BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84206_g1_i1 len=463 path=[441:0-462]

Length=463
                                                                      Score     E

ref|XP_010683915.1|  PREDICTED: zinc finger MYM-type protein 1-like   62.8    1e-08   
ref|XP_010678581.1|  PREDICTED: zinc finger MYM-type protein 5-like   60.1    6e-08   
gb|EEC74074.1|  hypothetical protein OsI_09091                        60.1    1e-07   Oryza sativa Indica Group [Indian rice]
gb|EAY87545.1|  hypothetical protein OsI_08956                        58.5    4e-07   Oryza sativa Indica Group [Indian rice]
gb|ACX94087.1|  hAT family dimerization domain protein                58.5    4e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002446207.1|  hypothetical protein SORBIDRAFT_06g004070        57.4    9e-07   Sorghum bicolor [broomcorn]
ref|XP_010666024.1|  PREDICTED: zinc finger MYM-type protein 5-like   55.1    1e-06   
ref|XP_010682239.1|  PREDICTED: zinc finger MYM-type protein 5-like   55.5    2e-06   
ref|XP_008386065.1|  PREDICTED: zinc finger MYM-type protein 1-like   56.2    3e-06   
ref|XP_007225730.1|  hypothetical protein PRUPE_ppa003631mg           54.7    6e-06   
ref|XP_008343861.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  53.5    2e-05   
ref|XP_008227611.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  53.1    2e-05   
ref|XP_008342754.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  53.1    2e-05   
gb|EEC68490.1|  hypothetical protein OsI_36747                        52.8    3e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_002466981.1|  hypothetical protein SORBIDRAFT_01g017870        51.6    3e-05   Sorghum bicolor [broomcorn]
gb|EEE52405.1|  hypothetical protein OsJ_34512                        51.2    6e-05   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA56791.1|  TPA: hypothetical protein ZEAMMB73_441202            51.2    9e-05   
ref|NP_001068311.1|  Os11g0628800                                     50.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010695395.1|  PREDICTED: zinc finger MYM-type protein 1-like   50.8    1e-04   
ref|XP_010681190.1|  PREDICTED: zinc finger MYM-type protein 1-like   50.8    1e-04   
ref|XP_010681192.1|  PREDICTED: uncharacterized protein LOC104896172  50.8    1e-04   
gb|AFW81139.1|  hypothetical protein ZEAMMB73_832266                  50.4    2e-04   
gb|KEH41611.1|  hypothetical protein MTR_1g052795                     46.2    4e-04   
ref|XP_010682004.1|  PREDICTED: zinc finger MYM-type protein 1-like   48.9    6e-04   
ref|XP_010666463.1|  PREDICTED: chloride channel protein F-like       47.4    6e-04   



>ref|XP_010683915.1| PREDICTED: zinc finger MYM-type protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=555

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  278  RKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQKDDVKE  415
            RKY SG+EKRKK +R+EQL QSQKGAL++F+ K+ Q++E  D+ KE
Sbjct  3    RKYQSGYEKRKKAKRVEQLIQSQKGALDRFILKEPQVEENSDNSKE  48



>ref|XP_010678581.1| PREDICTED: zinc finger MYM-type protein 5-like [Beta vulgaris 
subsp. vulgaris]
Length=338

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  278  RKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQKDDVKEKLLDVNLDIED  448
            RKYSSG EKRKKK R+EQ  QSQKGAL++F +K  Q+ E+  + + + +++N++ E+
Sbjct  3    RKYSSGHEKRKKKERVEQFIQSQKGALDRFFSKGPQVGERSSNSECENVEINVECEN  59



>gb|EEC74074.1| hypothetical protein OsI_09091 [Oryza sativa Indica Group]
Length=458

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = +2

Query  266  FMSSR--KYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQKDDVKEKLLDVNLD  439
             MSSR  KY SG EKRKK++R+E + QSQKGAL+KF  ++T     +DD+ + + +V+ +
Sbjct  283  IMSSRNRKYDSGAEKRKKRKRLEAVAQSQKGALDKFFLRETPNANIEDDISDDMAEVDAN  342

Query  440  IEDQDDC  460
            I + DD 
Sbjct  343  IAESDDA  349



>gb|EAY87545.1| hypothetical protein OsI_08956 [Oryza sativa Indica Group]
Length=844

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +2

Query  269  MSSR--KYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQKDDVKEKLLDVNLDI  442
            MSSR  KY SG EKRKK++R+E + QSQKGAL+KF  ++T     +DD+ + + +V+ +I
Sbjct  1    MSSRNRKYDSGAEKRKKRKRLEAVAQSQKGALDKFFLRETPNANIEDDISDDMAEVDANI  60

Query  443  EDQDDC  460
             + DD 
Sbjct  61   AESDDA  66



>gb|ACX94087.1| hAT family dimerization domain protein [Oryza sativa Japonica 
Group]
Length=844

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +2

Query  269  MSSR--KYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQKDDVKEKLLDVNLDI  442
            MSSR  KY SG EKRKK++R+E + QSQKGAL+KF  ++T     +DD+ + + +V+ +I
Sbjct  1    MSSRNRKYDSGAEKRKKRKRLEAVAQSQKGALDKFFLRETPNANIEDDISDDMAEVDANI  60

Query  443  EDQDDC  460
             + DD 
Sbjct  61   AESDDA  66



>ref|XP_002446207.1| hypothetical protein SORBIDRAFT_06g004070 [Sorghum bicolor]
 gb|EES10535.1| hypothetical protein SORBIDRAFT_06g004070 [Sorghum bicolor]
Length=664

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +2

Query  275  SRKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQKDDVKE-KLLDVNLDIEDQ  451
            SRK+ SG++KRKKK+RIE+L QSQ+GA++KFVTK++Q+      + + + +D N+D    
Sbjct  7    SRKFESGWQKRKKKQRIEELVQSQEGAMDKFVTKRSQVSSDNPTLDQGQAIDNNVDNNPI  66

Query  452  DDCE  463
            D  E
Sbjct  67   DPPE  70



>ref|XP_010666024.1| PREDICTED: zinc finger MYM-type protein 5-like [Beta vulgaris 
subsp. vulgaris]
Length=231

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 48/68 (71%), Gaps = 8/68 (12%)
 Frame = +2

Query  275  SRKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQI--DEQ-----KDDVKEK-LLDV  430
            +RKY  G+EKRKKK+R+E+LTQSQ+GA +KF+ K+  I  D Q      D++ E  + + 
Sbjct  5    TRKYEYGYEKRKKKQRLEELTQSQRGAFDKFIIKEPHIHVDNQNIEKVNDEILENEVTNE  64

Query  431  NLDIEDQD  454
            N+D+E+Q+
Sbjct  65   NVDMENQN  72



>ref|XP_010682239.1| PREDICTED: zinc finger MYM-type protein 5-like [Beta vulgaris 
subsp. vulgaris]
Length=272

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 4/59 (7%)
 Frame = +2

Query  275  SRKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQI----DEQKDDVKEKLLDVNLD  439
            +RKY SGFE  KKK+RIE+L +SQ+GAL KFV K   +    + Q  +V     DVNL+
Sbjct  5    TRKYDSGFETHKKKKRIEKLNRSQRGALVKFVVKDVHVHVFHESQNSNVNVDCNDVNLN  63



>ref|XP_008386065.1| PREDICTED: zinc finger MYM-type protein 1-like [Malus domestica]
Length=1217

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 8/64 (13%)
 Frame = +2

Query  239  RLSEIAT*DFMSSRKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQ--------IDE  394
            R + IA      +RKY SG+ KR++KR+IEQLTQSQKGA+++F  K+ +        I E
Sbjct  377  RRTRIANYQMAPTRKYPSGYXKRQRKRKIEQLTQSQKGAIDRFFLKEKEPQSSVDXLIXE  436

Query  395  QKDD  406
            Q+DD
Sbjct  437  QQDD  440



>ref|XP_007225730.1| hypothetical protein PRUPE_ppa003631mg [Prunus persica]
 gb|EMJ26929.1| hypothetical protein PRUPE_ppa003631mg [Prunus persica]
Length=560

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  MSSRKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQKDDV  409
            M  RK+SSG+ KR++ RR+E+LTQSQ+GAL+KF+ K+ Q  + +D++
Sbjct  1    MFKRKHSSGYRKRQQNRRVEELTQSQRGALDKFIIKEPQDSKSRDEL  47



>ref|XP_008343861.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger MYM-type protein 
1-like [Malus domestica]
Length=833

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 38/53 (72%), Gaps = 8/53 (15%)
 Frame = +2

Query  272  SSRKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQ--------IDEQKDD  406
             +RKY SG+ KR++KR+IEQLTQSQKGA+++F  K+ +        I EQ+DD
Sbjct  3    PTRKYPSGYXKRQRKRKIEQLTQSQKGAIDRFFLKEKEPQSXVDXLIXEQQDD  55



>ref|XP_008227611.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger MYM-type protein 
1-like [Prunus mume]
Length=801

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 8/56 (14%)
 Frame = +2

Query  272  SSRKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQ--IDE------QKDDVKE  415
             +RKY SG+ KR +KR+IE+LTQSQ+GAL++F+ +++   IDE      ++DDV+E
Sbjct  3    PTRKYVSGYTKRLRKRKIEELTQSQRGALDRFIVRESHATIDENIFNEQEQDDVEE  58



>ref|XP_008342754.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger MYM-type protein 
1-like [Malus domestica]
Length=833

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 38/53 (72%), Gaps = 8/53 (15%)
 Frame = +2

Query  272  SSRKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQ--------IDEQKDD  406
             +RKY SG+ KR++KR+IEQLTQSQKGA+++F  K+ +        I EQ+DD
Sbjct  3    PTRKYPSGYXKRQRKRKIEQLTQSQKGAIDRFFLKEKEPQSXVDXLIXEQQDD  55



>gb|EEC68490.1| hypothetical protein OsI_36747 [Oryza sativa Indica Group]
Length=658

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 47/68 (69%), Gaps = 5/68 (7%)
 Frame = +2

Query  269  MSS----RKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQKDDV-KEKLLDVN  433
            MSS    RK+ SG +KRKKK+RIE+LTQSQKGA+++F+ K++Q+      + +   LD +
Sbjct  98   MSSTNRFRKFESGSQKRKKKQRIEELTQSQKGAIDRFIIKESQVSSSNQTLDQAPALDRS  157

Query  434  LDIEDQDD  457
            ++   +DD
Sbjct  158  IENNPRDD  165



>ref|XP_002466981.1| hypothetical protein SORBIDRAFT_01g017870 [Sorghum bicolor]
 gb|EER93979.1| hypothetical protein SORBIDRAFT_01g017870 [Sorghum bicolor]
Length=265

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  278  RKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQ  397
            RKY SG EKRKKKRR+E   QSQKGAL++FV K+++   +
Sbjct  3    RKYESGHEKRKKKRRLEAAAQSQKGALDRFVVKESRFSPE  42



>gb|EEE52405.1| hypothetical protein OsJ_34512 [Oryza sativa Japonica Group]
Length=393

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 46/68 (68%), Gaps = 5/68 (7%)
 Frame = +2

Query  269  MSS----RKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQKDDV-KEKLLDVN  433
            MSS    R + SG +KRKKK+RIE+LTQSQKGA+++F+ K++Q+      + +   LD +
Sbjct  1    MSSTNRFRNFESGSQKRKKKQRIEELTQSQKGAIDRFIIKESQVSSSNQTLDQAPALDRS  60

Query  434  LDIEDQDD  457
            ++   +DD
Sbjct  61   IENNPRDD  68



>tpg|DAA56791.1| TPA: hypothetical protein ZEAMMB73_441202 [Zea mays]
Length=842

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = +2

Query  278  RKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQKDDVKEKLLDVNLDIED  448
            RK+ SG++KRKKK+RIE+LTQS KG++++FV K++Q+      +++   D  +DI++
Sbjct  9    RKHDSGYQKRKKKQRIEKLTQSMKGSMDRFVQKESQVSSANQTLEQ---DPTIDIDN  62



>ref|NP_001068311.1| Os11g0628800 [Oryza sativa Japonica Group]
 gb|ABA94938.1| hAT family dimerisation domain containing protein [Oryza sativa 
Japonica Group]
 dbj|BAF28674.1| Os11g0628800 [Oryza sativa Japonica Group]
Length=613

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 36/44 (82%), Gaps = 4/44 (9%)
 Frame = +2

Query  269  MSS----RKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQI  388
            MSS    R + SG +KRKKK+RIE+LTQSQKGA+++F+ K++Q+
Sbjct  1    MSSTNRFRNFESGSQKRKKKQRIEELTQSQKGAIDRFIIKESQV  44



>ref|XP_010695395.1| PREDICTED: zinc finger MYM-type protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=947

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +2

Query  278  RKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQKDDVKEKLLDVNLDIEDQDD  457
            RKY SG+EKR KK+++E L +SQ+GAL+KF+ K++Q+  +  +      D N+ I + +D
Sbjct  168  RKYQSGYEKRTKKKKVELLIESQRGALDKFLKKESQVPTENQNY-----DDNVVINENND  222

Query  458  CE  463
             E
Sbjct  223  VE  224



>ref|XP_010681190.1| PREDICTED: zinc finger MYM-type protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=794

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +2

Query  278  RKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQKDDVKEKLLDVNLDIEDQDD  457
            RKY SG+EKR KK+++E L +SQ+GAL+KF+ K++Q+  +  +      D N+ I + +D
Sbjct  6    RKYQSGYEKRTKKKKVELLIESQRGALDKFLKKESQVPTENQNY-----DDNVVINENND  60

Query  458  CE  463
             E
Sbjct  61   VE  62



>ref|XP_010681192.1| PREDICTED: uncharacterized protein LOC104896172 [Beta vulgaris 
subsp. vulgaris]
Length=1242

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +2

Query  278  RKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQKDDVKEKLLDVNLDIEDQDD  457
            RKY SG+EKR KK+++E L +SQ+GAL+KF+ K++Q+  +  +      D N+ I + +D
Sbjct  100  RKYQSGYEKRTKKKKVELLIESQRGALDKFLKKESQVPTENQNY-----DDNVVINENND  154

Query  458  CE  463
             E
Sbjct  155  VE  156



>gb|AFW81139.1| hypothetical protein ZEAMMB73_832266 [Zea mays]
Length=656

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 4/79 (5%)
 Frame = +2

Query  233  RQRLSEIAT*DFMSSRKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQI--DEQKDD  406
            R R   +     +S  K+SS ++KRKKK+RIE+L QSQ+GA++ FVTK++Q+  D    D
Sbjct  135  RARAHVVLAKCHLSDLKFSS-WQKRKKKQRIEKLVQSQQGAMDMFVTKQSQVSSDNPTPD  193

Query  407  VKEKLLDVNLDIEDQDDCE  463
              +  +D N+DI+  D  E
Sbjct  194  QGQS-IDNNIDIDRIDPIE  211



>gb|KEH41611.1| hypothetical protein MTR_1g052795 [Medicago truncatula]
Length=85

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  278  RKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQID  391
            RK+ SG EKR+KK++I +L +SQ GAL+KF+ K+ QI 
Sbjct  15   RKFESGAEKRRKKKKIAELIESQTGALDKFILKEIQIP  52



>ref|XP_010682004.1| PREDICTED: zinc finger MYM-type protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=838

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  269  MSSRKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQ  385
            M  RK++SGFEKRKK++R ++L +SQKGA++KF +++ +
Sbjct  1    MLPRKHASGFEKRKKRQRAQELLESQKGAIDKFFSRRVE  39



>ref|XP_010666463.1| PREDICTED: chloride channel protein F-like [Beta vulgaris subsp. 
vulgaris]
Length=186

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  278  RKYSSGFEKRKKKRRIEQLTQSQKGALEKFVTKKTQIDEQ  397
            RKY  G+EKRKKK+RIE+LTQSQ+GAL+KFV K++ I  Q
Sbjct  6    RKYDCGYEKRKKKKRIEELTQSQRGALDKFVVKESHIGTQ  45



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516943081458