNFDLMYEQVKALKEGKPVMKPIYNHVTGILDPAEQINPPKILVIEGLHPMFDA  182

Query  777   RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYA  956
             RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI+ARKPDFDA+IDPQKQYA
Sbjct  183   RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIQARKPDFDAFIDPQKQYA  242

Query  957   DAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYP  1136
             D VI+VLPT+LIP++NEGKVLRVR++MKEGV  F+PVYLFDEGSTISWIPCGRKLTCSYP
Sbjct  243   DVVIQVLPTELIPEENEGKVLRVRMVMKEGVNFFNPVYLFDEGSTISWIPCGRKLTCSYP  302

Query  1137  GIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFP  1316
             GIKF YGPD Y+ +EVSVLEMDGQFDRL+ELIYVESHLS++STKFYGEVTQQMLKHADFP
Sbjct  303   GIKFFYGPDIYYDNEVSVLEMDGQFDRLEELIYVESHLSNISTKFYGEVTQQMLKHADFP  362

Query  1317  GSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             GSNNGTG FQTIVGLKIRD+YEQ+++    A +EA
Sbjct  363   GSNNGTGLFQTIVGLKIRDVYEQLISQTTGASLEA  397



>ref|XP_004976668.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Setaria italica]
Length=394

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/349 (85%), Positives = 321/349 (92%), Gaps = 0/349 (0%)
 Frame = +3

Query  357   ISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTV  536
             +SC+AA   GKTVVIGLAADSGCGKSTF+RRLTSV GG AEPP GGNPDSNTL+    TV
Sbjct  37    VSCSAAAAAGKTVVIGLAADSGCGKSTFVRRLTSVLGGGAEPPSGGNPDSNTLVGSTATV  96

Query  537   ICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPP  716
             ICLDDYHSLDR  RK +G+TALDPRANDFDLMYEQV+A+KEG+AVDKP+YNHVTGLLDPP
Sbjct  97    ICLDDYHSLDRAARKARGLTALDPRANDFDLMYEQVRAIKEGRAVDKPVYNHVTGLLDPP  156

Query  717   ELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKA  896
             E   PPKILVIEGLHPMYD RVR+LLDFSIYLDIS EVKFAWKIQRDMAERGHSLESIKA
Sbjct  157   ERIAPPKILVIEGLHPMYDERVRDLLDFSIYLDISEEVKFAWKIQRDMAERGHSLESIKA  216

Query  897   SIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLF  1076
             SI+ARKPDFDAYIDPQKQYADAVIEVLPTQLIP+D EGKVLRVRLIMKEGV+HF+PVYLF
Sbjct  217   SIDARKPDFDAYIDPQKQYADAVIEVLPTQLIPNDEEGKVLRVRLIMKEGVRHFAPVYLF  276

Query  1077  DEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSS  1256
             DEGS ++WIPCGRKL+CSYPGIKF YG  TYFGHEVSVLEMDGQFD+LDELIYVE+HLS+
Sbjct  277   DEGSVVTWIPCGRKLSCSYPGIKFAYGFGTYFGHEVSVLEMDGQFDKLDELIYVETHLSN  336

Query  1257  LSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             LSTKFYGEV QQMLKHAD PGS+NGTG FQTIVGLK+RDLYEQI A RA
Sbjct  337   LSTKFYGEVAQQMLKHADLPGSSNGTGLFQTIVGLKVRDLYEQIAAERA  385



>ref|XP_008813156.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Phoenix dactylifera]
Length=416

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/377 (80%), Positives = 335/377 (89%), Gaps = 11/377 (3%)
 Frame = +3

Query  315   RQVFVYKKSARK--------VGISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGG  470
             R+ FV+  + RK         GISC+A   + +TVVIGLAADSGCGKSTFMRRLTSVFGG
Sbjct  39    RRQFVFYTNWRKGRRGRGASCGISCSA---EARTVVIGLAADSGCGKSTFMRRLTSVFGG  95

Query  471   AAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKA  650
             AAEPP+GGNP+SNTL+SD TTVICLDDYH LDR GRKE+GVTALDPRAN+FDLMYEQVKA
Sbjct  96    AAEPPRGGNPESNTLLSDTTTVICLDDYHLLDREGRKEEGVTALDPRANNFDLMYEQVKA  155

Query  651   LKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEV  830
             LK G AV+KPIYNHVTGLLDPPEL  PP +L IEGLHPM+D RVR+LLDFSIYLDIS+EV
Sbjct  156   LKAGVAVEKPIYNHVTGLLDPPELILPPNLLFIEGLHPMFDPRVRDLLDFSIYLDISDEV  215

Query  831   KFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEG  1010
             KFAWK QRD+ ERGHSLESI+ASIEARKPDFDAY+DPQKQYAD VIEVLPTQLIP DNE 
Sbjct  216   KFAWKTQRDVEERGHSLESIQASIEARKPDFDAYVDPQKQYADVVIEVLPTQLIPGDNER  275

Query  1011  KVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSV  1190
             KVLRVR++MKEGVK+F+PVYLFDEGS+ISWIPCGRKL+CSYPGIKF YGPDTYF HEVS 
Sbjct  276   KVLRVRMVMKEGVKYFNPVYLFDEGSSISWIPCGRKLSCSYPGIKFFYGPDTYFSHEVSA  335

Query  1191  LEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIR  1370
             LEMDGQFDRLDEL+YVESHL++LSTK+YGE T+QMLKH DFPGSNNGTG FQTI+GLKIR
Sbjct  336   LEMDGQFDRLDELMYVESHLNNLSTKYYGEATEQMLKHGDFPGSNNGTGLFQTIIGLKIR  395

Query  1371  DLYEQIVATRAAAPVEA  1421
             +LYE IVA ++  P+EA
Sbjct  396   ELYECIVAEKSVTPLEA  412



>dbj|BAL03266.1| chloroplast phosphoribulokinase [Closterium peracerosum-strigosum-littorale 
complex]
Length=417

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/355 (83%), Positives = 327/355 (92%), Gaps = 2/355 (1%)
 Frame = +3

Query  345   RKVGISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD  524
             R V + C AAG   KTVV+GLAADSGCGKSTFMRR+T VFGG+A PPKGGNPDSNTL+SD
Sbjct  64    RTVLVVCKAAGE--KTVVVGLAADSGCGKSTFMRRMTGVFGGSAAPPKGGNPDSNTLLSD  121

Query  525   MTTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGL  704
             MTTVICLDDYHSLDR GRKE  VTALDP+AN+FDLMYEQVKALKEGK+V KPIYNHV+GL
Sbjct  122   MTTVICLDDYHSLDRNGRKEANVTALDPKANNFDLMYEQVKALKEGKSVMKPIYNHVSGL  181

Query  705   LDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLE  884
             LDPPEL + PKILVIEGLHPMYD RVR+L+DFSIYLDIS+EVKFAWKIQRDMAERGHSLE
Sbjct  182   LDPPELIESPKILVIEGLHPMYDERVRDLIDFSIYLDISDEVKFAWKIQRDMAERGHSLE  241

Query  885   SIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSP  1064
             SIKASI+ARKPDFDAYIDPQKQ+AD VI+VLPTQLIPDDNEGK+LRVR+I KEG+ +F P
Sbjct  242   SIKASIQARKPDFDAYIDPQKQHADVVIQVLPTQLIPDDNEGKILRVRMIQKEGLDNFDP  301

Query  1065  VYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVES  1244
             VYLFDEGS+ISWIPCGRKLTCSYPGIKF YGPDTYFG+EVSVLEMDGQFD+L+ELIYVES
Sbjct  302   VYLFDEGSSISWIPCGRKLTCSYPGIKFYYGPDTYFGNEVSVLEMDGQFDKLEELIYVES  361

Query  1245  HLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             HLS+ STKFYGEVTQQMLK++DFPGS NGTG FQT+VGLK+R+ YE+I++  A A
Sbjct  362   HLSNTSTKFYGEVTQQMLKNSDFPGSTNGTGLFQTMVGLKLREAYERIISKSAVA  416



>dbj|BAL03267.1| chloroplast phosphoribulokinase [Chara braunii]
Length=459

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/355 (84%), Positives = 325/355 (92%), Gaps = 3/355 (1%)
 Frame = +3

Query  351   VGISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMT  530
             V I C AA  + KTVVIGLAADSGCGKSTFMRRLTSVFGGAA PPKGGNPDSNTLISD T
Sbjct  108   VLIICKAA--NDKTVVIGLAADSGCGKSTFMRRLTSVFGGAASPPKGGNPDSNTLISDTT  165

Query  531   TVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLD  710
             TVICLDDYHSLDRTGRK  GVTALDPRAN+FDLMYEQVKALKEGK V+KP+YNHV+GLLD
Sbjct  166   TVICLDDYHSLDRTGRKVHGVTALDPRANNFDLMYEQVKALKEGKTVEKPVYNHVSGLLD  225

Query  711   PPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESI  890
             P E    PKILVIEGLHPMYD RVRELLDFS+YLDIS++VKFAWKIQRDMAERGHSLESI
Sbjct  226   PAETIAAPKILVIEGLHPMYDERVRELLDFSVYLDISDDVKFAWKIQRDMAERGHSLESI  285

Query  891   KASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVY  1070
             KASI ARKPDFDAYID QKQYAD VI+VLPTQLIPDDNEGK+LRVR+IMKEG+++F P Y
Sbjct  286   KASIAARKPDFDAYIDTQKQYADVVIQVLPTQLIPDDNEGKILRVRMIMKEGLENFVPAY  345

Query  1071  LFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHL  1250
             LFDEGST+SW+PCGRKLTCSYPGIKF YGPDTY+G EVSVLEMDGQFD+L+ELIYVESHL
Sbjct  346   LFDEGSTVSWVPCGRKLTCSYPGIKFFYGPDTYYGQEVSVLEMDGQFDKLEELIYVESHL  405

Query  1251  SSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPV  1415
             S+ STKFYGE+TQQML+HADFPGSNNGTG FQTIVGLKIR++YE+IVA +   PV
Sbjct  406   SNTSTKFYGEITQQMLRHADFPGSNNGTGLFQTIVGLKIREVYERIVA-KEVVPV  459



>gb|ABR16489.1| unknown [Picea sitchensis]
Length=377

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/372 (80%), Positives = 326/372 (88%), Gaps = 5/372 (1%)
 Frame = +3

Query  237   AVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARKVGISCAAAGGDGKTVVIGLAAD  416
             A  T  TV+S +S    ++P  +          +  R+  + C+   G  KTVVIGLAAD
Sbjct  8     ATSTPATVRSWNSQFCSNSPLASFSLAHT---TRRPRRALVVCSV--GPEKTVVIGLAAD  62

Query  417   SGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGVT  596
             SGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDDYHSLDR GRK+KGVT
Sbjct  63    SGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGRKDKGVT  122

Query  597   ALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDA  776
             ALDPRAN+FDLMYEQVKALKEGK V KPIYNHVTG+LDP E   PPKILVIEGLHPM+DA
Sbjct  123   ALDPRANNFDLMYEQVKALKEGKPVMKPIYNHVTGILDPAEQINPPKILVIEGLHPMFDA  182

Query  777   RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYA  956
             RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASI+ARKPDFDA+IDPQKQYA
Sbjct  183   RVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIQARKPDFDAFIDPQKQYA  242

Query  957   DAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYP  1136
             D VI+VLPT+LIP++NEGKVLRVR++MKEGV  F+PVYLFDEGSTISWIPCGRKLTCSYP
Sbjct  243   DVVIQVLPTELIPEENEGKVLRVRMVMKEGVNFFNPVYLFDEGSTISWIPCGRKLTCSYP  302

Query  1137  GIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFP  1316
             GIKF YGPD Y+ +EVSVLEMDGQFDRL+ELIYVESHLS++STKFYGEVTQQMLKHADFP
Sbjct  303   GIKFFYGPDIYYDNEVSVLEMDGQFDRLEELIYVESHLSNISTKFYGEVTQQMLKHADFP  362

Query  1317  GSNNGTGFFQTI  1352
             GSNNGTG FQTI
Sbjct  363   GSNNGTGLFQTI  374



>ref|XP_002448449.1| hypothetical protein SORBIDRAFT_06g027270 [Sorghum bicolor]
 gb|EES12777.1| hypothetical protein SORBIDRAFT_06g027270 [Sorghum bicolor]
Length=387

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/392 (75%), Positives = 334/392 (85%), Gaps = 8/392 (2%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARK-VGISCAAAGGDGKTVVIGLA  410
             MA  T++T  +        T      + + + Y  +A   + +SC+       TVVIG+A
Sbjct  1     MAAFTMHTSAATSPYSPAGTAILLRSRSRSYSYPTAATTTIRVSCSKT-----TVVIGVA  55

Query  411   ADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKG  590
             ADSGCGKSTF RRLTSV GG AEPP+GGNP+SNTL+SD  TVICLDDYHSLDR GRK KG
Sbjct  56    ADSGCGKSTFTRRLTSVLGGGAEPPRGGNPNSNTLVSDTATVICLDDYHSLDRAGRKAKG  115

Query  591   VTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMY  770
             VTALDPRA DFDLMY+QV+A+K+G+AV+KP+YNHVTG +DPPEL  PP+ILVI+GLHPMY
Sbjct  116   VTALDPRAIDFDLMYQQVRAIKDGRAVEKPVYNHVTGRIDPPELITPPEILVIKGLHPMY  175

Query  771   DARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQ  950
             D RVR+LLD SIYLDISNEVKFAWK+QRDMAERGHSLESI+ASIEARKPDFDAYI+PQKQ
Sbjct  176   DERVRDLLDLSIYLDISNEVKFAWKVQRDMAERGHSLESIRASIEARKPDFDAYIEPQKQ  235

Query  951   YADAVIEVLPTQLI--PDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLT  1124
             YADAVIEVLPTQLI  P D+EGKVLRV+LIMKEGV+HF+PVYLFDEGST++WIPCGRKL+
Sbjct  236   YADAVIEVLPTQLIPGPGDDEGKVLRVKLIMKEGVEHFAPVYLFDEGSTVNWIPCGRKLS  295

Query  1125  CSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKH  1304
             CSYPGI+F YG  TYFGHEVSV+EMDGQFD+LDELIYVE+HLS+LSTKFYGEV QQML H
Sbjct  296   CSYPGIRFAYGFGTYFGHEVSVVEMDGQFDKLDELIYVETHLSNLSTKFYGEVAQQMLTH  355

Query  1305  ADFPGSNNGTGFFQTIVGLKIRDLYEQIVATR  1400
             AD PGSNNGTG FQTIVGLKIRDLYEQIVA R
Sbjct  356   ADLPGSNNGTGLFQTIVGLKIRDLYEQIVARR  387



>gb|EAY95389.1| hypothetical protein OsI_17227 [Oryza sativa Indica Group]
Length=398

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/360 (82%), Positives = 320/360 (89%), Gaps = 10/360 (3%)
 Frame = +3

Query  357   ISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGG----NPDSNTLISD  524
             +SC+AA G   TVVIGLAADSGCGK+TF+RRLTSV G             NP SNTL+ D
Sbjct  34    VSCSAAAG--GTVVIGLAADSGCGKTTFVRRLTSVLGAGTAAAAAPPWGGNPGSNTLLGD  91

Query  525   MTTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGL  704
               TVICLDDYHSLDR GRKE+GVTALDPRANDFDLMY Q+KA+KEG+AV KPIYNH TGL
Sbjct  92    AATVICLDDYHSLDRAGRKERGVTALDPRANDFDLMYRQLKAIKEGRAVAKPIYNHATGL  151

Query  705   LDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLE  884
             LDPPEL  PPKILV+EGLHPMYD RVR LLDFSIYLDIS+++KFAWKIQRDMAERGHSLE
Sbjct  152   LDPPELITPPKILVVEGLHPMYDERVRGLLDFSIYLDISSDIKFAWKIQRDMAERGHSLE  211

Query  885   SIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIP----DDNEGKVLRVRLIMKEGVK  1052
             SIKASIEARKPDFDAYIDPQKQYADAVIEVLPT+LI     D +EGKVLRV+LIMKEGV+
Sbjct  212   SIKASIEARKPDFDAYIDPQKQYADAVIEVLPTRLIAAADDDGDEGKVLRVKLIMKEGVE  271

Query  1053  HFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELI  1232
             HF+P YLFDEGSTISWIPCGRKL+CSYPGIKF+Y PDTYFGHEVSVLEMDG+FD+LDELI
Sbjct  272   HFAPAYLFDEGSTISWIPCGRKLSCSYPGIKFSYFPDTYFGHEVSVLEMDGKFDKLDELI  331

Query  1233  YVESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAP  1412
             YVESHLS+LSTK+YGEVTQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQ+VA RAA+P
Sbjct  332   YVESHLSNLSTKYYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQVVAERAASP  391



>ref|XP_009415222.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=407

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/387 (74%), Positives = 327/387 (84%), Gaps = 1/387 (0%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARKVGISCAAAGGDGKTVVIGLAA  413
             M+VC++Y V ++  +CS S       Q    V +  AR+   +  +   + +TVVIGLAA
Sbjct  1     MSVCSLYRV-TMPCSCSESHLGSCRKQLMFCVSRGKARRRAWTRVSCSAETRTVVIGLAA  59

Query  414   DSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGV  593
             DSGCGKSTFMRRLTSV GG AEPP+G N  SNTL+ D TTVICLDDYH+LDR GRKEK V
Sbjct  60    DSGCGKSTFMRRLTSVLGGVAEPPRGCNAYSNTLVGDATTVICLDDYHALDREGRKEKCV  119

Query  594   TALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYD  773
             TALDP+AN+FDLMYEQV+ALK G AV+KP+YNHVTG LDPPEL +PP IL IEGLHP++D
Sbjct  120   TALDPKANNFDLMYEQVRALKSGVAVEKPVYNHVTGRLDPPELIRPPNILFIEGLHPLFD  179

Query  774   ARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQY  953
              R+R LLDFSIYLDISNEVKFAWKIQRDMAERG SLESIKASI+ARK DFD YIDPQKQ+
Sbjct  180   PRIRSLLDFSIYLDISNEVKFAWKIQRDMAERGESLESIKASIKARKSDFDMYIDPQKQF  239

Query  954   ADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSY  1133
             AD VIEVLPT+LIPD +  +VLRVRL+M+EGVKHF+PVYLFDEGSTISW PCG KL+CSY
Sbjct  240   ADVVIEVLPTRLIPDKSATEVLRVRLVMREGVKHFTPVYLFDEGSTISWTPCGGKLSCSY  299

Query  1134  PGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADF  1313
             PGI+F YGPDTYF  E SVLEMDGQFDRLDELIYVESHLS+LSTK+YGEVTQQMLKHADF
Sbjct  300   PGIRFFYGPDTYFSDEASVLEMDGQFDRLDELIYVESHLSNLSTKYYGEVTQQMLKHADF  359

Query  1314  PGSNNGTGFFQTIVGLKIRDLYEQIVA  1394
             PGSN+GTG FQTI+GLKIR LYEQI+A
Sbjct  360   PGSNDGTGLFQTIIGLKIRQLYEQIIA  386



>ref|XP_006652740.1| PREDICTED: phosphoribulokinase, chloroplastic-like [Oryza brachyantha]
Length=390

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/351 (83%), Positives = 315/351 (90%), Gaps = 8/351 (2%)
 Frame = +3

Query  348   KVGISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGG---AAEPPKGGNPDSNTLI  518
             +V  S AAAGG   TVVIGLAADSGCGKSTFMRRLTSV GG   AA PP+GG P   TL+
Sbjct  31    RVTCSAAAAGG---TVVIGLAADSGCGKSTFMRRLTSVLGGGTAAAAPPRGGEP--GTLV  85

Query  519   SDMTTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVT  698
                 TVICLDDYHSLDR GRK KGVTAL PRANDF+LMY QV+ALK+G+AV+KPIYNH T
Sbjct  86    EGDATVICLDDYHSLDRAGRKAKGVTALHPRANDFELMYRQVRALKDGRAVEKPIYNHAT  145

Query  699   GLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHS  878
             GLLDPPEL  PP+ILVIEGLHPMYDARVR LLDFSIYLDIS+E+KFAWKIQRDMAERGHS
Sbjct  146   GLLDPPELVAPPRILVIEGLHPMYDARVRGLLDFSIYLDISSEIKFAWKIQRDMAERGHS  205

Query  879   LESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHF  1058
             LESIKASI ARKPDFD+YIDPQKQYADAVIEVLPT+LIPDD+EG+VLRV+LIMKEG +HF
Sbjct  206   LESIKASIAARKPDFDSYIDPQKQYADAVIEVLPTRLIPDDDEGEVLRVKLIMKEGARHF  265

Query  1059  SPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYV  1238
             SP YLFDEGSTISWIPCGRKL+CSYPGI F Y PDTYFGHEVSVLEMDG+FD+LDELIYV
Sbjct  266   SPAYLFDEGSTISWIPCGRKLSCSYPGISFAYFPDTYFGHEVSVLEMDGRFDKLDELIYV  325

Query  1239  ESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIV  1391
             ESHLS+LST++YGEVTQQMLKHAD PGSNNGTG FQTIVGLKIRDL EQIV
Sbjct  326   ESHLSNLSTRYYGEVTQQMLKHADLPGSNNGTGLFQTIVGLKIRDLCEQIV  376



>ref|NP_001174075.1| Os04g0595700 [Oryza sativa Japonica Group]
 dbj|BAH92803.1| Os04g0595700 [Oryza sativa Japonica Group]
Length=402

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/363 (81%), Positives = 320/363 (88%), Gaps = 8/363 (2%)
 Frame = +3

Query  348   KVGISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGG----NPDSNTL  515
             +V  S AAA   G TVVIGLAADSGCGK+TF+RRLTSV G             NP SNTL
Sbjct  33    RVSCSAAAAAAAGGTVVIGLAADSGCGKTTFVRRLTSVLGAGTAAAAAPPWGGNPGSNTL  92

Query  516   ISDMTTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHV  695
             + D  TVICLDDYHSLDR GRKE+GVTALDPRANDFDLMY Q+KA+KEG+AV KPIYNH 
Sbjct  93    LGDAATVICLDDYHSLDRAGRKERGVTALDPRANDFDLMYRQLKAIKEGRAVAKPIYNHA  152

Query  696   TGLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGH  875
             TGLLDPPEL  PPKILV+EGLHPMYD RVR LLDFSIYLDIS+++KFAWKIQRDMAERGH
Sbjct  153   TGLLDPPELITPPKILVVEGLHPMYDERVRGLLDFSIYLDISSDIKFAWKIQRDMAERGH  212

Query  876   SLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIP----DDNEGKVLRVRLIMKE  1043
             SLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPT+LI     D +EGKVLRV+LIMKE
Sbjct  213   SLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTRLIAAADDDGDEGKVLRVKLIMKE  272

Query  1044  GVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLD  1223
             GV+HF+P YLFDEGSTISWIPCGRKL+CSYPGIKF+Y PDTYFGHEVSVLEMDG+FD+LD
Sbjct  273   GVEHFAPAYLFDEGSTISWIPCGRKLSCSYPGIKFSYFPDTYFGHEVSVLEMDGKFDKLD  332

Query  1224  ELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             ELIYVESHLS+LSTK+YGEVTQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQ+VA RA
Sbjct  333   ELIYVESHLSNLSTKYYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQVVAERA  392

Query  1404  AAP  1412
             A+P
Sbjct  393   ASP  395



>ref|NP_001148258.1| LOC100281866 [Zea mays]
 gb|ACG30330.1| phosphoribulokinase [Zea mays]
 tpg|DAA36214.1| TPA: phosphoribulokinase [Zea mays]
Length=381

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/352 (82%), Positives = 318/352 (90%), Gaps = 8/352 (2%)
 Frame = +3

Query  351   VGISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGG-NPDSNTLISDM  527
             + +SC+      KTVVIG+AADSGCGK+TF RRL SV GG AEPP+ G NP SNTL+SD 
Sbjct  36    IRVSCS------KTVVIGVAADSGCGKTTFTRRLASVLGGGAEPPRAGRNPGSNTLVSDT  89

Query  528   TTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLL  707
             TTVICLDDYHSLDR GRK KGVTALDPR  DFDLMYEQV+A+KEG+AV+KP+YNHVTGLL
Sbjct  90    TTVICLDDYHSLDRVGRKAKGVTALDPRFVDFDLMYEQVRAIKEGRAVEKPVYNHVTGLL  149

Query  708   DPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERG-HSLE  884
             DPPEL  PP ILVI+GLHPM+D RVR+LLDFSIYLDISNEVK AWKIQRDM ERG HSLE
Sbjct  150   DPPELITPPNILVIKGLHPMFDERVRDLLDFSIYLDISNEVKLAWKIQRDMGERGGHSLE  209

Query  885   SIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSP  1064
             SIKASIEARKPDF+AYI+PQKQYADAVIEVLPTQLIP D+E KV+RV+LIMKEGV+HF+P
Sbjct  210   SIKASIEARKPDFEAYIEPQKQYADAVIEVLPTQLIPGDDECKVVRVKLIMKEGVEHFAP  269

Query  1065  VYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVES  1244
             V+LFDEGST+ WIPCGRKL+CSYPGI+F YG DTYFGHEVSV+EMDGQFD+LDELIYVE+
Sbjct  270   VHLFDEGSTVYWIPCGRKLSCSYPGIRFAYGFDTYFGHEVSVVEMDGQFDKLDELIYVET  329

Query  1245  HLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATR  1400
             HLS+LSTKFYGEVTQQML+HAD PGSNNGTG FQTIVGLKIRDLYEQIVA R
Sbjct  330   HLSNLSTKFYGEVTQQMLRHADVPGSNNGTGLFQTIVGLKIRDLYEQIVARR  381



>ref|XP_001771011.1| predicted protein [Physcomitrella patens]
 gb|EDQ64166.1| predicted protein [Physcomitrella patens]
Length=331

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/331 (86%), Positives = 305/331 (92%), Gaps = 2/331 (1%)
 Frame = +3

Query  441   MRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGVTALDPRAND  620
             MRRLTSVFGGAA PPKGGNPDSNTLISD TTVICLDDYHSLDR GRKE  VTALDPRAN+
Sbjct  1     MRRLTSVFGGAASPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGRKEAAVTALDPRANN  60

Query  621   FDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDARVRELLDF  800
             FDLMYEQVKALKEGK+V+KPIYNHVTGLLD PE   PPKILVIEGLHPMYD RVRELLDF
Sbjct  61    FDLMYEQVKALKEGKSVEKPIYNHVTGLLDAPETIHPPKILVIEGLHPMYDERVRELLDF  120

Query  801   SIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLP  980
             SIYLDIS++VKFAWKIQRDMAERGHSLESIKASI ARKPDFDA+IDPQKQYAD VI+VLP
Sbjct  121   SIYLDISDDVKFAWKIQRDMAERGHSLESIKASIAARKPDFDAFIDPQKQYADVVIQVLP  180

Query  981   TQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGP  1160
             TQLIPDDNEGKVLRVR++MKEGV  F PVYLFDEGSTISWIPCGRKLTCSYPGIKF YGP
Sbjct  181   TQLIPDDNEGKVLRVRMVMKEGVPFFEPVYLFDEGSTISWIPCGRKLTCSYPGIKFFYGP  240

Query  1161  DTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGF  1340
             DTY+G+EVSVLEMDGQFD+LDELIYVESHLS++STKFYGE+TQQMLKHADFPGSNNGTG 
Sbjct  241   DTYYGNEVSVLEMDGQFDKLDELIYVESHLSNISTKFYGEITQQMLKHADFPGSNNGTGL  300

Query  1341  FQTIVGLKIRDLYEQIVATR--AAAPVEAKA  1427
             FQTI GLKIR +YE+I+A +  AA    AKA
Sbjct  301   FQTICGLKIRGVYERILANQNNAATLESAKA  331



>ref|XP_005847700.1| phosphoribulokinase precursor, partial [Chlorella variabilis]
 gb|EFN55598.1| phosphoribulokinase precursor, partial [Chlorella variabilis]
Length=405

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/379 (76%), Positives = 322/379 (85%), Gaps = 5/379 (1%)
 Frame = +3

Query  258   VQSLHSTCSISTPT--KTHFQRQVFVYKKSARKVGISCAAAGGDGKTVVIGLAADSGCGK  431
              Q   S   I+ PT   T  QR +   + ++R V +   A GGD K VVIGLAADSGCGK
Sbjct  27    AQLAASAAPIARPTFSSTLNQRTLKAGRVASRVVVVK--AEGGD-KIVVIGLAADSGCGK  83

Query  432   STFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGVTALDPR  611
             STFMRR+T +FGG  +PP GGNPDSNTLISDMTTVICLDDYHSLDR GRKE GVTAL P 
Sbjct  84    STFMRRVTGIFGGEPKPPSGGNPDSNTLISDMTTVICLDDYHSLDRNGRKEAGVTALAPE  143

Query  612   ANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDARVREL  791
             + +FDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPE T  P ILVIEGLHP YD RV EL
Sbjct  144   SQNFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPEPTSSPNILVIEGLHPFYDERVNEL  203

Query  792   LDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIE  971
             +DF IYLDIS+E+KFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQK+ AD +I+
Sbjct  204   VDFRIYLDISDEIKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKKKADMIIQ  263

Query  972   VLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFT  1151
             VLPTQL+PD+ EGK+LRVRLIMK+G K F PVYLFD+GST+SWIPCGRKLTCS+PGIK  
Sbjct  264   VLPTQLVPDEKEGKILRVRLIMKDGKKLFDPVYLFDQGSTVSWIPCGRKLTCSFPGIKMF  323

Query  1152  YGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNG  1331
             YGPDTY+G EVSVLEMDGQFD+L+ELIY+ESHLS+ S KFYGE+TQQMLK++ FPGSNNG
Sbjct  324   YGPDTYYGEEVSVLEMDGQFDKLEELIYMESHLSNTSAKFYGEITQQMLKNSSFPGSNNG  383

Query  1332  TGFFQTIVGLKIRDLYEQI  1388
             TG FQTIVGLK R++YE+I
Sbjct  384   TGLFQTIVGLKCREVYERI  402



>emb|CAE05477.1| OSJNBa0006A01.23 [Oryza sativa Japonica Group]
 emb|CAE03931.3| OSJNba0093F12.5 [Oryza sativa Japonica Group]
Length=495

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/354 (82%), Positives = 312/354 (88%), Gaps = 8/354 (2%)
 Frame = +3

Query  348   KVGISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGG----NPDSNTL  515
             +V  S AAA   G TVVIGLAADSGCGK+TF+RRLTSV G             NP SNTL
Sbjct  33    RVSCSAAAAAAAGGTVVIGLAADSGCGKTTFVRRLTSVLGAGTAAAAAPPWGGNPGSNTL  92

Query  516   ISDMTTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHV  695
             + D  TVICLDDYHSLDR GRKE+GVTALDPRANDFDLMY Q+KA+KEG+AV KPIYNH 
Sbjct  93    LGDAATVICLDDYHSLDRAGRKERGVTALDPRANDFDLMYRQLKAIKEGRAVAKPIYNHA  152

Query  696   TGLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGH  875
             TGLLDPPEL  PPKILV+EGLHPMYD RVR LLDFSIYLDIS+++KFAWKIQRDMAERGH
Sbjct  153   TGLLDPPELITPPKILVVEGLHPMYDERVRGLLDFSIYLDISSDIKFAWKIQRDMAERGH  212

Query  876   SLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIP----DDNEGKVLRVRLIMKE  1043
             SLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPT+LI     D +EGKVLRV+LIMKE
Sbjct  213   SLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTRLIAAADDDGDEGKVLRVKLIMKE  272

Query  1044  GVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLD  1223
             GV+HF+P YLFDEGSTISWIPCGRKL+CSYPGIKF+Y PDTYFGHEVSVLEMDG+FD+LD
Sbjct  273   GVEHFAPAYLFDEGSTISWIPCGRKLSCSYPGIKFSYFPDTYFGHEVSVLEMDGKFDKLD  332

Query  1224  ELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQ  1385
             ELIYVESHLS+LSTK+YGEVTQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQ
Sbjct  333   ELIYVESHLSNLSTKYYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQ  386



>ref|XP_005651008.1| phosphoribulokinase [Coccomyxa subellipsoidea C-169]
 gb|EIE26464.1| phosphoribulokinase [Coccomyxa subellipsoidea C-169]
Length=340

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/340 (78%), Positives = 302/340 (89%), Gaps = 0/340 (0%)
 Frame = +3

Query  396   VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTG  575
             +IGLAADSGCGKSTFMRR+  VFGG+   P+GGNP+SNTL+SDM TVICLDDYH LDRTG
Sbjct  1     MIGLAADSGCGKSTFMRRMIGVFGGSPRAPEGGNPESNTLLSDMATVICLDDYHCLDRTG  60

Query  576   RKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEG  755
             RKEKGVTALDP+A DF+LMYEQ KA+KEGK++DKPIYNHV+GLLDP E  KPPKI+V+EG
Sbjct  61    RKEKGVTALDPKAQDFELMYEQAKAIKEGKSIDKPIYNHVSGLLDPAETIKPPKIMVLEG  120

Query  756   LHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYI  935
             LHP YD RVR+L DF IYLDIS+EVKFAWKIQRDM ERGHSLESIKASIEAR+PDFDAYI
Sbjct  121   LHPFYDERVRDLYDFKIYLDISDEVKFAWKIQRDMKERGHSLESIKASIEARRPDFDAYI  180

Query  936   DPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGR  1115
             DPQK++AD +I+VLPTQLIPD+ EGKVLRVR I KEGV  F P +LFDEGSTISWIPCGR
Sbjct  181   DPQKKHADVIIQVLPTQLIPDEKEGKVLRVRFIQKEGVNFFKPTFLFDEGSTISWIPCGR  240

Query  1116  KLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQM  1295
             KLTCS+PGIKF YGPDTY+G EVS+LEMDGQFD+++ELIYVESHLS+ S KFYGE+TQQM
Sbjct  241   KLTCSFPGIKFFYGPDTYYGEEVSILEMDGQFDKIEELIYVESHLSNTSAKFYGEITQQM  300

Query  1296  LKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPV  1415
             LK++ FPGS NGTG FQTIVGLKIR++YE +V T   + V
Sbjct  301   LKNSQFPGSTNGTGLFQTIVGLKIREVYEAVVDTTVKSAV  340



>ref|XP_001694038.1| phosphoribulokinase [Chlamydomonas reinhardtii]
 sp|P19824.1|KPPR_CHLRE RecName: Full=Phosphoribulokinase, chloroplastic; Short=PRK; 
Short=PRKase; AltName: Full=Phosphopentokinase; Flags: Precursor 
[Chlamydomonas reinhardtii]
 gb|AAF36402.1|AF228914_1 phosphoribulokinase precursor [Chlamydomonas reinhardtii]
 gb|AAA33090.1| phosphoribulokinase [Chlamydomonas reinhardtii]
 gb|EDP02974.1| phosphoribulokinase [Chlamydomonas reinhardtii]
 prf||1703465A phosphoribulokinase
Length=375

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/351 (77%), Positives = 305/351 (87%), Gaps = 1/351 (0%)
 Frame = +3

Query  339   SARKVGISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLI  518
             +A +   S        KTVVIGLAADSGCGKSTFMRR+TS+FGG  +PP GGNPDSNTLI
Sbjct  19    TANRARRSLVVRADKDKTVVIGLAADSGCGKSTFMRRMTSIFGGVPKPPAGGNPDSNTLI  78

Query  519   SDMTTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVT  698
             SDMTTVICLDDYH LDR GRK KGVTAL P A +FDLMY QVKALKEGK+VDKPIYNHV+
Sbjct  79    SDMTTVICLDDYHCLDRNGRKVKGVTALAPEAQNFDLMYNQVKALKEGKSVDKPIYNHVS  138

Query  699   GLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHS  878
             GL+D PE  + P ILVIEGLHP YD RV ELLDF IYLDIS+++KFAWKIQRDMAERGHS
Sbjct  139   GLIDAPEKIESPPILVIEGLHPFYDKRVAELLDFKIYLDISDDIKFAWKIQRDMAERGHS  198

Query  879   LESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHF  1058
             LESIK+SI ARKPDFDAYIDPQK+ AD +I+VLPTQL+PDD +G+ LRVRLIMKEG K F
Sbjct  199   LESIKSSIAARKPDFDAYIDPQKKDADMIIQVLPTQLVPDD-KGQYLRVRLIMKEGSKMF  257

Query  1059  SPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYV  1238
              PVYLFDEGSTISWIPCGRKLTCS+PGIK  YGPDT++G EVSVLEMDGQFD+L+ELIYV
Sbjct  258   DPVYLFDEGSTISWIPCGRKLTCSFPGIKMFYGPDTWYGQEVSVLEMDGQFDKLEELIYV  317

Query  1239  ESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIV  1391
             ESHLS+ S KFYGE+TQQMLK++ FPGSNNGTG FQTIVGLK+R++YE+IV
Sbjct  318   ESHLSNTSAKFYGEITQQMLKNSGFPGSNNGTGLFQTIVGLKVREVYERIV  368



>ref|XP_002949322.1| hypothetical protein VOLCADRAFT_104265 [Volvox carteri f. nagariensis]
 gb|EFJ49815.1| hypothetical protein VOLCADRAFT_104265 [Volvox carteri f. nagariensis]
Length=376

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/335 (80%), Positives = 300/335 (90%), Gaps = 1/335 (0%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             KTVVIGLAADSGCGKSTFMRR+TS+FGG  +PP GGNPDSNTLISDMTTVICLDDYH LD
Sbjct  36    KTVVIGLAADSGCGKSTFMRRMTSIFGGVPKPPAGGNPDSNTLISDMTTVICLDDYHCLD  95

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK KGVTAL P A +FDLMY QVKALKEGKAVDKPIYNHVTGL+D PE    P ILV
Sbjct  96    RNGRKVKGVTALAPEAQNFDLMYNQVKALKEGKAVDKPIYNHVTGLIDAPEKIDSPNILV  155

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP +D RV +LLDF IYLDIS+++KFAWKIQRDMAERGHSL++IK+SIEARKPDFD
Sbjct  156   IEGLHPFFDKRVADLLDFKIYLDISDDIKFAWKIQRDMAERGHSLQAIKSSIEARKPDFD  215

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQK+ AD +I+VLPTQL+PDD +G+ LRVRLI KEG K F PVYLFDEGSTISWIP
Sbjct  216   AYIDPQKKDADMIIQVLPTQLVPDD-KGQYLRVRLIQKEGSKMFDPVYLFDEGSTISWIP  274

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCS+PGIK  YGPDT++G EVSVLEMDGQFD+L+ELIYVESHLS+ S KFYGE+T
Sbjct  275   CGRKLTCSFPGIKMFYGPDTWYGQEVSVLEMDGQFDKLEELIYVESHLSNTSAKFYGEIT  334

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIV  1391
             QQMLK++ FPGSNNGTG FQTIVGLK+R++YE+IV
Sbjct  335   QQMLKNSGFPGSNNGTGLFQTIVGLKVREVYERIV  369



>ref|XP_003058071.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58022.1| predicted protein [Micromonas pusilla CCMP1545]
Length=376

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/358 (74%), Positives = 310/358 (87%), Gaps = 3/358 (1%)
 Frame = +3

Query  336   KSARKVGISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTL  515
             ++A++  ++ AA  G    V+IGLAADSGCGKSTFMRR+TS+FGG A PP+GGNPDSNTL
Sbjct  20    RAAKRNVVTRAARDG---PVIIGLAADSGCGKSTFMRRMTSLFGGKATPPEGGNPDSNTL  76

Query  516   ISDMTTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHV  695
             ISD TTV+CLDDYH  DR GRKE G+TAL+ +  +FDLMY+QVKALKEGKAV+KPIYNHV
Sbjct  77    ISDTTTVLCLDDYHLNDRNGRKESGLTALNLKEQNFDLMYDQVKALKEGKAVEKPIYNHV  136

Query  696   TGLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGH  875
             TG+ DP E  + P IL++EGLHP  D RVR++ DF IYLDIS++VKFAWKIQRDMAERGH
Sbjct  137   TGVFDPAEKIESPDILILEGLHPFADERVRDMFDFKIYLDISDDVKFAWKIQRDMAERGH  196

Query  876   SLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKH  1055
             SLESIKASIEARKPDFD ++DPQKQY+D +I+VLPTQLIPDDNEGK+LRVR+IMKEGV++
Sbjct  197   SLESIKASIEARKPDFDEFVDPQKQYSDVIIQVLPTQLIPDDNEGKILRVRMIMKEGVEN  256

Query  1056  FSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIY  1235
             F   YLFDEGSTISWIPCGRKLTCSYPGIKF YGPDT+FG EVSVLEMDGQFD+L+ELIY
Sbjct  257   FDAPYLFDEGSTISWIPCGRKLTCSYPGIKFFYGPDTFFGEEVSVLEMDGQFDKLEELIY  316

Query  1236  VESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             VESHLS+ STKFYGE+TQQMLK+ + PGSNNGTG FQT+ GLK+R+LYE+I      A
Sbjct  317   VESHLSNTSTKFYGEITQQMLKYQNGPGSNNGTGLFQTLCGLKVRELYERISEKEVVA  374



>gb|KFM26811.1| Phosphoribulokinase, chloroplastic [Auxenochlorella protothecoides]
Length=352

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/345 (76%), Positives = 299/345 (87%), Gaps = 0/345 (0%)
 Frame = +3

Query  372   AGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDD  551
             A G G+TVVIGLAADSGCGKSTFMRR+T VFGG  +PP GGNPDSNTLISDMTTVICLDD
Sbjct  6     AAGPGQTVVIGLAADSGCGKSTFMRRVTGVFGGVPKPPSGGNPDSNTLISDMTTVICLDD  65

Query  552   YHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKP  731
             YHSLDR GRK + VTAL PRA +FDLMYEQVKALK G++V KPIYNHVTG LDPPE   P
Sbjct  66    YHSLDRNGRKVEKVTALHPRAQNFDLMYEQVKALKNGQSVQKPIYNHVTGALDPPEEITP  125

Query  732   PKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR  911
             PKIL++EGLHP +D RV +L+DF IYLDIS+  KFAWKIQRDM ERGHSLESIKASIE+R
Sbjct  126   PKILIVEGLHPFFDDRVNDLIDFRIYLDISDATKFAWKIQRDMEERGHSLESIKASIESR  185

Query  912   KPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGST  1091
             KPDFDAYIDPQK  AD +I+VLPT L+PD+ EGK+LRVRLI KEG + FSP YLFDEGST
Sbjct  186   KPDFDAYIDPQKAKADVIIQVLPTDLVPDEKEGKILRVRLIQKEGRELFSPSYLFDEGST  245

Query  1092  ISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKF  1271
             ISW+PCGRKLTCS+PGIK  YGPDTY+G +VSVLEMDGQF++L+ELIYVESHLS+ STKF
Sbjct  246   ISWVPCGRKLTCSFPGIKLFYGPDTYYGEDVSVLEMDGQFEKLEELIYVESHLSNTSTKF  305

Query  1272  YGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAA  1406
             YGE+TQQMLK+++FPGS NGTG FQ I GLK+R++YEQ+     A
Sbjct  306   YGEITQQMLKNSNFPGSKNGTGLFQVITGLKVREVYEQLTQREVA  350



>ref|XP_002508184.1| phosphoribulokinase chloroplast precursor [Micromonas sp. RCC299]
 gb|ACO69442.1| phosphoribulokinase chloroplast precursor [Micromonas sp. RCC299]
Length=387

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/354 (75%), Positives = 304/354 (86%), Gaps = 4/354 (1%)
 Frame = +3

Query  327   VYKKSARKVGISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDS  506
             V + + R V +     G     V+IGLAADSGCGKSTFMRR+TS+FGG A PP+GGNPDS
Sbjct  29    VVRAAKRNVTVKAERDG----PVLIGLAADSGCGKSTFMRRMTSLFGGKATPPEGGNPDS  84

Query  507   NTLISDMTTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIY  686
             NTLISD TTV+CLDDYH  DR GRKE G+TAL+ +  +FDLMYEQ KAL EGKAVDKPIY
Sbjct  85    NTLISDSTTVLCLDDYHLNDRNGRKESGLTALNLKEQNFDLMYEQTKALMEGKAVDKPIY  144

Query  687   NHVTGLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAE  866
             NHVTG+ DP E  + P IL++EGLHP  D RVR++ DF IYLDIS++VKFAWKIQRDMAE
Sbjct  145   NHVTGVFDPAEKIESPSILILEGLHPFADERVRDMFDFKIYLDISDDVKFAWKIQRDMAE  204

Query  867   RGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEG  1046
             RGHSLESIKASIEARKPDFD ++DPQKQYAD VI+VLPTQLIPDDNEGK+LRVR+IMKEG
Sbjct  205   RGHSLESIKASIEARKPDFDEFVDPQKQYADIVIQVLPTQLIPDDNEGKILRVRMIMKEG  264

Query  1047  VKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDE  1226
             V++F   YLFDEGSTISWIPCGRKLTCSYPGIKF YGPDT+FG EVSVLEMDGQFD+L+E
Sbjct  265   VENFDAPYLFDEGSTISWIPCGRKLTCSYPGIKFFYGPDTFFGEEVSVLEMDGQFDKLEE  324

Query  1227  LIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQI  1388
             LIYVESHLS+ STKFYGE+TQQMLK+ + PGSNNGTG FQT+ GLK+R+LYE+I
Sbjct  325   LIYVESHLSNTSTKFYGEITQQMLKYQNGPGSNNGTGLFQTLCGLKVRELYERI  378



>ref|XP_007512393.1| phosphoribulokinase [Bathycoccus prasinos]
 emb|CCO16993.1| phosphoribulokinase [Bathycoccus prasinos]
Length=381

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/363 (75%), Positives = 308/363 (85%), Gaps = 5/363 (1%)
 Frame = +3

Query  333   KKSARKVGISCAA----AGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNP  500
             K SAR    S A+    A  DG  V+IGLAADSGCGKSTFMRR+TS+FGG A PP+GGNP
Sbjct  19    KSSARNQVKSRASLRVNAKADG-PVIIGLAADSGCGKSTFMRRMTSLFGGKASPPEGGNP  77

Query  501   DSNTLISDMTTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKP  680
             DSNTLISD TTV+CLDDYH  DR GRKE G+TAL+ +  +FDLM+EQVKALKEGK V KP
Sbjct  78    DSNTLISDTTTVLCLDDYHLNDRQGRKESGLTALNLKEQNFDLMHEQVKALKEGKTVQKP  137

Query  681   IYNHVTGLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDM  860
             IYNHVTG+ DP E    PK+L++EGLHP  D RVR   DF IYLDIS++VKFAWKIQRDM
Sbjct  138   IYNHVTGVFDPAEEIVSPKVLILEGLHPFADDRVRNFYDFKIYLDISDDVKFAWKIQRDM  197

Query  861   AERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMK  1040
             AERGHSLESIKASIEARKPDFDA++DPQK++AD VI+VLPTQLIPDDNEGK+LRVR+IMK
Sbjct  198   AERGHSLESIKASIEARKPDFDAFVDPQKKFADVVIQVLPTQLIPDDNEGKILRVRMIMK  257

Query  1041  EGVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRL  1220
             EGVK F   YLFDEGSTISWIPCGRKLTCSYPGIKF YGPDT++G EVSVLEMDGQFD+L
Sbjct  258   EGVKFFDTPYLFDEGSTISWIPCGRKLTCSYPGIKFFYGPDTFYGEEVSVLEMDGQFDKL  317

Query  1221  DELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATR  1400
             +ELIYVES LS+ STKFYGE+TQQMLK+ + PGSNNGTGFFQT+VGLK+R+LYE+I  T 
Sbjct  318   EELIYVESLLSNTSTKFYGELTQQMLKYQNGPGSNNGTGFFQTLVGLKVRELYEKISETE  377

Query  1401  AAA  1409
               A
Sbjct  378   VVA  380



>ref|XP_001417260.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95553.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=381

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/352 (75%), Positives = 311/352 (88%), Gaps = 5/352 (1%)
 Frame = +3

Query  336   KSARKVGISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTL  515
             +SAR V      A  DG  V+IGLAADSGCGKSTFMRR+TS+FGG A PP+GGNPDSNTL
Sbjct  28    RSARVV----TQAKRDG-PVIIGLAADSGCGKSTFMRRMTSLFGGKATPPEGGNPDSNTL  82

Query  516   ISDMTTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHV  695
             ISD TTV+CLDDYH  DR GRK+ G+TAL+ +  +FDLMYEQVKALKEGK+VDKPIYNHV
Sbjct  83    ISDTTTVLCLDDYHLNDRQGRKDSGLTALNLKEQNFDLMYEQVKALKEGKSVDKPIYNHV  142

Query  696   TGLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGH  875
             TG+ DP E  + P++L++EGLHP  D RVR++ DF IYLDIS+EVKFAWKIQRDMAERGH
Sbjct  143   TGVFDPAEKIESPEVLILEGLHPFADTRVRDMFDFKIYLDISDEVKFAWKIQRDMAERGH  202

Query  876   SLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKH  1055
             SLESIKASIEARKPDFDA++DPQK+++D +I+VLPTQLIPDDNEGK+LRVR+IMKEG+++
Sbjct  203   SLESIKASIEARKPDFDAFVDPQKEFSDVIIQVLPTQLIPDDNEGKILRVRMIMKEGLEN  262

Query  1056  FSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIY  1235
             F   +LFDEGSTISWIPCGRKLTCSYPGIKF YGPDT++G EV+VLEMDGQFD+L+ELIY
Sbjct  263   FDAPFLFDEGSTISWIPCGRKLTCSYPGIKFFYGPDTFYGKEVTVLEMDGQFDKLEELIY  322

Query  1236  VESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIV  1391
             VESHLS+ STKFYGE+TQQMLK+ + PGSNNGTGFFQTIVGLK+R++YE+I 
Sbjct  323   VESHLSNTSTKFYGEITQQMLKYQNGPGSNNGTGFFQTIVGLKVREVYERIA  374



>emb|CEF97598.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=382

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/339 (76%), Positives = 302/339 (89%), Gaps = 0/339 (0%)
 Frame = +3

Query  393   VVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRT  572
             V+IGLAADSGCGKSTFMRR+TS+FGG A PP+GGNPDSNTLIS+ TTV+CLDDYH  DR 
Sbjct  42    VIIGLAADSGCGKSTFMRRMTSLFGGKATPPEGGNPDSNTLISETTTVLCLDDYHLNDRA  101

Query  573   GRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIE  752
             GRK  G+TAL+ +  +FDLMY+QVKALKEGK+VDKPIYNHVTG+ DP E  + P++L++E
Sbjct  102   GRKTSGLTALNLKEQNFDLMYDQVKALKEGKSVDKPIYNHVTGVFDPAEKIESPEVLILE  161

Query  753   GLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAY  932
             GLHP  D RVR++ DF IYLDIS++VKFAWKIQRDMAERGHSLESIKASIEARKPDFDA+
Sbjct  162   GLHPFADTRVRDMFDFKIYLDISDDVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAF  221

Query  933   IDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCG  1112
             +DPQK++AD VIEVLPTQLIPDDNEGK+LRVR+IMKE V++F   YLFDEGSTISWIPCG
Sbjct  222   VDPQKEHADVVIEVLPTQLIPDDNEGKILRVRMIMKENVENFDAPYLFDEGSTISWIPCG  281

Query  1113  RKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQ  1292
             RKLTCSYPGIKF YGPDTY+G EV+VLEMDGQFD+L+ELIYVESHLS+ S+KFYGE+TQQ
Sbjct  282   RKLTCSYPGIKFFYGPDTYYGKEVTVLEMDGQFDKLEELIYVESHLSNTSSKFYGEITQQ  341

Query  1293  MLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             MLK+ + PGSNNGTGFFQTIVGLK+R++YE+I      A
Sbjct  342   MLKYQNGPGSNNGTGFFQTIVGLKVREVYERISGKEVVA  380



>ref|XP_003078808.1| KPPR_CHLRE Phosphoribulokinase, chloroplast precursor (ISS) [Ostreococcus 
tauri]
Length=413

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/347 (74%), Positives = 301/347 (87%), Gaps = 8/347 (2%)
 Frame = +3

Query  393   VVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRT  572
             V+IGLAADSGCGKSTFMRR+TS+FGG A PP+GGNPDSNTLIS+ TTV+CLDDYH  DR 
Sbjct  65    VIIGLAADSGCGKSTFMRRMTSLFGGKATPPEGGNPDSNTLISETTTVLCLDDYHLNDRA  124

Query  573   GRKEKGVTALDPRANDF--------DLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTK  728
             GRK  G+TAL+ +  +F         LMY+QVKALKEGK+VDKPIYNHVTG+ DP E  +
Sbjct  125   GRKTSGLTALNLKEQNFGTTRRSRAHLMYDQVKALKEGKSVDKPIYNHVTGVFDPAEKIE  184

Query  729   PPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEA  908
              P++L++EGLHP  D RVR++ DF IYLDIS++VKFAWKIQRDMAERGHSLESIKASIEA
Sbjct  185   SPEVLILEGLHPFADTRVRDMFDFKIYLDISDDVKFAWKIQRDMAERGHSLESIKASIEA  244

Query  909   RKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGS  1088
             RKPDFDA++DPQK++AD VIEVLPTQLIPDDNEGK+LRVR+IMKE V++F   YLFDEGS
Sbjct  245   RKPDFDAFVDPQKEHADVVIEVLPTQLIPDDNEGKILRVRMIMKENVENFDAPYLFDEGS  304

Query  1089  TISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTK  1268
             TISWIPCGRKLTCSYPGIKF YGPDTY+G EV+VLEMDGQFD+L+ELIYVESHLS+ S+K
Sbjct  305   TISWIPCGRKLTCSYPGIKFFYGPDTYYGKEVTVLEMDGQFDKLEELIYVESHLSNTSSK  364

Query  1269  FYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             FYGE+TQQMLK+ + PGSNNGTGFFQTIVGLK+R++YE+I      A
Sbjct  365   FYGEITQQMLKYQNGPGSNNGTGFFQTIVGLKVREVYERISGKEVVA  411



>gb|EEE61597.1| hypothetical protein OsJ_16006 [Oryza sativa Japonica Group]
Length=392

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/363 (77%), Positives = 304/363 (84%), Gaps = 18/363 (5%)
 Frame = +3

Query  348   KVGISCAAAGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGG----NPDSNTL  515
             +V  S AAA   G TVVIGLAADSGCGK+TF+RRLTSV G             NP SNTL
Sbjct  33    RVSCSAAAAAAAGGTVVIGLAADSGCGKTTFVRRLTSVLGAGTAAAAAPPWGGNPGSNTL  92

Query  516   ISDMTTVICLDDYHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHV  695
             + D  TVICLDDYHSLDR GRKE+GVTALDPRANDFDLMY Q+KA+KEG+AV KPIYNH 
Sbjct  93    LGDAATVICLDDYHSLDRAGRKERGVTALDPRANDFDLMYRQLKAIKEGRAVAKPIYNHA  152

Query  696   TGLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGH  875
             TGLLDPPEL  PPKILV+EGLHPMYD RVR LLDFSIYLDIS+++KFAWKIQRDMAERGH
Sbjct  153   TGLLDPPELITPPKILVVEGLHPMYDERVRGLLDFSIYLDISSDIKFAWKIQRDMAERGH  212

Query  876   SLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIP----DDNEGKVLRVRLIMKE  1043
             SLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPT+LI     D +EGKVLRV+LIMKE
Sbjct  213   SLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTRLIAAADDDGDEGKVLRVKLIMKE  272

Query  1044  GVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLD  1223
             GV+HF+P YLFDEGSTISWIPCGRKL+   P  +            VSVLEMDG+FD+LD
Sbjct  273   GVEHFAPAYLFDEGSTISWIPCGRKLSWLLPWHQIL----------VSVLEMDGKFDKLD  322

Query  1224  ELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             ELIYVESHLS+LSTK+YGEVTQQMLKHADFPGSNNGTG FQTIVGLKIRDLYEQ+VA RA
Sbjct  323   ELIYVESHLSNLSTKYYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQVVAERA  382

Query  1404  AAP  1412
             A+P
Sbjct  383   ASP  385



>gb|AAD55057.1| phosphoribulokinase [Beta vulgaris]
Length=271

 Score =   522 bits (1344),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 248/271 (92%), Positives = 262/271 (97%), Gaps = 0/271 (0%)
 Frame = +3

Query  426   GKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKGVTALD  605
             GKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISD TTVICLDD+HSLDRTGRKEKGVTALD
Sbjct  1     GKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDFHSLDRTGRKEKGVTALD  60

Query  606   PRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDARVR  785
             PRANDFDLMY+QVKALK+GK VDKPIYNHV+GLLDPPE+ +PPKILVIEGLHPMYDARVR
Sbjct  61    PRANDFDLMYDQVKALKQGKPVDKPIYNHVSGLLDPPEVIQPPKILVIEGLHPMYDARVR  120

Query  786   ELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAV  965
             ELLDFS+YLDISNEVKFAWKIQRDM ERGHSLESIKASIEARKPDFDAYIDPQKQYAD V
Sbjct  121   ELLDFSLYLDISNEVKFAWKIQRDMKERGHSLESIKASIEARKPDFDAYIDPQKQYADVV  180

Query  966   IEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIK  1145
             IEVLPTQLIPDD+EGKVLRVR+I KEGVK F+PVYLFDEGSTISWIPCGRKLTCSYPGIK
Sbjct  181   IEVLPTQLIPDDDEGKVLRVRMIQKEGVKFFNPVYLFDEGSTISWIPCGRKLTCSYPGIK  240

Query  1146  FTYGPDTYFGHEVSVLEMDGQFDRLDELIYV  1238
             F+YGPDTY+G+EV+VLEMDG FDRLD LIYV
Sbjct  241   FSYGPDTYYGNEVTVLEMDGIFDRLDGLIYV  271



>gb|ABK95585.1| unknown [Populus trichocarpa]
Length=267

 Score =   516 bits (1328),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 243/264 (92%), Positives = 256/264 (97%), Gaps = 0/264 (0%)
 Frame = +3

Query  630   MYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIY  809
             MYEQVKA+K+G AV+KPIYNHVTGLLDPPEL KPPKILVIEGLHPMYD RVR+LLDFSIY
Sbjct  1     MYEQVKAIKDGTAVEKPIYNHVTGLLDPPELIKPPKILVIEGLHPMYDQRVRDLLDFSIY  60

Query  810   LDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQL  989
             LDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQL
Sbjct  61    LDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQL  120

Query  990   IPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTY  1169
             IPDDNEGKVLRV+LIMKEGV+ FSPVYLFDEGS+ISWIPCGRKLTCSYPGIKF+YGPD Y
Sbjct  121   IPDDNEGKVLRVKLIMKEGVEFFSPVYLFDEGSSISWIPCGRKLTCSYPGIKFSYGPDAY  180

Query  1170  FGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQT  1349
             +GHEVSVLEMDGQFDRLDELIYVESHLS++STKFYGEVTQQMLKHADFPGSNNGTG FQT
Sbjct  181   YGHEVSVLEMDGQFDRLDELIYVESHLSNISTKFYGEVTQQMLKHADFPGSNNGTGLFQT  240

Query  1350  IVGLKIRDLYEQIVATRAAAPVEA  1421
             IVGLKIRDL+EQIVA+RA  PVEA
Sbjct  241   IVGLKIRDLFEQIVASRAKTPVEA  264



>emb|CBI23277.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   515 bits (1327),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 242/264 (92%), Positives = 257/264 (97%), Gaps = 0/264 (0%)
 Frame = +3

Query  630   MYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIY  809
             MYEQVKA+K+G AV+KPIYNHVTGLLDPPE  KPPKILVIEGLHPMYDARVR+LLDFSIY
Sbjct  1     MYEQVKAIKDGIAVEKPIYNHVTGLLDPPETIKPPKILVIEGLHPMYDARVRDLLDFSIY  60

Query  810   LDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQL  989
             LDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQL
Sbjct  61    LDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQL  120

Query  990   IPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTY  1169
             IPDDNEGKVLRVRLIMKEGV +FSPVYLFDEGSTISWIPCGRKLTCSYPGI F+YGPDTY
Sbjct  121   IPDDNEGKVLRVRLIMKEGVTYFSPVYLFDEGSTISWIPCGRKLTCSYPGINFSYGPDTY  180

Query  1170  FGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQT  1349
             +GHEVSVLEMDGQFDRLDELIYVESHLS++STKFYGE+TQQ+LKH+DFPGSNNGTG FQT
Sbjct  181   YGHEVSVLEMDGQFDRLDELIYVESHLSNISTKFYGEITQQLLKHSDFPGSNNGTGLFQT  240

Query  1350  IVGLKIRDLYEQIVATRAAAPVEA  1421
             IVGLKIRDL+EQIVA+RAA P+EA
Sbjct  241   IVGLKIRDLFEQIVASRAATPLEA  264



>emb|CDP11724.1| unnamed protein product [Coffea canephora]
Length=266

 Score =   508 bits (1308),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 241/266 (91%), Positives = 254/266 (95%), Gaps = 0/266 (0%)
 Frame = +3

Query  630   MYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIY  809
             MYEQVKA+K+G AVDKPIYNHVTGLLDPPEL KPPKILVIEGLHPMYD RVR++LDFSIY
Sbjct  1     MYEQVKAIKDGVAVDKPIYNHVTGLLDPPELIKPPKILVIEGLHPMYDQRVRDILDFSIY  60

Query  810   LDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQL  989
             LDIS+EVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYAD VIEVLPTQL
Sbjct  61    LDISSEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADVVIEVLPTQL  120

Query  990   IPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTY  1169
             IPDDNEGKVLRV+LI KEGV HFSPVYLFDEGSTISWIPCGRKLTCSYPGIKF YGPDTY
Sbjct  121   IPDDNEGKVLRVKLIQKEGVNHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFAYGPDTY  180

Query  1170  FGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQT  1349
             FG+EVSV+EMDGQFDRLDELIYVESHLS++S+KFYGEVTQQMLKHADFPGS+NGTG FQT
Sbjct  181   FGNEVSVVEMDGQFDRLDELIYVESHLSNISSKFYGEVTQQMLKHADFPGSSNGTGLFQT  240

Query  1350  IVGLKIRDLYEQIVATRAAAPVEAKA  1427
             IVGLKIRDLYEQIVA+RA A   AKA
Sbjct  241   IVGLKIRDLYEQIVASRAEALQTAKA  266



>emb|CBN76689.1| Phosphoribulokinase [Ectocarpus siliculosus]
Length=435

 Score =   513 bits (1321),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 249/379 (66%), Positives = 292/379 (77%), Gaps = 6/379 (2%)
 Frame = +3

Query  267   LHSTCSISTPTKTHFQRQVFVYKKSARKVGISCAAAGGDGKTVVIGLAADSGCGKSTFMR  446
             L +  + STPT T  +         AR   +S    G D K V+IG+AADSGCGKSTFMR
Sbjct  43    LGTRWASSTPTSTKARPGTMSRSARARLEALSMKL-GEDEKVVLIGVAADSGCGKSTFMR  101

Query  447   RLTSVFGGAAEPPKGGNPD-----SNTLISDMTTVICLDDYHSLDRTGRKEKGVTALDPR  611
             RLTS+FGG    P GG  D     +N+L+SD+TTV+CLDDYH  DR GRK  G TAL   
Sbjct  102   RLTSIFGGDTVGPLGGGFDNGGWETNSLVSDLTTVLCLDDYHLNDRGGRKVSGRTALHTE  161

Query  612   ANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMYDARVREL  791
                FDLMYEQ+  LK GK+V KPIYNHV G LD PE  KP  I++IEGLHP  D RVR+L
Sbjct  162   EQKFDLMYEQLNDLKNGKSVMKPIYNHVNGTLDTPEEIKPTPIVIIEGLHPFVDKRVRDL  221

Query  792   LDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIE  971
             LDF+IYLDIS+E+KFAWKIQRDM ERGHSLESI+ASIEARKPDFDA+I PQ+  AD VI+
Sbjct  222   LDFTIYLDISDEIKFAWKIQRDMMERGHSLESIQASIEARKPDFDAFIAPQRSEADVVIQ  281

Query  972   VLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFT  1151
             VLPTQLIP D EGK+LR R++ KEG+  F P +LFDEGSTISW+PCGRKLTCS+PGIKF 
Sbjct  282   VLPTQLIPGDTEGKILRTRMVQKEGLDFFDPAFLFDEGSTISWVPCGRKLTCSFPGIKFA  341

Query  1152  YGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHADFPGSNNG  1331
             YGPDTY+ +EVSV+EMDGQFD L ELIYVESHLS++ TKFYGE+TQ +LK AD PGSNNG
Sbjct  342   YGPDTYYDNEVSVIEMDGQFDNLQELIYVESHLSNIGTKFYGELTQNILKQADSPGSNNG  401

Query  1332  TGFFQTIVGLKIRDLYEQI  1388
             TGF QT+V LK+R++YE+I
Sbjct  402   TGFLQTLVALKLREVYERI  420



>ref|XP_002274133.2| PREDICTED: phosphoribulokinase, chloroplastic-like [Vitis vinifera]
Length=349

 Score =   506 bits (1304),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 248/353 (70%), Positives = 290/353 (82%), Gaps = 12/353 (3%)
 Frame = +3

Query  234   MAVCTVYTVQSLHSTCSISTPTKTHF---QRQVFVYKKSARKVGI---SCAAAGGDGKTV  395
             M +  V+   S++ T S   PTKTHF   Q  +  YKK+  K  I   SC++ G     V
Sbjct  1     MTISMVFRANSINHTPSFPNPTKTHFLSPQNLLHFYKKTPLKNHIGEFSCSSPG----PV  56

Query  396   VIGLAADSGCGKSTFMRRLTSVFGGAAEPPKG-GNPDSNTLISDMTTVICLDDYHSLDRT  572
             V+GLAADSGCGK+TFM+RLTSVFGGA +      NPDSNTLI+D TTVICLDDYH LDR 
Sbjct  57    VVGLAADSGCGKTTFMKRLTSVFGGAPKADHNHQNPDSNTLITDTTTVICLDDYHLLDRK  116

Query  573   GRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIE  752
              RKEKGVTAL PRAN+FDLM+EQ++ALK G  ++KPIYNH TGLLDPPEL  PPKILV+E
Sbjct  117   ERKEKGVTALHPRANNFDLMFEQIEALKHGFPIEKPIYNHATGLLDPPELIHPPKILVLE  176

Query  753   GLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAY  932
             GLHP+YD+RVR+LLDFSIYLDISNEVKF+WKIQRDMAERGHSLES++ASI+ARK DFDAY
Sbjct  177   GLHPLYDSRVRDLLDFSIYLDISNEVKFSWKIQRDMAERGHSLESVRASIKARKSDFDAY  236

Query  933   IDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKE-GVKHFSPVYLFDEGSTISWIPC  1109
             I+PQKQYA  V+EVLPTQLIPDD E KVLRVRLIMKE GVK+F P+Y+FDEGSTISW+PC
Sbjct  237   IEPQKQYASVVMEVLPTQLIPDDTERKVLRVRLIMKESGVKNFQPIYIFDEGSTISWVPC  296

Query  1110  GRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTK  1268
             GRKLTCSYPGIKF  GP+ YF +EV+VLEMDG+FD+L+EL+YVE HL ++ST 
Sbjct  297   GRKLTCSYPGIKFFCGPEAYFENEVTVLEMDGEFDKLEELVYVEGHLCNVSTN  349



>ref|WP_035984555.1| phosphoribulokinase [Leptolyngbya sp. KIOST-1]
Length=334

 Score =   503 bits (1294),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 230/337 (68%), Positives = 280/337 (83%), Gaps = 17/337 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             K V+IG+A DSGCGKSTF+RRL+ +FG                 ++  TVICLDDYHSLD
Sbjct  7     KVVLIGVAGDSGCGKSTFLRRLSDLFG-----------------AEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RK  GVTAL+P+AN+FDLMYEQ+KALKEG ++DKPIYNH TG LDPPE   P +I+V
Sbjct  50    RKQRKAAGVTALNPKANNFDLMYEQIKALKEGNSIDKPIYNHETGELDPPERVDPNRIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVRELLDFS+YLDIS+EVK AWKIQRDMAERGH+ E + ASI AR+PDF+
Sbjct  110   IEGLHPLYDERVRELLDFSVYLDISDEVKIAWKIQRDMAERGHTYEDVLASINARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYID QKQYAD VI++LPTQLIP+D E KVLRVRL+ +EG++ F PVYLFDEGSTI WIP
Sbjct  170   AYIDIQKQYADVVIQILPTQLIPNDEEKKVLRVRLMQREGIEGFDPVYLFDEGSTIDWIP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+  YGPD+Y+GHEVSVLE+DGQFDRL+E+IY+ESHLS+ STK+YGE+T
Sbjct  230   CGRKLTCSYPGIRMHYGPDSYYGHEVSVLEVDGQFDRLEEMIYIESHLSNTSTKYYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT  1397
             + +LKH ++PGS NG+G FQ +VGLK+R  YE++++T
Sbjct  290   ELLLKHREYPGSTNGSGLFQVLVGLKMRATYERLIST  326



>ref|WP_026072248.1| phosphoribulokinase [Nodosilinea nodulosa]
Length=334

 Score =   501 bits (1291),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 230/337 (68%), Positives = 279/337 (83%), Gaps = 17/337 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             K V+IG+A DSGCGKSTF+RRL+ +FG                 ++  TVICLDDYHSLD
Sbjct  7     KVVLIGVAGDSGCGKSTFLRRLSDLFG-----------------AEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RK  GVTALDP+AN+FDLMYEQ+KALK+GK++DKPIYNH TG LDPPE     +I+V
Sbjct  50    RKQRKAAGVTALDPKANNFDLMYEQIKALKDGKSIDKPIYNHETGELDPPERVDANRIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVREL+DFS+YLDIS+EVK AWKIQRDMAERGH+ E + ASI AR+PDF+
Sbjct  110   IEGLHPLYDERVRELIDFSVYLDISDEVKIAWKIQRDMAERGHTYEDVLASINARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYID QKQYAD VI++LPTQLIP+D E KVLRVRL+ +EG++ F PVYLFDEGSTI WIP
Sbjct  170   AYIDIQKQYADVVIQILPTQLIPNDEEKKVLRVRLMQREGIEGFEPVYLFDEGSTIDWIP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+  YGPD+Y+GHEVSVLE+DGQFDRL+ELIY+ESHLS+ STK+YGE+T
Sbjct  230   CGRKLTCSYPGIRMHYGPDSYYGHEVSVLEVDGQFDRLEELIYIESHLSNTSTKYYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT  1397
             + +LKH ++PGS NG+G FQ +VGLK+R  YE+++A 
Sbjct  290   ELLLKHREYPGSKNGSGLFQVLVGLKMRATYERLIAA  326



>ref|WP_017295158.1| phosphoribulokinase [Geminocystis herdmanii]
Length=336

 Score =   499 bits (1284),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 232/341 (68%), Positives = 273/341 (80%), Gaps = 17/341 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYH LD
Sbjct  5     RVVIIGVAGDSGCGKSTFLRRLEDLFG-----------------KEFMTVICLDDYHCLD  47

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRKE GVTALDPRAN+FDLM EQVKALK G+A+DKPIYNH TG LDPPE  +P K++V
Sbjct  48    RKGRKEAGVTALDPRANNFDLMAEQVKALKNGQAIDKPIYNHETGELDPPERIEPNKVIV  107

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YDARVREL+DFS+YLDIS EVK  WKIQRDMAERGHS + + ASI ARKPDF 
Sbjct  108   IEGLHPLYDARVRELVDFSVYLDISEEVKINWKIQRDMAERGHSYDDVVASIMARKPDFT  167

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQKQYAD V++VLPTQLI D+ EGK+LRVRLI KEG+ HF P YLFDEGSTI W P
Sbjct  168   AYIEPQKQYADIVLQVLPTQLIKDEKEGKILRVRLIEKEGIPHFEPTYLFDEGSTIDWRP  227

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC++PG+K  YGPD Y G+EVS+LE+DGQFD L+E+IYVESHLS  STK+YGE+T
Sbjct  228   CGRKLTCAFPGLKMYYGPDNYMGNEVSILEIDGQFDNLEEIIYVESHLSRTSTKYYGEMT  287

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             + +LKH D+PGSNNGTG FQ +VGLK+R+ YEQ+    A +
Sbjct  288   ELLLKHKDYPGSNNGTGLFQVLVGLKMRETYEQLTGVVAKS  328



>ref|WP_006455960.1| phosphoribulokinase [Synechococcus sp. PCC 7335]
 gb|EDX86199.1| Phosphoribulokinase / Uridine kinase family [Synechococcus sp. 
PCC 7335]
Length=335

 Score =   498 bits (1282),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 228/340 (67%), Positives = 275/340 (81%), Gaps = 17/340 (5%)
 Frame = +3

Query  381   DGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHS  560
             D + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHS
Sbjct  5     DSQVVLIGVAGDSGCGKSTFLRRLADLFG-----------------EEFMTVICLDDYHS  47

Query  561   LDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKI  740
             LDR  RKEK VTAL+P+AN+FDLMYEQ+KALKEG  +DKPIYNH TG LDPPE  +P KI
Sbjct  48    LDRKQRKEKKVTALNPKANNFDLMYEQIKALKEGNTIDKPIYNHETGELDPPEKVEPNKI  107

Query  741   LVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPD  920
             +VIEGLHP+YD RVR LLDFS+YLDIS+EVK  WKIQRDMAERGH+ E + A+I ARKPD
Sbjct  108   IVIEGLHPLYDERVRNLLDFSVYLDISDEVKINWKIQRDMAERGHTYEDVLAAINARKPD  167

Query  921   FDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             F+AYID QKQYAD VI++LPT LIP+D E K+LRVRLI +EG++ F PVYLFDEGSTI+W
Sbjct  168   FEAYIDVQKQYADVVIQILPTNLIPNDKENKILRVRLIQREGIEGFEPVYLFDEGSTINW  227

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
             IPCGRKLTCSYPG++  YGPD+YFG+EVSVLE+DG+FDRL+E+IYVESHLS+ ST  YGE
Sbjct  228   IPCGRKLTCSYPGLRMQYGPDSYFGNEVSVLELDGEFDRLEEVIYVESHLSNTSTNHYGE  287

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATR  1400
             +T+ +L H D+PGSNNG+G FQ +VGLK+R  YE++ A +
Sbjct  288   MTELLLNHRDYPGSNNGSGLFQVLVGLKMRATYEKLTAAK  327



>gb|AAK21910.1|AF336986_1 phosphoribulokinase [Vaucheria litorea]
 gb|ABD60353.1| chloroplast phosphoribulokinase precursor [Vaucheria litorea]
 gb|AFA52561.1| phosphoribulokinase [Vaucheria litorea]
Length=405

 Score =   501 bits (1289),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 246/393 (63%), Positives = 293/393 (75%), Gaps = 11/393 (3%)
 Frame = +3

Query  249   VYTVQSLHSTCSISTPTKTHFQRQVFVYKKSARKV-GISCAAAGGDGKTVVIGLAADSGC  425
             V +  S HS    ST     F        K+A K+  +       D   V+IG+AADSGC
Sbjct  17    VESFVSTHSALRTST-----FTNNAQSLNKAASKLQALEMKLGDPDEPVVIIGVAADSGC  71

Query  426   GKSTFMRRLTSVFGGAA-----EPPKGGNPDSNTLISDMTTVICLDDYHSLDRTGRKEKG  590
             GKSTFMRRLT++FGG++          G  ++NTL+SD+TTVICLDDYH  DR GRK  G
Sbjct  72    GKSTFMRRLTNIFGGSSVGPLGGGFGNGGWETNTLVSDLTTVICLDDYHLNDRNGRKVSG  131

Query  591   VTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVIEGLHPMY  770
              TAL      FDLM EQ+ ALK G++V KPIYNHV G LD PE  KP  I++IEGLHP  
Sbjct  132   RTALHTDEQKFDLMTEQLSALKRGESVMKPIYNHVNGTLDTPEEVKPTPIVIIEGLHPFV  191

Query  771   DARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQ  950
             D RVR+LLDF+IYLDIS+E+KFAWKIQRDM ERGHSLESI+ASIEARKPDFDAYI PQ+ 
Sbjct  192   DERVRDLLDFTIYLDISDEIKFAWKIQRDMMERGHSLESIQASIEARKPDFDAYIAPQRA  251

Query  951   YADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPCGRKLTCS  1130
              AD V++VLPT+L+P+D EGK+LR RLI KE VK+F   YLFDEGSTI+WIPCGRKLTCS
Sbjct  252   QADVVLQVLPTKLVPEDKEGKILRTRLIQKENVKNFETAYLFDEGSTINWIPCGRKLTCS  311

Query  1131  YPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQQMLKHAD  1310
             +PGIKF YGPDTYF +EVSVLEMDGQFD L ELIYVE  LS+  TKFYGE+TQ +LK +D
Sbjct  312   FPGIKFAYGPDTYFDNEVSVLEMDGQFDNLQELIYVEGFLSNTGTKFYGELTQNILKLSD  371

Query  1311  FPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
              PGSNNGTGF QT++ LK+R++YE+I  ++A A
Sbjct  372   SPGSNNGTGFLQTVIALKLREIYEKITTSQAEA  404



>ref|WP_015185887.1| uridine kinase [Microcoleus sp. PCC 7113]
 ref|YP_007125164.1| uridine kinase [Microcoleus sp. PCC 7113]
 gb|AFZ21758.1| uridine kinase [Microcoleus sp. PCC 7113]
Length=335

 Score =   495 bits (1274),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 229/345 (66%), Positives = 279/345 (81%), Gaps = 19/345 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EEFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE+GVTAL+P+AN+FDLMYEQ+KALKEGKA+DKPIYNH TG LDPPE  +P KILV
Sbjct  50    RKQRKEQGVTALNPKANNFDLMYEQIKALKEGKAIDKPIYNHETGELDPPERIEPNKILV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DF +YLDIS+EVK  WKIQRDMAERGH  E + A+I AR+PDF 
Sbjct  110   IEGLHPLYDERVRSLIDFGVYLDISDEVKVNWKIQRDMAERGHRYEDVIAAINARRPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQK++AD VI++LPTQL+PDD E K+LRVRL+ K+ V+ F PVYLFDEGSTI W P
Sbjct  170   AYIEPQKEFADVVIQILPTQLLPDDKESKILRVRLLQKDNVEGFDPVYLFDEGSTIDWRP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD+Y+GH+VSVLE+DGQFD L+E+IY+ESHLS+ STKFYGE+T
Sbjct  230   CGRKLTCAYPGIKLFYGPDSYYGHDVSVLEVDGQFDNLEEMIYIESHLSNTSTKFYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             + MLKH D+PGSNNG+G FQ +VGLK+R  YE++ A++  +PV A
Sbjct  290   ELMLKHPDYPGSNNGSGLFQVLVGLKMRATYERLTASK--SPVAA  332



>ref|WP_015223383.1| phosphoribulokinase [Cyanobacterium stanieri]
 ref|YP_007165716.1| phosphoribulokinase [Cyanobacterium stanieri PCC 7202]
 gb|AFZ48067.1| phosphoribulokinase [Cyanobacterium stanieri PCC 7202]
Length=335

 Score =   494 bits (1273),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 231/339 (68%), Positives = 272/339 (80%), Gaps = 18/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             K V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSLD
Sbjct  5     KVVIIGVAGDSGCGKSTFLRRLEDLFG-----------------KEFMTVICLDDYHSLD  47

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTALDP+AN+FDLM EQ+KALK G+A+DKPIYNH TG LDPPE  +P K++V
Sbjct  48    RKGRKAAGVTALDPKANNFDLMAEQIKALKNGQAIDKPIYNHETGELDPPEKIEPNKVIV  107

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVREL+DFS+YLDIS EVK  WKIQRDMAERGH+ + + ASI ARKPDF 
Sbjct  108   IEGLHPLYDERVRELVDFSVYLDISEEVKIQWKIQRDMAERGHTYDDVVASINARKPDFT  167

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQKQYAD VI+VLPTQLI ++ EGK+LRVRLI KEG++HF P YLFDEGSTI W P
Sbjct  168   AYIEPQKQYADIVIQVLPTQLI-EEKEGKILRVRLIEKEGIEHFEPTYLFDEGSTIDWRP  226

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG+K  YGPD Y G+EVS+LE+DGQFD L+E+IYVESHLS   TK+YGE+T
Sbjct  227   CGRKLTCSYPGLKMYYGPDNYMGNEVSILEIDGQFDNLEEMIYVESHLSRTGTKYYGEMT  286

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             + +LKH D+PGSNNGTG FQ +VGLK+R+ YE+I  T A
Sbjct  287   ELLLKHKDYPGSNNGTGLFQVLVGLKMRETYEKITGTVA  325



>ref|WP_008318786.1| uridine kinase [Leptolyngbya sp. PCC 6406]
Length=336

 Score =   494 bits (1273),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 225/347 (65%), Positives = 280/347 (81%), Gaps = 17/347 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLADLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RK  GVTAL+P+AN+FDLMYEQ+K LK G+ +DKPIYNH TG +DPPE  +P +I+V
Sbjct  50    RKQRKAAGVTALNPKANNFDLMYEQIKTLKSGQPIDKPIYNHETGEIDPPERIEPNRIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHPMYD R+RELLDFS+YLDI ++VK AWKIQRDMAERGH+ E + ASI AR+PDF+
Sbjct  110   VEGLHPMYDERMRELLDFSVYLDIDDDVKIAWKIQRDMAERGHTYEDVLASINARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYID QKQYAD VI++LPTQLIPDD + K+LRVRL+ KEG++ F+PVYLFDEGSTI+W+P
Sbjct  170   AYIDVQKQYADVVIQILPTQLIPDDKDHKILRVRLVQKEGIEDFAPVYLFDEGSTINWVP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+  YGPD+YFG+EVSVLE+DG+FDRL+E+IYVESHLS+ STK+YGE+T
Sbjct  230   CGRKLTCSYPGIRMYYGPDSYFGNEVSVLEIDGEFDRLEEVIYVESHLSNTSTKYYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             + +LKH ++PGSNNG+G FQ +VGLK+R  YE++      A  +A A
Sbjct  290   ELLLKHREYPGSNNGSGLFQVLVGLKMRSTYERLTIAAGQAMAKANA  336



>ref|WP_006515551.1| uridine kinase [Leptolyngbya sp. PCC 7375]
 gb|EKV01147.1| uridine kinase [Leptolyngbya sp. PCC 7375]
Length=336

 Score =   493 bits (1270),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 224/341 (66%), Positives = 279/341 (82%), Gaps = 17/341 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF++RL+ +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLKRLSDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RK+ GVTAL+P+AN+FDLMYEQ+KALK G+++DKPIYNH TGL+DPPE   P  ++V
Sbjct  50    RQQRKQAGVTALNPKANNFDLMYEQIKALKSGQSIDKPIYNHETGLIDPPERIDPNHVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR+LLDFS+YLDIS+EVK AWKIQRDMAERGH+ E + ASI+ARKPDF+
Sbjct  110   IEGLHPLYDGRVRDLLDFSVYLDISDEVKIAWKIQRDMAERGHTYEDVLASIQARKPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYID QKQYAD V++VLPT LI +D E K+LRV++I KEG++ F P YLFDEGSTI+W+P
Sbjct  170   AYIDVQKQYADVVLQVLPTNLIKEDKERKILRVQMIQKEGIEGFEPAYLFDEGSTINWVP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+ TYGPDTY G+EVSVLE+DGQF++L+ELIYVE HLS++ST+ YGE+T
Sbjct  230   CGRKLTCSYPGIRMTYGPDTYMGNEVSVLEIDGQFEKLEELIYVEEHLSNISTRSYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             + +LKH ++PGSNNGTG FQ +VGLK+R  YE++  TRA  
Sbjct  290   ELLLKHREYPGSNNGTGLFQVLVGLKMRATYERLTNTRAGV  330



>ref|WP_012629603.1| phosphoribulokinase [Cyanothece sp. PCC 7425]
 ref|YP_002484914.1| phosphoribulokinase [Cyanothece sp. PCC 7425]
 gb|ACL46553.1| Phosphoribulokinase [Cyanothece sp. PCC 7425]
Length=334

 Score =   493 bits (1269),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 225/342 (66%), Positives = 273/342 (80%), Gaps = 17/342 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + VVIG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVVIGVAGDSGCGKSTFLRRLADLFG-----------------REFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALK G+A+DKPIYNH TGL+DPPE  +P  ++V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKSGQAIDKPIYNHETGLIDPPERVEPNNVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVREL+DFS+YLDIS++VK AWKIQRDMAERGH+ E + ASI AR+PDFD
Sbjct  110   IEGLHPLYDQRVRELIDFSVYLDISDDVKIAWKIQRDMAERGHTYEDVLASINARRPDFD  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD VI++LPTQL+ ++  G +LRVRL+ K+GV  F PVYLFDEGSTI+WIP
Sbjct  170   AYIDPQKQYADVVIQILPTQLVKEEKVGNILRVRLLQKDGVPGFEPVYLFDEGSTINWIP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIK  YGPD Y+GH VSVLE+DG+FDRLDE+IY+E HLS+ S K+YGE+T
Sbjct  230   CGRKLTCSYPGIKMFYGPDEYYGHSVSVLEVDGRFDRLDEVIYIEGHLSNTSAKYYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAP  1412
               +L+H D+PGS+NG+G FQ + GLK+R  YE++ A     P
Sbjct  290   HLLLQHRDYPGSDNGSGLFQVLTGLKMRATYERLTAQEVQEP  331



>ref|WP_017715709.1| phosphoribulokinase [Oscillatoria sp. PCC 10802]
Length=334

 Score =   492 bits (1267),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 226/345 (66%), Positives = 276/345 (80%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  D+ TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EDLVTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALK G++V+KPIYNH TG++DPPE+ +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKNGQSVNKPIYNHETGMIDPPEVVEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+YLDIS++VK AWKIQRDMAERGH  E + A+I AR+PDF 
Sbjct  110   VEGLHPLYDERVRSLLDFSVYLDISDDVKIAWKIQRDMAERGHRYEDVIAAINARRPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQ+++AD VI+VLPTQLIPDD E KVLRVRLI + GV+   PVYLFDEGSTI+WIP
Sbjct  170   AYIEPQREFADMVIQVLPTQLIPDDKERKVLRVRLIQRFGVEGLEPVYLFDEGSTINWIP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCS+PGIK  YGPD+Y+GHEVSVLE+DGQFD L+E+ Y+E+HLS  STK+YGE+T
Sbjct  230   CGRKLTCSWPGIKMFYGPDSYYGHEVSVLEVDGQFDNLEEVSYIENHLSHTSTKYYGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ I GLK+R  YE++ A  A   VE 
Sbjct  290   HLLLQHREYPGSNNGTGLFQVIAGLKMRATYERLTAKEAKIAVEV  334



>ref|WP_017662489.1| phosphoribulokinase [Geitlerinema sp. PCC 7105]
Length=334

 Score =   491 bits (1265),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 227/345 (66%), Positives = 274/345 (79%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +M TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLADLFG-----------------EEMMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTALDPRAN+FDLMYEQVKALKEGK+VDKPIYNH TG LDPPE   P  I+V
Sbjct  50    RKGRKAAGVTALDPRANNFDLMYEQVKALKEGKSVDKPIYNHETGELDPPERVDPNNIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK AWKIQRDMAERGH+ E + ASIE+R+PDF+
Sbjct  110   IEGLHPIYDERVRNLLDFSVYLDISDEVKIAWKIQRDMAERGHTYEDVLASIESRRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YIDPQKQ+AD VI++LPT LI DD E K+LRV+LI +  ++ F PVYLFDEGSTI W P
Sbjct  170   KYIDPQKQHADVVIQILPTNLIKDDKERKILRVQLIQRNDIEGFEPVYLFDEGSTIHWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG+K  YGPD Y+GH+VSVLE+DG+FD L+E+IYVE HLS  STK+YGE+ 
Sbjct  230   CGRKLTCSYPGLKLFYGPDNYYGHDVSVLEVDGRFDNLEEMIYVEGHLSKTSTKYYGELA  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PG+N+GTG FQ +VGLK+R+ YE++ A+ +  PVE 
Sbjct  290   HLLLQHKEYPGANDGTGLFQLLVGLKMREAYERLTASDSKVPVEV  334



>ref|WP_039727294.1| phosphoribulokinase [Lyngbya confervoides]
 gb|KIF15273.1| phosphoribulokinase [Aphanocapsa montana BDHKU210001]
 gb|KIF40188.1| phosphoribulokinase [Lyngbya confervoides BDU141951]
Length=332

 Score =   491 bits (1265),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 226/341 (66%), Positives = 277/341 (81%), Gaps = 17/341 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLADLFG-----------------EEFITVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RK  GVTAL+P+AN+FDLMYEQ+K+LK G ++DKPIYNH TG +DPPE   P  I+V
Sbjct  50    RKQRKAAGVTALNPKANNFDLMYEQIKSLKAGNSIDKPIYNHETGEIDPPERVDPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHPMYD RVRELLDFS+YLDI ++VK AWKI+RDMAERGH+ E + ASI AR+PDF+
Sbjct  110   VEGLHPMYDERVRELLDFSVYLDIHDDVKIAWKIKRDMAERGHTYEDVLASINARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYID QKQYAD VI++LPTQLIP+D E K+LRVRL+ KEG++ F PVYLFDEGSTI WIP
Sbjct  170   AYIDIQKQYADVVIQILPTQLIPNDEEKKILRVRLLQKEGIEGFDPVYLFDEGSTIDWIP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+  YGPD+Y+G+EVSVLE+DGQF+RL+ELIYVESHLS+ STK+YGE+T
Sbjct  230   CGRKLTCSYPGIRMHYGPDSYYGNEVSVLEIDGQFERLEELIYVESHLSNTSTKYYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             + +LKH ++PGSNNG+G FQ +VGLK+R+ YE+I+A    A
Sbjct  290   ELLLKHREYPGSNNGSGLFQVLVGLKMRESYEKIIAKTPQA  330



>ref|WP_012597129.1| MULTISPECIES: phosphoribulokinase [Cyanothece]
 ref|YP_002374031.1| phosphoribulokinase [Cyanothece sp. PCC 8801]
 ref|YP_003139618.1| phosphoribulokinase [Cyanothece sp. PCC 8802]
 gb|ACK67875.1| Phosphoribulokinase [Cyanothece sp. PCC 8801]
 gb|ACV02783.1| Phosphoribulokinase [Cyanothece sp. PCC 8802]
Length=332

 Score =   491 bits (1264),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 225/341 (66%), Positives = 274/341 (80%), Gaps = 18/341 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK+ GVTALDP+AN+FDLMYEQVKALK G+A+DKPIYNH TG++DPPE  +P K++V
Sbjct  50    RQGRKQAGVTALDPKANNFDLMYEQVKALKSGQAIDKPIYNHETGMIDPPERIEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+YLDIS+EVK  WKIQRDMAERGH+ E + ASI ARKPDF 
Sbjct  110   IEGLHPLYDERVRSLVDFSVYLDISDEVKINWKIQRDMAERGHTYEDVLASINARKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQKQ+AD VI+VLPTQL+ DD + K+LRVRL+ KEG+ +F P YLFDEGSTI W P
Sbjct  170   AYIEPQKQHADVVIQVLPTQLV-DDKQSKLLRVRLVQKEGITYFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCAYPGIKMYYGPDNFMGNEVSILEVDGQFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             + +L+H D+PGSNNGTG FQ +VGLK+R+ YE+I AT   A
Sbjct  289   ELLLQHKDYPGSNNGTGLFQVLVGLKMRETYEKITATTKVA  329



>ref|WP_015179263.1| phosphoribulokinase [Oscillatoria nigro-viridis]
 ref|YP_007118478.1| phosphoribulokinase [Oscillatoria nigro-viridis PCC 7112]
 gb|AFZ10062.1| phosphoribulokinase [Oscillatoria nigro-viridis PCC 7112]
Length=334

 Score =   491 bits (1264),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 226/343 (66%), Positives = 271/343 (79%), Gaps = 17/343 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  D  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EDFVTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLM EQ+KALKEG A+DKPIYNH TG++DPPE  +P  ++V
Sbjct  50    RKQRKETGITALDPRANNFDLMAEQMKALKEGHAIDKPIYNHETGMIDPPERVEPNHVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK AWKIQRDMAERGH  E +  +I ARKPDF 
Sbjct  110   IEGLHPLYDERVRSLLDFSVYLDISDEVKIAWKIQRDMAERGHRYEDVLFAINARKPDFT  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD VI+VLPT LI DD E KVLRV++I +EG+ +F P YLFDEGSTI+W+P
Sbjct  170   AYIDPQKQYADVVIQVLPTNLIKDDKERKVLRVQMIQREGIANFEPAYLFDEGSTINWVP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIK  YGPD ++GHEVS+LE+DGQF+ L+E+IY+ESHLS  STK+ GE+T
Sbjct  230   CGRKLTCSYPGIKMYYGPDAFYGHEVSILEVDGQFENLEEVIYIESHLSKTSTKYEGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPV  1415
               +L+H ++PGSNNGTG FQ +VGLK+R  YE++ A  A   V
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLVGLKMRATYEKLTAKEAKVAV  332



>ref|WP_015123780.1| uridine kinase [Synechococcus sp. PCC 6312]
 ref|YP_007060779.1| uridine kinase [Synechococcus sp. PCC 6312]
 gb|AFY60236.1| uridine kinase [Synechococcus sp. PCC 6312]
Length=333

 Score =   491 bits (1263),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 225/341 (66%), Positives = 274/341 (80%), Gaps = 17/341 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  D  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EDFLTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+K LK GK++ KPIYNH TGL+DPPEL +P  ++V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKDLKNGKSIMKPIYNHETGLIDPPELIEPNHVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+YLDIS+EVK AWKI+RDMAERGH+ E + ASI AR+PDF 
Sbjct  110   LEGLHPLYDERVRGLLDFSVYLDISDEVKIAWKIKRDMAERGHTYEDVLASINARRPDFM  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD VI++LPTQL+ ++  G +LRVR++ ++GV+ F PVYLFDEGSTISWIP
Sbjct  170   AYIDPQKQYADVVIQILPTQLVKEEKIGNILRVRMLQRDGVQGFDPVYLFDEGSTISWIP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+  YGPD Y+GH VSVLE+DG+FDRLDE+IY+ESHLS+ STK YGE+T
Sbjct  230   CGRKLTCSYPGIRLAYGPDEYYGHSVSVLEVDGRFDRLDEVIYIESHLSNTSTKHYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
               +L+H D+PGS+NGTG FQ + GLK+R  YE++ AT   A
Sbjct  290   HLLLQHRDYPGSDNGTGLFQVLTGLKMRATYERLTATEVQA  330



>ref|WP_036002848.1| phosphoribulokinase [Leptolyngbya sp. JSC-1]
Length=337

 Score =   491 bits (1263),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 232/350 (66%), Positives = 279/350 (80%), Gaps = 19/350 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  ++ TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLADLFG-----------------EELMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE GVTAL+P+AN+FDLMYEQVKALK G+ V KPIYNH TG +DPPE   P  I+V
Sbjct  50    RKQRKEVGVTALNPKANNFDLMYEQVKALKAGQEVMKPIYNHETGTIDPPERIVPTPIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHPMYD RVR LLDFS+YLDI +EVK AWKIQRDMAERGH+ E + A IE+R+PDF+
Sbjct  110   IEGLHPMYDERVRSLLDFSVYLDIDDEVKIAWKIQRDMAERGHTYEDVLAQIESRRPDFN  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYID QKQYADAVI+VLPT+LIP+D E +VLRVRL+ K+GV+ F PVYLFDEGSTI WIP
Sbjct  170   AYIDVQKQYADAVIQVLPTKLIPNDTERRVLRVRLVQKDGVEGFEPVYLFDEGSTIDWIP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+  YGPDTY+G+ VS+LE+DGQFDRL+E+IY+ESHLS+ STK+YGE+T
Sbjct  230   CGRKLTCSYPGIRMFYGPDTYYGNSVSILEVDGQFDRLEEMIYIESHLSNTSTKYYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA*KN  1436
             + +LKH ++PGS NGTG FQ +VGLK+R  YE++V     A + AKA  N
Sbjct  290   ELLLKHKEYPGSTNGTGLFQVLVGLKMRATYERLVG--GEAKLAAKAVSN  337



>ref|WP_011242879.1| MULTISPECIES: phosphoribulokinase [Synechococcus]
 ref|YP_171277.1| phosphoribulokinase [Synechococcus elongatus PCC 6301]
 ref|YP_399994.1| phosphoribulokinase [Synechococcus elongatus PCC 7942]
 dbj|BAD78757.1| phosphoribulokinase [Synechococcus elongatus PCC 6301]
 gb|ABB57007.1| phosphoribulokinase [Synechococcus elongatus PCC 7942]
 gb|AJD58472.1| phosphoribulokinase [Synechococcus sp. UTEX 2973]
Length=333

 Score =   491 bits (1263),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 230/345 (67%), Positives = 273/345 (79%), Gaps = 19/345 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+ RL  +FG                 +++ TVICLDDYHSLD
Sbjct  6     RVVLIGVAGDSGCGKSTFLNRLADLFG-----------------TELMTVICLDDYHSLD  48

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRKE GVTALDPRAN+FDLMYEQVKALK G+ + KPIYNH TGL+DPPE  +P +I+V
Sbjct  49    RKGRKEAGVTALDPRANNFDLMYEQVKALKNGETIMKPIYNHETGLIDPPEKIEPNRIIV  108

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVRELLDFS+YLDI +EVK AWKIQRDMAERGHS E + ASIEAR+PDF 
Sbjct  109   IEGLHPLYDERVRELLDFSVYLDIDDEVKIAWKIQRDMAERGHSYEDVLASIEARRPDFK  168

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQ+ +AD VI V+PTQLIP+D E KVLRV+LI +EG   F P YLFDEGSTI W P
Sbjct  169   AYIEPQRGHADIVIRVMPTQLIPNDTERKVLRVQLIQREGRDGFEPAYLFDEGSTIQWTP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+  YGPDTY+GHEVSVLE+DGQF+ L+E+IYVE HLS   T++YGE+T
Sbjct  229   CGRKLTCSYPGIRLAYGPDTYYGHEVSVLEVDGQFENLEEMIYVEGHLSKTDTQYYGELT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H D+PGSNNGTG FQ + GLK+R  YE++  T  AAPV A
Sbjct  289   HLLLQHKDYPGSNNGTGLFQVLTGLKMRAAYERL--TSQAAPVAA  331



>ref|WP_011613049.1| phosphoribulokinase [Trichodesmium erythraeum]
 ref|YP_723190.1| phosphoribulokinase [Trichodesmium erythraeum IMS101]
 gb|ABG52717.1| phosphoribulokinase [Trichodesmium erythraeum IMS101]
Length=336

 Score =   491 bits (1263),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 227/337 (67%), Positives = 273/337 (81%), Gaps = 17/337 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             K V+IG+A DSGCGKSTF+RR+T VFG                  +  TVICLDDYHSLD
Sbjct  6     KVVLIGVAGDSGCGKSTFLRRITDVFG-----------------PEFVTVICLDDYHSLD  48

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALK  +++DKPIYNH TG++DPPE   P  I+V
Sbjct  49    RKQRKETGITALDPRANNFDLMYEQIKALKNLESIDKPIYNHETGMIDPPEKIHPNHIIV  108

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVREL+DFS+YLDI +EVK AWKI+RD+AERGH  E + ASI AR+PDF+
Sbjct  109   IEGLHPLYDERVRELIDFSVYLDIGDEVKIAWKIKRDLAERGHRYEDVLASINARRPDFE  168

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             +YIDPQK +AD VI+VLPT+LIP+D E KVLRVRLI +EGVK+F PVYLFDEGSTI+WIP
Sbjct  169   SYIDPQKVHADVVIQVLPTKLIPNDQEHKVLRVRLIQREGVKNFDPVYLFDEGSTINWIP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIK  YGPD+Y G+EVS+LE+DG FD L+E+IYVE HLS+ STK+YGE+T
Sbjct  229   CGRKLTCSYPGIKMFYGPDSYDGNEVSILEVDGNFDNLEEMIYVEGHLSNTSTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT  1397
               M+KH D+PGSNNG+G FQ +VGLK+R  YE + AT
Sbjct  289   HAMMKHQDYPGSNNGSGLFQVLVGLKMRATYESLTAT  325



>ref|WP_002783281.1| Phosphoribulokinase [Microcystis aeruginosa]
 emb|CCI12868.1| Phosphoribulokinase [Microcystis aeruginosa PCC 9806]
Length=333

 Score =   490 bits (1262),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 226/345 (66%), Positives = 281/345 (81%), Gaps = 20/345 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                 ++  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------AEFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE GVTAL+P+AN+FDLMYEQ+KALKEG+A++KPIYNH TG++DPPE+ +P K++V
Sbjct  50    RKQRKEVGVTALNPKANNFDLMYEQIKALKEGQAINKPIYNHETGMIDPPEIIEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK  WKIQRDMAERGH+ + + A+I +RKPDF 
Sbjct  110   IEGLHPLYDERVRALLDFSVYLDISDEVKVNWKIQRDMAERGHTYDDVMAAINSRKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQ+QYAD VI+VLPTQL+ +D+E K+LRVRLI KEGV++F P YLFDEGSTI W P
Sbjct  170   AYIDPQRQYADVVIQVLPTQLL-EDHESKLLRVRLIQKEGVENFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCAYPGIKLYYGPDGFLGNEVSILELDGQFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA--AAPV  1415
             + +LKH D+PGS NGTG FQ +VGLK+R+ YE+++A  A  AAPV
Sbjct  289   ELLLKHKDYPGSTNGTGLFQVLVGLKMRETYEKLMAAEAKVAAPV  333



>ref|WP_015145549.1| uridine kinase [Pleurocapsa minor]
 ref|YP_007082808.1| uridine kinase [Pleurocapsa sp. PCC 7327]
 gb|AFY79251.1| uridine kinase [Pleurocapsa sp. PCC 7327]
Length=337

 Score =   490 bits (1262),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 227/347 (65%), Positives = 277/347 (80%), Gaps = 18/347 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE+GVTAL+P+AN+FDLMYEQ+KALK G+A+DKPIYNH TG +DPPE  +P K++V
Sbjct  50    RKQRKEQGVTALNPKANNFDLMYEQIKALKNGQAIDKPIYNHETGTIDPPERIEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+YLDIS+EVK  WKIQRDMAERGH+ + + A+I ARKPDF 
Sbjct  110   IEGLHPLYDERVRSLIDFSVYLDISDEVKINWKIQRDMAERGHTYDDVIAAINARKPDFT  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQKQYAD VI+VLPTQL+ DD E K+LRVRLI KEGV +F P YLFDEGSTI W P
Sbjct  170   AYIEPQKQYADVVIQVLPTQLL-DDKESKLLRVRLIQKEGVPNFEPSYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   TKFYGE+T
Sbjct  229   CGRKLTCAYPGIKMYYGPDNFMGNEVSILEVDGQFDNLEEMIYIESHLSKTGTKFYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             + +L+H D+PGSNNGTG FQ +VGLK+R+ YE++ A+   A  +A A
Sbjct  289   ELLLQHKDYPGSNNGTGLFQVLVGLKMREAYEKLTASTTPAAKKATA  335



>ref|WP_006527577.1| uridine kinase [Gloeocapsa sp. PCC 73106]
 gb|ELR99591.1| uridine kinase [Gloeocapsa sp. PCC 73106]
Length=333

 Score =   490 bits (1262),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 227/336 (68%), Positives = 271/336 (81%), Gaps = 18/336 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + VVIG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVVIGVAGDSGCGKSTFLRRLVDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTALDP+AN+FDLMYEQ+KALKE KAVDKPIYNH TG +DPPE  +P K++V
Sbjct  50    RKGRKAAGVTALDPKANNFDLMYEQIKALKERKAVDKPIYNHETGEIDPPERVEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP YDARVREL+DF +YLDIS EVK  WKIQRDMAERGH+ E + ASI ARKPDF+
Sbjct  110   IEGLHPFYDARVRELVDFGVYLDISEEVKINWKIQRDMAERGHTYEDVLASINARKPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD VI++L TQLI DD E ++LRVRL+ KEG++ F P YLFDEGSTI W P
Sbjct  170   AYIDPQKQYADVVIQILSTQLIKDD-ESRILRVRLVQKEGIEGFQPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPG+K  YGPD+Y+G EVSVLE+DGQFD L+E+IY+ESHLS + TK+YGE+T
Sbjct  229   CGRKLTCAYPGLKMFYGPDSYYGQEVSVLEIDGQFDNLEEMIYIESHLSKIGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVA  1394
             + +LKH D+PGSNNG+G FQ +VGLK+R+ YE +V+
Sbjct  289   ELLLKHKDYPGSNNGSGLFQVLVGLKMRETYELLVS  324



>ref|WP_015171442.1| phosphoribulokinase [Geitlerinema sp. PCC 7407]
 ref|YP_007108927.1| phosphoribulokinase [Geitlerinema sp. PCC 7407]
 gb|AFY65875.1| phosphoribulokinase [Geitlerinema sp. PCC 7407]
Length=336

 Score =   490 bits (1262),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 226/347 (65%), Positives = 275/347 (79%), Gaps = 17/347 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  D  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLEDLFG-----------------KDFITVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE GVTAL+P+AN+FDLMYEQ+KALK G+A+DKPIYNH TG +DPPE  +P  I+V
Sbjct  50    RKQRKEAGVTALNPKANNFDLMYEQIKALKNGQAIDKPIYNHETGEIDPPERIEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YDARVRELLDFS+YLDIS+EVK AWKIQRDMAERGH+ + + ASI +RKPDF 
Sbjct  110   VEGLHPLYDARVRELLDFSVYLDISDEVKIAWKIQRDMAERGHTYDDVIASINSRKPDFT  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQK++A+ VI VLPTQLI DD E KVLRV++I ++GV+ F PVYLFDEGSTI W P
Sbjct  170   AYIDPQKEFANVVIRVLPTQLIKDDTERKVLRVQMIQRDGVEGFDPVYLFDEGSTIHWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIK  YGPD+Y+GHEVS+LE+DGQFD L+E+ Y+E+HLS+ STK+YGE+T
Sbjct  230   CGRKLTCSYPGIKMYYGPDSYYGHEVSILEVDGQFDNLEEVSYIENHLSNTSTKYYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
               +L+H D+PGSNNGTG FQ + GLK+R  YE++ +  A     A A
Sbjct  290   HLLLQHRDYPGSNNGTGLFQVLTGLKMRATYERLTSREAKVATPANA  336



>dbj|GAL95813.1| phosphoribulokinase [Microcystis aeruginosa NIES-44]
Length=333

 Score =   490 bits (1261),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 225/345 (65%), Positives = 282/345 (82%), Gaps = 20/345 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                 ++  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------AEFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE GVTAL+P+AN+FDLMYEQ+KALKEG+A++KPIYNH TG++DPPE+ +P K++V
Sbjct  50    RKQRKEVGVTALNPKANNFDLMYEQIKALKEGQAINKPIYNHETGMIDPPEIIEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK  WKIQRDMAERGH+ + + A+I +RKPDF 
Sbjct  110   IEGLHPLYDERVRALLDFSVYLDISDEVKVNWKIQRDMAERGHTYDDVMAAINSRKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQ+QYAD VI+VLPTQL+ +D+E K+LRVRLI KEGV++F P YLFDEGSTI W P
Sbjct  170   AYIDPQRQYADVVIQVLPTQLL-EDHESKLLRVRLIQKEGVENFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCAYPGIKLYYGPDGFLGNEVSILELDGQFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVA--TRAAAPV  1415
             + +LKH D+PGS NGTG FQ +VGLK+R+ YE+++A  ++ AAPV
Sbjct  289   ELLLKHKDYPGSTNGTGLFQVLVGLKMRETYEKLMAAESKVAAPV  333



>ref|WP_024545168.1| phosphoribulokinase [Synechococcus sp. NKBG15041c]
Length=333

 Score =   489 bits (1260),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 228/340 (67%), Positives = 272/340 (80%), Gaps = 18/340 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVIIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRKE GVTALDP+AN+FDLM EQ++ LK GK ++KPIYNH TG +DPPE  KP K++V
Sbjct  50    RKGRKEAGVTALDPKANNFDLMAEQIRDLKNGKVINKPIYNHETGEIDPPEQIKPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YDARVREL+DFS+YLDIS+EVK  WKIQRDMAERGH+ E I ASI ARKPDF 
Sbjct  110   IEGLHPLYDARVRELVDFSVYLDISDEVKIQWKIQRDMAERGHTYEDILASINARKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQ+Q+AD VI+VLPT+L+ DD EGK LRVRLI KEGV  F P YLFDEGSTI W P
Sbjct  170   AYIEPQRQFADVVIQVLPTELV-DDKEGKYLRVRLIQKEGVTGFEPAYLFDEGSTIHWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD+YFG+EVSVLE+DG+FD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCNYPGIKLAYGPDSYFGNEVSVLEVDGKFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAA  1406
             + +LKH D+PGS+NGTG FQ +VGLK+R  YE I + + A
Sbjct  289   ELLLKHKDYPGSDNGTGLFQVLVGLKMRQTYEYITSAQGA  328



>ref|WP_006632794.1| phosphoribulokinase [Microcoleus vaginatus]
 gb|EGK88013.1| Phosphoribulokinase [Microcoleus vaginatus FGP-2]
Length=334

 Score =   489 bits (1258),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 224/343 (65%), Positives = 270/343 (79%), Gaps = 17/343 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  D  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EDFVTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLM EQ+KALKEG A+DKPIYNH TG++DPPE  +P  ++V
Sbjct  50    RKQRKETGITALDPRANNFDLMAEQMKALKEGNAIDKPIYNHETGMIDPPERVEPNHVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+YLDIS+EVK AWKIQRDMAERGH  E +  +I ARKPDF 
Sbjct  110   IEGLHPLYDERVRSLIDFSVYLDISDEVKIAWKIQRDMAERGHRYEDVLFAINARKPDFT  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD VI+VLPT LI DD E KVLRV++I +EG+ +F P YLFDEGSTI+W+P
Sbjct  170   AYIDPQKQYADVVIQVLPTNLIKDDKERKVLRVQMIQREGIANFEPAYLFDEGSTINWVP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIK  YGPD ++GHEVS+LE+DGQF+ L+E+IY+ESHLS  S K+ GE+T
Sbjct  230   CGRKLTCSYPGIKMYYGPDAFYGHEVSILEVDGQFENLEEVIYIESHLSKTSAKYEGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPV  1415
               +L+H ++PGSNNGTG FQ +VGLK+R  YE++ A  A   V
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLVGLKMRATYEKLTAKEAKVAV  332



>ref|WP_015192029.1| Phosphoribulokinase [Stanieria cyanosphaera]
 ref|YP_007131322.1| Phosphoribulokinase [Stanieria cyanosphaera PCC 7437]
 gb|AFZ34356.1| Phosphoribulokinase [Stanieria cyanosphaera PCC 7437]
Length=333

 Score =   488 bits (1255),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 223/347 (64%), Positives = 277/347 (80%), Gaps = 20/347 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK+ GVTALDP+AN+FDLMYEQ+KALKEG A+DKPIYNH TG++DPPE  +P K++V
Sbjct  50    RQGRKKAGVTALDPKANNFDLMYEQIKALKEGNAIDKPIYNHETGMIDPPERIEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP++D RVR LLDFS+YLDIS+EVK  WKIQRDMAERGHS + + ASI ARKPDF 
Sbjct  110   IEGLHPLFDERVRSLLDFSVYLDISDEVKIQWKIQRDMAERGHSYDDVIASINARKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQ+++AD VI+VLPTQL+ D +   +LRVRLI KEGVK+F P YLFDEGSTI W P
Sbjct  170   AYIEPQREFADVVIQVLPTQLLEDSD---LLRVRLIQKEGVKNFEPAYLFDEGSTIDWRP  226

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD+++G+EVS+LE+DGQFD L+E+IY+ESHLS   T+ YGE+T
Sbjct  227   CGRKLTCAYPGIKMYYGPDSFYGNEVSILEVDGQFDNLEEMIYIESHLSKTGTQHYGEMT  286

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             + +LKH D+PGSNNGTG FQ +VGLK+R+ YE++ +T    P +  +
Sbjct  287   ELLLKHRDYPGSNNGTGLFQVLVGLKMRETYEKLTSTTTKQPAQVSS  333



>ref|XP_005707300.1| phosphoribulokinase [Galdieria sulphuraria]
 gb|EME30780.1| phosphoribulokinase [Galdieria sulphuraria]
Length=457

 Score =   492 bits (1267),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 226/346 (65%), Positives = 282/346 (82%), Gaps = 8/346 (2%)
 Frame = +3

Query  378   GDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYH  557
             G  + V+IG+AADSGCGKSTF+RR+  +FG            S+T   ++ TVICLDD+H
Sbjct  118   GIERPVIIGVAADSGCGKSTFLRRVNEIFGTKVS-------QSHTPQGELVTVICLDDFH  170

Query  558   SLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPK  737
             +LDR GR EK VTAL+P AN+F+LMY+Q+ ALKEG  + KPIYNH TGL+DPPEL +P  
Sbjct  171   TLDRKGRAEKKVTALNPEANNFELMYQQIAALKEGYDIMKPIYNHQTGLIDPPELIQPNH  230

Query  738   ILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKP  917
             I+VIEGLHP YDAR+++LLDF++YLDIS+EVK AWKIQRDMAERGH LE+I ASIE+RKP
Sbjct  231   IIVIEGLHPWYDARMKQLLDFTVYLDISDEVKVAWKIQRDMAERGHKLENILASIESRKP  290

Query  918   DFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTIS  1097
             DF  YIDPQK+ A AVI+VLPT+LIPDD E KVLRVRLI +EG++ F  VYL+DEGSTI 
Sbjct  291   DFQQYIDPQKKDAVAVIQVLPTRLIPDDTEKKVLRVRLIQREGIQGFQSVYLYDEGSTID  350

Query  1098  WIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYG  1277
             WIPCGRKLTCSYPGIKF YGPD ++ H+VSVLE+DG F++L+ELIY+ESHL++ STKFYG
Sbjct  351   WIPCGRKLTCSYPGIKFHYGPDNWYNHDVSVLEVDGNFEKLEELIYIESHLNNTSTKFYG  410

Query  1278  EVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPV  1415
             E+TQQ+L+++  PGSNNGTG FQ +  LK+R LYE++   ++ APV
Sbjct  411   EITQQLLRNSSAPGSNNGTGLFQVLTALKMRQLYEELTG-KSIAPV  455



>emb|CAC80070.1| phosphoribulokinase [Galdieria sulphuraria]
Length=448

 Score =   492 bits (1266),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 226/346 (65%), Positives = 282/346 (82%), Gaps = 8/346 (2%)
 Frame = +3

Query  378   GDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYH  557
             G  + V+IG+AADSGCGKSTF+RR+  +FG            S+T   ++ TVICLDD+H
Sbjct  109   GIERPVIIGVAADSGCGKSTFLRRVNEIFGTKVS-------QSHTPQGELVTVICLDDFH  161

Query  558   SLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPK  737
             +LDR GR EK VTAL+P AN+F+LMY+Q+ ALKEG  + KPIYNH TGL+DPPEL +P  
Sbjct  162   TLDRKGRAEKKVTALNPEANNFELMYQQIAALKEGYDIMKPIYNHQTGLIDPPELIQPNH  221

Query  738   ILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKP  917
             I+VIEGLHP YDAR+++LLDF++YLDIS+EVK AWKIQRDMAERGH LE+I ASIE+RKP
Sbjct  222   IIVIEGLHPWYDARMKQLLDFTVYLDISDEVKVAWKIQRDMAERGHKLENILASIESRKP  281

Query  918   DFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTIS  1097
             DF  YIDPQK+ A AVI+VLPT+LIPDD E KVLRVRLI +EG++ F  VYL+DEGSTI 
Sbjct  282   DFQQYIDPQKKDAVAVIQVLPTRLIPDDTEKKVLRVRLIQREGIQGFQSVYLYDEGSTID  341

Query  1098  WIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYG  1277
             WIPCGRKLTCSYPGIKF YGPD ++ H+VSVLE+DG F++L+ELIY+ESHL++ STKFYG
Sbjct  342   WIPCGRKLTCSYPGIKFHYGPDNWYNHDVSVLEVDGNFEKLEELIYIESHLNNTSTKFYG  401

Query  1278  EVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPV  1415
             E+TQQ+L+++  PGSNNGTG FQ +  LK+R LYE++   ++ APV
Sbjct  402   EITQQLLRNSSAPGSNNGTGLFQVLTALKMRQLYEELTG-KSIAPV  446



>ref|WP_010477991.1| phosphoribulokinase [Acaryochloris sp. CCMEE 5410]
Length=334

 Score =   487 bits (1254),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 223/343 (65%), Positives = 275/343 (80%), Gaps = 17/343 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                     TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLEDLFG-----------------EQFITVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+K LK G+++DKPIYNH TGL+DPPE   P  ++V
Sbjct  50    RYQRKETGITALDPRANNFDLMYEQIKTLKGGQSIDKPIYNHETGLIDPPERIDPNHVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVREL+DFS+YLDIS+EVK AWKIQRDMAERGH+ E + ASI AR+PDF+
Sbjct  110   IEGLHPLYDERVRELIDFSVYLDISDEVKIAWKIQRDMAERGHTYEDVLASINARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQ+AD VI++LPTQL+ ++  G +LRVRLI K+GV  F+PVYLFDEGSTI+W+P
Sbjct  170   AYIDPQKQHADVVIQILPTQLLKEEKPGSILRVRLIQKDGVPDFAPVYLFDEGSTINWVP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+  YGPD Y+G+ VSVLE+DGQF++LDE+IY+E HLS+ STKF GE+T
Sbjct  230   CGRKLTCSYPGIRMAYGPDDYYGNAVSVLEVDGQFEKLDEVIYIEGHLSNTSTKFEGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPV  1415
             + +LKH D+PGSNNG+G FQ I GLK+R  YE++ AT+ +  V
Sbjct  290   ELLLKHRDYPGSNNGSGLFQVIAGLKMRATYEKLTATKTSETV  332



>ref|WP_015219287.1| phosphoribulokinase [Cyanobacterium aponinum]
 ref|YP_007161602.1| phosphoribulokinase [Cyanobacterium aponinum PCC 10605]
 gb|AFZ53558.1| phosphoribulokinase [Cyanobacterium aponinum PCC 10605]
Length=335

 Score =   487 bits (1254),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 227/347 (65%), Positives = 271/347 (78%), Gaps = 18/347 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSLD
Sbjct  5     RVVIIGVAGDSGCGKSTFLRRLEDLFG-----------------KEFMTVICLDDYHSLD  47

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRKE GVTALDP+AN+FDLM EQ+ ALK G+A+DKPIYNH TG +DPPE  +P K++V
Sbjct  48    RKGRKEAGVTALDPKANNFDLMAEQIAALKNGQAIDKPIYNHETGEIDPPERIEPNKVIV  107

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP YD RVR L+DF +YLDIS EVK  WKIQRDMAERGH+ E + ASI ARKPDF 
Sbjct  108   IEGLHPFYDERVRNLVDFGVYLDISEEVKIQWKIQRDMAERGHTYEDVLASINARKPDFT  167

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQKQYAD VI+VLPTQLI +D EGK+LRVRLI KEG++HF P YLFDEGSTI W P
Sbjct  168   AYIEPQKQYADIVIQVLPTQLI-EDKEGKILRVRLIEKEGIEHFEPTYLFDEGSTIDWRP  226

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPG+K  YGPD Y G+EVS+LE+DGQFD L+E+IYVESHLS   TK+YGE+T
Sbjct  227   CGRKLTCAYPGLKMYYGPDNYMGNEVSILEIDGQFDNLEEIIYVESHLSRTGTKYYGEMT  286

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             + +LKH D+PGSNNGTG FQ +VGLK+R+ YE++  +   +  E  A
Sbjct  287   ELLLKHKDYPGSNNGTGLFQVLVGLKMRETYEKLTGSATFSTEEEVA  333



>ref|WP_009556309.1| uridine kinase [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ69400.1| uridine kinase [Oscillatoriales cyanobacterium JSC-12]
Length=334

 Score =   487 bits (1253),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 223/339 (66%), Positives = 274/339 (81%), Gaps = 17/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  D+ TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLEDLFG-----------------KDLITVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE GVTAL+P+AN+FDLMYEQ+KALK G+ ++KPIYNH TG +DPPEL +P  I+V
Sbjct  50    RKQRKEAGVTALNPKANNFDLMYEQIKALKAGETINKPIYNHETGTIDPPELVEPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK AWKIQRDMAERGH+ E + A+I +R+PDF 
Sbjct  110   IEGLHPLYDERVRALLDFSVYLDISDEVKIAWKIQRDMAERGHTYEDVLAAINSRRPDFA  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQK++AD VI+VLPTQLI +D E KVLRV++I ++GV+ F P YLFDEGSTI WIP
Sbjct  170   AYIDPQKEFADVVIQVLPTQLIKNDTERKVLRVQMIQRDGVEGFEPAYLFDEGSTIDWIP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+  YGPDTY+GH VSVLE+DGQFD+L+E+IY+E HLS+LSTK+ GE+T
Sbjct  230   CGRKLTCSYPGIRMHYGPDTYYGHNVSVLEVDGQFDKLEEVIYIEQHLSNLSTKYNGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             + +L+H D+PGSNNGTG FQ + GLK+R  YE++ A  A
Sbjct  290   ELLLQHRDYPGSNNGTGLFQVLTGLKMRATYERLTAKGA  328



>ref|WP_002768058.1| phosphoribulokinase [Microcystis aeruginosa]
 emb|CCI02388.1| Phosphoribulokinase [Microcystis aeruginosa PCC 9443]
Length=333

 Score =   486 bits (1252),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 221/345 (64%), Positives = 278/345 (81%), Gaps = 18/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                 ++  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------AEFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE GVTAL+P+AN+FDLMYEQ+KALK+G+A++KPIYNH TG++DPPE+ +P K++V
Sbjct  50    RKQRKEVGVTALNPKANNFDLMYEQIKALKQGQAINKPIYNHETGMIDPPEIIEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK  WKIQRDMAERGH+ + + A+I +RKPDF 
Sbjct  110   IEGLHPLYDERVRSLLDFSVYLDISDEVKVNWKIQRDMAERGHTYDDVMAAINSRKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQ+QYAD VI+VLPTQL+ +D+E K+LRVRLI KEGV++F P YLFDEGSTI W P
Sbjct  170   AYIDPQRQYADVVIQVLPTQLL-EDHESKLLRVRLIQKEGVENFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCAYPGIKLYYGPDGFLGNEVSILELDGQFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             + +LKH D+PGS NGTG FQ +VGLK+R+ YE+++A  A    + 
Sbjct  289   ELLLKHKDYPGSTNGTGLFQVLVGLKMRETYEKLMAAEAKVAAQV  333



>ref|WP_012266619.1| phosphoribulokinase [Microcystis aeruginosa]
 ref|YP_001658859.1| phosphoribulokinase [Microcystis aeruginosa NIES-843]
 dbj|BAG03667.1| phosphoribulokinase [Microcystis aeruginosa NIES-843]
Length=333

 Score =   486 bits (1252),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 224/345 (65%), Positives = 281/345 (81%), Gaps = 20/345 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                 ++  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------AEFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE GVTAL+P+AN+FDLMYEQ+KALKEG+A++KPIYNH TG++DPPE+ +P K++V
Sbjct  50    RKQRKEVGVTALNPKANNFDLMYEQIKALKEGQAINKPIYNHETGMIDPPEIIEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK  WKIQRDMAERGH+ + + A+I +RKPDF 
Sbjct  110   IEGLHPLYDERVRALLDFSVYLDISDEVKVNWKIQRDMAERGHTYDDVMAAINSRKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQ+QYAD VI+VLPTQL+ +D+E K+LRVRLI KEGV++F P YLFDEGSTI W P
Sbjct  170   AYIDPQRQYADVVIQVLPTQLL-EDHESKLLRVRLIQKEGVENFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCAYPGIKLYYGPDGFLGNEVSILELDGQFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVA--TRAAAPV  1415
             + +LKH D+PGS NGTG FQ +VGLK+R+ YE+++A  ++ AA V
Sbjct  289   ELLLKHKDYPGSTNGTGLFQVLVGLKMRETYEKLMAAESKVAAQV  333



>ref|WP_023075025.1| phosphoribulokinase [Leptolyngbya sp. Heron Island J]
 gb|ESA34228.1| phosphoribulokinase [Leptolyngbya sp. Heron Island J]
Length=338

 Score =   487 bits (1253),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 222/341 (65%), Positives = 275/341 (81%), Gaps = 17/341 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF++RL+ +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLKRLSDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RK  GVTAL+P+AN+FDLMYEQ+KALK G  +DKPIYNH TGL+DPPE  +P  ++V
Sbjct  50    RKQRKLAGVTALNPKANNFDLMYEQIKALKSGNPIDKPIYNHETGLIDPPERIEPNHVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR+LLDFS+YLDIS+EVK AWKIQRDMAERGH+ E + ASI+ARKPDF+
Sbjct  110   IEGLHPLYDERVRDLLDFSVYLDISDEVKIAWKIQRDMAERGHTYEDVLASIQARKPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYID QKQYAD V++VLPT LI DD E K+LRV++I KEGV+ F P YLFDEGSTI+W+P
Sbjct  170   AYIDVQKQYADVVLQVLPTNLIKDDKERKILRVQMIQKEGVEGFEPAYLFDEGSTINWVP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+  YGPDTY G+EVS+LE+DGQF++L+ELIYVE HLS++ST+ YGE+T
Sbjct  230   CGRKLTCSYPGIRMAYGPDTYMGNEVSILEIDGQFEKLEELIYVEEHLSNISTRSYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             + +LKH ++PGSNNGTG FQ +VGLK+R  YE++  + A  
Sbjct  290   ELLLKHREYPGSNNGTGLFQVLVGLKMRATYERLTNSLAGV  330



>ref|WP_006099100.1| phosphoribulokinase [Coleofasciculus chthonoplastes]
 gb|EDX77839.1| Phosphoribulokinase / Uridine kinase family [Coleofasciculus 
chthonoplastes PCC 7420]
Length=333

 Score =   486 bits (1252),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 225/342 (66%), Positives = 273/342 (80%), Gaps = 18/342 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+I +A DSGCGKSTF+ RL  +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIAVAGDSGCGKSTFLHRLADLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTAL+P+AN+FDLMYEQ+KALK G+A+DKPIYNH TG LDPPE  +P K++V
Sbjct  50    RKGRKAAGVTALNPKANNFDLMYEQIKALKNGQAIDKPIYNHETGELDPPERVEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DF +YLDIS+EVK  WKIQRDMAERGH+ E I ASI AR+PDF 
Sbjct  110   IEGLHPLYDERVRSLVDFGVYLDISDEVKINWKIQRDMAERGHTYEDILASINARRPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQK++AD VI++LPTQLI DD E K+LRVRL+ KEGV+ F PVYLFDEGSTI W P
Sbjct  170   AYIEPQKEFADVVIQILPTQLIRDDKECKILRVRLVQKEGVEGFEPVYLFDEGSTIDWRP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC YPGIK  YGPD+YFGH+VSVLE+DGQFD L+E+IY+ESHLS+ STK+YGE+T
Sbjct  230   CGRKLTCGYPGIKLYYGPDSYFGHDVSVLEVDGQFDNLEEMIYIESHLSNTSTKYYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAP  1412
             + +LKH D+PGSNNG+G FQ +VGLK+R  YE++  ++A  P
Sbjct  290   ELLLKHKDYPGSNNGSGLFQILVGLKMRSTYERL-TSKAQVP  330



>ref|WP_009787964.1| phosphoribulokinase [Lyngbya sp. PCC 8106]
 gb|EAW33476.1| phosphoribulokinase [Lyngbya sp. PCC 8106]
Length=334

 Score =   486 bits (1252),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 226/345 (66%), Positives = 274/345 (79%), Gaps = 19/345 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RR+T +FG                  D  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRITDIFG-----------------EDFVTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLM EQ+KALK G+++ KPIYNH TGL+DPPE   P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMAEQIKALKNGQSIMKPIYNHETGLIDPPERIDPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVRELLDFS+YLDIS+EVK AWKIQRDMAERGH  E + ASI AR+PDF+
Sbjct  110   IEGLHPLYDERVRELLDFSVYLDISDEVKIAWKIQRDMAERGHRYEDVLASINARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYID QKQYA+ VI++LPTQLIPDD E KVLR+RL+ +EG++ F P YLFDEGSTI W P
Sbjct  170   AYIDTQKQYANVVIQILPTQLIPDDKERKVLRIRLVQREGIEGFEPAYLFDEGSTIYWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIK  YGPD  +G+EVS+LE+DG+FD LDE+IYVE HLS++STK+YGE+T
Sbjct  230   CGRKLTCSYPGIKMYYGPDASYGNEVSILEVDGKFDNLDEMIYVEGHLSNISTKYYGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT--RAAAPV  1415
               M +H D+PGSN+G+G FQ +VGLK+R  YE++V +  + AA V
Sbjct  290   HMMREHQDYPGSNDGSGLFQVLVGLKMRATYERLVGSGEKVAAAV  334



>ref|WP_008055552.1| phosphoribulokinase [Arthrospira sp. PCC 8005]
 emb|CCE19454.1| phosphoribulokinase [Arthrospira sp. PCC 8005]
 emb|CDM95792.1| Phosphoribulokinase [Arthrospira sp. PCC 8005]
Length=334

 Score =   486 bits (1251),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 226/345 (66%), Positives = 275/345 (80%), Gaps = 19/345 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RR+T +FG                  D  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRITDIFG-----------------EDFVTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+K LK G++++KPIYNH TGL+DPPE   P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKTLKSGQSINKPIYNHETGLIDPPERIDPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK +WKIQRDMAERGH  E + ASI AR+PDF+
Sbjct  110   IEGLHPLYDERVRGLLDFSVYLDISDEVKISWKIQRDMAERGHRYEDVLASINARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD VI++LPTQLIPDD E KVLRVRL+ ++GV+ F P YLFDEGSTI W P
Sbjct  170   AYIDPQKQYADVVIQILPTQLIPDDKEHKVLRVRLMQRDGVEGFEPAYLFDEGSTIHWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIK  YGPD Y+G+EVSVLE+DG+FD L+E+IYVE H+S+++TK+YGE+T
Sbjct  230   CGRKLTCSYPGIKMFYGPDGYYGNEVSVLEVDGKFDNLEEMIYVEGHMSNIATKYYGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT--RAAAPV  1415
               + +H D+PGSN+GTG FQ +VGLK+R  YE++V    + AA V
Sbjct  290   HLLREHQDYPGSNDGTGLFQVLVGLKMRATYERLVGKGEKVAAAV  334



>gb|ABQ42600.1| chloroplast phosphoribulokinase precursor [Heterosigma akashiwo]
Length=390

 Score =   488 bits (1257),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 229/339 (68%), Positives = 273/339 (81%), Gaps = 5/339 (1%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAA-----EPPKGGNPDSNTLISDMTTVICLDD  551
             + V+IG+AADSGCGKSTFMRRLT +FG             G  ++NTL+S  TTVICLDD
Sbjct  45    EVVLIGVAADSGCGKSTFMRRLTGMFGTDGVQMLGGGFGNGGWETNTLVSPSTTVICLDD  104

Query  552   YHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKP  731
             YH  DR GRK  G+TAL  + N+FDLMYEQ+K LK GK + KPIYNHV G LD PE  +P
Sbjct  105   YHLNDRNGRKVSGLTALHEKENNFDLMYEQLKELKSGKTIKKPIYNHVNGTLDTPEEVEP  164

Query  732   PKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR  911
               I+++EGLHPM D RV ELLDF IYLDIS+E+KFAWKIQRDM ERGHSLESIKASIEAR
Sbjct  165   TPIVIVEGLHPMLDDRVAELLDFRIYLDISDEIKFAWKIQRDMEERGHSLESIKASIEAR  224

Query  912   KPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGST  1091
             KPDF+A++ PQ+  +D VI+VLPT+LIPD  +GK+LRVR+I KEG  +F P YLFDEGST
Sbjct  225   KPDFEAFVSPQRAKSDIVIQVLPTELIPDSTDGKILRVRMIQKEGNPNFKPAYLFDEGST  284

Query  1092  ISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKF  1271
             ISW PCGRKLTCSYPGIKF+YGPDT+F +EVSV+EMDG+FD L+EL+YVESHLS   +KF
Sbjct  285   ISWTPCGRKLTCSYPGIKFSYGPDTFFDNEVSVIEMDGEFDNLEELVYVESHLSQTGSKF  344

Query  1272  YGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQI  1388
             YGE+ QQMLK ++ PGSNNGTGFFQT+  LK+R++YE I
Sbjct  345   YGELAQQMLKMSNSPGSNNGTGFFQTLTALKLREVYETI  383



>ref|WP_015229416.1| uridine kinase [Dactylococcopsis salina]
 ref|YP_007171776.1| uridine kinase [Dactylococcopsis salina PCC 8305]
 gb|AFZ50419.1| uridine kinase [Dactylococcopsis salina PCC 8305]
Length=333

 Score =   485 bits (1249),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 230/342 (67%), Positives = 271/342 (79%), Gaps = 18/342 (5%)
 Frame = +3

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              + V+IG+A DSGCGKSTF+RRL  +FG                     TVICLDDYHSL
Sbjct  6     NRVVLIGVAGDSGCGKSTFLRRLKDLFG-----------------EKFMTVICLDDYHSL  48

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DR GRK  GVTAL+P+AN+FDLMYEQVKALKEG A+DKPIYNH TG LDPPE  +P K++
Sbjct  49    DRKGRKAAGVTALNPKANNFDLMYEQVKALKEGHAIDKPIYNHETGELDPPERIEPNKVV  108

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHP+YD RVREL+DFS+YLDIS+EVK  WKI+RDMAERGH+ E + ASI +RKPDF
Sbjct  109   VIEGLHPLYDERVRELIDFSVYLDISDEVKINWKIKRDMAERGHTYEDVLASINSRKPDF  168

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
              AYI+PQK++AD VI+VLPTQLI +D E K LRVRLI KEGV+ F PVYLFDEGSTI W 
Sbjct  169   TAYIEPQKEFADIVIQVLPTQLI-EDKESKYLRVRLIQKEGVEGFDPVYLFDEGSTIDWR  227

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTC+YPGIK  YGPD+Y+GHEVSVLE+DG FD LDE+IY+ESHLS  +TKFYGE+
Sbjct  228   PCGRKLTCAYPGIKLFYGPDSYYGHEVSVLEVDGYFDNLDEMIYIESHLSKTATKFYGEM  287

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             T+ +LKH D PGSN+GTG FQ +VGLK+R+ YE +    A A
Sbjct  288   TELLLKHPDAPGSNDGTGLFQVLVGLKMRETYELLTKEEAKA  329



>ref|WP_006625041.1| phosphoribulokinase [Arthrospira platensis]
 gb|EKD07168.1| phosphoribulokinase [Arthrospira platensis C1]
Length=334

 Score =   485 bits (1248),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 225/345 (65%), Positives = 275/345 (80%), Gaps = 19/345 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RR+T +FG                  D  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRITDIFG-----------------EDFVTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+K LK G++++KPIYNH TGL+DPPE   P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKTLKSGQSINKPIYNHETGLIDPPERIDPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK +WKIQRDMAERGH  E + ASI AR+PDF+
Sbjct  110   IEGLHPLYDERVRGLLDFSVYLDISDEVKISWKIQRDMAERGHRYEDVLASINARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD VI++LPT+LIPDD E KVLRVRL+ ++GV+ F P YLFDEGSTI W P
Sbjct  170   AYIDPQKQYADVVIQILPTKLIPDDKEHKVLRVRLMQRDGVEGFEPAYLFDEGSTIHWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIK  YGPD Y+G+EVSVLE+DG+FD L+E+IYVE H+S+++TK+YGE+T
Sbjct  230   CGRKLTCSYPGIKMFYGPDGYYGNEVSVLEVDGKFDNLEEMIYVEGHMSNIATKYYGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT--RAAAPV  1415
               + +H D+PGSN+GTG FQ +VGLK+R  YE++V    + AA V
Sbjct  290   HLLREHQDYPGSNDGTGLFQVLVGLKMRSTYERLVGKGEKVAAAV  334



>ref|WP_006616865.1| phosphoribulokinase, partial [Arthrospira platensis]
 ref|YP_005072299.1| phosphoribulokinase [Arthrospira platensis NIES-39]
 dbj|BAI93761.1| phosphoribulokinase [Arthrospira platensis NIES-39]
 gb|KDR56923.1| phosphoribulokinase [Arthrospira platensis str. Paraca]
Length=334

 Score =   485 bits (1248),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 225/345 (65%), Positives = 275/345 (80%), Gaps = 19/345 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RR+T +FG                  D  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRITDIFG-----------------EDFVTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+K LK G++++KPIYNH TGL+DPPE   P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKTLKSGQSINKPIYNHETGLIDPPERIDPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK +WKIQRDMAERGH  E + ASI AR+PDF+
Sbjct  110   IEGLHPLYDERVRGLLDFSVYLDISDEVKISWKIQRDMAERGHRYEDVLASINARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD VI++LPTQLIP D E KVLRVRL+ ++GV+ F P YLFDEGSTI+W P
Sbjct  170   AYIDPQKQYADVVIQILPTQLIPGDKEHKVLRVRLMQRDGVEGFEPAYLFDEGSTINWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIK  YGPD Y+G+EVSVLE+DG+FD L+E+IYVE H+S+++TK+YGE+T
Sbjct  230   CGRKLTCSYPGIKMFYGPDAYYGNEVSVLEVDGKFDNLEEMIYVEGHMSNIATKYYGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT--RAAAPV  1415
               + +H D+PGSN+GTG FQ +VGLK+R  YE++V    + AA V
Sbjct  290   HLLREHQDYPGSNDGTGLFQVLVGLKMRATYERLVGKGEKVAAAV  334



>ref|WP_023065306.1| phosphoribulokinase [Lyngbya aestuarii]
 gb|ERT08483.1| phosphoribulokinase [Lyngbya aestuarii BL J]
Length=334

 Score =   484 bits (1247),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 225/345 (65%), Positives = 273/345 (79%), Gaps = 19/345 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RR+T +FG                  D  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRITDIFG-----------------EDFVTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLM EQ+KALK G+++ KPIYNH TGL+DPPE   P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMAEQIKALKNGQSIMKPIYNHETGLIDPPERIDPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVRELLDFS+YLDIS+EVK AWKIQRDM ERGH  E + ASI AR+PDF+
Sbjct  110   IEGLHPLYDERVRELLDFSVYLDISDEVKIAWKIQRDMTERGHRYEDVLASINARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYID QKQYA+ VI++LPTQLIPDD E KVLR+RL+ +EG++ F P YLFDEGSTI W P
Sbjct  170   AYIDTQKQYANVVIQILPTQLIPDDKERKVLRIRLVQREGIEGFEPAYLFDEGSTIYWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIK  YGPD  +G+EVS+LE+DG+FD LDE+IYVE HLS++STK+YGE+T
Sbjct  230   CGRKLTCSYPGIKMYYGPDASYGNEVSILEVDGKFDNLDEMIYVEGHLSNISTKYYGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT--RAAAPV  1415
               M +H D+PGSN+G+G FQ +VGLK+R  YE++V +  + AA V
Sbjct  290   HMMREHQDYPGSNDGSGLFQVLVGLKMRATYERLVGSGEKVAAAV  334



>ref|WP_015224638.1| phosphoribulokinase [Halothece sp. PCC 7418]
 ref|YP_007166974.1| phosphoribulokinase [Halothece sp. PCC 7418]
 gb|AFZ42760.1| phosphoribulokinase [Halothece sp. PCC 7418]
Length=332

 Score =   484 bits (1247),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 229/342 (67%), Positives = 272/342 (80%), Gaps = 18/342 (5%)
 Frame = +3

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              + V+IG+A DSGCGKSTF+RRL  +FG                     TVICLDDYHSL
Sbjct  6     NRVVLIGVAGDSGCGKSTFLRRLKDLFG-----------------EQFMTVICLDDYHSL  48

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DR GRK  GVTAL+P+AN+FDLMYEQVKALKEG+A+DKPIYNH TG LDPPE  +P K++
Sbjct  49    DRKGRKAAGVTALNPKANNFDLMYEQVKALKEGQAIDKPIYNHETGELDPPERIEPNKVV  108

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHP+YD RVRELLDFS+YLDIS+EVK  WKI+RDMAERGH+ E + ASI ARKPDF
Sbjct  109   VIEGLHPLYDERVRELLDFSVYLDISDEVKINWKIKRDMAERGHTYEDVLASINARKPDF  168

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
              AYI+PQK++A+ VI+VLPTQLI +D E K LRVRLI KEGV+ F PVYLFDEGSTI W 
Sbjct  169   TAYIEPQKEFANIVIQVLPTQLI-EDKESKYLRVRLIQKEGVEGFEPVYLFDEGSTIDWR  227

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTC+YPGIK  YGPD+Y+GHEVSVLE+DG FD L+E+IY+ESHLS  +TKFYGE+
Sbjct  228   PCGRKLTCAYPGIKLFYGPDSYYGHEVSVLEVDGYFDNLEEMIYIESHLSKTATKFYGEM  287

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             T+ +LKH D PG+N+GTG FQ +VGLK+R+ YE +     AA
Sbjct  288   TELLLKHPDAPGANDGTGLFQVLVGLKMREAYELLTQETKAA  329



>ref|WP_009627590.1| phosphoribulokinase [Pseudanabaena biceps]
 gb|ELS32293.1| phosphoribulokinase [Pseudanabaena biceps PCC 7429]
Length=332

 Score =   484 bits (1247),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 227/346 (66%), Positives = 274/346 (79%), Gaps = 19/346 (5%)
 Frame = +3

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              + VVIG+A DSGCGKSTF+ RL  +FG                  +  TVICLDDYHSL
Sbjct  6     NRVVVIGVAGDSGCGKSTFLGRLKDLFG-----------------EEFMTVICLDDYHSL  48

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DR  RK  G+TALDPRAN+FDLMYEQ+KALKEGK+V KPIYNH TGL+DPPEL +P K++
Sbjct  49    DRKQRKATGITALDPRANNFDLMYEQIKALKEGKSVMKPIYNHETGLIDPPELIEPNKVI  108

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHP+YD RVR+LLDFSIYLD+SNEVK AWKIQRDMAERGH+L  +  +IE+R+PDF
Sbjct  109   VIEGLHPIYDERVRKLLDFSIYLDLSNEVKIAWKIQRDMAERGHTLSDVVQAIESRRPDF  168

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             +AYIDPQK +AD +I++LPT L+P D+E KVLRVRLI + GV+   P YLFDEGSTISWI
Sbjct  169   EAYIDPQKAHADIIIQILPTNLLPHDSEQKVLRVRLIQRTGVEGLEPAYLFDEGSTISWI  228

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCG KLTCSYPGIK   GPD++ G  VSVLE+DGQFDRL+E++Y+E+HLSS +TKFYGE+
Sbjct  229   PCGTKLTCSYPGIKLFSGPDSWLGQPVSVLEIDGQFDRLEEMVYIENHLSSTNTKFYGEL  288

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             TQ +LKH D+PGSNNGTG  Q IVGLK+R  +E++  T+   PV A
Sbjct  289   TQLLLKHPDYPGSNNGTGLLQIIVGLKMRATFEKL--TQPVEPVTA  332



>ref|WP_022609417.1| uridine kinase [Rubidibacter lacunae]
 gb|ERN39766.1| uridine kinase [Rubidibacter lacunae KORDI 51-2]
Length=335

 Score =   484 bits (1245),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 230/345 (67%), Positives = 272/345 (79%), Gaps = 18/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + VVIG+A DSGCGKSTF+RRL  +FG                     TVICLDDYHSLD
Sbjct  9     RVVVIGVAGDSGCGKSTFLRRLIDLFG-----------------EQFMTVICLDDYHSLD  51

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTAL+ +AN+FDLM EQV ALK GKA+DKPIYNH TG LDPPE  +P K++V
Sbjct  52    RKGRKAAGVTALNLKANNFDLMAEQVAALKAGKAIDKPIYNHETGELDPPERIEPNKVIV  111

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVREL+DF +YLDIS EVK  WKI+RDMAERGH+ E + ASI ARKPDF 
Sbjct  112   IEGLHPLYDERVRELVDFGVYLDISEEVKVNWKIKRDMAERGHTYEDVLASIRARKPDFS  171

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQ+++AD VI+VLPT LI DD E K LRVRLI KEGV+ FSPVYLFDEGSTI W P
Sbjct  172   AYIEPQREFADVVIQVLPTTLI-DDKESKYLRVRLIQKEGVRDFSPVYLFDEGSTIDWRP  230

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD Y+GHEVSVLE+DG FD L+E+IY+E+HLS+ STKFYGE+T
Sbjct  231   CGRKLTCAYPGIKMFYGPDAYYGHEVSVLEVDGLFDNLEEMIYIETHLSNTSTKFYGEMT  290

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             + +LKH +FPGSN+GTG FQ +VGLK+R+ YE++VA  A  PV+ 
Sbjct  291   ELLLKHPNFPGSNDGTGLFQVLVGLKMRETYEKLVAETAKTPVQV  335



>ref|WP_015168312.1| uridine kinase [Synechococcus sp. PCC 7502]
 ref|YP_007105789.1| uridine kinase [Synechococcus sp. PCC 7502]
 gb|AFY73654.1| uridine kinase [Synechococcus sp. PCC 7502]
Length=336

 Score =   484 bits (1245),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 225/347 (65%), Positives = 276/347 (80%), Gaps = 21/347 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RK+ G+TALDPRAN+FDLMYEQ+KALK G+++ KPIYNH TGL+DPPEL KP  I+V
Sbjct  50    RKQRKQTGITALDPRANNFDLMYEQIKALKSGESIMKPIYNHETGLIDPPELIKPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLD+S+EVK AWKIQRDMAERGH+L  +  +IEAR+PDF 
Sbjct  110   IEGLHPLYDERVRSLLDFSVYLDLSDEVKIAWKIQRDMAERGHTLADVMQAIEARRPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQK +AD VI++LPT LI DD + KVLRVRL+ ++ V++F PVYLFDEGS I+W P
Sbjct  170   AYIDPQKAHADVVIQILPTNLIKDDKDRKVLRVRLVQRDSVENFQPVYLFDEGSDITWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CG+KLTCSYPG++F YG D+Y+GH V+VLE+DGQFDRLDE+IY+E+HLS+L TK YGE+T
Sbjct  230   CGKKLTCSYPGMRFYYGSDSYYGHPVTVLEVDGQFDRLDEVIYIENHLSNLDTKDYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQI----VATRAAAPV  1415
             Q +LKH D+PGSNNGTG  Q IVGLK+R  YE++    VATR  + V
Sbjct  290   QLLLKHPDYPGSNNGTGLLQVIVGLKMRATYERLTKESVATRVPSLV  336



>ref|WP_012308260.1| MULTISPECIES: phosphoribulokinase [Synechococcus]
 ref|YP_001735897.1| phosphoribulokinase [Synechococcus sp. PCC 7002]
 gb|ACB00642.1| phosphoribulokinase [Synechococcus sp. PCC 7002]
Length=333

 Score =   483 bits (1242),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 223/340 (66%), Positives = 271/340 (80%), Gaps = 18/340 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVIIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRKE GVTAL+P+AN+FDLM EQ++ LK GKA+DKPIYNH TG +DPPE  +P K++V
Sbjct  50    RKGRKEAGVTALNPKANNFDLMAEQIRDLKNGKAIDKPIYNHETGEIDPPERIEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YDARVREL+DF +YLDIS+EVK  WKIQRDMAERGH+ E + ASI ARKPDF 
Sbjct  110   IEGLHPLYDARVRELVDFGVYLDISDEVKIQWKIQRDMAERGHTYEDVLASINARKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQ+++AD VI+VLPT+L+ DD EGK LRVRL+ KEGV  F P YLFDEGSTI+W P
Sbjct  170   AYIEPQREFADVVIQVLPTELV-DDKEGKYLRVRLVQKEGVAGFEPAYLFDEGSTINWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD YFG+EVSVLE+DG+FD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCNYPGIKMYYGPDNYFGNEVSVLEVDGKFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAA  1406
             + +LKH D+PGS+NGTG FQ +VGLK+R  YE +   + A
Sbjct  289   ELLLKHKDYPGSDNGTGLFQVLVGLKMRQTYEYLTTGKGA  328



>ref|WP_002750016.1| MULTISPECIES: phosphoribulokinase [Microcystis]
 emb|CCH95207.1| Phosphoribulokinase [Microcystis aeruginosa PCC 9432]
 emb|CCI31885.1| Phosphoribulokinase [Microcystis sp. T1-4]
Length=333

 Score =   483 bits (1242),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 220/339 (65%), Positives = 276/339 (81%), Gaps = 18/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                 ++  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------AEFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE GVTAL+P+AN+FDLMYEQ+KALK G+A++KPIYNH TG++DPPE+ +P K++V
Sbjct  50    RKQRKEVGVTALNPKANNFDLMYEQIKALKGGQAINKPIYNHETGMIDPPEIIEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK  WKIQRDMAERGH+ + + A+I +RKPDF 
Sbjct  110   IEGLHPLYDERVRSLLDFSVYLDISDEVKVNWKIQRDMAERGHTYDDVMAAINSRKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQ+QYAD VI+VLPT+L+ +D+E K+LRVRLI KEGV++F P YLFDEGSTI W P
Sbjct  170   AYIDPQRQYADVVIQVLPTKLL-EDHESKLLRVRLIQKEGVENFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCTYPGIKLYYGPDGFLGNEVSILELDGQFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             + +LKH D+PGS NGTG FQ +VGLK+R+ YE+++A  A
Sbjct  289   ELLLKHKDYPGSTNGTGLFQVLVGLKMRETYEKLMAAEA  327



>ref|WP_009547106.1| MULTISPECIES: phosphoribulokinase [Cyanothece]
 ref|YP_001802412.1| phosphoribulokinase [Cyanothece sp. ATCC 51142]
 gb|ACB50346.1| phosphoribulokinase [Cyanothece sp. ATCC 51142]
Length=332

 Score =   483 bits (1242),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 223/336 (66%), Positives = 270/336 (80%), Gaps = 18/336 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+I +A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIAVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTAL+P+AN+FDLMYEQ+KALK G+A+DKPIYNH TG LDPPE  +P K++V
Sbjct  50    RKGRKAAGVTALNPKANNFDLMYEQIKALKSGQAIDKPIYNHETGELDPPERVEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP++D RVREL+DF +YLDIS+EVK  WKIQRDMAERGHS E + ASI ARKPDF 
Sbjct  110   IEGLHPLFDERVRELVDFGVYLDISDEVKINWKIQRDMAERGHSYEDVLASINARKPDFT  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQKQYAD VI+VLPTQLI +D+E K+LRVRL+ KEGV +F P YLFDEGSTI W P
Sbjct  170   AYIEPQKQYADVVIQVLPTQLI-EDHESKLLRVRLVQKEGVANFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCAYPGIKMYYGPDNFMGNEVSILEVDGQFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVA  1394
             + +L+H D+PGS NGTG FQ +VGLK+R+ YE++ A
Sbjct  289   ELLLQHKDYPGSTNGTGLFQVLVGLKMRETYEKLTA  324



>ref|WP_002740086.1| phosphoribulokinase [Microcystis aeruginosa]
 emb|CAO89332.1| prK [Microcystis aeruginosa PCC 7806]
 emb|CCI17572.1| Phosphoribulokinase [Microcystis aeruginosa PCC 9807]
 emb|CCI23868.1| Phosphoribulokinase [Microcystis aeruginosa PCC 9808]
 emb|CCI36013.1| Phosphoribulokinase [Microcystis aeruginosa PCC 9701]
 gb|ELP52369.1| phosphoribulokinase [Microcystis aeruginosa TAIHU98]
 gb|ELS48165.1| phosphoribulokinase [Microcystis aeruginosa DIANCHI905]
Length=333

 Score =   483 bits (1242),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 220/339 (65%), Positives = 276/339 (81%), Gaps = 18/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                 ++  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------AEFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE GVTAL+P+AN+FDLMYEQ+KALK G+A++KPIYNH TG++DPPE+ +P K++V
Sbjct  50    RKQRKEVGVTALNPKANNFDLMYEQIKALKGGQAINKPIYNHETGMIDPPEIIEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK  WKIQRDMAERGH+ + + A+I +RKPDF 
Sbjct  110   IEGLHPLYDERVRSLLDFSVYLDISDEVKVNWKIQRDMAERGHTYDDVMAAINSRKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQ+QYAD VI+VLPT+L+ +D+E K+LRVRLI KEGV++F P YLFDEGSTI W P
Sbjct  170   AYIDPQRQYADVVIQVLPTKLL-EDHESKLLRVRLIQKEGVENFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCTYPGIKLYYGPDGFLGNEVSILELDGQFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             + +LKH D+PGS NGTG FQ +VGLK+R+ YE+++A  A
Sbjct  289   ELLLKHKDYPGSTNGTGLFQVLVGLKMRETYEKLMAAEA  327



>ref|WP_002797047.1| phosphoribulokinase [Microcystis aeruginosa]
 emb|CCI24719.1| Phosphoribulokinase [Microcystis aeruginosa PCC 9809]
Length=333

 Score =   482 bits (1241),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 220/339 (65%), Positives = 276/339 (81%), Gaps = 18/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                 ++  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------AEFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE GVTAL+P+AN+FDLMYEQ+KALK G+A++KPIYNH TG++DPPE+ +P K++V
Sbjct  50    RKQRKEVGVTALNPKANNFDLMYEQIKALKGGQAINKPIYNHETGMIDPPEIIEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK  WKIQRDMAERGH+ + + A+I +RKPDF 
Sbjct  110   IEGLHPLYDERVRALLDFSVYLDISDEVKVNWKIQRDMAERGHTYDDVMAAINSRKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQ+QYAD VI+VLPT+L+ +D+E K+LRVRLI KEGV++F P YLFDEGSTI W P
Sbjct  170   AYIDPQRQYADVVIQVLPTKLL-EDHESKLLRVRLIQKEGVENFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCTYPGIKLYYGPDGFLGNEVSILELDGQFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             + +LKH D+PGS NGTG FQ +VGLK+R+ YE+++A  A
Sbjct  289   ELLLKHKDYPGSTNGTGLFQVLVGLKMRETYEKLMAAEA  327



>ref|WP_006511669.1| uridine kinase [Xenococcus sp. PCC 7305]
 gb|ELS01288.1| uridine kinase [Xenococcus sp. PCC 7305]
Length=331

 Score =   482 bits (1241),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 225/341 (66%), Positives = 270/341 (79%), Gaps = 18/341 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTAL+P+AN+FDLMYEQ+KALKEG A+DKPIYNH TG LDPPE  +P K++V
Sbjct  50    RKGRKAAGVTALNPKANNFDLMYEQIKALKEGNAIDKPIYNHETGELDPPEKVEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YDARVREL+DFS+YLDIS+EVK  WKIQRDMAERGH+ E I ASIEARKPDF 
Sbjct  110   IEGLHPLYDARVRELIDFSVYLDISDEVKIQWKIQRDMAERGHTYEDILASIEARKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+ Q+ +AD VI+VLPTQL  DD E  +LRVRL+ KEG+++F   YLFDEGSTI W P
Sbjct  170   AYIEVQRAFADVVIQVLPTQLT-DDKESDLLRVRLVQKEGIENFETAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD  FG+EVSVLE+DGQFD L+E+IY+ESHLS   TK YGE+T
Sbjct  229   CGRKLTCAYPGIKMYYGPDNIFGNEVSVLEVDGQFDNLEEMIYIESHLSKTGTKHYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             + +LKH D+PGSNNGTG FQ +VGLK+R+ Y+++   + A 
Sbjct  289   ELLLKHKDYPGSNNGTGLFQVLVGLKMRETYDKLTVAKEAV  329



>ref|WP_012165158.1| phosphoribulokinase [Acaryochloris marina]
 ref|YP_001519202.1| phosphoribulokinase [Acaryochloris marina MBIC11017]
 gb|ABW29884.1| phosphoribulokinase [Acaryochloris marina MBIC11017]
Length=334

 Score =   482 bits (1241),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 221/343 (64%), Positives = 274/343 (80%), Gaps = 17/343 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                     TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLEDLFG-----------------EQFITVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+K LK G+++DKPIYNH TGL+DPPE   P  ++V
Sbjct  50    RYQRKETGITALDPRANNFDLMYEQIKTLKGGQSIDKPIYNHETGLIDPPERIDPNHVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP++D RVR L+DFS+YLDIS+EVK AWKIQRDMAERGH+ E + ASI AR+PDF+
Sbjct  110   IEGLHPLHDERVRGLIDFSVYLDISDEVKIAWKIQRDMAERGHTYEDVLASINARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQ+AD VI++LPTQL+ ++  G +LRVRLI K+GV  F+PVYLFDEGSTI+W+P
Sbjct  170   AYIDPQKQHADVVIQILPTQLLKEEKPGSILRVRLIQKDGVPDFAPVYLFDEGSTINWVP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+  YGPD Y+G+ VSVLE+DGQF++LDE+IY+E HLS+ STKF GE+T
Sbjct  230   CGRKLTCSYPGIRMAYGPDDYYGNAVSVLEVDGQFEKLDEVIYIEGHLSNTSTKFEGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPV  1415
             + +LKH D+PGSNNG+G FQ I GLK+R  YE++ AT+ +  V
Sbjct  290   ELLLKHRDYPGSNNGSGLFQVIAGLKMRATYEKLTATKTSETV  332



>ref|WP_024124948.1| phosphoribulokinase Prk [Thermosynechococcus sp. NK55a]
 ref|YP_008900066.1| phosphoribulokinase Prk [Thermosynechococcus sp. NK55a]
 gb|AHB88553.1| phosphoribulokinase Prk [Thermosynechococcus sp. NK55a]
Length=334

 Score =   482 bits (1241),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 220/341 (65%), Positives = 272/341 (80%), Gaps = 17/341 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  D  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLADLFG-----------------EDFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALK G+++ KPIYNH TG +DPPE   P  ++V
Sbjct  50    RKQRKEMGITALDPRANNFDLMYEQIKALKNGESIMKPIYNHETGTIDPPEKVDPNHVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+YLDIS++VK AWKI+RDMAERGHS E + ASI AR+PDF 
Sbjct  110   IEGLHPLYDERVRSLIDFSVYLDISDDVKIAWKIKRDMAERGHSYEDVIASINARRPDFM  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD V+++LPTQL+ ++  G +LRVR++ +EG+  F PVYLFDEGSTI+WIP
Sbjct  170   AYIDPQKQYADVVLQILPTQLVKEEKVGNILRVRMLQREGIPGFEPVYLFDEGSTITWIP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+ +YGPD Y+GH VSVLE+DG+F++LDELIY+ESHLS+ STK YGEVT
Sbjct  230   CGRKLTCSYPGIRLSYGPDEYYGHPVSVLEVDGRFEKLDELIYIESHLSNTSTKHYGEVT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             + +LKH D+PGS+NG+G FQ + GLK+R  YE++ A  AA 
Sbjct  290   ELLLKHRDYPGSDNGSGLFQVLTGLKMRATYERLTARDAAT  330



>ref|WP_008179669.1| phosphoribulokinase [Moorea producens]
 gb|EGJ34671.1| phosphoribulokinase [Moorea producens 3L]
Length=336

 Score =   482 bits (1241),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 223/341 (65%), Positives = 272/341 (80%), Gaps = 19/341 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + VVIG+A DSGCGKSTF++RLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVVIGVAGDSGCGKSTFLKRLTDLFG-----------------QEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKEK VTAL+P+AN+FDLMYEQ+KALKEG+ +DKPIYNH TG +DPPE  +P K++V
Sbjct  50    RKQRKEKRVTALNPKANNFDLMYEQIKALKEGRGIDKPIYNHETGEIDPPERVEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVREL+DF +YLDIS+EVK  WKIQRDMAERGH  E I ASIEAR+PDF+
Sbjct  110   IEGLHPLYDERVRELVDFGVYLDISDEVKIQWKIQRDMAERGHRYEDILASIEARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDD--NEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             AYI+ QKQYAD VI++ PTQL+  +   E  +LRVRL+ KEGV++F PVYLFDEGSTI W
Sbjct  170   AYIEVQKQYADVVIQIFPTQLLQGEAAKESNLLRVRLLQKEGVENFDPVYLFDEGSTIDW  229

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
              PCGRKLTC+YPG+K  YGPD+Y G+EVSVLE+DGQFD L+E+IY+ESHLS  STK+YGE
Sbjct  230   RPCGRKLTCAYPGLKMYYGPDSYMGNEVSVLEVDGQFDNLEEMIYIESHLSKTSTKYYGE  289

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             +T+ +LKH D+PGSNNG+G FQ +VGLK+R  YE +V+  A
Sbjct  290   MTELLLKHTDYPGSNNGSGLFQVLVGLKMRSTYESLVSGEA  330



>ref|WP_017303295.1| phosphoribulokinase [Spirulina subsalsa]
Length=336

 Score =   482 bits (1241),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 224/334 (67%), Positives = 271/334 (81%), Gaps = 18/334 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + VVIG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVVIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTAL+P+AN+FDLMYEQ+KALKEGKA+DKPIYNH TG +DPPE  +P K++V
Sbjct  50    RKGRKAAGVTALNPKANNFDLMYEQIKALKEGKAIDKPIYNHETGEIDPPERIEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP++D RVR L+DF +YLDIS+EVK  WKIQRDMAERGH+ E + ASI ARKPDF 
Sbjct  110   VEGLHPLFDERVRSLIDFGVYLDISDEVKINWKIQRDMAERGHTYEDVIASINARKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQKQYAD VI+VLPTQLI +D E K LRVRLI KEG+ HF+PVYLFDEGSTI W P
Sbjct  170   AYIEPQKQYADVVIQVLPTQLI-EDKESKYLRVRLIEKEGIPHFNPVYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD++ G+EVS+LE+DG+FD L+E+IYVESHLS+ ST++ GE+T
Sbjct  229   CGRKLTCNYPGIKLYYGPDSFMGNEVSILEVDGKFDNLEEMIYVESHLSNTSTRYTGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQI  1388
             + +LKH D+PGS+NGTG FQ +VGLK+R  YE +
Sbjct  289   ELLLKHKDYPGSDNGTGMFQVLVGLKMRATYEAL  322



>dbj|BAA96253.1| phosphoribulokinase [Synechococcus elongatus PCC 7942]
Length=333

 Score =   482 bits (1240),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 227/345 (66%), Positives = 270/345 (78%), Gaps = 19/345 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+ RL  +FG                 +++ TVICLDDYHSLD
Sbjct  6     RVVLIGVAGDSGCGKSTFLNRLADLFG-----------------TELMTVICLDDYHSLD  48

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRKE GVTALDPRAN+FDLMYEQVKALK G+ + KPIYNH TGL+DPPE  +P +I+V
Sbjct  49    RKGRKEAGVTALDPRANNFDLMYEQVKALKNGETIMKPIYNHETGLIDPPEKIEPNRIIV  108

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVRELLDFS+YLDI +EVK AWKIQRDMAERGHS E + ASIEAR+PDF 
Sbjct  109   IEGLHPLYDERVRELLDFSVYLDIDDEVKIAWKIQRDMAERGHSYEDVLASIEARRPDFK  168

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQ+ +AD VI V+PTQLIP+D E KVLRV+LI +EG   F P YLFDEGSTI W P
Sbjct  169   AYIEPQRGHADIVIRVMPTQLIPNDTERKVLRVQLIQREGRDGFEPAYLFDEGSTIQWTP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+  YGP TY+GH VSVLE+DGQF+ L+E+IYVE HLS   T++YGE+T
Sbjct  229   CGRKLTCSYPGIRLAYGPGTYYGHGVSVLEVDGQFENLEEMIYVEGHLSKTDTQYYGELT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               + +H D+PGSNNGTG FQ + GLK+R  YE++  T  AAPV A
Sbjct  289   HLLPQHKDYPGSNNGTGLFQVLTGLKMRAAYERL--TSQAAPVAA  331



>ref|WP_016517207.1| Uridine kinase [Microcystis aeruginosa]
 gb|EPF17191.1| Uridine kinase [Microcystis aeruginosa SPC777]
Length=333

 Score =   481 bits (1239),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 219/339 (65%), Positives = 276/339 (81%), Gaps = 18/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                 ++  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------AEFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE GVTAL+P+AN+FDLMYEQ+KALK G+A++KPIYNH TG++DPPE+ +P K++V
Sbjct  50    RKQRKEVGVTALNPKANNFDLMYEQIKALKGGQAINKPIYNHETGMIDPPEIIEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK  WKIQRDMAERGH+ + + A+I +RKPDF 
Sbjct  110   IEGLHPLYDERVRSLLDFSVYLDISDEVKVNWKIQRDMAERGHTYDDVMAAINSRKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQ+QYAD VI+VLPT+L+ +D+E K+LRVRLI KEGV++F P YLFDEGSTI W P
Sbjct  170   AYIDPQRQYADVVIQVLPTKLL-EDHESKLLRVRLIQKEGVENFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCTYPGIKLYYGPDGFLGNEVSILELDGQFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             + +LKH D+PGS NGTG FQ +VGLK+R+ YE+++A  +
Sbjct  289   ELLLKHKDYPGSTNGTGLFQVLVGLKMRETYEKLMAAES  327



>ref|WP_011434422.1| phosphoribulokinase [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_479066.1| phosphoribulokinase [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD03803.1| phosphoribulokinase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=335

 Score =   481 bits (1239),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 225/342 (66%), Positives = 275/342 (80%), Gaps = 18/342 (5%)
 Frame = +3

Query  372   AGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDD  551
             A    + V+IG+A DSGCGKSTF+RRL  +FG                  D+ T ICLDD
Sbjct  2     ASSPDRVVMIGVAGDSGCGKSTFLRRLGDLFG-----------------RDLITTICLDD  44

Query  552   YHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKP  731
             YHSLDR  RKEKG+TALDPRAN+FDLMYEQ KALK G++V KPIYNH TG++DPPEL +P
Sbjct  45    YHSLDRYQRKEKGITALDPRANNFDLMYEQAKALKNGQSVMKPIYNHETGMIDPPELVEP  104

Query  732   PKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR  911
              +I+V+EGLHPMYD RVRELLDF +YLD++ E+K AWK++RDMAERGH+ E +  SIEAR
Sbjct  105   NRIIVLEGLHPMYDERVRELLDFKVYLDLAPEIKIAWKVKRDMAERGHTYEDVLRSIEAR  164

Query  912   KPDFDAYIDPQKQYADAVIEVLPTQLIPD-DNEGKVLRVRLIMKEGVKHFSPVYLFDEGS  1088
             +PDF+AY+D QKQYADAVIEVLPTQL+P+ D E KVLRVRLI +EGVK+F  VYLFDEGS
Sbjct  165   RPDFEAYVDVQKQYADAVIEVLPTQLLPELDPEHKVLRVRLIQREGVKYFDHVYLFDEGS  224

Query  1089  TISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTK  1268
             TI WIPCG+KLTCSYPGI+  YGP TYF H VS+LE+DG FD+L+E+IY+E+HLS+LST+
Sbjct  225   TIDWIPCGKKLTCSYPGIRLHYGPSTYFEHPVSILEIDGTFDKLEEVIYIENHLSNLSTR  284

Query  1269  FYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVA  1394
             +YGE+T+ + KH ++PGS NG+G  Q IVGLK+R LYEQI A
Sbjct  285   YYGELTELLRKHPEYPGSRNGSGLIQIIVGLKLRALYEQIRA  326



>ref|WP_010873078.1| phosphoribulokinase [Synechocystis sp. PCC 6803]
 ref|NP_441778.1| phosphoribulokinase [Synechocystis sp. PCC 6803]
 ref|YP_005383645.1| phosphoribulokinase [Synechocystis sp. PCC 6803 substr. GT-I]
 ref|YP_005386814.1| phosphoribulokinase [Synechocystis sp. PCC 6803 substr. PCC-P]
 ref|YP_005409521.1| phosphoribulokinase [Synechocystis sp. PCC 6803 substr. PCC-N]
 ref|YP_005651837.1| phosphoribulokinase [Synechocystis sp. PCC 6803]
 ref|YP_007451659.1| phosphoribulokinase [Synechocystis sp. PCC 6803]
 dbj|BAA18458.1| phosphoribulokinase [Synechocystis sp. PCC 6803]
 dbj|BAK50632.1| phosphoribulokinase [Synechocystis sp. PCC 6803]
 dbj|BAL29630.1| phosphoribulokinase [Synechocystis sp. PCC 6803 substr. GT-I]
 dbj|BAL32799.1| phosphoribulokinase [Synechocystis sp. PCC 6803 substr. PCC-N]
 dbj|BAL35968.1| phosphoribulokinase [Synechocystis sp. PCC 6803 substr. PCC-P]
 dbj|BAM54823.1| phosphoribulokinase [Synechocystis sp. PCC 6803]
 gb|AGF52145.1| phosphoribulokinase [Synechocystis sp. PCC 6803]
Length=332

 Score =   481 bits (1238),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 223/336 (66%), Positives = 270/336 (80%), Gaps = 18/336 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTALDPRAN+FDLMYEQ+K LK G+++ KPIYNH TGLLDPPE  +P K++V
Sbjct  50    RQGRKAAGVTALDPRANNFDLMYEQIKTLKSGQSIMKPIYNHETGLLDPPEKVEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVREL+DF +YLDIS EVK  WKIQRDMAERGH+ E I ASI ARKPDF 
Sbjct  110   IEGLHPLYDERVRELVDFGVYLDISEEVKINWKIQRDMAERGHTYEDILASINARKPDFT  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQKQYAD VI+VLPT+LI +D E K+LRVRL+ KEGVK F P YLFDEGSTI W P
Sbjct  170   AYIEPQKQYADVVIQVLPTRLI-EDKESKLLRVRLVQKEGVKFFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DG+F+ L+E++YVE+HLS   TK+YGE+T
Sbjct  229   CGRKLTCTYPGIKMYYGPDNFMGNEVSLLEVDGRFENLEEMVYVENHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVA  1394
             + +LKH D+PG++NGTG FQ +VGLK+R++YEQ+ A
Sbjct  289   ELLLKHKDYPGTDNGTGLFQVLVGLKMREVYEQLTA  324



>ref|WP_007353376.1| MULTISPECIES: phosphoribulokinase [Kamptonema]
 emb|CBN54149.1| phosphoribulokinase [ [[Oscillatoria] sp. PCC 6506]
Length=334

 Score =   481 bits (1238),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 220/343 (64%), Positives = 268/343 (78%), Gaps = 17/343 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  D  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EDFVTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLM EQ+KALK G+A++KPIYNH TG +DPPE+ +P  ++V
Sbjct  50    RKQRKETGITALDPRANNFDLMAEQMKALKNGQAINKPIYNHETGAIDPPEIVEPNHVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK AWKIQRDM+ERGH+ E +  +I ARKPDF 
Sbjct  110   IEGLHPLYDERVRSLLDFSVYLDISDEVKIAWKIQRDMSERGHTYEDVLFAINARKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD V++VLPT LI DD E K+LRV++I +EG+ +F   YLFDEGSTI W P
Sbjct  170   AYIDPQKQYADVVVQVLPTNLIKDDKERKILRVQMIQREGIPNFESAYLFDEGSTIHWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIK  YGPD Y+GHEVS+LE+DGQF+ L+E+IY+E HLS  STK+ GE+T
Sbjct  230   CGRKLTCSYPGIKMYYGPDAYYGHEVSILEVDGQFENLEEVIYIEKHLSKTSTKYEGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPV  1415
               +L+H ++PGSNNGTG FQ +VGLK+R  YE++ A  A   V
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLVGLKMRATYERLTAKEAKVAV  332



>ref|WP_019498279.1| phosphoribulokinase [Pseudanabaena sp. PCC 6802]
Length=336

 Score =   481 bits (1237),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 220/335 (66%), Positives = 269/335 (80%), Gaps = 17/335 (5%)
 Frame = +3

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
             G+ V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSL
Sbjct  6     GRVVLIGVAGDSGCGKSTFLRRLKDLFG-----------------EEFMTVICLDDYHSL  48

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DR  RKE G+TALDPRAN+FDLMYEQ+KALK G+++ KPIYNH TG +DPPE  +P  ++
Sbjct  49    DRKQRKETGITALDPRANNFDLMYEQIKALKSGESIMKPIYNHETGAIDPPERIEPNHVI  108

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHP+YD RVR LLDFS+YLD+S+EVK AWKIQRDMAERGH+L  +  +IEAR+PDF
Sbjct  109   VIEGLHPLYDERVRTLLDFSVYLDLSDEVKVAWKIQRDMAERGHTLADVMQAIEARRPDF  168

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             DAYIDPQK +AD VI++LPT LI DD + KVLRVR++ +EG++   P YLFDEGSTISW 
Sbjct  169   DAYIDPQKAHADVVIQILPTNLIKDDKDRKVLRVRMVQREGIEGLEPAYLFDEGSTISWT  228

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCG+KLTCSYPGI+  YG D+Y+GH V+VLE+DGQFDRLDE+IY+E+HLS+LSTK YGE+
Sbjct  229   PCGKKLTCSYPGIQLYYGSDSYYGHPVTVLEVDGQFDRLDEVIYIENHLSNLSTKEYGEL  288

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQI  1388
             TQ +LKH D+PGSNNGTG  Q IVGLK+R  YE++
Sbjct  289   TQLLLKHPDYPGSNNGTGLLQVIVGLKMRATYERL  323



>ref|WP_026786374.1| phosphoribulokinase [Planktothrix rubescens]
Length=334

 Score =   481 bits (1237),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 224/345 (65%), Positives = 270/345 (78%), Gaps = 19/345 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RR+T +FG                  D  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRITDIFG-----------------KDFVTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMY+QV ALK G ++DKPIYNH TG LDPPE  +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYQQVNALKNGISIDKPIYNHETGELDPPERIEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK +WKIQRDMAERGH  E + A+I AR+PDF+
Sbjct  110   IEGLHPLYDERVRSLLDFSVYLDISDEVKISWKIQRDMAERGHRYEDVLAAINARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD V+++LPT LI +D E KVLRVRL+ KEGV+   P YLFD+GSTI WIP
Sbjct  170   AYIDPQKQYADVVVQILPTNLIAEDKEHKVLRVRLVQKEGVEGLEPSYLFDQGSTIYWIP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG+K  YGPD Y+G+EVS+LE+DGQFD LDE+IYVE HLS+LSTK+YGE+T
Sbjct  230   CGRKLTCSYPGLKMYYGPDNYYGNEVSILEVDGQFDNLDEMIYVEGHLSNLSTKYYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT--RAAAPV  1415
               + +  D+PGSNNG+G FQ +VGLK+R  YE++V    + AA V
Sbjct  290   HLLRERQDYPGSNNGSGLFQVLVGLKMRATYERLVGVSEKVAAAV  334



>sp|P37101.1|KPPR_SYNY3 RecName: Full=Phosphoribulokinase; Short=PRK; Short=PRKase; AltName: 
Full=Phosphopentokinase [Synechocystis sp. PCC 6803 
substr. Kazusa]
 gb|AAA27293.1| phosphoribulokinase [Synechocystis sp.]
Length=332

 Score =   480 bits (1236),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 223/336 (66%), Positives = 269/336 (80%), Gaps = 18/336 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTALDPRAN+FDLMYEQ+K LK G+++ KPIYNH TGLLDPPE  +P K++V
Sbjct  50    RQGRKAAGVTALDPRANNFDLMYEQIKTLKSGQSIMKPIYNHETGLLDPPEKVEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVREL+DF +YLDIS EVK  WKIQRDMAERGH+ E I ASI ARKPDF 
Sbjct  110   IEGLHPLYDERVRELVDFGVYLDISEEVKINWKIQRDMAERGHTYEDILASINARKPDFT  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQKQYAD VI+VLPT+LI +D E K+LRVRL+ KEGVK F P YLFDEGSTI W P
Sbjct  170   AYIEPQKQYADVVIQVLPTRLI-EDKESKLLRVRLVQKEGVKFFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DG+F+ L+E++YVE+HLS   TK+YGE+T
Sbjct  229   CGRKLTCTYPGIKMYYGPDNFMGNEVSLLEVDGRFENLEEMVYVENHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVA  1394
             + +LKH D+PG++NGTG FQ +VGLK+R +YEQ+ A
Sbjct  289   ELLLKHKDYPGTDNGTGLFQVLVGLKMRKVYEQLTA  324



>ref|WP_018399211.1| phosphoribulokinase [filamentous cyanobacterium ESFC-1]
Length=335

 Score =   480 bits (1236),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 225/348 (65%), Positives = 271/348 (78%), Gaps = 18/348 (5%)
 Frame = +3

Query  384   GKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSL  563
              + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSL
Sbjct  6     NQVVLIGVAGDSGCGKSTFLRRLEDLFG-----------------KEFMTVICLDDYHSL  48

Query  564   DRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKIL  743
             DR GRK+ GVTAL+P+AN+FDLMYEQ+KA+KEG A+DKPIYNH TG LDPPE  +P K++
Sbjct  49    DRKGRKKAGVTALNPKANNFDLMYEQIKAIKEGNAIDKPIYNHETGELDPPERVEPNKVV  108

Query  744   VIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDF  923
             VIEGLHP+YD RVREL+DFS+YLDIS EVK  WKIQRDMAERGH+ E I ASI +RKPDF
Sbjct  109   VIEGLHPLYDERVRELVDFSVYLDISEEVKINWKIQRDMAERGHTYEDILASIRSRKPDF  168

Query  924   DAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
              AYI+PQK+YAD VIEVLPTQLI +D E K LRVRLI KEG   F   YLFDEGSTI W 
Sbjct  169   TAYIEPQKEYADVVIEVLPTQLI-EDKESKYLRVRLIQKEGKPTFDTAYLFDEGSTIDWR  227

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCGRKLTC+YPGIK  YGPD Y GH+VS+LE+DGQFD L+E+IY+ESHLS  STK YGE+
Sbjct  228   PCGRKLTCAYPGIKMYYGPDNYMGHDVSILEVDGQFDNLEEVIYIESHLSKTSTKHYGEM  287

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             T+ +L+H D+PGS NG+G FQ +VGLK+R+ YE++ +++ +    AK 
Sbjct  288   TELLLQHKDYPGSTNGSGLFQVLVGLKMREAYERLTSSQTSEKETAKV  335



>ref|WP_002776450.1| phosphoribulokinase [Microcystis aeruginosa]
 emb|CCI06843.1| Phosphoribulokinase [Microcystis aeruginosa PCC 7941]
Length=333

 Score =   480 bits (1236),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 219/339 (65%), Positives = 275/339 (81%), Gaps = 18/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                 ++  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------AEFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE GVTAL+P+AN+FDLMYEQ+KALK G+A++KPIYNH TG++DPPE+ +P K++V
Sbjct  50    RKQRKEVGVTALNPKANNFDLMYEQIKALKGGQAINKPIYNHETGMIDPPEIIEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK  WKIQRDMAERGH+ + + A+I +RKPDF 
Sbjct  110   IEGLHPLYDERVRSLLDFSVYLDISDEVKVNWKIQRDMAERGHTYDDVMAAINSRKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQ+QYAD VI+VLPT+L+ +D E K+LRVRLI KEGV++F P YLFDEGSTI W P
Sbjct  170   AYIDPQRQYADVVIQVLPTKLL-EDPESKLLRVRLIQKEGVENFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCTYPGIKLYYGPDGFLGNEVSILELDGQFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             + +LKH D+PGS NGTG FQ +VGLK+R+ YE+++A  +
Sbjct  289   ELLLKHKDYPGSTNGTGLFQVLVGLKMRETYEKLMAAES  327



>gb|KEI66144.1| Prk [Planktothrix agardhii NIVA-CYA 126/8]
Length=334

 Score =   480 bits (1236),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 223/345 (65%), Positives = 271/345 (79%), Gaps = 19/345 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RR+T +FG                  D  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRITDIFG-----------------KDFVTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMY+QV ALK G ++DKPIYNH TG LDPPE  +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYQQVNALKNGISIDKPIYNHETGELDPPERIEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK +WKIQRDMAERGH  E + A+I AR+PDF+
Sbjct  110   IEGLHPLYDERVRSLLDFSVYLDISDEVKISWKIQRDMAERGHRYEDVLAAINARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD V+++LPT LI +D E KVLRVRL+ KEGV+   P YLFD+GSTI WIP
Sbjct  170   AYIDPQKQYADVVVQILPTNLIAEDKEHKVLRVRLVQKEGVEGLEPSYLFDQGSTIYWIP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG+K  YGPD Y+G+EVS+LE+DGQFD LDE+IYVE HLS+LSTK+YGE+T
Sbjct  230   CGRKLTCSYPGLKMYYGPDNYYGNEVSILEVDGQFDNLDEMIYVEGHLSNLSTKYYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT--RAAAPV  1415
               + +  ++PGSNNG+G FQ +VGLK+R  YE++V+   + AA V
Sbjct  290   HLLRERQEYPGSNNGSGLFQVLVGLKMRATYERLVSANEKVAAAV  334



>ref|WP_028947748.1| phosphoribulokinase [Synechocystis sp. PCC 6714]
 gb|AIE74812.1| Phosphoribulokinase [Synechocystis sp. PCC 6714]
Length=332

 Score =   480 bits (1235),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 223/336 (66%), Positives = 270/336 (80%), Gaps = 18/336 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTALDPRAN+FDLMYEQ+K LK G+ + KPIYNH TGLLDPPE  +P K++V
Sbjct  50    RQGRKAAGVTALDPRANNFDLMYEQIKTLKSGQPIMKPIYNHETGLLDPPEKVEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVREL+DF +YLDIS EVK  WKIQRDMAERGH+ E I ASI ARKPDF 
Sbjct  110   IEGLHPLYDERVRELVDFGVYLDISEEVKINWKIQRDMAERGHTYEDILASINARKPDFT  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQKQYAD VI+VLPT+LI +D E K+LRVRL+ KEGVK F P YLFDEGSTI W P
Sbjct  170   AYIEPQKQYADVVIQVLPTRLI-EDKESKLLRVRLVQKEGVKFFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD++ G+EVS+LE+DG+F+ L+E++YVE+HLS   TK+YGE+T
Sbjct  229   CGRKLTCTYPGIKMYYGPDSFMGNEVSLLEVDGRFENLEEMVYVENHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVA  1394
             + +LKH D+PG++NGTG FQ +VGLK+R++YEQ+ A
Sbjct  289   ELLLKHKDYPGTDNGTGLFQVLVGLKMREVYEQLTA  324



>ref|WP_015957128.1| phosphoribulokinase [Cyanothece sp. PCC 7424]
 ref|YP_002380417.1| phosphoribulokinase [Cyanothece sp. PCC 7424]
 gb|ACK73549.1| phosphoribulokinase/uridine kinase [Cyanothece sp. PCC 7424]
Length=334

 Score =   479 bits (1233),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 217/345 (63%), Positives = 271/345 (79%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK+ GVTAL+P+AN+FDLMYEQ+KALKEG+ + KPIYNH TG++DPPE  +P K++V
Sbjct  50    RQGRKKAGVTALNPQANNFDLMYEQIKALKEGQPIMKPIYNHETGMIDPPERIEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+YLDIS+EVK  WKIQRDMAERGH+ + + ASI ARKPDF 
Sbjct  110   IEGLHPLYDERVRSLVDFSVYLDISDEVKINWKIQRDMAERGHTYDDVIASINARKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQ++YAD VI+VLPT LI +D E K+LRVRLI KEG+++F PVYLFDEGSTI W P
Sbjct  170   AYIEPQREYADVVIQVLPTNLIENDKESKILRVRLIQKEGIENFQPVYLFDEGSTIDWRP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPG+K  YGPD  FG+EVS+LE+DGQFD L+E+IY+E HLS   TK+YGE+T
Sbjct  230   CGRKLTCAYPGLKMYYGPDNIFGNEVSILEIDGQFDNLEEMIYIEQHLSRTGTKYYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               + +H D+PGSNNGTG FQ +VGLK+R+ YE + +  +    + 
Sbjct  290   HLLQQHKDYPGSNNGTGLFQVLVGLKMRETYEILTSVESKVATQV  334



>dbj|BAP18282.1| phosphoribulokinase [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=338

 Score =   479 bits (1233),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 218/337 (65%), Positives = 271/337 (80%), Gaps = 18/337 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG++ DSGCGKSTF+RRL  +FG                 ++  TVICLDDYHSLD
Sbjct  13    RVVLIGVSGDSGCGKSTFLRRLIDLFG-----------------AEFMTVICLDDYHSLD  55

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK+ GVTAL+P+AN+FDLMYEQ+K LK GK +DKPIYNH TG++DPPE  +P +++V
Sbjct  56    RQGRKKAGVTALNPKANNFDLMYEQIKTLKSGKGIDKPIYNHETGIIDPPERVEPNRLVV  115

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVREL+DFS+YLDI +EVK  WKIQRD+AERGH+ E + A I ARKPDF+
Sbjct  116   IEGLHPLYDQRVRELIDFSVYLDIEDEVKINWKIQRDIAERGHTYEDVLALINARKPDFN  175

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD VI+VLPTQL+ +D+E K+LRVRLI KEG+ +F P YLFDEGSTI W P
Sbjct  176   AYIDPQKQYADVVIQVLPTQLL-EDHESKLLRVRLIEKEGIPYFEPAYLFDEGSTIDWRP  234

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   T +YGE+T
Sbjct  235   CGRKLTCAYPGIKMYYGPDNFMGNEVSILELDGQFDNLEEMIYIESHLSKTGTNYYGEIT  294

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT  1397
             + +L H D+PGSNNGTG FQ +VGLK+R++YE+I A 
Sbjct  295   ELLLHHKDYPGSNNGTGLFQVLVGLKMREIYEKITAA  331



>ref|WP_015135454.1| phosphoribulokinase [Leptolyngbya sp. PCC 7376]
 ref|YP_007072548.1| phosphoribulokinase [Leptolyngbya sp. PCC 7376]
 gb|AFY39714.1| phosphoribulokinase [Leptolyngbya sp. PCC 7376]
Length=331

 Score =   479 bits (1232),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 219/343 (64%), Positives = 275/343 (80%), Gaps = 18/343 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                 ++  TVICLDDYHSLD
Sbjct  7     RVVIIGVAGDSGCGKSTFLRRLTDLFG-----------------AEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTAL+P+AN+FDLM EQV+ LK GKA+DKPIYNH TG LDPPE  +P K++V
Sbjct  50    RKGRKAAGVTALNPKANNFDLMAEQVRDLKNGKAIDKPIYNHETGELDPPERIEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVRE +DFS+Y DIS+EVK  WKIQRDMAERGH+ + + ASI ARKPDF 
Sbjct  110   IEGLHPLYDERVREQIDFSVYFDISDEVKIQWKIQRDMAERGHTYDDVLASINARKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQ+++AD V++VLPT+L+ +D EGK LRVRL+ +EG+++F P YLFDEGSTI W P
Sbjct  170   AYIEPQREFADVVMQVLPTELV-EDKEGKYLRVRLVQQEGIENFEPAYLFDEGSTIHWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD+Y G+EVS+LE+DG+FD LDE+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCNYPGIKMYYGPDSYLGNEVSILEVDGKFDNLDEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPV  1415
             + +LKH D+PGS+NGTG FQ ++GLK+R  YE++VA + AA V
Sbjct  289   ELVLKHRDYPGSDNGTGLFQILIGLKMRQTYEKLVAQKKAAVV  331



>ref|WP_026794224.1| MULTISPECIES: phosphoribulokinase [Planktothrix]
Length=334

 Score =   479 bits (1233),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 223/345 (65%), Positives = 270/345 (78%), Gaps = 19/345 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RR+T +FG                  D  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRITDIFG-----------------KDFVTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMY+QV ALK G ++DKPIYNH TG LDPPE  +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYQQVNALKNGISIDKPIYNHETGELDPPERIEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLDIS+EVK +WKIQRDMAERGH  E + A+I AR+PDF+
Sbjct  110   IEGLHPLYDERVRSLLDFSVYLDISDEVKISWKIQRDMAERGHRYEDVLAAINARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD V+++LPT LI +D E KVLRVRL+ KEGV+   P YLFD+GSTI WIP
Sbjct  170   AYIDPQKQYADVVVQILPTNLIAEDKEHKVLRVRLVQKEGVEGLEPSYLFDQGSTIYWIP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG+K  YGPD Y+G+EVS+LE+DGQFD LDE+IYVE HLS+LSTK+YGE+T
Sbjct  230   CGRKLTCSYPGLKMYYGPDNYYGNEVSILEVDGQFDNLDEMIYVEGHLSNLSTKYYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT--RAAAPV  1415
               + +  ++PGSNNG+G FQ +VGLK+R  YE++V    + AA V
Sbjct  290   HLLRERQEYPGSNNGSGLFQVLVGLKMRATYERLVGANEKVAAAV  334



>ref|WP_011057751.1| phosphoribulokinase [Thermosynechococcus elongatus]
 ref|NP_682704.1| phosphoribulokinase [Thermosynechococcus elongatus BP-1]
 dbj|BAC09466.1| phosphoribulokinase [Thermosynechococcus elongatus BP-1]
 dbj|BAC11759.1| phosphoribulokinase [Thermosynechococcus vulcanus]
Length=334

 Score =   478 bits (1231),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 218/341 (64%), Positives = 271/341 (79%), Gaps = 17/341 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  D  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLADLFG-----------------EDFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALK G+++ KPIYNH TG +DPPE   P  ++V
Sbjct  50    RKQRKEMGITALDPRANNFDLMYEQIKALKNGESIMKPIYNHETGTIDPPEKVDPNHVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+YLDIS++VK AWKI+RDMAERGHS E + ASI AR+PDF 
Sbjct  110   IEGLHPLYDERVRSLIDFSVYLDISDDVKIAWKIKRDMAERGHSYEDVIASINARRPDFM  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQKQYAD V+++LP+QL  ++  G +LRVR++ +EG+  F PVYLFDEGSTI+WIP
Sbjct  170   AYIDPQKQYADVVLQILPSQLAKEEKVGNILRVRMLQREGIPGFEPVYLFDEGSTITWIP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+ +YGPD Y+GH VSVLE+DG+F++LDELIY+ESHLS+ STK YGEVT
Sbjct  230   CGRKLTCSYPGIRLSYGPDEYYGHPVSVLEVDGRFEKLDELIYIESHLSNTSTKHYGEVT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAA  1409
             + +LKH D+PGS+NG+G FQ + GLK+R  YE++ +  AA 
Sbjct  290   ELLLKHRDYPGSDNGSGLFQVLTGLKMRATYERLTSRDAAT  330



>ref|WP_017711931.1| phosphoribulokinase [Prochlorothrix hollandica]
Length=335

 Score =   478 bits (1231),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 223/345 (65%), Positives = 270/345 (78%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  D  TVICLDDYHSLD
Sbjct  6     RVVMIGVAGDSGCGKSTFLRRLTDLFG-----------------KDFITVICLDDYHSLD  48

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE+GVTAL+P+AN+F+LM EQV ALK G AVDKPIYNH TG +DPPE  +P  I+V
Sbjct  49    RKQRKEQGVTALNPQANNFELMAEQVAALKNGIAVDKPIYNHETGYIDPPERIEPNHIIV  108

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP++D RVR+L+DFS+YLDIS+EVK AWKIQRDMAERGH+ E + ASI +RKPDFD
Sbjct  109   IEGLHPLHDQRVRDLIDFSVYLDISDEVKIAWKIQRDMAERGHTYEDVLASINSRKPDFD  168

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQK+YAD V++VLPT LI DD E KVLRV++I +EG++ F P YLFDEGSTI W P
Sbjct  169   AYIDPQKKYADVVLQVLPTNLIKDDTERKVLRVQMIQREGLEGFEPTYLFDEGSTIHWTP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIK  YGPD+Y+G+EVSVLE+DGQF+ L+E+IY+E HLS   TK+YGE+T
Sbjct  229   CGRKLTCSYPGIKMYYGPDSYYGNEVSVLEVDGQFENLEEMIYIEGHLSKTDTKYYGELT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               ML+H ++PGS NGTG FQ + GLK+R  YE++ A  A   V A
Sbjct  289   HLMLQHKEYPGSTNGTGLFQVLTGLKMRAAYERLTAKDAKTTVAA  333



>ref|WP_007311685.1| phosphoribulokinase [Crocosphaera watsonii]
 gb|EHJ11583.1| Phosphoribulokinase [Crocosphaera watsonii WH 0003]
 emb|CCQ62992.1| Phosphoribulokinase [Crocosphaera watsonii WH 0401]
 emb|CCQ53231.1| Phosphoribulokinase [Crocosphaera watsonii WH 8502]
 emb|CCQ55151.1| Phosphoribulokinase [Crocosphaera watsonii WH 0005]
 emb|CCQ66798.1| Phosphoribulokinase [Crocosphaera watsonii WH 0402]
Length=332

 Score =   478 bits (1230),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 220/337 (65%), Positives = 270/337 (80%), Gaps = 18/337 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+I +A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIAVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTAL+P+AN+FDLMYEQ+KALK G+A+DKPIYNH TG LDPPE  +P K++V
Sbjct  50    RKGRKAAGVTALNPKANNFDLMYEQIKALKSGQAIDKPIYNHETGELDPPERIEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP++D RVREL+DF +YLDIS+EVK  WKIQRDMAERGH+ E + ASI ARKPDF 
Sbjct  110   IEGLHPLFDERVRELVDFGVYLDISDEVKINWKIQRDMAERGHTYEDVLASINARKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             A+I+PQKQ+AD VI+VLPTQLI +D+E K+LRVRL+ KEG+ +F P YLFDEGSTI W P
Sbjct  170   AFIEPQKQHADVVIQVLPTQLI-EDHESKLLRVRLVQKEGIANFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCAYPGIKMYYGPDNFMGNEVSMLEVDGQFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT  1397
             + +L+H D+PGS NGTG FQ +VGLK+R+ YE+I A 
Sbjct  289   ELLLQHKDYPGSTNGTGLFQVLVGLKMRETYEKITAV  325



>ref|WP_015146554.1| uridine kinase [Oscillatoria acuminata]
 ref|YP_007083824.1| uridine kinase [Oscillatoria acuminata PCC 6304]
 gb|AFY79904.1| uridine kinase [Oscillatoria acuminata PCC 6304]
Length=334

 Score =   478 bits (1230),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 222/338 (66%), Positives = 265/338 (78%), Gaps = 17/338 (5%)
 Frame = +3

Query  390   TVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLDR  569
              V+IG+A DSGCGKSTF+ RL  +FG                  ++ TVICLDDYHSLDR
Sbjct  8     VVLIGVAGDSGCGKSTFLHRLKDLFG-----------------EELMTVICLDDYHSLDR  50

Query  570   TGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILVI  749
               RKE GVTALDPRAN+FDLMYEQVKALK G+ V+KPIYNH TG++DPPE  +P  I+VI
Sbjct  51    KQRKEHGVTALDPRANNFDLMYEQVKALKNGQGVNKPIYNHETGMIDPPERVEPNHIIVI  110

Query  750   EGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDA  929
             EGLHP+YD RVR LLDFS+YLDIS+EVK AWKIQRDMAERGH  E + ASI +R+PDF A
Sbjct  111   EGLHPIYDERVRSLLDFSVYLDISDEVKIAWKIQRDMAERGHRYEDVLASINSRRPDFSA  170

Query  930   YIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIPC  1109
             YI+PQK +AD VI VLPT LIPDD E KVLRV++I + GV    PVYLFDEGSTI+W PC
Sbjct  171   YIEPQKAHADVVIRVLPTNLIPDDKERKVLRVQMIQRYGVHGMDPVYLFDEGSTINWTPC  230

Query  1110  GRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVTQ  1289
             GRKLTCSYPGIK  YGPD + GHEVS+LE+DGQF+ L+E+IY+ESHLS+ STKFYGE+T+
Sbjct  231   GRKLTCSYPGIKMAYGPDAFEGHEVSILEVDGQFENLEEMIYIESHLSNTSTKFYGELTE  290

Query  1290  QMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
              +L+H  +PGSNNGTG FQ + GLK+R  YE++ +  A
Sbjct  291   LLLQHPTYPGSNNGTGLFQVLTGLKMRAAYERLTSKEA  328



>ref|WP_008276485.1| phosphoribulokinase [Cyanothece sp. CCY0110]
 gb|EAZ90411.1| phosphoribulokinase [Cyanothece sp. CCY0110]
Length=332

 Score =   478 bits (1230),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 223/347 (64%), Positives = 275/347 (79%), Gaps = 21/347 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+I +A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIAVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTAL+P+AN+FDLMYEQ+KALK G+A+DKPIYNH TG LDPPE  +P K++V
Sbjct  50    RKGRKAAGVTALNPKANNFDLMYEQIKALKSGQAIDKPIYNHETGELDPPERIEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP++D RVREL+DF +YLDIS+EVK  WKIQRDMAERGHS + + ASI ARKPDF 
Sbjct  110   IEGLHPLFDERVRELVDFGVYLDISDEVKINWKIQRDMAERGHSYDDVLASINARKPDFT  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQK++AD VI+VLPTQLI +D+E K+LRVRL+ KEGV +F P YLFDEGSTI W P
Sbjct  170   AYIEPQKEHADVVIQVLPTQLI-EDHESKLLRVRLVQKEGVANFEPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD + G+EVS+LE+DGQFD L+E+IY+ESHLS   TK+YGE+T
Sbjct  229   CGRKLTCAYPGIKMYYGPDNFMGNEVSILEVDGQFDNLEEMIYIESHLSKTGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             + +L+H D+PGS NGTG FQ +VGLK+R+ YE++ A +   PV A+ 
Sbjct  289   ELLLQHKDYPGSTNGTGLFQVLVGLKMRETYEKLTADQ---PVPAQV  332



>ref|WP_017651923.1| phosphoribulokinase [Microchaete sp. PCC 7126]
Length=334

 Score =   478 bits (1229),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 215/345 (62%), Positives = 271/345 (79%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  D+ TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EDLMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALK G+ ++KPIYNH TG++DPPE+ KP  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKSGQQINKPIYNHETGMIDPPEVIKPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVREL+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF+
Sbjct  110   VEGLHPLYDERVRELIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI DD E KVLRVR++ +EG + F+P YLFDEGSTI+W P
Sbjct  170   KYIEPQREFADVVLQVLPTNLIKDDTERKVLRVRMLQREGKEGFAPAYLFDEGSTINWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  V+VLE+DGQFD L+E+IY+E+HLS+ STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVTVLEVDGQFDNLEEVIYIETHLSNTSTKYQGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +LKH ++PGSNNGTG FQ + GLK+RD YE++ AT A   V+ 
Sbjct  290   HLLLKHREYPGSNNGTGLFQVLTGLKMRDAYERLTATEAKLAVQV  334



>ref|WP_009344599.1| phosphoribulokinase [Raphidiopsis brookii]
 gb|EFA71522.1| Phosphoribulokinase/uridine kinase [Raphidiopsis brookii D9]
Length=334

 Score =   476 bits (1225),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 220/345 (64%), Positives = 267/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  D  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EDFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG AVDKPIYNH TG++DPPE  KP  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGHAVDKPIYNHETGMIDPPERIKPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDFD
Sbjct  110   VEGLHPLYDERVRSLLDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFD  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              +I+PQ+++AD V++VLPT LI +D E KVLRVR++ KEG + F+PVYLFDEGSTI+W P
Sbjct  170   KFIEPQREFADVVLQVLPTNLIKNDTERKVLRVRMLQKEGKEGFAPVYLFDEGSTINWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD LDE+IYVE HLS+ STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQMHYGSDVYYGRYVSVLEVDGQFDNLDEVIYVEKHLSNTSTKYIGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+R +YE + A  A   V+A
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRSVYEILTAKEAKLAVKA  334



>ref|WP_019504595.1| phosphoribulokinase [Pleurocapsa sp. PCC 7319]
Length=332

 Score =   475 bits (1223),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 221/339 (65%), Positives = 273/339 (81%), Gaps = 18/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK  GVTAL+P+AN+FDLMYEQ+KALKEGKA+DKPIYNH TG LDPPE  +P K++V
Sbjct  50    RKGRKAAGVTALNPKANNFDLMYEQIKALKEGKAIDKPIYNHETGELDPPERIEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVREL+DF +YLDIS+EVK  WKIQRDM+ERGH+ E I ASI+AR+PDF 
Sbjct  110   IEGLHPLYDQRVRELVDFGVYLDISDEVKIQWKIQRDMSERGHTYEDILASIKAREPDFK  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+ Q+++AD VI+VLPTQL+ DD E  +LRVRLI KEGV++F  VYLFDEGSTI W P
Sbjct  170   AYIEVQREFADVVIQVLPTQLV-DDKETDLLRVRLIQKEGVENFDTVYLFDEGSTIHWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPGIK  YGPD ++ +EVS+LE+DGQFD L+E+IY+ESHLS+  T  YGE+T
Sbjct  229   CGRKLTCAYPGIKMYYGPDAFYNNEVSILEVDGQFDNLEEMIYIESHLSNTGTGHYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             + +LKH D+PGSNNGTG FQ +VGLK+R+ Y++++ T A
Sbjct  289   ELLLKHKDYPGSNNGTGLFQVLVGLKMRETYDKLMTTMA  327



>ref|WP_006275609.1| phosphoribulokinase [Cylindrospermopsis raciborskii]
 gb|EFA71370.1| Phosphoribulokinase/uridine kinase [Cylindrospermopsis raciborskii 
CS-505]
Length=334

 Score =   475 bits (1222),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 221/350 (63%), Positives = 267/350 (76%), Gaps = 17/350 (5%)
 Frame = +3

Query  372   AGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDD  551
              G   + V+IG+A DSGCGKSTF+RRL  +FG                  D  TVICLDD
Sbjct  2     TGKPERVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EDFMTVICLDD  44

Query  552   YHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKP  731
             YH LDR  RKE G+TALDPRAN+FDLMYEQ+KALKEG AVDKPIYNH TG++DPPE  KP
Sbjct  45    YHCLDRKQRKETGITALDPRANNFDLMYEQIKALKEGYAVDKPIYNHETGMIDPPERIKP  104

Query  732   PKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR  911
               I+V+EGLHP+YD RVR LLDFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +R
Sbjct  105   NHIIVVEGLHPLYDERVRSLLDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSR  164

Query  912   KPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGST  1091
             KPDFD +I+PQ+++AD V++VLPT LI +D E KVLRVR++ KEG + F+PVYLFDEGST
Sbjct  165   KPDFDKFIEPQREFADVVLQVLPTNLIKNDTERKVLRVRMLQKEGKEGFAPVYLFDEGST  224

Query  1092  ISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKF  1271
             I W PCGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD LDE+IYVE HLS+ STK+
Sbjct  225   IQWTPCGRKLTCSYPGMQMYYGSDVYYGRYVSVLEVDGQFDNLDEVIYVEKHLSNTSTKY  284

Query  1272  YGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
              GE+T  +L+H ++PGSNNGTG FQ + GLK+R +YE + A  A   V+A
Sbjct  285   IGEMTHLLLQHREYPGSNNGTGLFQVLTGLKMRSVYEILTAKEAKLAVKA  334



>ref|WP_013320530.1| phosphoribulokinase [Cyanothece sp. PCC 7822]
 ref|YP_003885695.1| phosphoribulokinase [Cyanothece sp. PCC 7822]
 gb|ADN12420.1| Phosphoribulokinase [Cyanothece sp. PCC 7822]
Length=335

 Score =   475 bits (1222),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 217/337 (64%), Positives = 267/337 (79%), Gaps = 17/337 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK+ GVTALDP+AN+FDLM EQ+KALK G+ + KPIYNH TG++DPPE  +P K++V
Sbjct  50    RQGRKKAGVTALDPKANNFDLMAEQIKALKSGQPIMKPIYNHETGMIDPPERVEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+YLDIS+EVK  WKIQRDMAERGHS + + ASI ARKPDF 
Sbjct  110   IEGLHPLYDERVRSLVDFSVYLDISDEVKINWKIQRDMAERGHSYDDVIASINARKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQ++YAD VI+VLPT+LI +D E K+LRVRLI KEG+++F P YLFDEGSTI W P
Sbjct  170   AYIEPQREYADVVIQVLPTKLIENDTESKILRVRLIQKEGLENFKPAYLFDEGSTIDWRP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC+YPG+K  YGPD  FG+EVS+LE+DGQFD L+E+IY+E HLS   TK+YGE+T
Sbjct  230   CGRKLTCAYPGLKMYYGPDNIFGNEVSILEIDGQFDNLEEMIYIEQHLSRTGTKYYGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT  1397
               + +H D+PGSNNGTG FQ +VGLK+R+ YE + A 
Sbjct  290   HLLQQHKDYPGSNNGTGLFQVLVGLKMRETYEILTAV  326



>ref|WP_011317639.1| phosphoribulokinase [Anabaena variabilis]
 ref|YP_321300.1| phosphoribulokinase [Anabaena variabilis ATCC 29413]
 gb|ABA20405.1| phosphoribulokinase [Anabaena variabilis ATCC 29413]
Length=334

 Score =   474 bits (1221),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 215/345 (62%), Positives = 269/345 (78%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+ ++KPIYNH TGL+DPPE+ KP  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGQTINKPIYNHETGLIDPPEIVKPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+Y DIS+EVK AWKIQRDMAERGH  E + A+I +RKPDF 
Sbjct  110   VEGLHPLYDERVRSLLDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAAINSRKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI DD + KVLRVR++ +EG + F P YLFDEGSTI+W P
Sbjct  170   KYIEPQREFADVVLQVLPTNLIKDDTDRKVLRVRMLQREGKEGFEPAYLFDEGSTINWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS+ STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSNTSTKYQGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             Q +L+H ++PGSNNGTGFFQ + GLK+R  YE++ A  A   V+ 
Sbjct  290   QLLLQHREYPGSNNGTGFFQVLTGLKMRAAYERLTAKEAKLAVQV  334



>ref|WP_010998262.1| phosphoribulokinase [Nostoc sp. PCC 7120]
 ref|NP_488163.1| phosphoribulokinase [Nostoc sp. PCC 7120]
 dbj|BAB75822.1| phosphoribulokinase [Nostoc sp. PCC 7120]
Length=334

 Score =   474 bits (1221),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 215/345 (62%), Positives = 268/345 (78%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+ ++KPIYNH TGL+DPPE+ KP  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGQTINKPIYNHETGLIDPPEIVKPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+Y DIS+EVK AWKIQRDMAERGH  E + A+I +RKPDF 
Sbjct  110   VEGLHPLYDERVRSLLDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAAINSRKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI DD E KVLRVR++ +EG + F P YLFDEGSTI+W P
Sbjct  170   KYIEPQREFADVVLQVLPTNLIKDDTERKVLRVRMLQREGKEGFEPAYLFDEGSTINWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS+ STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSNTSTKYQGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             Q +L+H ++PGSNNGTGFFQ + GLK+R  YE++    A   V+ 
Sbjct  290   QLLLQHREYPGSNNGTGFFQVLTGLKMRAAYERLTTKEAKLAVQV  334



>ref|WP_017287228.1| phosphoribulokinase [Leptolyngbya boryana]
Length=336

 Score =   474 bits (1219),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/347 (63%), Positives = 269/347 (78%), Gaps = 17/347 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RR+T +FG                  D  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRITDLFG-----------------EDFVTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TAL+P+AN+FDLM EQ+KALK G+ +DKPIYNH TG +DPPE  +P  I+V
Sbjct  50    RKQRKETGITALNPKANNFDLMAEQIKALKSGETIDKPIYNHETGEIDPPEKIEPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR+L+DFS+YLDIS+EVK AWKIQRDMAERGHS E + A I +RKPDFD
Sbjct  110   IEGLHPLYDKRVRDLIDFSVYLDISDEVKIAWKIQRDMAERGHSYEDVLAQINSRKPDFD  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQK++AD VI+VLPTQLI +D E KVLRV++I ++G++ + PVYLFDEGSTI W P
Sbjct  170   AYIDPQKEFADVVIQVLPTQLIKEDKERKVLRVQMIQRDGIEGYDPVYLFDEGSTIDWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGI+  YGPD Y+ H VSVLE+DGQFD+L+E+IY+E HLS  S K+ GEVT
Sbjct  230   CGRKLTCSYPGIRMHYGPDVYYKHGVSVLEVDGQFDKLEEVIYIEQHLSKTSAKYNGEVT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
             + +L+H ++PGSNNGTG FQ + GLK+R  YE++     A  V A  
Sbjct  290   ELLLQHREYPGSNNGTGLFQVLTGLKMRATYERLTNQAGATKVPANV  336



>ref|WP_013193002.1| phosphoribulokinase [Trichormus azollae]
 ref|YP_003723115.1| Phosphoribulokinase ['Nostoc azollae' 0708]
 gb|ADI65992.1| Phosphoribulokinase ['Nostoc azollae' 0708]
Length=333

 Score =   472 bits (1214),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 214/345 (62%), Positives = 268/345 (78%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  D+ TVICLDDYHSLD
Sbjct  6     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EDLMTVICLDDYHSLD  48

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+A+DKPIYNH TGL+DP E  +P  I+V
Sbjct  49    RKQRKETGITALDPRANNFDLMYEQIKALKEGQAIDKPIYNHETGLIDPAERIEPNHIIV  108

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDFD
Sbjct  109   VEGLHPLYDERVRALLDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFD  168

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              +I+PQ+++AD V++VLPT LI +D E KVLRVR++ +EG + F+P YLFDEGSTI W P
Sbjct  169   KFIEPQREFADVVLQVLPTNLINNDTERKVLRVRMLQREGKEGFNPAYLFDEGSTIQWTP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS+ STK+ GE+T
Sbjct  229   CGRKLTCSYPGMQMYYGSDVYYGRYVSVLEVDGQFDNLEEIIYIENHLSNTSTKYIGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+R +YE++ A  A   V+ 
Sbjct  289   HLLLQHREYPGSNNGTGLFQVLTGLKMRSVYERLTAKEAKLAVQV  333



>ref|WP_015163401.1| phosphoribulokinase [Pseudanabaena sp. PCC 7367]
 ref|YP_007100855.1| phosphoribulokinase [Pseudanabaena sp. PCC 7367]
 gb|AFY68427.1| phosphoribulokinase [Pseudanabaena sp. PCC 7367]
Length=336

 Score =   471 bits (1212),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/337 (65%), Positives = 266/337 (79%), Gaps = 17/337 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLNDLFG-----------------KEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RK+ G+TALDPRAN+FDLMYEQ+ ALK G+++ KPIYNH TG LDPPEL +P  ++V
Sbjct  50    RKQRKQTGITALDPRANNFDLMYEQIAALKSGESIMKPIYNHETGELDPPELIEPNHVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR LLDFS+YLD+S  VK AWK++RDMAERGH+LE +  +I ARKPDF 
Sbjct  110   IEGLHPLYDERVRGLLDFSVYLDLSEPVKAAWKVKRDMAERGHTLEDVMQAINARKPDFT  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQK++ADAVI++LPT L+ +D E KVLRVRL+ +EGV +F   YLFDEGSTISW P
Sbjct  170   AYIDPQKEHADAVIQILPTNLVKEDPEHKVLRVRLLQREGVDNFEHAYLFDEGSTISWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CG+KLTCSYPG++F YGPD Y+ H VSVLE+DGQFDRLDE+IY+E+HLS+LSTK YGE+T
Sbjct  230   CGKKLTCSYPGMRFFYGPDAYYKHPVSVLEVDGQFDRLDEVIYIENHLSNLSTKHYGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVAT  1397
             + + KH D+PGSNNGTG  Q IVGLK+R  YE +  T
Sbjct  290   ELLRKHPDYPGSNNGTGLLQVIVGLKMRAKYELLTQT  326



>ref|WP_026733812.1| phosphoribulokinase [Fischerella sp. PCC 9605]
Length=334

 Score =   471 bits (1212),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 214/345 (62%), Positives = 268/345 (78%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  ++ TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EELMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+++ KPIYNH TG +DPPEL +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGQSIMKPIYNHETGTIDPPELVEPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF 
Sbjct  110   IEGLHPLYDERVRSLIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI +D E KVLRVR++ +EG + F+PVYLFDEGSTI W P
Sbjct  170   KYIEPQREFADVVLQVLPTNLIKEDKERKVLRVRMLQREGKEGFAPVYLFDEGSTIHWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD LDE+IY+E+HLS+ STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLDEVIYIETHLSNTSTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+R  YE++ A  A   ++ 
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRATYERLTAKEAKMAIQV  334



>ref|WP_015189197.1| phosphoribulokinase [Gloeocapsa sp. PCC 7428]
 ref|YP_007128485.1| phosphoribulokinase [Gloeocapsa sp. PCC 7428]
 gb|AFZ31325.1| phosphoribulokinase [Gloeocapsa sp. PCC 7428]
Length=337

 Score =   471 bits (1211),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 214/338 (63%), Positives = 267/338 (79%), Gaps = 17/338 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFLTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALK G+A+DKPIYNH TG++DPPE  +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKNGQAIDKPIYNHETGMIDPPERVEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+YLDIS+EVK AWKIQRDMAERGH  E +  +I AR+PDF 
Sbjct  110   VEGLHPLYDERVRSLLDFSVYLDISDEVKIAWKIQRDMAERGHRYEDVLQAINARRPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQ+++AD V++VLPT LI DD E KVLRVR++ +EG + F PVYLFDEGSTI W P
Sbjct  170   AYIEPQREFADVVLQVLPTNLIKDDTERKVLRVRMLQREGKEGFEPVYLFDEGSTIHWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFDRL+E+ Y+E+HLS+ STK+ GE+T
Sbjct  230   CGRKLTCSYPGMRLFYGSDVYYGRYVSVLEVDGQFDRLEEVSYIETHLSNTSTKYPGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATR  1400
               +L+H ++PGSNNGTG FQ + GLK+R  YE+++A +
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRATYERLMAAK  327



>ref|WP_040932417.1| phosphoribulokinase [Prochloron didemni]
Length=334

 Score =   471 bits (1211),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 216/336 (64%), Positives = 270/336 (80%), Gaps = 18/336 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVIIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RK  GVTAL+P+AN+FDLMYEQ+KALK G+A+DKPIYNH TG +DPPE  +P K++V
Sbjct  50    RLRRKAAGVTALNPKANNFDLMYEQIKALKNGQAIDKPIYNHETGEIDPPERIEPNKVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP++D RVR L+DF +YLDIS+EVK +WKIQRDMAERGH+ + + ASI ARKPDF 
Sbjct  110   IEGLHPLFDERVRSLVDFGVYLDISDEVKISWKIQRDMAERGHTYDDVLASINARKPDFS  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQ+++AD VI++LPTQLI +D E K+LRVRL+ KEGV+ F P YLFDEGSTI W P
Sbjct  170   AYIEPQREHADVVIQILPTQLI-EDKENKLLRVRLVQKEGVEGFDPAYLFDEGSTIDWRP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIK  YGPD+Y+G+EVSVLE+DGQF+ L+E+IY+ESHLS + TK+YGE+T
Sbjct  229   CGRKLTCSYPGIKLYYGPDSYYGNEVSVLEVDGQFENLEEMIYIESHLSKIGTKYYGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVA  1394
             + +LK  D PGSNNG+G FQ +VGLK+R+ YE + +
Sbjct  289   ELLLKKKDAPGSNNGSGLFQVLVGLKMRESYEYLTS  324



>ref|WP_017316736.1| phosphoribulokinase [Mastigocladopsis repens]
Length=334

 Score =   471 bits (1211),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 213/339 (63%), Positives = 266/339 (78%), Gaps = 17/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  ++ TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EELMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+A+DKPIYNH TG++DPPE  +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGRAIDKPIYNHETGMIDPPERIEPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVREL+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF 
Sbjct  110   VEGLHPLYDERVRELIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFT  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI DD + KVLRVR++ +EG + F PVYLFDEGSTI W P
Sbjct  170   KYIEPQREFADVVLQVLPTNLIKDDKDRKVLRVRMLQREGKEGFDPVYLFDEGSTIQWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS  STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSKTSTKYKGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
             Q +L+H ++PGSNNGTG FQ + GLK+R  YE++ +  A
Sbjct  290   QLLLQHREYPGSNNGTGLFQVLTGLKMRTAYERLTSKEA  328



>ref|WP_012409283.1| phosphoribulokinase [Nostoc punctiforme]
 ref|YP_001866232.1| phosphoribulokinase [Nostoc punctiforme PCC 73102]
 gb|ACC81289.1| phosphoribulokinase/uridine kinase [Nostoc punctiforme PCC 73102]
Length=334

 Score =   470 bits (1210),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 212/345 (61%), Positives = 268/345 (78%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  D+ TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EDLMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+K LK G+A+DKPIYNH TGL+DPPE  +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKTLKSGQAIDKPIYNHETGLIDPPERVEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR L+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF+
Sbjct  110   VEGLHPLYDERVRSLIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              +I+PQ+++AD V++VLPT LI +D E +VLRVR++ +EG + F P YLFDEGSTI+W P
Sbjct  170   KFIEPQREFADVVLQVLPTNLIKNDTERRVLRVRMLQREGKEGFDPTYLFDEGSTINWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS+ STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSNTSTKYQGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTGFFQ + GLK+R  YE++ AT A   V+ 
Sbjct  290   HLLLQHREYPGSNNGTGFFQVLTGLKMRAAYERLTATEAKLAVQV  334



>ref|WP_039713238.1| phosphoribulokinase [Scytonema millei]
 gb|KIF20891.1| phosphoribulokinase [Scytonema millei VB511283]
Length=336

 Score =   470 bits (1209),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 215/347 (62%), Positives = 267/347 (77%), Gaps = 17/347 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  ++ TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EELVTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TAL+P+AN+FDLMYEQ+KALK G+A++KPIYNH TG +DPPE  +P  I+V
Sbjct  50    RKQRKETGITALNPKANNFDLMYEQIKALKNGQAIEKPIYNHETGCIDPPEHIEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+YLDISNEVK AWKIQRDMAERGH  E + A+I +RKPDFD
Sbjct  110   VEGLHPLYDERVRSLLDFSVYLDISNEVKIAWKIQRDMAERGHRYEDVVAAINSRKPDFD  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQ+++AD VI+VLPT LI +D E KVLRVR++ KE V   +P YLFDEGSTI W P
Sbjct  170   AYIEPQREFADVVIQVLPTNLIKEDKERKVLRVRMLQKEDVHGMTPTYLFDEGSTIQWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+ Y+E+HLS+  TK+ GE+T
Sbjct  230   CGRKLTCSYPGMQMFYGSDVYYGQYVSVLEVDGQFDNLEEVAYIETHLSNTFTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
               +L+H ++PGSNNGTG FQ + GLK+R +YE + A      V AKA
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRAVYESLTAKEIKMAVSAKA  336



>ref|WP_015118896.1| uridine kinase [Rivularia sp. PCC 7116]
 ref|YP_007055874.1| uridine kinase [Rivularia sp. PCC 7116]
 gb|AFY55327.1| uridine kinase [Rivularia sp. PCC 7116]
Length=334

 Score =   469 bits (1208),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 216/345 (63%), Positives = 266/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSLD
Sbjct  7     RIVMIGVAGDSGCGKSTFLRRLIDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TAL+P+AN+FDLMYEQ+KALKEG+A+DKPIYNH TG LDPPE  +P  I+V
Sbjct  50    RKQRKETGITALNPKANNFDLMYEQMKALKEGQAIDKPIYNHETGELDPPERIEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+YLDIS+EVK AWKIQRDM ERGH+ E + A+I +RKPDF 
Sbjct  110   IEGLHPLYDERVRSLIDFSVYLDISDEVKIAWKIQRDMEERGHTYEDVLAAINSRKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD VI+VLPT LI +D E KVLRVR++ +EG + F PVYLFDEGSTI W P
Sbjct  170   NYIEPQREHADVVIQVLPTNLIKEDKERKVLRVRMLQREGKEGFEPVYLFDEGSTIQWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD LDE+IY+E+HLS  STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQMYYGSDVYYGRYVSVLEVDGQFDNLDEVIYIETHLSKTSTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+R  YE++  T A   VE 
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRAAYERLTQTEAKMAVEV  334



>ref|WP_015111866.1| phosphoribulokinase [Nostoc sp. PCC 7107]
 ref|YP_007048780.1| phosphoribulokinase [Nostoc sp. PCC 7107]
 gb|AFY41630.1| phosphoribulokinase [Nostoc sp. PCC 7107]
Length=334

 Score =   469 bits (1207),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 212/345 (61%), Positives = 269/345 (78%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EEFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+A++KPIYNH TGL+DPPE+ +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGQAINKPIYNHETGLIDPPEIVEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+Y DIS+EVK AWKIQRDMAERGH  E + A+I +RKPDF 
Sbjct  110   VEGLHPLYDERVRSLLDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAAINSRKPDFT  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI +D E KVLRVR++ +EG + F+PVYLFDEGSTI+W P
Sbjct  170   KYIEPQREFADVVLQVLPTNLIKNDTERKVLRVRMLQREGKEGFAPVYLFDEGSTINWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS+ STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEIIYIENHLSNTSTKYEGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+R  YE++ +  A   V+ 
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRATYERLTSKEAKLAVQV  334



>ref|WP_039741864.1| phosphoribulokinase [Hassallia byssoidea]
 gb|KIF35241.1| phosphoribulokinase [Hassallia byssoidea VB512170]
Length=335

 Score =   469 bits (1207),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 215/339 (63%), Positives = 263/339 (78%), Gaps = 17/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  ++ TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EELMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEGKA+DKPIYNH TGLLDPPE  +P  ILV
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGKAIDKPIYNHETGLLDPPERIEPNHILV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDFD
Sbjct  110   IEGLHPLYDERVRSLIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFD  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              +I+PQ+++AD V++VLPT LI +D E KVLRVR++ +E  + F P YLFDEGSTI W P
Sbjct  170   KFIEPQREFADVVLQVLPTNLIKEDKERKVLRVRMLQREDKQGFEPTYLFDEGSTIQWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS  STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSKTSTKYEGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
               +L+H ++PGSNNGTG FQ + GLK+R  YE++ AT A
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRAAYERLTATEA  328



>ref|WP_015137356.1| uridine kinase [Nostoc sp. PCC 7524]
 ref|YP_007074497.1| uridine kinase [Nostoc sp. PCC 7524]
 gb|AFY46900.1| uridine kinase [Nostoc sp. PCC 7524]
Length=334

 Score =   469 bits (1207),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 211/345 (61%), Positives = 268/345 (78%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  ++ TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EELMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+A++KPIYNH TG++DPPE+ +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGQAINKPIYNHETGMIDPPEIVEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+Y DIS+EVK AWKIQRDMAERGH  E + A+I +RKPDF 
Sbjct  110   VEGLHPLYDERVRSLLDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAAINSRKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI +D + KVLRVR++ +EG + F P YLFDEGSTI W P
Sbjct  170   KYIEPQREFADVVLQVLPTNLIKNDTDRKVLRVRMLQREGKEGFEPAYLFDEGSTIQWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS+ STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQMYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSNTSTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+R  YE++ A  A   V+ 
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRATYERLTAKEAKLAVQV  334



>ref|WP_016876433.1| phosphoribulokinase [Chlorogloeopsis fritschii]
Length=334

 Score =   469 bits (1206),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 214/345 (62%), Positives = 266/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  ++ TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EELMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+++ KPIYNH TGL+DPPEL +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGQSIMKPIYNHETGLIDPPELIEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF 
Sbjct  110   IEGLHPLYDERVRSLIDFSVYFDISDEVKIAWKIQRDMAERGHKYEDVLAQINSRKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI +D E KVLRVR++ +EG + F PVYLFDEGSTI W P
Sbjct  170   KYIEPQREFADVVLQVLPTNLIKEDKERKVLRVRMLQREGKEGFEPVYLFDEGSTIHWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD LDE+IY+E+HLS+ STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQMYYGSDVYYGRYVSVLEVDGQFDNLDEVIYIETHLSNTSTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+R  YE++ A  A   V+ 
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRAAYERLTAKEAKMAVQV  334



>ref|WP_015153059.1| phosphoribulokinase [Chroococcidiopsis thermalis]
 ref|YP_007090379.1| phosphoribulokinase [Chroococcidiopsis thermalis PCC 7203]
 gb|AFY86510.1| phosphoribulokinase [Chroococcidiopsis thermalis PCC 7203]
Length=336

 Score =   469 bits (1206),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 214/347 (62%), Positives = 267/347 (77%), Gaps = 17/347 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  ++ TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EELVTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TAL+P+AN+FDLMYEQ+KALK G++++KPIYNH TG +DPPE  +P  I+V
Sbjct  50    RKQRKETGITALNPKANNFDLMYEQIKALKNGQSIEKPIYNHETGCIDPPEHIEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+YLDISNEVK AWKIQRDMAERGH  E + A+I +RKPDFD
Sbjct  110   VEGLHPLYDERVRSLLDFSVYLDISNEVKIAWKIQRDMAERGHRYEDVVAAINSRKPDFD  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYI+PQ+++AD VI+VLPT LI +D E KVLRVR++ KE V   +P YLFDEGSTI W P
Sbjct  170   AYIEPQREFADVVIQVLPTNLIKEDKERKVLRVRMLQKEDVHGMTPTYLFDEGSTIQWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+ Y+E+HLS+  TK+ GE+T
Sbjct  230   CGRKLTCSYPGMQMFYGSDVYYGQYVSVLEVDGQFDNLEEVAYIETHLSNTFTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEAKA  1427
               +L+H ++PGSNNGTG FQ + GLK+R +YE + A      V AKA
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRAVYESLTAKEIKMAVSAKA  336



>ref|WP_017328005.1| phosphoribulokinase [Synechococcus sp. PCC 7336]
Length=333

 Score =   468 bits (1203),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 223/344 (65%), Positives = 266/344 (77%), Gaps = 18/344 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL+ +FG                  D+ T ICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLSDLFG-----------------EDLITTICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKEKGVTALDP AN+FDLMYEQV ALK G+++ KPIYNH TGL+DPPE   P  I+V
Sbjct  50    RYQRKEKGVTALDPAANNFDLMYEQVAALKSGRSIMKPIYNHETGLIDPPEKIDPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHPMYD RVR LLDFS+YLDIS+E+K AWK+QRDMAERGH+ + +  SIEAR+PDF+
Sbjct  110   IEGLHPMYDERVRNLLDFSVYLDISSEIKVAWKVQRDMAERGHTYDDVLRSIEARRPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPD-DNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWI  1103
             AYID QKQYAD VIEVLPT L+P+ D E K+L+VRLI  EGV +F P YLFDEGSTI WI
Sbjct  170   AYIDVQKQYADVVIEVLPTDLLPELDKEHKILKVRLIQTEGVDNFEPAYLFDEGSTIDWI  229

Query  1104  PCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEV  1283
             PCG KLTCSYPGIK  YGP T+ G  VS+LE+DGQ D L+E+IY+E+HLSSLSTK YGE+
Sbjct  230   PCGTKLTCSYPGIKLHYGPSTFHGKPVSLLEIDGQIDNLEEVIYLENHLSSLSTKQYGEL  289

Query  1284  TQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPV  1415
             T+ + KH ++PGS NG+G FQ IVGLK+R +YE I +    A V
Sbjct  290   TELLRKHPEYPGSRNGSGLFQVIVGLKLRAIYETITSQAQLAAV  333



>ref|WP_026720815.1| phosphoribulokinase [Fischerella sp. PCC 9431]
Length=334

 Score =   468 bits (1203),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 212/345 (61%), Positives = 266/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  ++ TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EELMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALK+G+++ KPIYNH TG +DPPEL +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKDGQSIMKPIYNHETGAIDPPELIEPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR L+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF 
Sbjct  110   VEGLHPLYDERVRSLIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI +D E KVLRVR++ +EG + F PVYLFDEGSTI W P
Sbjct  170   KYIEPQREFADVVLQVLPTNLIKEDKERKVLRVRMLQREGKEGFEPVYLFDEGSTIQWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS  STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSKTSTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+RD YE++ A  A   V+ 
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRDAYERLTAKEAKMAVQV  334



>ref|WP_011430121.1| phosphoribulokinase [Synechococcus sp. JA-3-3Ab]
 ref|YP_474704.1| phosphoribulokinase [Synechococcus sp. JA-3-3Ab]
 gb|ABC99441.1| phosphoribulokinase [Synechococcus sp. JA-3-3Ab]
Length=335

 Score =   467 bits (1202),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 219/342 (64%), Positives = 270/342 (79%), Gaps = 18/342 (5%)
 Frame = +3

Query  372   AGGDGKTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDD  551
             A    + V+IG+A DSGCGKSTF+RRL  +FG                  D+ T ICLDD
Sbjct  2     ASSPERIVMIGVAGDSGCGKSTFLRRLGDLFG-----------------RDLITTICLDD  44

Query  552   YHSLDRTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKP  731
             YHSLDR  RKEKG+TALDPRAN+FDLMYEQ KALK G++V KPIYNH TGL+DPPE   P
Sbjct  45    YHSLDRYQRKEKGITALDPRANNFDLMYEQAKALKNGQSVMKPIYNHETGLIDPPERVDP  104

Query  732   PKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEAR  911
               I+V+EGLHPMYD RVRELLDF +YLD++ E+K AWK++RDMAERGH+ E +  SIEAR
Sbjct  105   SPIIVLEGLHPMYDERVRELLDFKVYLDLAPEIKIAWKVKRDMAERGHTYEDVLRSIEAR  164

Query  912   KPDFDAYIDPQKQYADAVIEVLPTQLIPD-DNEGKVLRVRLIMKEGVKHFSPVYLFDEGS  1088
             +PDF+AY+D QK+YAD VIEVLPT+L+P+ D E KVLRVR+I +EGV++F  VYLFDEGS
Sbjct  165   RPDFEAYVDVQKRYADVVIEVLPTKLLPELDPEHKVLRVRMIQREGVRYFDHVYLFDEGS  224

Query  1089  TISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTK  1268
             TI WIPCG+KLTCSYPGI+  YGP TYF   VSVLE+DG FD+L+E+IY+E+HLS+LST+
Sbjct  225   TIDWIPCGKKLTCSYPGIRLHYGPSTYFDQPVSVLEIDGTFDKLEEVIYIENHLSNLSTR  284

Query  1269  FYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVA  1394
             +YGE+T+ + KH ++PGS NG+G  Q IVGLK+R LYE+I A
Sbjct  285   YYGELTELLRKHPEYPGSRNGSGLIQVIVGLKLRALYEKIQA  326



>ref|WP_015208881.1| uridine kinase [Cylindrospermum stagnale]
 ref|YP_007148313.1| uridine kinase [Cylindrospermum stagnale PCC 7417]
 gb|AFZ25633.1| uridine kinase [Cylindrospermum stagnale PCC 7417]
Length=334

 Score =   467 bits (1202),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 213/345 (62%), Positives = 264/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  D+ TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EDLMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+ +DKPIYNH TGLLDPPE  +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGQGIDKPIYNHETGLLDPPERVEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR L+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF+
Sbjct  110   VEGLHPLYDERVRSLIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              +I+PQ+++AD V++VLPT LI +D E KVLRVR++ +EG + F P YLFDEGSTI W P
Sbjct  170   KFIEPQREFADVVLQVLPTNLIKNDTERKVLRVRMLQREGKEGFDPTYLFDEGSTIQWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS  STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDDLEEVIYIETHLSKTSTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+R  YEQ+ A  A   V+ 
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRAAYEQLTAKEAKLAVQV  334



>ref|WP_039203945.1| phosphoribulokinase [Aphanizomenon flos-aquae]
 gb|KHG39777.1| phosphoribulokinase [Aphanizomenon flos-aquae 2012/KM/D3]
Length=333

 Score =   467 bits (1201),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 212/345 (61%), Positives = 265/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSLD
Sbjct  6     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EEFMTVICLDDYHSLD  48

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+K+LKEG+A+ KPIYNH TG++DPPE  +P  I+V
Sbjct  49    RKQRKETGITALDPRANNFDLMYEQIKSLKEGQAIHKPIYNHETGMIDPPEWIEPNHIIV  108

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF+
Sbjct  109   VEGLHPLYDERVRALLDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFE  168

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              +I+PQ+++AD V++VLPT LI +D E KVLRVR++ +EG + F P YLFDEGSTI W P
Sbjct  169   KFIEPQREFADVVLQVLPTNLIKNDTERKVLRVRMLQQEGKEGFEPSYLFDEGSTIQWTP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD LDE+IY+E+HLS  STK+ GE+T
Sbjct  229   CGRKLTCSYPGMQLYYGTDVYYGRYVSVLEVDGQFDNLDEVIYIETHLSKTSTKYQGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+RD YE++ A  A   V+ 
Sbjct  289   HLLLQHREYPGSNNGTGLFQVLTGLKMRDAYERLTAKEAKLAVQV  333



>ref|WP_009459579.1| MULTISPECIES: phosphoribulokinase [Fischerella]
 gb|EHC09032.1| Phosphoribulokinase [Fischerella sp. JSC-11]
Length=334

 Score =   466 bits (1200),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 213/345 (62%), Positives = 265/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  ++ TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EELMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+++ KPIYNH TG +DPPEL +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGQSIMKPIYNHETGTIDPPELVEPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF 
Sbjct  110   IEGLHPLYDERVRSLIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI +D E KVLRVR++ +EG + F PVYLFDEGSTI W P
Sbjct  170   KYIEPQREFADVVLQVLPTNLIKEDKERKVLRVRMLQREGKEGFEPVYLFDEGSTIHWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS  STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSKTSTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+R  YE++ A  A   V+ 
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRATYERLTAKEAKMAVQV  334



>ref|WP_036533346.1| phosphoribulokinase [Neosynechococcus sphagnicola]
 gb|KGF72589.1| phosphoribulokinase [Neosynechococcus sphagnicola sy1]
Length=333

 Score =   466 bits (1200),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 214/339 (63%), Positives = 266/339 (78%), Gaps = 18/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYH LD
Sbjct  7     RVVIIGVAGDSGCGKSTFLRRLADLFG-----------------EEFITVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+K LK G +V KPIYNH TG++DPPE  +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKTLKSGHSVLKPIYNHETGMIDPPEQIEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR+LLDFS+YLDIS+EVK AWKIQRDM+ERGH+ E + A+I AR+PDF 
Sbjct  110   VEGLHPLYDERVRKLLDFSVYLDISDEVKIAWKIQRDMSERGHTYEDVLAAINARRPDFK  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
             AYIDPQK++AD VI+VLPT+L+ DD +GK+LRVR+I ++GV+   P YLFDEGSTI W P
Sbjct  170   AYIDPQKEFADVVIQVLPTELLKDD-QGKILRVRMIQRDGVEGLEPAYLFDEGSTIYWTP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPGIK  YGPD+Y+GH VSVLE+DGQFD L+E+IY+ESHLS+ S K+ GE+T
Sbjct  229   CGRKLTCSYPGIKMYYGPDSYYGHSVSVLEVDGQFDNLEEVIYIESHLSNTSAKYQGELT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
               +L+H ++PGS NGTG FQ + GLK+R  YE++ A  A
Sbjct  289   HLLLQHREYPGSTNGTGLFQVLAGLKMRATYERLAAPEA  327



>ref|WP_035158114.1| phosphoribulokinase [Calothrix sp. 336/3]
 gb|KFB86119.1| phosphoribulokinase [Calothrix sp. 336/3]
Length=334

 Score =   466 bits (1198),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 210/345 (61%), Positives = 267/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EEFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+A++KPIYNH TG++DPPE+ +P  I+V
Sbjct  50    RVQRKETGITALDPRANNFDLMYEQIKALKEGQAINKPIYNHETGMIDPPEIVEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+Y DIS+EVK AWKIQRDMAERGH  E + A+I +RKPDF+
Sbjct  110   VEGLHPLYDERVRSLLDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAAINSRKPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI +D E KVLRVR++ +E  + F+P YLFDEGSTI W P
Sbjct  170   KYIEPQREHADVVLQVLPTNLIKEDKERKVLRVRMLQREDKEGFAPAYLFDEGSTIKWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS+ STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIENHLSNTSTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+R  YE++ +  A   VE 
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRTTYERLTSKEAKMAVEV  334



>ref|WP_016869826.1| phosphoribulokinase [Fischerella muscicola]
Length=334

 Score =   466 bits (1198),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 212/345 (61%), Positives = 266/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  ++ TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EELMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+++ KPIYNH TG +DPPEL +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGQSIMKPIYNHETGNIDPPELVEPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF 
Sbjct  110   IEGLHPLYDERVRSLIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI +D E KVLRVR++ +EG + F PVYLFDEGSTI W P
Sbjct  170   NYIEPQREFADVVLQVLPTNLIKEDKERKVLRVRMLQREGKEGFEPVYLFDEGSTIHWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKL+CSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS+ STK+ GE+T
Sbjct  230   CGRKLSCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSNTSTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+R  YE++ A  A   V+ 
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRATYERLTAKEAKMAVQV  334



>ref|WP_017312088.1| phosphoribulokinase [Fischerella sp. PCC 9339]
Length=334

 Score =   465 bits (1197),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 213/345 (62%), Positives = 264/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  ++ TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EELMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG++V KPIYNH TG +DPPE  +P  ILV
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGQSVMKPIYNHETGAIDPPEHIEPNHILV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR L+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF 
Sbjct  110   VEGLHPLYDERVRSLIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI +D E KVLRVR++ +EG + F PVYLFDEGSTI W P
Sbjct  170   KYIEPQREFADVVLQVLPTNLIKEDKERKVLRVRMLQREGKEGFEPVYLFDEGSTIQWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS  STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSKTSTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+R  YE++ A  A   V+ 
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRAAYERLTAKEAKMAVQV  334



>gb|KIJ82542.1| phosphoribulokinase [Scytonema tolypothrichoides VB-61278]
Length=333

 Score =   465 bits (1196),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 213/339 (63%), Positives = 263/339 (78%), Gaps = 17/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  ++ TVICLDDYH LD
Sbjct  6     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EELMTVICLDDYHCLD  48

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+A+DKPIYNH TG +DPPE  +P  I+V
Sbjct  49    RKQRKETGITALDPRANNFDLMYEQIKALKEGQAIDKPIYNHETGNIDPPERIEPNHIVV  108

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVREL+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF 
Sbjct  109   IEGLHPLYDERVRELIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFT  168

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI DD E KVLRVR++ +EG + F PVYLFDEGSTI W P
Sbjct  169   KYIEPQREFADVVLQVLPTNLIKDDKERKVLRVRMLQREGKEGFDPVYLFDEGSTIQWTP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS  STK+ GE+T
Sbjct  229   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSKTSTKYKGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
               +L+H ++PGSNNGTG FQ + GLK+R  YE++ +  A
Sbjct  289   HLLLQHREYPGSNNGTGLFQVLTGLKMRAAYERLTSKEA  327



>ref|WP_015129088.1| phosphoribulokinase [Calothrix sp. PCC 7507]
 ref|YP_007066111.1| phosphoribulokinase [Calothrix sp. PCC 7507]
 gb|AFY33277.1| phosphoribulokinase [Calothrix sp. PCC 7507]
Length=334

 Score =   465 bits (1196),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 210/345 (61%), Positives = 263/345 (76%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  D+ TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EDLMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALK G+ +DKPIYNH TGL+DPPE  +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKNGQGIDKPIYNHETGLIDPPERIEPNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR L+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF+
Sbjct  110   VEGLHPLYDERVRSLIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI +D E KVLRVR++ +E  + F P YLFD+GSTI+W P
Sbjct  170   KYIEPQREFADVVLQVLPTNLIKNDTERKVLRVRMLQQESKEGFEPAYLFDQGSTINWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E HLS  STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIEKHLSQTSTKYQGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+RD YE++    A   V+ 
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRDAYERLTTKEAKLAVQV  334



>ref|WP_016860626.1| phosphoribulokinase [Fischerella muscicola]
Length=334

 Score =   465 bits (1196),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 211/345 (61%), Positives = 265/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  ++ TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EELMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALK+G+++ KPIYNH TG +DPPEL +P  I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKDGQSIMKPIYNHETGAIDPPELIEPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR L+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF 
Sbjct  110   VEGLHPLYDERVRSLIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI +D E KVLRVR++ +EG + F PVYLFDEGSTI W P
Sbjct  170   KYIEPQREFADVVLQVLPTNLIKEDKERKVLRVRMLQREGKEGFEPVYLFDEGSTIQWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS  STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSKTSTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+R  YE++ A  A   V+ 
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRAAYERLTAKEAKMAVQV  334



>ref|WP_036477080.1| phosphoribulokinase [Myxosarcina sp. GI1]
Length=335

 Score =   464 bits (1195),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 212/340 (62%), Positives = 271/340 (80%), Gaps = 19/340 (6%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRLT +FG                  +  TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R GRK+  VTAL+P+AN+FDLMYEQ+KA+KEGKA+DKPIYNH TG LDPPE  +P K++V
Sbjct  50    REGRKKAKVTALNPKANNFDLMYEQIKAIKEGKAIDKPIYNHETGELDPPERVEPNKVVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DF +YLDIS+EVK  WK+QRDM+ERGH+ E + ASI++R+PDF 
Sbjct  110   IEGLHPLYDERVRSLVDFGVYLDISDEVKVQWKVQRDMSERGHTYEDVMASIKSREPDFK  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDD--NEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISW  1100
             AYI+PQ++YAD VI+V PT+L+  +   E  +++VRLI KEGV+ F PVYLFDEGSTI W
Sbjct  170   AYIEPQREYADVVIQVWPTELLDPEAAKESDLIKVRLIQKEGVETFEPVYLFDEGSTIDW  229

Query  1101  IPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGE  1280
              PCGRKLTC+YPGIK  YGPD+++GHEVS+LE+DGQFD L+E+IY+ESHLS   T  YGE
Sbjct  230   RPCGRKLTCAYPGIKMYYGPDSFYGHEVSILEVDGQFDNLEEMIYIESHLSKTGTDHYGE  289

Query  1281  VTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATR  1400
             +T+ +LKH ++PGS NGTG FQ +VGLK+R+ YE+++A +
Sbjct  290   MTELILKHKEYPGSKNGTGLFQVLVGLKMRETYEKLMAKQ  329



>ref|WP_041040515.1| phosphoribulokinase [Tolypothrix campylonemoides]
 gb|KIJ73637.1| phosphoribulokinase [Tolypothrix campylonemoides VB511288]
Length=333

 Score =   464 bits (1194),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 211/339 (62%), Positives = 264/339 (78%), Gaps = 17/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  ++ TVICLDDYHSLD
Sbjct  6     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EELMTVICLDDYHSLD  48

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALK G+A+DKPIYNH TG +DPPE  +P  I+V
Sbjct  49    RKQRKETGITALDPRANNFDLMYEQIKALKNGQAIDKPIYNHETGNIDPPERIEPNHIVV  108

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVREL+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF 
Sbjct  109   VEGLHPLYDERVRELIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFT  168

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI DD + KVLRVR++ +EG + F PVYLFDEGSTI+W P
Sbjct  169   KYIEPQREFADVVLQVLPTNLIKDDKDRKVLRVRMLQREGKEGFDPVYLFDEGSTINWTP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS  STK+ GE+T
Sbjct  229   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSKTSTKYKGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
               +L+H ++PGSNNGTG FQ + GLK+R  YE++ +  A
Sbjct  289   HLLLQHREYPGSNNGTGLFQVLTGLKMRAAYERLTSKEA  327



>ref|WP_029635046.1| phosphoribulokinase [[Scytonema hofmanni] UTEX B 1581]
Length=335

 Score =   464 bits (1194),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 213/339 (63%), Positives = 261/339 (77%), Gaps = 17/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  ++ TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EELMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEGK++DKPIYNH TGLLDPPE  +P  ILV
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGKSIDKPIYNHETGLLDPPERIEPNHILV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF+
Sbjct  110   IEGLHPLYDERVRSLIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              +I+PQ+++AD V++VLPT LI  D E KVLRVR++ +E  + F P YLFDEGSTI W P
Sbjct  170   KFIEPQREFADIVLQVLPTNLIKGDKERKVLRVRMLQREDKQGFEPTYLFDEGSTIQWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS  STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSKTSTKYEGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
               +L+H ++PGSNNGTG FQ + GLK+R  YEQ+ A  A
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRAAYEQLTAKEA  328



>ref|WP_015080196.1| phosphoribulokinase [Anabaena sp. 90]
 ref|YP_006996852.1| phosphoribulokinase [Anabaena sp. 90]
 gb|AFW95039.1| phosphoribulokinase [Anabaena sp. 90]
Length=333

 Score =   464 bits (1194),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 211/345 (61%), Positives = 263/345 (76%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYHSLD
Sbjct  6     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EEFMTVICLDDYHSLD  48

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+ + KPIYNH TG++DPPE  +P  I+V
Sbjct  49    RKQRKETGITALDPRANNFDLMYEQIKALKEGQKIHKPIYNHETGMIDPPEWIEPNHIIV  108

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF+
Sbjct  109   VEGLHPLYDERVRALLDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFE  168

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              +I+PQ+++AD V++VLPT LI +D E KVLRVR++ +E  + F P YLFDEGSTI W P
Sbjct  169   KFIEPQREFADVVLQVLPTNLIKNDTERKVLRVRMLQREDKEGFEPSYLFDEGSTIQWTP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD LDE+IY+E+HLS  STK+ GE+T
Sbjct  229   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLDEIIYIETHLSKTSTKYQGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+RD YE++ A  A   V+ 
Sbjct  289   HLLLQHREYPGSNNGTGLFQVLTGLKMRDAYERLTAKEAKLAVQV  333



>ref|WP_017322257.1| phosphoribulokinase [cyanobacterium PCC 7702]
Length=334

 Score =   464 bits (1194),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 212/342 (62%), Positives = 263/342 (77%), Gaps = 17/342 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  ++ TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLKDLFG-----------------EELMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  R+E G+TALDPRAN+FDLMYEQ+KALKEG+++ KPIYNH TG +DPPEL +P  I+V
Sbjct  50    RKQRRETGITALDPRANNFDLMYEQIKALKEGQSIMKPIYNHETGTIDPPELVEPNHIVV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             IEGLHP+YD RVR L+DFS+Y DIS+EVK AWKIQRDM ERGH  E + A I +RKPDF 
Sbjct  110   IEGLHPLYDERVRALVDFSVYFDISDEVKIAWKIQRDMTERGHRYEDVLAQINSRKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI DD E KVLRVR++ +EG + F PVYLFDEGSTI W P
Sbjct  170   KYIEPQREFADIVLQVLPTNLIKDDKERKVLRVRMLQREGKEGFEPVYLFDEGSTIYWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTC YPGI+F YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS+ STK+ GE+T
Sbjct  230   CGRKLTCPYPGIQFYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSNTSTKYKGELT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAP  1412
               +L+H D+PGSNNGTG FQ + GLK+R +YE ++A     P
Sbjct  290   HLLLQHRDYPGSNNGTGLFQVLTGLKMRAIYEHLIAKEGKIP  331



>ref|WP_028083118.1| phosphoribulokinase [Dolichospermum circinale]
Length=334

 Score =   464 bits (1193),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 210/345 (61%), Positives = 264/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EEFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RK+ G+TALDPRAN+FDLMYEQ+KALKEG+ ++KPIYNH TG +DPPE+ KP  ++V
Sbjct  50    RKQRKQTGITALDPRANNFDLMYEQIKALKEGQTINKPIYNHETGNIDPPEIVKPNHVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVRELLDFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF+
Sbjct  110   VEGLHPLYDERVRELLDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              +I+PQ+++AD V++VLPT LI +D E KVLRVR++ +EG + F P YLFDEGSTI W P
Sbjct  170   KFIEPQREFADVVLQVLPTNLIKNDTERKVLRVRMLQREGKEGFEPTYLFDEGSTIQWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD LDE+IY+E+HLS  STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGFDVYYGRYVSVLEVDGQFDNLDEVIYIETHLSKTSTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +++H ++PGSNNGTG FQ + GLK+R  YE++ A  A   VE 
Sbjct  290   HLLVQHREYPGSNNGTGLFQVLTGLKMRATYERLTAKEAKLAVEV  334



>ref|WP_015214457.1| phosphoribulokinase [Anabaena cylindrica]
 ref|YP_007156731.1| phosphoribulokinase [Anabaena cylindrica PCC 7122]
 gb|AFZ57821.1| phosphoribulokinase [Anabaena cylindrica PCC 7122]
Length=333

 Score =   464 bits (1193),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 211/345 (61%), Positives = 264/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  D+ TVICLDDYH LD
Sbjct  6     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EDLMTVICLDDYHCLD  48

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+A+DKPIYNH TGLLDP E  +P  I+V
Sbjct  49    RKQRKETGITALDPRANNFDLMYEQIKALKEGQAIDKPIYNHETGLLDPAERIEPNHIIV  108

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR L+DFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF+
Sbjct  109   VEGLHPLYDERVRALIDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFE  168

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              +I+PQ+++AD V++VLPT LI +D E KVLRVR++ +EG + F P YLFDEGSTI W P
Sbjct  169   KFIEPQREFADVVLQVLPTNLIKNDTERKVLRVRMLQREGKEGFEPTYLFDEGSTIQWTP  228

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD L+E+IY+E+HLS+ ST + GE+T
Sbjct  229   CGRKLTCSYPGMQLYYGSDVYYGRYVSVLEVDGQFDNLEEVIYIETHLSNTSTTYQGEMT  288

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +L+H ++PGSNNGTG FQ + GLK+R  YE++ A  A   V+ 
Sbjct  289   HLLLQHREYPGSNNGTGLFQVLTGLKMRAAYERLTAKEAKLAVQV  333



>ref|WP_027838886.1| phosphoribulokinase [Mastigocoleus testarum]
Length=334

 Score =   464 bits (1193),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 212/339 (63%), Positives = 264/339 (78%), Gaps = 17/339 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  ++ TVICLDDYHSLD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EELMTVICLDDYHSLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RKE G+TALDPRAN+FDLMYEQ+KALKEG+ +DKPIYNH TG +DPPE  +   I+V
Sbjct  50    RKQRKETGITALDPRANNFDLMYEQIKALKEGQPIDKPIYNHETGEIDPPERVEQNHIIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVR LLDFS+YLDIS+EVK AWKIQRDMAERGH  E + A+I +RKPDF 
Sbjct  110   VEGLHPLYDERVRSLLDFSVYLDISDEVKIAWKIQRDMAERGHRYEDVLAAINSRKPDFQ  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              YI+PQ+++AD V++VLPT LI DD E KVLRVR++ +E  + F PVYLFDEGSTI+W P
Sbjct  170   KYIEPQREFADVVLQVLPTNLIKDDKERKVLRVRMLQREDREGFEPVYLFDEGSTINWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD LDE+IY+E+HLS+ STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQVYYGSDVYYGRYVSVLEIDGQFDNLDEVIYIETHLSNTSTKYEGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRA  1403
               +L+H ++PGSNNGTG FQ + GLK+R  YE++ +  A
Sbjct  290   HLLLQHREYPGSNNGTGLFQVLTGLKMRAAYEKLTSQEA  328



>gb|AFK48786.1| unknown [Medicago truncatula]
Length=295

 Score =   462 bits (1188),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 216/240 (90%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = +3

Query  702   LLDPPELTKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSL  881
              LDPPEL KPPKILVIEGLHP+YD+RVR+LLDFS+YLDISNEVKFAWKIQRDMAERGHSL
Sbjct  53    FLDPPELIKPPKILVIEGLHPLYDSRVRDLLDFSVYLDISNEVKFAWKIQRDMAERGHSL  112

Query  882   ESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFS  1061
             ESIKASIEARKPDF+AYIDPQKQYADAVIEVLPTQLIPDDNEGK+LRVRLI KEGVK+FS
Sbjct  113   ESIKASIEARKPDFEAYIDPQKQYADAVIEVLPTQLIPDDNEGKILRVRLIQKEGVKYFS  172

Query  1062  PVYLFDEGSTISWIPCGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVE  1241
             PVYLFD+GSTISWIPCGRKLTCSYPGIKF+YGP+TY G+EVSV+EMDGQFDRLDELIYVE
Sbjct  173   PVYLFDDGSTISWIPCGRKLTCSYPGIKFSYGPETYKGNEVSVVEMDGQFDRLDELIYVE  232

Query  1242  SHLSSLSTKFYGEVTQQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
             SHLS+LS+KFYGEVTQQMLKHADFPGSNNGTG FQTIVGLKIRDL+EQIVA+RA  PV A
Sbjct  233   SHLSNLSSKFYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLFEQIVASRAETPVGA  292



>ref|WP_028089692.1| phosphoribulokinase [Dolichospermum circinale]
Length=334

 Score =   463 bits (1191),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 210/345 (61%), Positives = 264/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  387   KTVVIGLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDMTTVICLDDYHSLD  566
             + V+IG+A DSGCGKSTF+RRL  +FG                  +  TVICLDDYH LD
Sbjct  7     RVVLIGVAGDSGCGKSTFLRRLIDLFG-----------------EEFMTVICLDDYHCLD  49

Query  567   RTGRKEKGVTALDPRANDFDLMYEQVKALKEGKAVDKPIYNHVTGLLDPPELTKPPKILV  746
             R  RK+ G+TALDPRAN+FDLMYEQ+KALKEG+ ++KPIYNH TG +DPPE+ KP  ++V
Sbjct  50    RKQRKQTGITALDPRANNFDLMYEQIKALKEGQTINKPIYNHETGNIDPPEIVKPNHVIV  109

Query  747   IEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFD  926
             +EGLHP+YD RVRELLDFS+Y DIS+EVK AWKIQRDMAERGH  E + A I +RKPDF+
Sbjct  110   VEGLHPLYDERVRELLDFSVYFDISDEVKIAWKIQRDMAERGHRYEDVLAQINSRKPDFE  169

Query  927   AYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKHFSPVYLFDEGSTISWIP  1106
              +I+PQ+++AD V++VLPT LI +D E KVLRVR++ +EG + F P YLFDEGSTI W P
Sbjct  170   KFIEPQREFADVVLQVLPTNLIKNDTERKVLRVRMLQREGKEGFEPSYLFDEGSTIQWTP  229

Query  1107  CGRKLTCSYPGIKFTYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSSLSTKFYGEVT  1286
             CGRKLTCSYPG++  YG D Y+G  VSVLE+DGQFD LDE+IY+E+HLS  STK+ GE+T
Sbjct  230   CGRKLTCSYPGMQLYYGFDVYYGRYVSVLEVDGQFDNLDEVIYIETHLSKTSTKYQGEMT  289

Query  1287  QQMLKHADFPGSNNGTGFFQTIVGLKIRDLYEQIVATRAAAPVEA  1421
               +++H ++PGSNNGTG FQ + GLK+R  YE++ A  A   VE 
Sbjct  290   HLLVQHREYPGSNNGTGLFQVLTGLKMRATYERLTAKEAKLAVEV  334



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5036537040986