BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84191_g1_i1 len=1677 path=[1:0-1676]

Length=1677
                                                                      Score     E

ref|XP_011096364.1|  PREDICTED: serine/threonine-protein kinase-l...    419   2e-139   
emb|CDO99487.1|  unnamed protein product                                404   2e-133   
ref|XP_010111171.1|  Serine/threonine-protein kinase-like protein       385   3e-126   
ref|XP_007025531.1|  Serine/threonine-protein kinase-like protein...    385   4e-126   
ref|XP_002509422.1|  ATP binding protein, putative                      383   2e-125   Ricinus communis
ref|XP_009609107.1|  PREDICTED: proline-rich receptor-like protei...    384   2e-125   
gb|KDO77711.1|  hypothetical protein CISIN_1g020027mg                   382   6e-125   
ref|XP_010655460.1|  PREDICTED: serine/threonine-protein kinase-l...    382   6e-125   
ref|XP_006449415.1|  hypothetical protein CICLE_v10015883mg             382   7e-125   
ref|XP_007148114.1|  hypothetical protein PHAVU_006G181600g             379   1e-123   
ref|XP_009800291.1|  PREDICTED: proline-rich receptor-like protei...    377   5e-123   
ref|XP_010057359.1|  PREDICTED: putative receptor protein kinase ...    374   6e-122   
ref|XP_003529351.1|  PREDICTED: serine/threonine-protein kinase-l...    374   8e-122   
ref|XP_003542719.1|  PREDICTED: serine/threonine-protein kinase-l...    373   2e-121   
ref|XP_004293894.1|  PREDICTED: serine/threonine-protein kinase-l...    372   4e-121   
ref|XP_008225156.1|  PREDICTED: serine/threonine-protein kinase-l...    369   1e-119   
gb|KDP21015.1|  hypothetical protein JCGZ_21486                         367   4e-119   
gb|KHN09962.1|  Serine/threonine-protein kinase-like protein ACR4       365   4e-119   
ref|XP_003543022.1|  PREDICTED: serine/threonine-protein kinase-l...    367   6e-119   
gb|KHN18943.1|  Serine/threonine-protein kinase-like protein ACR4       366   2e-118   
emb|CAN77470.1|  hypothetical protein VITISV_029763                     380   4e-118   Vitis vinifera
ref|XP_010245579.1|  PREDICTED: serine/threonine-protein kinase-l...    362   3e-117   
ref|XP_006377418.1|  kinase family protein                              361   1e-116   
ref|XP_004485842.1|  PREDICTED: serine/threonine-protein kinase-l...    359   6e-116   
ref|XP_007159372.1|  hypothetical protein PHAVU_002G232700g             357   3e-115   
ref|XP_009352846.1|  PREDICTED: serine/threonine-protein kinase-l...    355   3e-114   
ref|XP_006468213.1|  PREDICTED: receptor-like protein kinase HSL1...    380   5e-114   
ref|XP_006361040.1|  PREDICTED: serine/threonine-protein kinase-l...    354   7e-114   
ref|XP_011001222.1|  PREDICTED: serine/threonine-protein kinase-l...    353   1e-113   
ref|XP_004248119.1|  PREDICTED: serine/threonine-protein kinase-l...    352   4e-113   
ref|XP_008383682.1|  PREDICTED: serine/threonine-protein kinase-l...    350   1e-112   
ref|XP_011027769.1|  PREDICTED: serine/threonine-protein kinase-l...    349   5e-112   
ref|XP_002305775.2|  kinase family protein                              348   1e-111   Populus trichocarpa [western balsam poplar]
ref|XP_004168541.1|  PREDICTED: phytosulfokine receptor 1-like          347   6e-111   
ref|XP_004134945.1|  PREDICTED: phytosulfokine receptor 1-like          345   2e-110   
ref|XP_003593653.1|  Receptor-like protein kinase BRI1-like protein     345   2e-110   
ref|XP_010686482.1|  PREDICTED: proline-rich receptor-like protei...    342   4e-109   
ref|XP_008439805.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    342   7e-109   
ref|XP_010260528.1|  PREDICTED: serine/threonine-protein kinase-l...    342   7e-109   
ref|XP_007213126.1|  hypothetical protein PRUPE_ppa024055mg             337   2e-107   
ref|XP_010518776.1|  PREDICTED: serine/threonine-protein kinase-l...    310   7e-97    
ref|XP_008798337.1|  PREDICTED: putative receptor protein kinase ...    305   7e-95    
emb|CBI30616.3|  unnamed protein product                                300   1e-93    
ref|XP_010924407.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...    296   1e-91    
ref|XP_002863430.1|  kinase family protein                              294   8e-91    
ref|XP_006280800.1|  hypothetical protein CARUB_v10026769mg             293   1e-90    
ref|XP_010494773.1|  PREDICTED: serine/threonine-protein kinase-l...    292   5e-90    
ref|XP_006398289.1|  hypothetical protein EUTSA_v10000955mg             290   5e-89    
ref|NP_199420.1|  protein kinase family protein                         289   5e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481501.1|  PREDICTED: serine/threonine-protein kinase-l...    289   7e-89    
ref|XP_010441630.1|  PREDICTED: serine/threonine-protein kinase-l...    288   1e-88    
emb|CDY03245.1|  BnaC09g19110D                                          283   8e-87    
ref|XP_009101550.1|  PREDICTED: serine/threonine-protein kinase-l...    278   2e-84    
emb|CDX77628.1|  BnaC07g18820D                                          278   2e-84    
ref|XP_009114378.1|  PREDICTED: serine/threonine-protein kinase-l...    276   6e-84    
emb|CDY58061.1|  BnaA06g40290D                                          276   8e-84    
emb|CDY69005.1|  BnaAnng29100D                                          275   1e-83    
ref|XP_009394203.1|  PREDICTED: serine/threonine-protein kinase-l...    271   6e-82    
gb|KHN08485.1|  Serine/threonine-protein kinase-like protein ACR4       222   4e-65    
gb|AAO42178.1|  putative serine/threonine protein kinase                199   2e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006852578.1|  hypothetical protein AMTR_s00021p00210750          201   3e-55    
gb|EYU28017.1|  hypothetical protein MIMGU_mgv1a025119mg                172   1e-46    
ref|XP_009413674.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    160   2e-40    
ref|NP_001141596.2|  uncharacterized LOC100273713                       160   7e-40    Zea mays [maize]
ref|NP_001136610.1|  LOC100216733                                       160   1e-39    Zea mays [maize]
ref|XP_002882968.1|  hypothetical protein ARALYDRAFT_479045             157   2e-39    
ref|XP_004303295.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    157   4e-39    
ref|XP_009607288.1|  PREDICTED: serine/threonine-protein kinase-l...    161   1e-38    
gb|EYU24637.1|  hypothetical protein MIMGU_mgv1a009016mg                155   2e-38    
ref|XP_010487434.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    154   2e-38    
emb|CDO98162.1|  unnamed protein product                                155   2e-38    
ref|XP_010487433.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    154   3e-38    
gb|ACU18280.1|  unknown                                                 153   3e-38    Glycine max [soybeans]
ref|XP_007215581.1|  hypothetical protein PRUPE_ppa007548mg             154   4e-38    
ref|XP_004486660.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    154   4e-38    
ref|XP_008387599.1|  PREDICTED: serine/threonine-protein kinase-l...    159   4e-38    
gb|EPS59499.1|  hypothetical protein M569_15303                         153   5e-38    
ref|NP_191501.1|  serine/threonine-protein kinase-like protein ACR4     159   6e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002456468.1|  hypothetical protein SORBIDRAFT_03g036860          155   6e-38    Sorghum bicolor [broomcorn]
ref|XP_003543684.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    153   6e-38    
ref|XP_008795870.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    153   9e-38    
ref|XP_003597913.1|  Somatic embryogenesis receptor kinase              153   9e-38    
ref|XP_002517653.1|  ATP binding protein, putative                      153   9e-38    Ricinus communis
ref|XP_010503552.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    152   1e-37    
ref|XP_007026031.1|  Kinase superfamily protein                         153   1e-37    
gb|AAM65900.1|  protein kinase, putative                                152   1e-37    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503560.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    152   1e-37    
gb|KDP37071.1|  hypothetical protein JCGZ_06127                         152   1e-37    
emb|CDY06005.1|  BnaA09g37750D                                          157   1e-37    
ref|XP_009342825.1|  PREDICTED: serine/threonine-protein kinase-l...    157   1e-37    
ref|XP_002878271.1|  hypothetical protein ARALYDRAFT_486409             158   1e-37    
ref|NP_566530.1|  PTI1-like tyrosine-protein kinase                     152   1e-37    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228699.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    152   2e-37    
ref|XP_011044847.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    152   2e-37    
ref|XP_008454209.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    152   2e-37    
emb|CDX87914.1|  BnaC06g09760D                                          152   2e-37    
gb|ABR17823.1|  unknown                                                 151   2e-37    Picea sitchensis
ref|XP_010927378.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    152   2e-37    
emb|CDY66068.1|  BnaC08g48960D                                          156   2e-37    
ref|XP_009144835.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    151   2e-37    
ref|XP_009772957.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    151   3e-37    
ref|XP_006364223.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    151   3e-37    
gb|EMT10158.1|  Putative receptor protein kinase CRINKLY4               157   3e-37    
ref|XP_010469358.1|  PREDICTED: serine/threonine-protein kinase-l...    157   3e-37    
ref|XP_007023225.1|  Brassinosteroid insensitive 1-associated rec...    151   3e-37    
ref|XP_009398667.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    150   3e-37    
ref|XP_007023226.1|  Brassinosteroid insensitive 1-associated rec...    150   4e-37    
ref|XP_010250169.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    151   4e-37    
ref|XP_004306242.1|  PREDICTED: serine/threonine-protein kinase-l...    156   4e-37    
gb|EMS64811.1|  Putative receptor protein kinase CRINKLY4               157   4e-37    
gb|KHF99665.1|  Serine/threonine-protein kinase PBS1                    152   4e-37    
ref|XP_003545853.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    151   4e-37    
ref|XP_006402689.1|  hypothetical protein EUTSA_v10005780mg             157   4e-37    
ref|XP_009607610.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    151   4e-37    
ref|XP_010512201.1|  PREDICTED: serine/threonine-protein kinase-l...    157   4e-37    
ref|XP_009407376.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    151   5e-37    
ref|XP_009418509.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    151   5e-37    
gb|EMT05325.1|  Serine/threonine-protein kinase PBS1                    152   6e-37    
ref|XP_011013943.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    150   6e-37    
ref|XP_002989320.1|  hypothetical protein SELMODRAFT_129596             150   6e-37    
ref|XP_007150759.1|  hypothetical protein PHAVU_005G178500g             150   6e-37    
ref|NP_001061679.1|  Os08g0376600                                       151   6e-37    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011009892.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    150   7e-37    
emb|CDY49913.1|  BnaA05g14800D                                          150   7e-37    
ref|XP_009116601.1|  PREDICTED: serine/threonine-protein kinase-l...    156   7e-37    
ref|XP_010413696.1|  PREDICTED: serine/threonine-protein kinase-l...    156   7e-37    
ref|XP_003597519.1|  Serine/threonine protein kinase-like protein...    156   8e-37    
ref|XP_006290261.1|  hypothetical protein CARUB_v10016669mg             156   8e-37    
gb|KFK35800.1|  hypothetical protein AALP_AA4G038100                    149   1e-36    
ref|XP_002973593.1|  hypothetical protein SELMODRAFT_99707              149   1e-36    
ref|XP_004152193.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    150   1e-36    
ref|XP_001782162.1|  predicted protein                                  149   1e-36    
ref|XP_010906578.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    149   1e-36    
ref|XP_002975616.1|  hypothetical protein SELMODRAFT_103981             149   1e-36    
ref|XP_002983581.1|  hypothetical protein SELMODRAFT_118274             149   1e-36    
emb|CDM84543.1|  unnamed protein product                                151   1e-36    
gb|KFK40245.1|  hypothetical protein AALP_AA3G349100                    155   1e-36    
ref|XP_010033970.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    150   1e-36    
gb|ABW81401.1|  receptor-like kinase CR4                                155   1e-36    Hordeum vulgare subsp. vulgare [barley]
dbj|BAK05611.1|  predicted protein                                      155   1e-36    
ref|XP_008356531.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    150   1e-36    
gb|KHG17287.1|  hypothetical protein F383_02161                         149   1e-36    
ref|XP_006465319.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    150   1e-36    
ref|XP_002973814.1|  hypothetical protein SELMODRAFT_149289             149   1e-36    
ref|XP_010930213.1|  PREDICTED: putative receptor protein kinase ...    155   1e-36    
gb|KCW53833.1|  hypothetical protein EUGRSUZ_J03069                     149   1e-36    
ref|XP_006427299.1|  hypothetical protein CICLE_v10025774mg             150   2e-36    
ref|XP_010465583.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    149   2e-36    
ref|XP_009374021.1|  PREDICTED: proline-rich receptor-like protei...    153   2e-36    
ref|XP_002969992.1|  hypothetical protein SELMODRAFT_146686             148   2e-36    
ref|XP_010465584.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    149   2e-36    
ref|XP_002980938.1|  hypothetical protein SELMODRAFT_113448             148   2e-36    
ref|NP_564609.3|  protein kinase superfamily protein                    149   2e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001781813.1|  predicted protein                                  148   2e-36    
ref|XP_010241557.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    149   2e-36    
ref|XP_007150432.1|  hypothetical protein PHAVU_005G153100g             154   2e-36    
ref|XP_010545758.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    149   2e-36    
gb|KHG29718.1|  Serine/threonine-protein kinase PBS1                    149   2e-36    
ref|XP_004235951.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    149   3e-36    
ref|XP_006852116.1|  hypothetical protein AMTR_s00049p00025350          154   3e-36    
gb|AAD55610.1|AC008016_20  Contains PF|00069 Eukaryotic protein k...    148   3e-36    Arabidopsis thaliana [mouse-ear cress]
gb|EYU45575.1|  hypothetical protein MIMGU_mgv1a004753mg                151   3e-36    
emb|CDX82425.1|  BnaA03g33960D                                          148   3e-36    
ref|XP_004970226.1|  PREDICTED: serine/threonine-protein kinase P...    150   3e-36    
gb|AES67539.2|  Serine/Threonine-kinase rlckvii-like protein, put...    149   4e-36    
ref|XP_009146898.1|  PREDICTED: serine/threonine-protein kinase-l...    153   4e-36    
emb|CAA18116.1|  serine/threonine protein kinase like protein           147   4e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010062992.1|  PREDICTED: serine/threonine-protein kinase P...    148   5e-36    
ref|XP_011073418.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    148   5e-36    
ref|XP_006372875.1|  epidermal differentiation family protein           154   5e-36    
ref|XP_002981460.1|  hypothetical protein SELMODRAFT_114199             146   5e-36    
ref|XP_002894383.1|  hypothetical protein ARALYDRAFT_337406             147   5e-36    
ref|XP_011037092.1|  PREDICTED: serine/threonine-protein kinase-l...    154   5e-36    
ref|XP_006647017.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    148   5e-36    
ref|XP_010557823.1|  PREDICTED: serine/threonine-protein kinase-l...    149   6e-36    
ref|XP_003597288.1|  Protein kinase-like protein                        148   6e-36    
ref|XP_006297987.1|  hypothetical protein CARUB_v10014029mg             147   6e-36    
ref|XP_010268133.1|  PREDICTED: serine/threonine-protein kinase-l...    153   6e-36    
ref|XP_008361244.1|  PREDICTED: proline-rich receptor-like protei...    151   6e-36    
ref|XP_010046663.1|  PREDICTED: serine/threonine-protein kinase-l...    152   7e-36    
ref|XP_002884755.1|  kinase family protein                              152   7e-36    
gb|KCW87886.1|  hypothetical protein EUGRSUZ_A00278                     150   7e-36    
gb|KCW88817.1|  hypothetical protein EUGRSUZ_A01154                     152   7e-36    
ref|XP_008337381.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    151   7e-36    
ref|XP_010462090.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    147   8e-36    
ref|XP_003546987.1|  PREDICTED: serine/threonine-protein kinase-l...    153   8e-36    
ref|XP_008243932.1|  PREDICTED: serine/threonine-protein kinase-l...    152   9e-36    
ref|XP_007207213.1|  hypothetical protein PRUPE_ppa001914mg             152   9e-36    
ref|XP_010064568.1|  PREDICTED: serine/threonine-protein kinase-l...    150   9e-36    
gb|KHN33307.1|  Serine/threonine-protein kinase-like protein ACR4       152   1e-35    
gb|EAZ06807.1|  hypothetical protein OsI_29051                          147   1e-35    Oryza sativa Indica Group [Indian rice]
emb|CDX75852.1|  BnaC03g39350D                                          146   1e-35    
ref|XP_010268132.1|  PREDICTED: serine/threonine-protein kinase-l...    153   1e-35    
gb|KHN30097.1|  Serine/threonine-protein kinase-like protein ACR4       152   1e-35    
ref|XP_004167794.1|  PREDICTED: proline-rich receptor-like protei...    147   1e-35    
ref|XP_009351272.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    147   1e-35    
ref|XP_007139102.1|  hypothetical protein PHAVU_008G001400g             149   1e-35    
ref|XP_008676673.1|  PREDICTED: uncharacterized LOC100216921 isof...    147   1e-35    
ref|XP_006645667.1|  PREDICTED: proline-rich receptor-like protei...    149   1e-35    
ref|XP_006305213.1|  hypothetical protein CARUB_v10009580mg             146   1e-35    
ref|XP_008800064.1|  PREDICTED: putative receptor protein kinase ...    152   1e-35    
ref|XP_010526052.1|  PREDICTED: serine/threonine-protein kinase-l...    152   1e-35    
ref|XP_007156929.1|  hypothetical protein PHAVU_002G029200g             150   1e-35    
gb|KDP43834.1|  hypothetical protein JCGZ_20844                         152   1e-35    
gb|EPS72385.1|  hypothetical protein M569_02367                         152   1e-35    
ref|XP_009770850.1|  PREDICTED: serine/threonine-protein kinase-l...    152   2e-35    
ref|XP_007014100.1|  LRR receptor-like serine/threonine-protein k...    147   2e-35    
ref|XP_011012925.1|  PREDICTED: serine/threonine-protein kinase-l...    152   2e-35    
ref|XP_009793904.1|  PREDICTED: serine/threonine-protein kinase P...    147   2e-35    
ref|XP_009135465.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    145   2e-35    
ref|XP_010665554.1|  PREDICTED: serine/threonine-protein kinase CDL1    147   2e-35    
ref|XP_006406905.1|  hypothetical protein EUTSA_v10020984mg             146   2e-35    
gb|KHN20676.1|  Proline-rich receptor-like protein kinase PERK1         148   2e-35    
ref|NP_189097.1|  proline-rich receptor-like protein kinase PERK3       149   2e-35    Arabidopsis thaliana [mouse-ear cress]
gb|KHN36118.1|  Proline-rich receptor-like protein kinase PERK4         147   2e-35    
ref|XP_011026418.1|  PREDICTED: serine/threonine-protein kinase-l...    152   2e-35    
ref|XP_003542059.1|  PREDICTED: serine/threonine-protein kinase-l...    152   2e-35    
gb|KHN25294.1|  Serine/threonine-protein kinase-like protein ACR4       151   2e-35    
ref|XP_009595311.1|  PREDICTED: serine/threonine-protein kinase P...    146   2e-35    
ref|XP_011081421.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    146   2e-35    
gb|KCW82429.1|  hypothetical protein EUGRSUZ_C03826                     146   2e-35    
ref|XP_010097212.1|  PTI1-like tyrosine-protein kinase                  146   2e-35    
ref|XP_008373969.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    146   2e-35    
ref|XP_009787085.1|  PREDICTED: serine/threonine-protein kinase-l...    147   3e-35    
gb|KDO48899.1|  hypothetical protein CISIN_1g014904mg                   147   3e-35    
ref|XP_008453980.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    151   3e-35    
ref|XP_004152097.1|  PREDICTED: serine/threonine-protein kinase-l...    151   3e-35    
ref|XP_010479762.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    145   3e-35    
ref|XP_007052432.1|  Serine/threonine-protein kinase protein            147   3e-35    
gb|KDO48900.1|  hypothetical protein CISIN_1g014904mg                   146   4e-35    
ref|XP_003564375.1|  PREDICTED: serine/threonine-protein kinase A...    147   4e-35    
emb|CDP04377.1|  unnamed protein product                                145   4e-35    
ref|XP_001754560.1|  predicted protein                                  150   4e-35    
ref|XP_003540697.2|  PREDICTED: serine/threonine-protein kinase-l...    150   4e-35    
ref|XP_006299975.1|  hypothetical protein CARUB_v10016188mg             150   4e-35    
ref|XP_006392910.1|  hypothetical protein EUTSA_v10011602mg             145   4e-35    
ref|XP_002519541.1|  ATP binding protein, putative                      150   5e-35    Ricinus communis
ref|XP_010907662.1|  PREDICTED: serine/threonine-protein kinase P...    146   5e-35    
ref|NP_001046121.1|  Os02g0186500                                       145   5e-35    Oryza sativa Japonica Group [Japonica rice]
gb|AFK40964.1|  unknown                                                 145   5e-35    
ref|XP_011092892.1|  PREDICTED: serine/threonine-protein kinase-l...    150   5e-35    
gb|KCW52764.1|  hypothetical protein EUGRSUZ_J02110                     145   5e-35    
ref|XP_002309807.2|  epidermal differentiation family protein           150   5e-35    Populus trichocarpa [western balsam poplar]
ref|XP_009380552.1|  PREDICTED: proline-rich receptor-like protei...    148   6e-35    
ref|XP_002453424.1|  hypothetical protein SORBIDRAFT_04g005810          145   6e-35    Sorghum bicolor [broomcorn]
ref|XP_010049677.1|  PREDICTED: proline-rich receptor-like protei...    147   6e-35    
ref|XP_010051588.1|  PREDICTED: proline-rich receptor-like protei...    147   7e-35    
ref|NP_001119030.1|  STRUBBELIG-receptor family 8 protein               147   7e-35    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006654162.1|  PREDICTED: proline-rich receptor-like protei...    146   7e-35    
gb|KHN41988.1|  Proline-rich receptor-like protein kinase PERK4         146   7e-35    
ref|XP_010500854.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    144   7e-35    
ref|XP_004951644.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    145   7e-35    
ref|XP_003528909.1|  PREDICTED: proline-rich receptor-like protei...    148   7e-35    
emb|CDY44730.1|  BnaA05g28760D                                          149   8e-35    
gb|KDP33677.1|  hypothetical protein JCGZ_07248                         148   8e-35    
ref|XP_010034609.1|  PREDICTED: probable serine/threonine-protein...    145   8e-35    
ref|XP_008449260.1|  PREDICTED: serine/threonine-protein kinase-l...    149   9e-35    
gb|AAO72646.1|  putative receptor protein kinase                        145   9e-35    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010488565.1|  PREDICTED: proline-rich receptor-like protei...    148   9e-35    
ref|NP_001241751.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    144   9e-35    
ref|XP_003529582.1|  PREDICTED: proline-rich receptor-like protei...    147   9e-35    
ref|XP_011088589.1|  PREDICTED: serine/threonine-protein kinase-l...    149   1e-34    
emb|CAN66493.1|  hypothetical protein VITISV_019852                     144   1e-34    Vitis vinifera
ref|XP_010464634.1|  PREDICTED: serine/threonine-protein kinase-l...    149   1e-34    
gb|KDP43800.1|  hypothetical protein JCGZ_23008                         144   1e-34    
ref|XP_004150305.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    144   1e-34    
ref|XP_002265603.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    144   1e-34    Vitis vinifera
ref|XP_002886504.1|  hypothetical protein ARALYDRAFT_475144             144   1e-34    
ref|XP_010907661.1|  PREDICTED: serine/threonine-protein kinase P...    145   1e-34    
gb|EEC78728.1|  hypothetical protein OsI_18915                          145   1e-34    Oryza sativa Indica Group [Indian rice]
ref|XP_008340255.1|  PREDICTED: serine/threonine-protein kinase P...    145   1e-34    
ref|XP_009349479.1|  PREDICTED: serine/threonine-protein kinase P...    145   1e-34    
gb|KHN48298.1|  Serine/threonine-protein kinase-like protein CCR1       148   1e-34    
ref|XP_008222558.1|  PREDICTED: serine/threonine-protein kinase-l...    149   1e-34    
ref|NP_001148756.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    144   1e-34    Zea mays [maize]
ref|XP_002533445.1|  receptor protein kinase, putative                  149   1e-34    Ricinus communis
ref|XP_004497430.1|  PREDICTED: serine/threonine-protein kinase P...    145   1e-34    
ref|XP_004512982.1|  PREDICTED: proline-rich receptor-like protei...    147   1e-34    
ref|XP_010466870.1|  PREDICTED: proline-rich receptor-like protei...    147   1e-34    
ref|NP_187589.1|  serine/threonine-protein kinase-like protein CCR1     149   1e-34    
gb|ACF86764.1|  unknown                                                 145   1e-34    
ref|NP_001054941.1|  Os05g0218400                                       144   1e-34    
ref|XP_004497429.1|  PREDICTED: serine/threonine-protein kinase P...    145   1e-34    
gb|EPS65054.1|  hypothetical protein M569_09726                         143   2e-34    
ref|XP_010068105.1|  PREDICTED: proline-rich receptor-like protei...    145   2e-34    
ref|NP_001237102.1|  putative receptor protein kinase PERK1             145   2e-34    
ref|XP_009418675.1|  PREDICTED: serine/threonine-protein kinase P...    144   2e-34    
ref|XP_010513600.1|  PREDICTED: proline-rich receptor-like protei...    147   2e-34    
ref|XP_006584465.1|  PREDICTED: serine/threonine-protein kinase i...    145   2e-34    
ref|XP_010103058.1|  Proline-rich receptor-like protein kinase PERK1    145   2e-34    
ref|XP_001763893.1|  predicted protein                                  142   2e-34    
ref|XP_002299270.2|  hypothetical protein POPTR_0001s14680g             144   2e-34    
gb|AAV25281.1|  putative protein kinase                                 145   2e-34    
gb|KHN45639.1|  Proline-rich receptor-like protein kinase PERK1         145   2e-34    
ref|XP_004139342.1|  PREDICTED: proline-rich receptor-like protei...    147   2e-34    
ref|XP_008666135.1|  PREDICTED: probable serine/threonine-protein...    143   2e-34    
ref|XP_009386921.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    144   2e-34    
ref|XP_003620684.1|  Somatic embryogenesis receptor kinase              147   2e-34    
ref|XP_010439362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    147   2e-34    
ref|XP_010473406.1|  PREDICTED: serine/threonine-protein kinase P...    144   2e-34    
gb|AFW77530.1|  putative prolin-rich extensin-like receptor prote...    144   2e-34    
ref|XP_008458364.1|  PREDICTED: proline-rich receptor-like protei...    147   2e-34    
ref|XP_010430212.1|  PREDICTED: serine/threonine-protein kinase P...    143   2e-34    
emb|CDP10055.1|  unnamed protein product                                148   2e-34    
ref|NP_001235164.1|  serine/threonine-protein kinase                    144   2e-34    
ref|XP_004143354.1|  PREDICTED: serine/threonine-protein kinase-l...    148   3e-34    
ref|XP_010063545.1|  PREDICTED: probable receptor-like protein ki...    144   3e-34    
emb|CDX91145.1|  BnaC02g04520D                                          144   3e-34    
emb|CDY41586.1|  BnaC05g43230D                                          147   3e-34    
ref|XP_009419365.1|  PREDICTED: serine/threonine-protein kinase P...    144   3e-34    
ref|XP_008447756.1|  PREDICTED: serine/threonine-protein kinase P...    144   3e-34    
emb|CDX85669.1|  BnaA02g01440D                                          144   3e-34    
ref|XP_002510817.1|  leucine-rich repeat receptor protein kinase ...    149   3e-34    
ref|XP_010236270.1|  PREDICTED: LOW QUALITY PROTEIN: tyrosine-sul...    149   3e-34    
ref|XP_006584464.1|  PREDICTED: serine/threonine-protein kinase i...    145   3e-34    
ref|XP_009397148.1|  PREDICTED: serine/threonine-protein kinase A...    143   3e-34    
ref|XP_003541409.1|  PREDICTED: serine/threonine-protein kinase-l...    147   3e-34    
ref|XP_006284970.1|  hypothetical protein CARUB_v10006274mg             147   3e-34    
gb|KFK40638.1|  hypothetical protein AALP_AA2G022700                    143   3e-34    
ref|XP_009395203.1|  PREDICTED: proline-rich receptor-like protei...    145   3e-34    
ref|XP_004309815.1|  PREDICTED: serine/threonine-protein kinase-l...    148   3e-34    
ref|XP_010434074.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    147   3e-34    
ref|XP_009757853.1|  PREDICTED: proline-rich receptor-like protei...    147   3e-34    
ref|XP_007043875.1|  Kinase superfamily protein                         144   3e-34    
ref|XP_009371460.1|  PREDICTED: proline-rich receptor-like protei...    146   3e-34    
ref|XP_006573581.1|  PREDICTED: proline-rich receptor-like protei...    146   3e-34    
ref|XP_010925846.1|  PREDICTED: proline-rich receptor-like protei...    145   4e-34    
ref|XP_010927303.1|  PREDICTED: proline-rich receptor-like protei...    142   4e-34    
ref|XP_003597286.1|  Protein kinase-like protein                        144   4e-34    
ref|XP_004979143.1|  PREDICTED: putative receptor protein kinase ...    148   4e-34    
ref|XP_004229679.1|  PREDICTED: serine/threonine-protein kinase-l...    144   4e-34    
dbj|BAB02005.1|  protein kinase-like protein                            145   4e-34    
ref|XP_009125889.1|  PREDICTED: serine/threonine-protein kinase P...    144   4e-34    
ref|XP_008782087.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    143   4e-34    
ref|XP_010905307.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    142   4e-34    
ref|NP_193944.2|  STRUBBELIG-receptor family 8 protein                  147   4e-34    
ref|XP_009602383.1|  PREDICTED: serine/threonine-protein kinase-l...    144   4e-34    
ref|XP_011009289.1|  PREDICTED: serine/threonine-protein kinase PBS1    142   4e-34    
ref|XP_010448928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    147   4e-34    
emb|CDX97232.1|  BnaC09g43930D                                          144   4e-34    
ref|XP_003538850.1|  PREDICTED: proline-rich receptor-like protei...    146   4e-34    
ref|NP_176379.2|  Protein kinase family protein                         143   4e-34    
ref|XP_006345390.1|  PREDICTED: serine/threonine-protein kinase-l...    144   4e-34    
ref|XP_009121792.1|  PREDICTED: serine/threonine-protein kinase PBS1    144   4e-34    
sp|Q1PEM5.2|PERK3_ARATH  RecName: Full=Proline-rich receptor-like...    144   4e-34    
ref|XP_009336453.1|  PREDICTED: serine/threonine-protein kinase P...    144   5e-34    
emb|CDY24861.1|  BnaA03g59650D                                          142   5e-34    
ref|XP_008795084.1|  PREDICTED: proline-rich receptor-like protei...    144   5e-34    
emb|CBI26102.3|  unnamed protein product                                144   5e-34    
ref|XP_003563239.1|  PREDICTED: putative receptor protein kinase ...    147   5e-34    
emb|CDP04243.1|  unnamed protein product                                145   5e-34    
ref|XP_007204236.1|  hypothetical protein PRUPE_ppa002532mg             146   5e-34    
ref|XP_010929601.1|  PREDICTED: serine/threonine-protein kinase P...    144   5e-34    
ref|XP_004156339.1|  PREDICTED: serine/threonine-protein kinase-l...    147   5e-34    
gb|KDP22307.1|  hypothetical protein JCGZ_26138                         148   5e-34    
ref|XP_008805652.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    141   5e-34    
emb|CDY47164.1|  BnaA01g22900D                                          142   5e-34    
ref|XP_007033959.1|  Crinkly4                                           147   6e-34    
emb|CDO97062.1|  unnamed protein product                                144   6e-34    
gb|KDP29109.1|  hypothetical protein JCGZ_16498                         147   6e-34    
ref|XP_007225732.1|  hypothetical protein PRUPE_ppa005276mg             144   6e-34    
ref|XP_010520632.1|  PREDICTED: proline-rich receptor-like protei...    145   6e-34    
gb|KHF97868.1|  Serine/threonine-protein kinase PBS1                    144   6e-34    
ref|XP_001762196.1|  predicted protein                                  141   6e-34    
ref|XP_009113360.1|  PREDICTED: serine/threonine-protein kinase P...    142   6e-34    
ref|XP_009105767.1|  PREDICTED: serine/threonine-protein kinase P...    142   6e-34    
ref|XP_004964746.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    142   6e-34    
ref|XP_006856498.1|  hypothetical protein AMTR_s00046p00085030          142   6e-34    
ref|XP_009763258.1|  PREDICTED: serine/threonine-protein kinase PBS1    143   6e-34    
ref|XP_008376715.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    141   6e-34    
ref|XP_006655827.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    142   6e-34    
ref|NP_001044487.1|  Os01g0789200                                       143   6e-34    
ref|XP_008242654.1|  PREDICTED: proline-rich receptor-like protei...    145   7e-34    
ref|XP_008791099.1|  PREDICTED: serine/threonine-protein kinase P...    143   7e-34    
ref|XP_002869840.1|  kinase                                             146   7e-34    
gb|EEC71622.1|  hypothetical protein OsI_04041                          143   7e-34    
gb|EPS72303.1|  hypothetical protein M569_02452                         145   7e-34    
dbj|BAF79943.1|  receptor-like kinase                                   144   7e-34    
ref|XP_008354402.1|  PREDICTED: proline-rich receptor-like protei...    145   7e-34    
gb|EEC75803.1|  hypothetical protein OsI_12742                          147   7e-34    
ref|XP_002264936.1|  PREDICTED: serine/threonine-protein kinase-l...    147   7e-34    
ref|XP_009619102.1|  PREDICTED: serine/threonine-protein kinase PBS1    143   7e-34    
ref|XP_006413689.1|  hypothetical protein EUTSA_v10024563mg             146   7e-34    
ref|XP_004160904.1|  PREDICTED: LOW QUALITY PROTEIN: PTI1-like ty...    141   7e-34    
gb|EAY73106.1|  hypothetical protein OsI_00982                          145   7e-34    
ref|XP_008446522.1|  PREDICTED: proline-rich receptor-like protei...    146   7e-34    
ref|XP_008222220.1|  PREDICTED: serine/threonine-protein kinase PBS1    143   7e-34    
ref|XP_008781703.1|  PREDICTED: proline-rich receptor-like protei...    145   7e-34    
ref|XP_010659216.1|  PREDICTED: serine/threonine-protein kinase-l...    143   7e-34    
ref|XP_003564264.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    142   7e-34    
gb|KDO60539.1|  hypothetical protein CISIN_1g012765mg                   143   8e-34    
ref|XP_008446521.1|  PREDICTED: proline-rich receptor-like protei...    146   8e-34    
ref|XP_004135415.1|  PREDICTED: proline-rich receptor-like protei...    146   8e-34    
ref|NP_001042469.1|  Os01g0227200                                       144   8e-34    
ref|XP_010097823.1|  Proline-rich receptor-like protein kinase PE...    146   8e-34    
gb|KDP26856.1|  hypothetical protein JCGZ_18014                         143   8e-34    
ref|XP_006369183.1|  hypothetical protein POPTR_0001s18340g             144   8e-34    
ref|NP_001050726.1|  Os03g0637800                                       147   8e-34    
ref|XP_006426253.1|  hypothetical protein CICLE_v10025570mg             143   8e-34    
ref|XP_006451164.1|  hypothetical protein CICLE_v10007670mg             145   8e-34    
ref|XP_010911937.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    142   8e-34    
ref|NP_001044187.1|  Os01g0738300                                       145   9e-34    
ref|XP_003556585.1|  PREDICTED: serine/threonine-protein kinase P...    143   9e-34    
gb|AFW82412.1|  putative protein kinase superfamily protein             144   9e-34    
ref|XP_006606603.1|  PREDICTED: serine/threonine-protein kinase P...    143   9e-34    
ref|XP_002514864.1|  receptor serine-threonine protein kinase, pu...    143   9e-34    
gb|ADE76472.1|  unknown                                                 143   9e-34    
emb|CDY25327.1|  BnaC01g29960D                                          142   9e-34    
ref|XP_007224894.1|  hypothetical protein PRUPE_ppa022122mg             147   9e-34    
ref|XP_004164336.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    142   9e-34    
ref|XP_002883531.1|  hypothetical protein ARALYDRAFT_479967             145   9e-34    
gb|KCW62848.1|  hypothetical protein EUGRSUZ_G00443                     145   9e-34    
ref|XP_004152921.1|  PREDICTED: serine/threonine-protein kinase P...    142   9e-34    
ref|XP_006436323.1|  hypothetical protein CICLE_v10033944mg             147   1e-33    
gb|EMS62683.1|  Proline-rich receptor-like protein kinase PERK1         142   1e-33    
ref|XP_004309853.1|  PREDICTED: probable serine/threonine-protein...    142   1e-33    
gb|AFW82073.1|  putative prolin-rich extensin-like receptor prote...    144   1e-33    
ref|XP_010112317.1|  putative serine/threonine-protein kinase RLC...    142   1e-33    
ref|XP_008223116.1|  PREDICTED: serine/threonine-protein kinase PBS1    143   1e-33    
ref|XP_008656420.1|  PREDICTED: serine/threonine-protein kinase A...    143   1e-33    
gb|AES76893.2|  receptor-like kinase                                    142   1e-33    
ref|XP_003620675.1|  Receptor protein kinase PERK1                      142   1e-33    
ref|XP_004512025.1|  PREDICTED: proline-rich receptor-like protei...    145   1e-33    
ref|XP_008222515.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    142   1e-33    
ref|XP_008656421.1|  PREDICTED: serine/threonine-protein kinase A...    143   1e-33    
ref|XP_002978708.1|  hypothetical protein SELMODRAFT_13751              140   1e-33    
gb|ACG28793.1|  receptor protein kinase PERK1                           145   1e-33    
gb|KEH42240.1|  Serine/Threonine-kinase CCR1-like protein               146   1e-33    
gb|KHG27222.1|  Serine/threonine-protein kinase PBS1                    141   1e-33    
ref|XP_008389922.1|  PREDICTED: serine/threonine-protein kinase P...    142   1e-33    
ref|XP_002973771.1|  hypothetical protein SELMODRAFT_99902              147   1e-33    
gb|AES67537.2|  receptor Serine/Threonine kinase                        143   1e-33    
ref|XP_008439143.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    141   1e-33    
ref|XP_010655363.1|  PREDICTED: serine/threonine-protein kinase CDL1    141   1e-33    
ref|XP_002271281.1|  PREDICTED: serine/threonine-protein kinase-l...    143   1e-33    
gb|ABR46067.1|  avrPphB susceptible 1                                   142   1e-33    
gb|KFK38368.1|  hypothetical protein AALP_AA3G104800                    145   1e-33    
gb|KFK28787.1|  hypothetical protein AALP_AA7G048200                    145   1e-33    
ref|XP_011010164.1|  PREDICTED: proline-rich receptor-like protei...    142   1e-33    
ref|XP_002975820.1|  hypothetical protein SELMODRAFT_103725             147   1e-33    
gb|KFK38367.1|  hypothetical protein AALP_AA3G104800                    145   1e-33    
gb|EYU37788.1|  hypothetical protein MIMGU_mgv1a003036mg                144   1e-33    
ref|NP_196820.1|  serine/threonine-protein kinase PBS1                  142   1e-33    
ref|NP_001148076.1|  LOC100281684                                       145   1e-33    
ref|XP_011071471.1|  PREDICTED: serine/threonine-protein kinase C...    143   1e-33    
ref|XP_002441844.1|  hypothetical protein SORBIDRAFT_08g003290          146   1e-33    
ref|XP_006302374.1|  hypothetical protein CARUB_v10020438mg             141   1e-33    
ref|XP_002871549.1|  avrPphB susceptible 1                              142   1e-33    
gb|ABR46086.1|  avrPphB susceptible 1                                   142   1e-33    
ref|XP_006586722.1|  PREDICTED: putative receptor protein kinase ...    144   1e-33    
ref|XP_004965690.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    142   1e-33    
ref|XP_002441330.1|  hypothetical protein SORBIDRAFT_09g024560          143   1e-33    
ref|XP_011094671.1|  PREDICTED: serine/threonine-protein kinase-l...    145   1e-33    
ref|NP_001145767.1|  uncharacterized LOC100279274                       144   2e-33    
ref|XP_007135679.1|  hypothetical protein PHAVU_010G149300g             143   2e-33    
ref|XP_006466328.1|  PREDICTED: receptor-like cytosolic serine/th...    142   2e-33    
ref|XP_009358277.1|  PREDICTED: probable serine/threonine-protein...    142   2e-33    
ref|XP_006391955.1|  hypothetical protein EUTSA_v10023513mg             141   2e-33    
gb|KHN39082.1|  Serine/threonine-protein kinase-like protein CCR1       145   2e-33    
ref|XP_003536986.1|  PREDICTED: serine/threonine-protein kinase-l...    145   2e-33    
ref|XP_002275431.1|  PREDICTED: serine/threonine-protein kinase CDL1    143   2e-33    
ref|XP_010254113.1|  PREDICTED: proline-rich receptor-like protei...    145   2e-33    
ref|XP_004507426.1|  PREDICTED: probable receptor-like serine/thr...    142   2e-33    
ref|XP_010666681.1|  PREDICTED: serine/threonine-protein kinase CDL1    142   2e-33    
ref|XP_010534706.1|  PREDICTED: serine/threonine-protein kinase PBS1    142   2e-33    
dbj|BAH57220.1|  AT3G24550                                              144   2e-33    
emb|CBI23192.3|  unnamed protein product                                141   2e-33    
ref|XP_004229213.1|  PREDICTED: serine/threonine-protein kinase PBS1    142   2e-33    
ref|XP_004487058.1|  PREDICTED: probable serine/threonine-protein...    141   2e-33    
ref|XP_002531835.1|  receptor serine-threonine protein kinase, pu...    141   2e-33    
ref|XP_002284430.2|  PREDICTED: proline-rich receptor-like protei...    144   2e-33    
ref|XP_006438819.1|  hypothetical protein CICLE_v10031492mg             142   2e-33    
ref|XP_007145220.1|  hypothetical protein PHAVU_007G220700g             145   2e-33    
ref|XP_002871261.1|  extra sporogenous cells                            146   2e-33    
ref|XP_008775587.1|  PREDICTED: serine/threonine-protein kinase P...    142   2e-33    
ref|XP_006352076.1|  PREDICTED: serine/threonine-protein kinase-l...    145   2e-33    
ref|XP_003535621.1|  PREDICTED: leucine-rich repeat receptor prot...    146   2e-33    
gb|KHN21723.1|  Leucine-rich repeat receptor protein kinase EXS         146   2e-33    
ref|XP_002299708.2|  hypothetical protein POPTR_0001s18340g             143   2e-33    
gb|KHN26671.1|  Leucine-rich repeat receptor protein kinase EXS         145   2e-33    
ref|XP_010476767.1|  PREDICTED: serine/threonine-protein kinase-l...    145   2e-33    
ref|XP_009411248.1|  PREDICTED: proline-rich receptor-like protei...    145   2e-33    
ref|XP_004287409.1|  PREDICTED: proline-rich receptor-like protei...    144   2e-33    
gb|EYU37937.1|  hypothetical protein MIMGU_mgv1a001147mg                145   2e-33    
ref|XP_002894514.1|  hypothetical protein ARALYDRAFT_892562             146   2e-33    
ref|NP_001105395.1|  putative receptor protein kinase CRINKLY4 pr...    145   2e-33    
emb|CDY66904.1|  BnaC01g40660D                                          142   2e-33    
ref|NP_180426.1|  protein kinase family protein                         141   2e-33    
gb|AAK43886.1|AF370509_1  protein kinase-like protein                   144   2e-33    
ref|XP_002879167.1|  predicted protein                                  141   2e-33    
ref|XP_006370671.1|  kinase family protein                              140   2e-33    
ref|XP_010691096.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    140   2e-33    
ref|XP_010264633.1|  PREDICTED: putative serine/threonine-protein...    145   2e-33    
ref|XP_011086183.1|  PREDICTED: serine/threonine-protein kinase C...    140   2e-33    
ref|XP_007225200.1|  hypothetical protein PRUPE_ppa002064mg             144   2e-33    
ref|XP_010913840.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    140   2e-33    
gb|KDO49101.1|  hypothetical protein CISIN_1g040832mg                   144   2e-33    
ref|XP_008376494.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    140   2e-33    
ref|XP_009382123.1|  PREDICTED: receptor-like cytosolic serine/th...    142   2e-33    
gb|KDP45108.1|  hypothetical protein JCGZ_18550                         140   2e-33    



>ref|XP_011096364.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Sesamum indicum]
Length=331

 Score =   419 bits (1078),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 215/305 (70%), Positives = 263/305 (86%), Gaps = 7/305 (2%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F+ CK+K   V+D+++E +     AKLSA++Y L E+DAATD FN RRIIGKGRLG VY+
Sbjct  26    FIICKRK--PVKDEEEEAL---PVAKLSASSYPLTEIDAATDAFNHRRIIGKGRLGTVYA  80

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
              V+ P+GELVAVKR HPRLVL+NA GFGFSS+L+WLSLADHP++VPI GFSEAPGERI+V
Sbjct  81    AVM-PKGELVAVKRIHPRLVLNNA-GFGFSSILKWLSLADHPHVVPITGFSEAPGERIIV  138

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             ME+GGMLSL+FYLHQNPD AALL WSRRLR+AAG ARG+E+LHE M P IVHGCVK SN+
Sbjct  139   MEFGGMLSLDFYLHQNPDGAALLDWSRRLRIAAGAARGIEYLHEVMAPPIVHGCVKPSNI  198

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSG  607
             L+DV+F AR+CDYGL+FLA +ERQ ++GYVD+EYW + RG SKE DV+GFGVVLLELLSG
Sbjct  199   LVDVKFCARICDYGLHFLAPHERQGLLGYVDQEYWRDKRGASKECDVFGFGVVLLELLSG  258

Query  606   RKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIV  427
             R+S++GL+V+WALPLIK MRF E+LDPR+AIP ++ PLVRL +VA ACVGN RK+RP++ 
Sbjct  259   RRSEQGLIVEWALPLIKGMRFSELLDPRLAIPSEVEPLVRLGRVAVACVGNCRKNRPSVA  318

Query  426   QVAAI  412
             QVAAI
Sbjct  319   QVAAI  323



>emb|CDO99487.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   404 bits (1038),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 213/303 (70%), Positives = 248/303 (82%), Gaps = 7/303 (2%)
 Frame = -1

Query  1317  CKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVL  1138
             CKKK    E+       C    KL A + +LM++D+ATDGFN RRIIGKGRLG VY+ V+
Sbjct  32    CKKKPIKAEETLQPAASC----KLCACSCSLMDIDSATDGFNNRRIIGKGRLGTVYAAVM  87

Query  1137  QPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY  958
              P GELVAVKR HPRLVL+NA GFGFSS ++ LSLADHP++VPI+G+SEAPGERI+VME+
Sbjct  88    -PRGELVAVKRIHPRLVLTNA-GFGFSSAIKCLSLADHPHVVPIIGYSEAPGERIIVMEF  145

Query  957   GGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLID  778
              GMLSLEFYLH NPD A LL WSRRLR+AAG ARG+E+LH+GM P IVHGC+K SN+LID
Sbjct  146   EGMLSLEFYLHHNPDGAVLLDWSRRLRIAAGAARGIEYLHQGMAPPIVHGCIKPSNILID  205

Query  777   VEFSARLCDYGLYFLASNERQEVIGYVDEEYWVE-GRGGSKESDVYGFGVVLLELLSGRK  601
             V+F ARLCDYGL FLA  ERQ + GYVD EYWVE G G SKESDVYGFGVVLLELLSGR+
Sbjct  206   VKFCARLCDYGLQFLAPRERQGLEGYVDHEYWVEKGGGASKESDVYGFGVVLLELLSGRR  265

Query  600   SQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             ++EGL+ KWALPLIKEM+F E+LDPR+ IP DI PL+RLAKVASACVGNSR SRPT+ Q+
Sbjct  266   NEEGLIAKWALPLIKEMKFDELLDPRLVIPSDIKPLIRLAKVASACVGNSRPSRPTLSQI  325

Query  420   AAI  412
               I
Sbjct  326   VPI  328



>ref|XP_010111171.1| Serine/threonine-protein kinase-like protein [Morus notabilis]
 gb|EXC30562.1| Serine/threonine-protein kinase-like protein [Morus notabilis]
Length=340

 Score =   385 bits (990),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 203/303 (67%), Positives = 244/303 (81%), Gaps = 6/303 (2%)
 Frame = -1

Query  1317  CKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVL  1138
             CK+K    +  D   +   KA   SA ++ L  +DAATDGFN RR+IG+GRLG +Y+ V 
Sbjct  33    CKRKAVTNQSQDQALLPVIKA---SATSFPLTNIDAATDGFNRRRVIGEGRLGTLYAAVF  89

Query  1137  QPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY  958
             + +GELVAVKR HPRLVLSNA G GFS+VL+ LSLA HPN+V I+GFSEAPGERIVV E+
Sbjct  90    E-KGELVAVKRIHPRLVLSNA-GLGFSTVLKSLSLAQHPNIVQIIGFSEAPGERIVVSEF  147

Query  957   GGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLID  778
              G +SLEFYLHQNPD  +LL WSRR+R+AAG ARGLE+LHE + PHIVHGCVK SN+LID
Sbjct  148   VGTISLEFYLHQNPDGVSLLDWSRRVRIAAGAARGLEYLHESVAPHIVHGCVKPSNILID  207

Query  777   VEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGS-KESDVYGFGVVLLELLSGRK  601
             + F AR+CD+GL FLA  E++ V+GYVD+EYW +  GG+ KESDVYGFGVVLLELLSGR+
Sbjct  208   LNFGARICDFGLTFLAPREKRGVVGYVDDEYWGQRNGGACKESDVYGFGVVLLELLSGRR  267

Query  600   SQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
              +EGL++KWALPLI+EMR  E LDPR+ IP D+ PLVRLAKVASACVGNSRKSRP+I QV
Sbjct  268   CEEGLILKWALPLIREMRINEFLDPRLVIPSDVKPLVRLAKVASACVGNSRKSRPSIGQV  327

Query  420   AAI  412
             A I
Sbjct  328   ATI  330



>ref|XP_007025531.1| Serine/threonine-protein kinase-like protein ACR4 [Theobroma 
cacao]
 gb|EOY28153.1| Serine/threonine-protein kinase-like protein ACR4 [Theobroma 
cacao]
Length=335

 Score =   385 bits (990),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 204/306 (67%), Positives = 247/306 (81%), Gaps = 9/306 (3%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
              + C+KK P   D   E        K+ A+AY L ++DAATDGFN RRIIGKGRLG VY+
Sbjct  28    IIICRKK-PVKSDQKQE-----LPVKVCASAYQLTDIDAATDGFNHRRIIGKGRLGTVYA  81

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
              +  P  ELVAVKR HPRLVLSNA GFGF+S++R LSLA HP++VP++GFS+APGERI+V
Sbjct  82    AI-SPRAELVAVKRIHPRLVLSNA-GFGFASIIRTLSLAQHPHIVPVIGFSQAPGERIIV  139

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             ME+ GM++L FYLH+N D A+LL W+RRLRVAAGVARGLE+LHEGM P+I+HGC+KASN+
Sbjct  140   MEFVGMVNLNFYLHENSDGASLLDWNRRLRVAAGVARGLEYLHEGMAPNIIHGCIKASNI  199

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVE-GRGGSKESDVYGFGVVLLELLS  610
             L+DV+F A+LC YGL FLA  E++ ++GYVD+EYWVE G G  KESDVYGFGVVLLELL+
Sbjct  200   LLDVKFVAKLCGYGLSFLAPQEKRGLVGYVDDEYWVERGGGACKESDVYGFGVVLLELLT  259

Query  609   GRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTI  430
             GR+S+EGLLV+WALPLIKE +  E+LDPR+ IP DI PLVRLAKVAS CVGN RK RP I
Sbjct  260   GRRSEEGLLVRWALPLIKEKKLSELLDPRLVIPSDIKPLVRLAKVASTCVGNYRKDRPCI  319

Query  429   VQVAAI  412
              QVA I
Sbjct  320   SQVATI  325



>ref|XP_002509422.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF50809.1| ATP binding protein, putative [Ricinus communis]
Length=335

 Score =   383 bits (984),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 197/304 (65%), Positives = 244/304 (80%), Gaps = 11/304 (4%)
 Frame = -1

Query  1317  CKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVL  1138
             C+KK   VE ++   +      K+SA  Y+L ++DAATDGFN RRI+G G LG VY+ V+
Sbjct  31    CRKK--PVESEETLSV------KVSAPTYSLTDIDAATDGFNHRRIVGTGHLGTVYAAVI  82

Query  1137  QPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY  958
              P  +LVAVKR HP LVLSN  GFGFSS+L+ LSLA H N+VPILGFS+APGERI+V E+
Sbjct  83    LPRQQLVAVKRIHPSLVLSNP-GFGFSSILKTLSLAQHSNIVPILGFSQAPGERIIVTEF  141

Query  957   GGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLID  778
              GM SL+FYLH+N D  +LL WSRRLR+ AG A G+++LHEGM P++VHGC KASNVL+D
Sbjct  142   VGMASLDFYLHENSDGGSLLDWSRRLRIGAGAASGMQYLHEGMAPNVVHGCFKASNVLLD  201

Query  777   VEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGS--KESDVYGFGVVLLELLSGR  604
             V+F  R+CDYGLYFLA NE++ + GYVD+EYW +  GG   K SDVYGFGVVLLELL+GR
Sbjct  202   VKFCPRVCDYGLYFLAPNEKRGLAGYVDDEYWSQTGGGGPCKASDVYGFGVVLLELLTGR  261

Query  603   KSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQ  424
             +S+ GLLVKWALPLIKEM+F E+LDPR+A+P D+N ++RL+KVASACV NSRK+RPTIVQ
Sbjct  262   RSEGGLLVKWALPLIKEMKFSELLDPRLALPSDMNQIIRLSKVASACVSNSRKNRPTIVQ  321

Query  423   VAAI  412
             VAAI
Sbjct  322   VAAI  325



>ref|XP_009609107.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 [Nicotiana 
tomentosiformis]
Length=339

 Score =   384 bits (985),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 213/309 (69%), Positives = 249/309 (81%), Gaps = 16/309 (5%)
 Frame = -1

Query  1320  CCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGV  1141
             CCKKK    E+            K SA++Y+LM++  ATDGFN RRIIG+GR+G VY+ +
Sbjct  31    CCKKKPIKAEET--------LPTKQSASSYSLMDIHTATDGFNYRRIIGQGRIGSVYAAI  82

Query  1140  LQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVME  961
             L P GE VAVKR HPRLVLSNA G GFSS+++WLSL DHPN+VPILGFSEAPGERIVVME
Sbjct  83    L-PNGEQVAVKRIHPRLVLSNA-GLGFSSIMKWLSLVDHPNIVPILGFSEAPGERIVVME  140

Query  960   YGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLI  781
             + GMLSL+FYLHQN D AALL WS RLR+AAGVA+G+E+LHE M P+I+HGC+K SN+LI
Sbjct  141   FEGMLSLDFYLHQNYDGAALLDWSCRLRIAAGVAKGIEYLHEVMAPNIIHGCIKPSNILI  200

Query  780   DVEFSARLCDYGLYFLASNERQE---VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLS  610
             DV+F AR+CDYGLYF   N  +    ++GYVDEEYW+E +GGSKESDVYG GVVLLELLS
Sbjct  201   DVKFCARICDYGLYFFLRNNYERKLGLMGYVDEEYWIEKKGGSKESDVYGLGVVLLELLS  260

Query  609   GRK---SQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSR  439
             GR+   +QE LLVKWALPLIKEM+F E LDPR+ IP D  PLVRLAKVA ACVGNSRKSR
Sbjct  261   GRRNSDNQENLLVKWALPLIKEMKFSEFLDPRLVIPSDTRPLVRLAKVALACVGNSRKSR  320

Query  438   PTIVQVAAI  412
             P+IVQVAAI
Sbjct  321   PSIVQVAAI  329



>gb|KDO77711.1| hypothetical protein CISIN_1g020027mg [Citrus sinensis]
Length=332

 Score =   382 bits (981),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 205/307 (67%), Positives = 251/307 (82%), Gaps = 12/307 (4%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
              V CKKK   VE ++   I      KL A AY L E+DAATDGF+ RRIIG+GRLG VY+
Sbjct  28    IVLCKKK--PVESEETLPI------KLCAFAYPLTEIDAATDGFSHRRIIGQGRLGTVYA  79

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
              +L   G+LVAVKR HPRLVLSNA GFGF+SV++ LSLA HPN+VPILGFS+APGERI+V
Sbjct  80    ALLS-TGKLVAVKRIHPRLVLSNA-GFGFASVIKTLSLAQHPNIVPILGFSQAPGERIIV  137

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
              E+  M SL+FYLH+N D A+LL W+RRLR+A G ARGLE+LH+G+ P+I+HGC+KASN+
Sbjct  138   SEFINMASLDFYLHENNDGASLLDWNRRLRIATGAARGLEYLHQGVAPNIIHGCIKASNI  197

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGG--SKESDVYGFGVVLLELL  613
             L++ +F AR+CDYGL FLA  E++ + GYVD++YW E  GG  ++ESDVYGFGVVLLE+L
Sbjct  198   LLNEKFCARVCDYGLSFLAPEEKRGLAGYVDDDYWHEKGGGNATRESDVYGFGVVLLEIL  257

Query  612   SGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPT  433
             SGR+ +EGLLVKWALPLIKEMRF E+LDPR+AIPC+I PLVRLAKVA ACVGNSRK+RP+
Sbjct  258   SGRRCEEGLLVKWALPLIKEMRFSELLDPRLAIPCEIKPLVRLAKVALACVGNSRKNRPS  317

Query  432   IVQVAAI  412
             IVQVA I
Sbjct  318   IVQVATI  324



>ref|XP_010655460.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Vitis vinifera]
Length=332

 Score =   382 bits (981),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 206/305 (68%), Positives = 243/305 (80%), Gaps = 10/305 (3%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F+ C+KK   VE ++   I      KL A A  L ++DAATD FN RRIIGKGRLG VY+
Sbjct  28    FILCRKK--PVESEETLPI------KLCAQACPLTDIDAATDCFNHRRIIGKGRLGTVYA  79

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
               L   GELVAVKR HP LVLSNA  FGFSS+LR LSLA HPN+V I+GFSE PGERI+V
Sbjct  80    A-LSGRGELVAVKRIHPGLVLSNAC-FGFSSILRSLSLAQHPNIVSIVGFSEGPGERIIV  137

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             ME+ GM+SL+FYL QN D A+LL W RRLR+AAG ARGLE+LHEGM PHIVHGC+KASN+
Sbjct  138   MEFAGMVSLDFYLQQNSDGASLLDWGRRLRIAAGAARGLEYLHEGMTPHIVHGCIKASNI  197

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSG  607
             +IDV+F AR+CDYGL FLA +E++ ++GYVD+EYW E  G SKESDVYGFGV+LLELLSG
Sbjct  198   IIDVKFCARVCDYGLSFLAPHEKRGLVGYVDDEYWAERGGASKESDVYGFGVMLLELLSG  257

Query  606   RKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIV  427
             R+S EGLLV+WALPLIKEM    +LDPR+ IP D+  L+RLAKVASACVGNSRK+RP+I 
Sbjct  258   RRSDEGLLVEWALPLIKEMNISALLDPRLVIPSDMKHLIRLAKVASACVGNSRKNRPSIA  317

Query  426   QVAAI  412
             QV AI
Sbjct  318   QVVAI  322



>ref|XP_006449415.1| hypothetical protein CICLE_v10015883mg [Citrus clementina]
 gb|ESR62655.1| hypothetical protein CICLE_v10015883mg [Citrus clementina]
Length=332

 Score =   382 bits (981),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 205/307 (67%), Positives = 251/307 (82%), Gaps = 12/307 (4%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
              V CKKK   VE ++   I      KL A AY L E+DAATDGF+ RRIIG+GRLG VY+
Sbjct  28    IVLCKKK--PVESEETLPI------KLCACAYPLTEIDAATDGFSHRRIIGQGRLGTVYA  79

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
              +L   G+LVAVKR HPRLVLSNA GFGF+SV++ LSLA HPN+VPILGFS+APGERI+V
Sbjct  80    ALLS-TGKLVAVKRIHPRLVLSNA-GFGFASVIKTLSLAQHPNIVPILGFSQAPGERIIV  137

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
              E+  M SL+FYLH+N D A+LL W+RRLR+A G ARGLE+LH+G+ P+I+HGC+KASN+
Sbjct  138   SEFINMASLDFYLHENNDGASLLDWNRRLRIATGAARGLEYLHQGVAPNIIHGCIKASNI  197

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGG--SKESDVYGFGVVLLELL  613
             L++ +F A +CDYGL FLA  E++ + GYVD++YW E  GG  ++ESDVYGFGVVLLE+L
Sbjct  198   LLNEKFCAMVCDYGLSFLAPEEKRGLAGYVDDDYWHERGGGNATRESDVYGFGVVLLEIL  257

Query  612   SGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPT  433
             SGR+S+EGLLVKWALPLIKEMRF E+LDPR+AIPC+I PLVRLAKVA ACVGNSRK+RP+
Sbjct  258   SGRRSEEGLLVKWALPLIKEMRFSELLDPRLAIPCEIKPLVRLAKVALACVGNSRKNRPS  317

Query  432   IVQVAAI  412
             IVQVA I
Sbjct  318   IVQVATI  324



>ref|XP_007148114.1| hypothetical protein PHAVU_006G181600g [Phaseolus vulgaris]
 gb|ESW20108.1| hypothetical protein PHAVU_006G181600g [Phaseolus vulgaris]
Length=334

 Score =   379 bits (972),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 245/307 (80%), Gaps = 12/307 (4%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F+ CKKK   VE ++   +      KL A AY LME+DAAT GFN RRIIG+GRLG VY+
Sbjct  28    FLACKKK--PVESEETLPV------KLCARAYPLMEVDAATGGFNHRRIIGQGRLGTVYA  79

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
             G L+ E ELVAVKR HP LVLSNA GFGFSSVL+WLSLA HPN+VPI+GFSEAPGER+++
Sbjct  80    GTLEKE-ELVAVKRIHPVLVLSNA-GFGFSSVLKWLSLAQHPNVVPIIGFSEAPGERVIL  137

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             ME+  M SL+FYLHQN D A+LL W++R R+AAG ARGL++LHE + P+IVHGCVK+SN+
Sbjct  138   MEFVHMASLDFYLHQNQDGASLLDWNKRFRIAAGAARGLQYLHEVVAPNIVHGCVKSSNI  197

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGG--SKESDVYGFGVVLLELL  613
             LIDV F AR+ DYGL FLA  E++ ++GYVD+EYW E RGG  +KESDVYG GV+LLELL
Sbjct  198   LIDVNFCARISDYGLNFLAPVEKRGLVGYVDDEYWSERRGGGATKESDVYGLGVILLELL  257

Query  612   SGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPT  433
             +G+  + GLLVKWALPLI+E  F E+LDPR+ IP D  PLVRLAKVASACVGNSRK RP+
Sbjct  258   TGKGCEGGLLVKWALPLIRETSFSELLDPRLVIPSDTKPLVRLAKVASACVGNSRKCRPS  317

Query  432   IVQVAAI  412
             + QVA I
Sbjct  318   VAQVATI  324



>ref|XP_009800291.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 [Nicotiana 
sylvestris]
Length=339

 Score =   377 bits (969),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 209/309 (68%), Positives = 246/309 (80%), Gaps = 16/309 (5%)
 Frame = -1

Query  1320  CCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGV  1141
             CCKKK    E+            K SA++Y+LM++  ATDGFN RRIIG+GR+G VY+ +
Sbjct  31    CCKKKPIKAEET--------LPTKQSASSYSLMDIHTATDGFNYRRIIGQGRIGSVYAAI  82

Query  1140  LQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVME  961
             L P GE VAVKR HP LVLSNA G GFSS+++WLSL DHPN+V ILGFSEAPGERIVVME
Sbjct  83    L-PNGEQVAVKRIHPSLVLSNA-GLGFSSIMKWLSLVDHPNIVSILGFSEAPGERIVVME  140

Query  960   YGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLI  781
             Y GMLSL+FYLHQN D  ALL WS RLR+AA VA+G+E+LHE M P+I+HGC+K SN+LI
Sbjct  141   YEGMLSLDFYLHQNYDGVALLDWSCRLRIAANVAKGIEYLHEVMAPNIIHGCIKPSNILI  200

Query  780   DVEFSARLCDYGLYFLASNERQE---VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLS  610
             DV+F AR+CDYGLYF   N  +    ++GYVD+EYW+E +GGSKESDVYG GVVLLELLS
Sbjct  201   DVKFCARVCDYGLYFFLGNNYERKLGLMGYVDDEYWIEKKGGSKESDVYGLGVVLLELLS  260

Query  609   GRK---SQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSR  439
             GR+   +QE LLVKWALPLIKEM+F E LDPR+ IP DI P+VRLAKVA ACVGNSRKSR
Sbjct  261   GRRNSDNQENLLVKWALPLIKEMKFSEFLDPRLVIPSDIRPIVRLAKVALACVGNSRKSR  320

Query  438   PTIVQVAAI  412
             P+IVQVAAI
Sbjct  321   PSIVQVAAI  329



>ref|XP_010057359.1| PREDICTED: putative receptor protein kinase CRINKLY4 [Eucalyptus 
grandis]
 gb|KCW74512.1| hypothetical protein EUGRSUZ_E03227 [Eucalyptus grandis]
Length=336

 Score =   374 bits (961),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 203/308 (66%), Positives = 243/308 (79%), Gaps = 15/308 (5%)
 Frame = -1

Query  1323  VCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSG  1144
             + CKKK   VE +D   +      K+ A AY L ++D+ATDGFNP RIIG+GR+G VY+ 
Sbjct  30    ISCKKK--PVESEDAVPV------KVCARAYPLTDIDSATDGFNPTRIIGQGRVGTVYAA  81

Query  1143  VLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVM  964
              L   GELVAVKR HP LVLS A GFGFSSV++ +SLA HPN+VPI+G S+ P ERIVV 
Sbjct  82    ALA-GGELVAVKRIHPGLVLSQA-GFGFSSVIKTISLALHPNIVPIIGLSQGPAERIVVT  139

Query  963   EYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVL  784
             E+  + SLEFYLHQNPD A+LL W+RR+R+AAG ARGLE+LHEGMVP +VHGCVKASN+L
Sbjct  140   EFVSLGSLEFYLHQNPDGASLLDWNRRVRIAAGAARGLEYLHEGMVPAVVHGCVKASNIL  199

Query  783   IDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGS----KESDVYGFGVVLLEL  616
             ID  F AR+ DYGL FLA  ER+ ++G+VDEEYW  GRGGS    KE+DVYGFGVVLLEL
Sbjct  200   IDANFCARVSDYGLAFLAPRERKGLVGFVDEEYW-SGRGGSFLACKETDVYGFGVVLLEL  258

Query  615   LSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRP  436
             LSGR+ +EG LVKWALPLIK+MRFGE+LDPR+ IP D+ PLVR+A+VA ACVGNSRKSRP
Sbjct  259   LSGRRCEEGFLVKWALPLIKDMRFGELLDPRLVIPSDLKPLVRMARVALACVGNSRKSRP  318

Query  435   TIVQVAAI  412
             +I QV  I
Sbjct  319   SIAQVVVI  326



>ref|XP_003529351.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Glycine max]
 gb|KHN15496.1| Serine/threonine-protein kinase-like protein ACR4 [Glycine soja]
Length=335

 Score =   374 bits (961),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 197/306 (64%), Positives = 240/306 (78%), Gaps = 9/306 (3%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             ++ CKKK   VE ++        A K    AY+LM++DAATDGF+  RI+GKGR+G VY+
Sbjct  28    YLVCKKKPVNVESEET------LALKHCVRAYSLMDIDAATDGFDHSRIVGKGRVGTVYA  81

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
              V Q  GELVAVKR H  LVLSNA GFGFSSVL+WLS A HPN+VPI+GFSEAPGERI+V
Sbjct  82    AV-QENGELVAVKRIHSVLVLSNA-GFGFSSVLKWLSSAHHPNIVPIIGFSEAPGERIIV  139

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             ME+G M+SL+FYLHQN + A+LL W++R+R+ AG ARG+++LHE   P+IVHGCVK+SNV
Sbjct  140   MEFGRMVSLDFYLHQNVNGASLLDWNKRIRIVAGAARGIQYLHEVATPNIVHGCVKSSNV  199

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWV-EGRGGSKESDVYGFGVVLLELLS  610
             LIDV F  R+CDYGL FLA  E++ ++G VD+EYW  EG G SKESDVYG GVV+LELLS
Sbjct  200   LIDVNFCTRICDYGLNFLAPREKRGLVGNVDDEYWNEEGGGASKESDVYGLGVVMLELLS  259

Query  609   GRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTI  430
             GR  +EGL+ KWA+PLIKEM FGE+LD R+ IP D+ PLVRLAKVA ACVGNSRK RP+I
Sbjct  260   GRGCEEGLIAKWAMPLIKEMSFGELLDARLVIPSDMKPLVRLAKVALACVGNSRKCRPSI  319

Query  429   VQVAAI  412
              QV  I
Sbjct  320   AQVTTI  325



>ref|XP_003542719.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Glycine max]
Length=333

 Score =   373 bits (958),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 241/306 (79%), Gaps = 11/306 (4%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             ++ CKKK   VE ++        A K  A AY+LM++ AATDGFN  RI+GKGR+G VY+
Sbjct  28    YLVCKKK--PVESEET------LAVKHCARAYSLMDIHAATDGFNHSRILGKGRVGTVYA  79

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
             GV Q  GELVAVKR H  LVLSNA GFGFSSVL+WLS A HPN+V ILGFSEAPGERI+V
Sbjct  80    GV-QENGELVAVKRIHSVLVLSNA-GFGFSSVLKWLSSAQHPNIVSILGFSEAPGERIIV  137

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             ME+G M+SL+FYLHQN + A+LL W++R+R+A+G ARG+++LHE   P+IVHGCVK+SNV
Sbjct  138   MEFGRMVSLDFYLHQNVNGASLLDWNKRIRIASGAARGIQYLHEVATPNIVHGCVKSSNV  197

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWV-EGRGGSKESDVYGFGVVLLELLS  610
             LIDV F  R+CDYGL FLA  E++ ++GYVD+EYW  EG G  KESDVYG GV++LELLS
Sbjct  198   LIDVNFCPRICDYGLNFLAPREKRGLVGYVDDEYWNEEGGGAGKESDVYGLGVIMLELLS  257

Query  609   GRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTI  430
             GR  +EGL+ KWALPLIKE  FGE+LD R+ IP D+ PLVRLAKVASACVGNSRK RP+I
Sbjct  258   GRGCEEGLIAKWALPLIKETSFGELLDARLVIPSDMKPLVRLAKVASACVGNSRKCRPSI  317

Query  429   VQVAAI  412
              QV  I
Sbjct  318   AQVTTI  323



>ref|XP_004293894.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Fragaria vesca subsp. vesca]
Length=338

 Score =   372 bits (956),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 234/302 (77%), Gaps = 7/302 (2%)
 Frame = -1

Query  1317  CKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVL  1138
             CKKK    +D  +E +     A++    Y L ++D ATDGFN RRI+G+GRLG VY+ + 
Sbjct  35    CKKKH-TTDDQSEEAV---IPARICPRVYPLTDIDVATDGFNRRRIVGEGRLGTVYAAIF  90

Query  1137  QPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY  958
             + +GE+ AVKR HPRLVL N  GFGFS  L  LSLA HPN+VPI+G+SEAPGER++VME+
Sbjct  91    E-KGEIAAVKRIHPRLVLGNI-GFGFSRTLSCLSLAQHPNIVPIVGYSEAPGERVIVMEF  148

Query  957   GGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLID  778
              GM+ L+FYLHQNPD  +LL W  RL +AAG A GL++LHEG+ P+IVHGCVKASN+LID
Sbjct  149   VGMVCLDFYLHQNPDGGSLLDWKHRLNIAAGAATGLQYLHEGVAPNIVHGCVKASNILID  208

Query  777   VEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS  598
             V F AR+CDYGL FLA  E++ ++GYVD+EYW  G G  KESD+YGFGVVLLELLSGR+ 
Sbjct  209   VNFYARVCDYGLSFLAPKEKRGLVGYVDDEYW-RGGGVCKESDMYGFGVVLLELLSGRRC  267

Query  597   QEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVA  418
             +EG LVKWALPLIKEMRF E LDPR+  P DI PLVR+AKVAS CV NSRKSRP+I QVA
Sbjct  268   EEGFLVKWALPLIKEMRFNEFLDPRLVFPRDIMPLVRMAKVASTCVSNSRKSRPSISQVA  327

Query  417   AI  412
              I
Sbjct  328   TI  329



>ref|XP_008225156.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Prunus mume]
Length=331

 Score =   369 bits (946),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 190/280 (68%), Positives = 228/280 (81%), Gaps = 3/280 (1%)
 Frame = -1

Query  1251  KLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAA  1072
             K SA  Y L  +DAATDGFN RRI+G+GRLG VY+ + + +GE+ AVKR H R VLSNA 
Sbjct  48    KPSAQVYPLTNIDAATDGFNHRRIVGEGRLGTVYAAIFE-KGEIAAVKRIHSRHVLSNA-  105

Query  1071  GFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHW  892
             GFGFS +LR +S A HPN+VPI+G+SE PGERI+VME+ GM+ L+FYLHQNP+ A+LL W
Sbjct  106   GFGFSRILRSISSAQHPNVVPIIGYSEGPGERIIVMEFVGMVCLDFYLHQNPEGASLLDW  165

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
             + RL++AAG A+GLE+LHEG+ P+IVHGCVKASN+LIDV F AR+CDYGL FLA  E++ 
Sbjct  166   NHRLKIAAGAAKGLEYLHEGVAPNIVHGCVKASNILIDVNFCARICDYGLSFLAPQEKRG  225

Query  711   VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKEMRFGEVL  532
             ++GYVD+EYW  G G  KESDVYGFG+VLLELLSGR  +EG LV WALPLIKEMR  E+L
Sbjct  226   LVGYVDDEYW-RGSGACKESDVYGFGIVLLELLSGRLCEEGRLVNWALPLIKEMRISELL  284

Query  531   DPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             DP + IP DI  LVRLAKVASACVGNSRKSRP+I QVA I
Sbjct  285   DPGLVIPVDIRALVRLAKVASACVGNSRKSRPSICQVATI  324



>gb|KDP21015.1| hypothetical protein JCGZ_21486 [Jatropha curcas]
Length=333

 Score =   367 bits (942),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 242/306 (79%), Gaps = 12/306 (4%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F C KK    VE ++   +       +SA  Y L ++D ATDGFN +RIIG+GRLG VY+
Sbjct  29    FTCRKK---PVESEESLSV------NVSAPTYQLTDIDTATDGFNHQRIIGEGRLGTVYA  79

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
              +L P  +LVAVKR HP LVL NA  FGFSS L+ LSLA HPN+V ILGFS+APGERI++
Sbjct  80    AIL-PREKLVAVKRIHPSLVLRNA-DFGFSSTLKTLSLAHHPNIVRILGFSQAPGERIII  137

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             M++ GM SL+FYLH+N D  +LL WSRRLR+AA  ARGLE+LH+GM P+++HG  KA+N+
Sbjct  138   MDFVGMASLDFYLHENSDGGSLLDWSRRLRIAADAARGLEYLHDGMAPNVIHGSFKAANI  197

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGG-SKESDVYGFGVVLLELLS  610
             L+D++F+A++CDYGL  LA NE++ V+GYVD+EYW    GG SK+ DVY FGVVLLELL+
Sbjct  198   LLDLKFNAKVCDYGLSSLAPNEKRAVLGYVDDEYWSPTGGGPSKQGDVYAFGVVLLELLT  257

Query  609   GRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTI  430
             GR++++GLLVKWALPLIKE+RF E+LDPR+ IP D+ P+VRLAKVASACV NSRKSRPTI
Sbjct  258   GRRNEQGLLVKWALPLIKEVRFSEILDPRLPIPSDMKPIVRLAKVASACVSNSRKSRPTI  317

Query  429   VQVAAI  412
             VQVAAI
Sbjct  318   VQVAAI  323



>gb|KHN09962.1| Serine/threonine-protein kinase-like protein ACR4 [Glycine soja]
Length=280

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 189/272 (69%), Positives = 226/272 (83%), Gaps = 3/272 (1%)
 Frame = -1

Query  1224  MEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLR  1045
             M++ AATDGFN  RI+GKGR+G VY+GV Q  GELVAVKR H  LVLSNA GFGFSSVL+
Sbjct  1     MDIHAATDGFNHSRILGKGRVGTVYAGV-QENGELVAVKRIHSVLVLSNA-GFGFSSVLK  58

Query  1044  WLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaag  865
             WLS A HPN+V ILGFSEAPGERI+VME+G M+SL+FYLHQN + A+LL W++R+R+A+G
Sbjct  59    WLSSAQHPNIVSILGFSEAPGERIIVMEFGRMVSLDFYLHQNVNGASLLDWNKRIRIASG  118

Query  864   vargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVIGYVDEEY  685
              ARG+++LHE   P+IVHGCVK+SNVLIDV F  R+CDYGL FLA  E++ ++GYVD+EY
Sbjct  119   AARGIQYLHEVATPNIVHGCVKSSNVLIDVNFCPRICDYGLNFLAPREKRGLVGYVDDEY  178

Query  684   WV-EGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPC  508
             W  EG G SKESDVYG GV++LELLSGR  +EGL+ KWALPLIKEM FGE+LD R+ IP 
Sbjct  179   WNEEGGGASKESDVYGLGVIMLELLSGRGCEEGLIAKWALPLIKEMSFGELLDARLVIPS  238

Query  507   DINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             D+ PLVRLAKVASACVGNSRK RP+I QV  I
Sbjct  239   DMKPLVRLAKVASACVGNSRKCRPSIAQVTTI  270



>ref|XP_003543022.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Glycine max]
Length=336

 Score =   367 bits (941),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 207/308 (67%), Positives = 248/308 (81%), Gaps = 12/308 (4%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F+ CKKK   VE ++   +      KL A A+ LME+DAATDGFNPRRIIG+GRLG VY+
Sbjct  28    FLACKKK--PVESEETLPV------KLCARAHPLMEIDAATDGFNPRRIIGQGRLGTVYA  79

Query  1146  GVLQPEGE-LVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIV  970
             G L  E E LVA+KR HP LVLSN AGFGFSSVL+WLSLA HPN+VPI+GFSEAPGER++
Sbjct  80    GTLDKEKEQLVALKRIHPFLVLSN-AGFGFSSVLKWLSLAQHPNVVPIIGFSEAPGERVI  138

Query  969   VMEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASN  790
             VME+  M SL+FYLHQN D A+LL W++R R+AAGVARGL++LHE + P+IVHGCVK+SN
Sbjct  139   VMEFVHMASLDFYLHQNQDGASLLDWNKRFRIAAGVARGLQYLHEVVAPNIVHGCVKSSN  198

Query  789   VLIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGG--SKESDVYGFGVVLLEL  616
             +LIDV F AR+CDYGL FLA  E++ ++GYVD+EYW E RGG  +KESDVYG GVVLLEL
Sbjct  199   ILIDVNFCARICDYGLNFLAPVEKRGIVGYVDDEYWSERRGGVATKESDVYGLGVVLLEL  258

Query  615   LSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRP  436
             LSG+  + GLLVKWALPLI+E  F E+LDPR+ IP D+ PLVRLAKV SACVGNSRK RP
Sbjct  259   LSGKGCEGGLLVKWALPLIRETSFSELLDPRLVIPSDMKPLVRLAKVVSACVGNSRKCRP  318

Query  435   TIVQVAAI  412
             ++ QVA I
Sbjct  319   SVAQVATI  326



>gb|KHN18943.1| Serine/threonine-protein kinase-like protein ACR4 [Glycine soja]
Length=337

 Score =   366 bits (939),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 207/309 (67%), Positives = 246/309 (80%), Gaps = 13/309 (4%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F+ CKKK   VE ++   +      KL A AY LME+DAATDGFN RRIIG+GRLG VY+
Sbjct  28    FLACKKK--PVESEETLPV------KLCARAYPLMEIDAATDGFNHRRIIGQGRLGTVYA  79

Query  1146  GVL-QPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIV  970
             G L Q E +LVAVKR HP LVLSNA GFGFSSVL+WLSLA HPN+VPI GFSEAPGER+V
Sbjct  80    GTLEQEEQQLVAVKRIHPFLVLSNA-GFGFSSVLKWLSLAQHPNVVPITGFSEAPGERVV  138

Query  969   VMEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASN  790
             +ME+  M SL+FYLHQN D A+LL W++R R+AAG ARGL++LHE + P+IVHGCVK+SN
Sbjct  139   LMEFVHMASLDFYLHQNQDGASLLDWNKRFRIAAGAARGLQYLHEVVAPNIVHGCVKSSN  198

Query  789   VLIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGG---SKESDVYGFGVVLLE  619
             +LIDV F AR+CDYGL FLA  E++  +GYVD+EYW E RGG   +KESDVYG GVVLLE
Sbjct  199   ILIDVNFCARICDYGLNFLAPVEKRGTVGYVDDEYWSERRGGGVATKESDVYGLGVVLLE  258

Query  618   LLSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSR  439
             LLSG+  + G+LVKWALPLI+E  F E+LDPR+ IP D+ PLVRLAKVASACVGNSRK R
Sbjct  259   LLSGKGCEGGMLVKWALPLIRETSFSELLDPRLVIPSDMKPLVRLAKVASACVGNSRKCR  318

Query  438   PTIVQVAAI  412
             P++ QVA I
Sbjct  319   PSMAQVATI  327



>emb|CAN77470.1| hypothetical protein VITISV_029763 [Vitis vinifera]
Length=796

 Score =   380 bits (975),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 206/305 (68%), Positives = 243/305 (80%), Gaps = 10/305 (3%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F+ C+KK   VE ++   I      KL A A  L ++DAATD FN RRIIGKGRLG VY+
Sbjct  75    FILCRKK--PVESEETLPI------KLCAQACPLTDIDAATDCFNHRRIIGKGRLGTVYA  126

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
               L   GELVAVKR HP LVLSNA  FGFSS+LR LSLA HPN+V I+GFSE PGERI+V
Sbjct  127   -ALSGRGELVAVKRIHPGLVLSNAC-FGFSSILRSLSLAQHPNIVSIVGFSEGPGERIIV  184

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             ME+ GM+SL+FYL QN D A+LL W RRLR+AAG ARGLE+LHEGM PHIVHGC+KASN+
Sbjct  185   MEFAGMVSLDFYLQQNSDGASLLDWGRRLRIAAGAARGLEYLHEGMTPHIVHGCIKASNI  244

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSG  607
             +IDV+F AR+CDYGL FLA +E++ ++GYVD+EYW E  G SKESDVYGFGV+LLELLSG
Sbjct  245   IIDVKFCARVCDYGLSFLAPHEKRGLVGYVDDEYWAERGGASKESDVYGFGVMLLELLSG  304

Query  606   RKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIV  427
             R+S EGLLV+WALPLIKEM    +LDPR+ IP D+  L+RLAKVASACVGNSRK+RP+I 
Sbjct  305   RRSDEGLLVEWALPLIKEMNISXLLDPRLVIPSDMKHLIRLAKVASACVGNSRKNRPSIA  364

Query  426   QVAAI  412
             QV AI
Sbjct  365   QVVAI  369



>ref|XP_010245579.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Nelumbo nucifera]
Length=335

 Score =   362 bits (930),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 189/305 (62%), Positives = 239/305 (78%), Gaps = 8/305 (3%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F+ CKKK PA  + ++         KLS  AY+L ++DAATDGFN R+IIG+GRLG VY 
Sbjct  29    FILCKKKEPAAVESEES-----LHLKLSVRAYSLTDVDAATDGFNKRQIIGQGRLGTVYE  83

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
               L   GEL+A+KR HPRLVLSNA GFGFSS+++ LS ADHP++VPI+GFSEAPGERI++
Sbjct  84    AHLTG-GELIAIKRIHPRLVLSNA-GFGFSSIVKSLSFADHPHIVPIIGFSEAPGERIIL  141

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             ME+ GM SL+++LH + + AA L W RRL++AAG ARG+++LHE M PH+VHGCVK SN+
Sbjct  142   MEFMGMRSLDYHLHHDCNGAAFLDWGRRLQIAAGAARGIKYLHEDMTPHVVHGCVKPSNI  201

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSG  607
             LID+   AR+ DYGL+FLA  ER+ ++GYVD EYW E R   K SDV+GFGVVLLELLSG
Sbjct  202   LIDLRICARVGDYGLFFLAPQERRGLVGYVDAEYWTEKR-VCKASDVFGFGVVLLELLSG  260

Query  606   RKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIV  427
             R+ +EG+LV+WALP IK+M+  E+LDP + +P DI PLVRLAKVASACV NSRK+RP+IV
Sbjct  261   RRCEEGMLVEWALPFIKDMKIEEILDPGLQLPSDIKPLVRLAKVASACVSNSRKNRPSIV  320

Query  426   QVAAI  412
             QV  I
Sbjct  321   QVVTI  325



>ref|XP_006377418.1| kinase family protein [Populus trichocarpa]
 gb|ERP55215.1| kinase family protein [Populus trichocarpa]
Length=337

 Score =   361 bits (927),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 194/306 (63%), Positives = 242/306 (79%), Gaps = 9/306 (3%)
 Frame = -1

Query  1323  VCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSG  1144
             + C+K +P +E ++        AAK+SA  Y L ++D AT+GFN RRIIG GRLG VY+ 
Sbjct  29    IFCRKIKP-IESEES-----LPAAKISAQGYPLTDIDDATEGFNRRRIIGTGRLGTVYAA  82

Query  1143  VLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVM  964
             VL  + + VAVKR HP LVLSNA GFGF+S+L+ LS A HPN+VPILGFS+APGERI+VM
Sbjct  83    VLPSDQKPVAVKRIHPSLVLSNA-GFGFTSILKTLSSARHPNIVPILGFSQAPGERIIVM  141

Query  963   EYGGMLSLEFYLHQNPD-AAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             E+   +SL++YLH+N D A++LL WSRRL +AAG ARGLE+LHEGM P+IVHGC KASNV
Sbjct  142   EFVSAVSLDYYLHENSDGASSLLDWSRRLSIAAGAARGLEYLHEGMAPNIVHGCFKASNV  201

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRG-GSKESDVYGFGVVLLELLS  610
             L+D +  AR+ DYGL  LA  E++ + GYVD+E+W  GRG   KE DVYGFGVVLLELLS
Sbjct  202   LLDDKLCARVSDYGLSSLAPYEKRGLAGYVDDEHWRNGRGEACKEGDVYGFGVVLLELLS  261

Query  609   GRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTI  430
             GR+++EGLLV+WALPLIK+MRF E+LD R+ +P D+ P++RLAKVASACV NSRKSRPTI
Sbjct  262   GRRAEEGLLVRWALPLIKQMRFSELLDLRLVMPSDMRPIIRLAKVASACVSNSRKSRPTI  321

Query  429   VQVAAI  412
             VQVA I
Sbjct  322   VQVATI  327



>ref|XP_004485842.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Cicer arietinum]
Length=336

 Score =   359 bits (921),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 201/308 (65%), Positives = 236/308 (77%), Gaps = 15/308 (5%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F  CKKK   VE ++   I      K SA AY L E+DAAT+GFN RRIIGKGRLG VY+
Sbjct  28    FYYCKKK--PVESEETLPI------KQSARAYPLTEIDAATNGFNHRRIIGKGRLGTVYA  79

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
             G LQ   ELVAVKR HP LVLS A GFGFSSV++ LSLA H N+V I+GFSE PGERI+V
Sbjct  80    GTLQ---ELVAVKRIHPVLVLSKA-GFGFSSVMKSLSLAQHTNVVSIIGFSEGPGERIIV  135

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             ME+  M SL+FYLH + D A+LL W++R ++AAGVARGL++LHE + P+IVHGCVK+SNV
Sbjct  136   MEFIRMSSLDFYLHGDNDGASLLDWNKRFKIAAGVARGLQYLHEVVSPNIVHGCVKSSNV  195

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWV---EGRGGSKESDVYGFGVVLLEL  616
             LIDV F AR+CDYGL F    E++ +IGYVD+EYW     G GGSKESDVYG GV+LLE+
Sbjct  196   LIDVNFCARICDYGLNFFGLVEKRGLIGYVDDEYWNNEGNGLGGSKESDVYGLGVILLEI  255

Query  615   LSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRP  436
             LSGR+ + GLLVKWALPLIKEMRF EVLDPR+ IPCD+ P VRLAKVA ACVGNSRK RP
Sbjct  256   LSGRECEGGLLVKWALPLIKEMRFSEVLDPRLVIPCDMKPFVRLAKVALACVGNSRKCRP  315

Query  435   TIVQVAAI  412
              +  V  I
Sbjct  316   CVDHVVNI  323



>ref|XP_007159372.1| hypothetical protein PHAVU_002G232700g [Phaseolus vulgaris]
 gb|ESW31366.1| hypothetical protein PHAVU_002G232700g [Phaseolus vulgaris]
Length=332

 Score =   357 bits (916),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 233/306 (76%), Gaps = 11/306 (4%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F+ CKKK+   E+          + K  A  Y+LM++DA TDGFN RRI+GKGRLG VY+
Sbjct  27    FLACKKKQVECEET--------PSVKHCARVYSLMDIDAVTDGFNHRRIVGKGRLGTVYA  78

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
             GV Q  GELVAVKR HP LVLSNA G GFSS L+WLS   HPN+VPI+GFSEAPGER++V
Sbjct  79    GV-QENGELVAVKRIHPVLVLSNA-GLGFSSALKWLSSVQHPNIVPIIGFSEAPGERVIV  136

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             ME+  M SLEFYLHQN + A+LL W++R+R+AAG ARG+++LHE   P+I+HG VK+SNV
Sbjct  137   MEFVRMTSLEFYLHQNVNGASLLDWNKRIRIAAGAARGVQYLHEVATPNIIHGRVKSSNV  196

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVE-GRGGSKESDVYGFGVVLLELLS  610
             LID+ F  R+CDYGL FLA  E++E++G VD+EYW + G G SKESDVYG G+V+LELLS
Sbjct  197   LIDINFCPRICDYGLDFLAPREKRELVGDVDDEYWNQRGGGASKESDVYGLGIVMLELLS  256

Query  609   GRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTI  430
             GR  +EG+  +W L LIK + FGEVLDPR+ IP D+ PL RLAKVASACV NSRK RP+I
Sbjct  257   GRGCKEGVTAEWCLGLIKALSFGEVLDPRLVIPSDMKPLFRLAKVASACVANSRKCRPSI  316

Query  429   VQVAAI  412
              QV  I
Sbjct  317   EQVTTI  322



>ref|XP_009352846.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Pyrus x bretschneideri]
Length=336

 Score =   355 bits (910),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 192/309 (62%), Positives = 234/309 (76%), Gaps = 13/309 (4%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F+   KK+P    +           K SA  Y L  +D ATDGFN RRI+G+GR G VY+
Sbjct  30    FILLCKKKPVQTQETP------PLTKPSAQVYPLTNIDVATDGFNHRRIVGEGRFGTVYA  83

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
              + + +G++ AVKR H R VLSNA GFGFS +LR +SLA HPN+VPI+G+SE PGERI+V
Sbjct  84    AIFE-KGQIAAVKRIHSRHVLSNA-GFGFSRILRSISLAQHPNIVPIIGYSEGPGERIIV  141

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             ME+ GM+ L++YLHQNPD A+L  W+ RL++AAG A+GLE+LHEG+ P+I+HGCVKASN+
Sbjct  142   MEFVGMVCLDYYLHQNPDGASL-DWNHRLKIAAGAAKGLEYLHEGVAPNIIHGCVKASNI  200

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYW----VEGRGGSKESDVYGFGVVLLE  619
             LIDV F AR+CDYGL FLA  E++ ++G+VDEEYW      G G  KESDVYGFGVVLLE
Sbjct  201   LIDVNFCARVCDYGLSFLAPQEKRGLLGHVDEEYWDGGLGGGGGACKESDVYGFGVVLLE  260

Query  618   LLSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSR  439
             LLSGR   EG LV W+LPLIKE RF E LDPR+AIP +I PLVRLAKVASACVGNSRKSR
Sbjct  261   LLSGRLCDEGRLVNWSLPLIKEKRFSEFLDPRLAIPSEILPLVRLAKVASACVGNSRKSR  320

Query  438   PTIVQVAAI  412
             P+I QVA I
Sbjct  321   PSIGQVATI  329



>ref|XP_006468213.1| PREDICTED: receptor-like protein kinase HSL1-like [Citrus sinensis]
Length=1381

 Score =   380 bits (976),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 204/307 (66%), Positives = 251/307 (82%), Gaps = 12/307 (4%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
              V CKKK   VE ++   I      KL A AY L E+DAATDGF+ RRIIG+GRLG VY+
Sbjct  1077  IVLCKKK--PVESEETLPI------KLCAFAYPLTEIDAATDGFSHRRIIGQGRLGTVYA  1128

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
              +L   G+LV+VKR HPRLVLSNA GFGF+SV++ LSLA HPN+VPILGFS+APGERI+V
Sbjct  1129  ALLS-TGKLVSVKRIHPRLVLSNA-GFGFASVIKTLSLAQHPNIVPILGFSQAPGERIIV  1186

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
              E+  M SL+FYLH+N D A+LL W+RRLR+A G ARGLE+LH+G+ P+I+HGC+KASN+
Sbjct  1187  SEFINMASLDFYLHENNDGASLLDWNRRLRIATGAARGLEYLHQGVAPNIIHGCIKASNI  1246

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGG--SKESDVYGFGVVLLELL  613
             L++ +F AR+CDYGL FLA  E++ + GYVD++YW E  GG  ++ESDVYGFGVVLLE+L
Sbjct  1247  LLNEKFCARVCDYGLSFLAPEEKRGLAGYVDDDYWHERGGGNATRESDVYGFGVVLLEIL  1306

Query  612   SGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPT  433
             SGR+ +EGLLVKWALPLIKEMRF E+LDPR+AIPC+I PLVRLAKVA ACVGNSRK+RP+
Sbjct  1307  SGRRCEEGLLVKWALPLIKEMRFSELLDPRLAIPCEIKPLVRLAKVALACVGNSRKNRPS  1366

Query  432   IVQVAAI  412
             IVQVA I
Sbjct  1367  IVQVATI  1373


 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 132/291 (45%), Gaps = 32/291 (11%)
 Frame = -1

Query  1203  DGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRL--------------VLSNAAGF  1066
             DG +   +IG G  G VY  VL   GE VAVK+    +              V       
Sbjct  683   DGLDEDNVIGSGSSGKVYKVVLS-NGEAVAVKKLWRGMSKECESGCDVEKGQVQDQVQDD  741

Query  1065  GFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSr  886
             GF + +  L    H N+V +         +++V EY    SL   LH       LL W  
Sbjct  742   GFQAEVETLGKIRHKNIVKLWCCCTTRDCKLLVYEYMPNGSLGDLLHSC--KGGLLDWPT  799

Query  885   rlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL--ASNERQE  712
             R ++    A GL +LH   VP IVH  VK++N+L+D +F AR+ D+G+  +  AS + + 
Sbjct  800   RYKIIVDAAEGLSYLHHDCVPSIVHRDVKSNNILLDGDFGARVADFGVAKVVDASGKPKS  859

Query  711   V------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGR-----KSQEGLLVKWALP  565
             +       GY+  EY    R   K SD+Y FGVV+LEL++GR     +  E  LVKW   
Sbjct  860   MSVIAGSCGYIAPEYAYTLRVNEK-SDIYSFGVVILELVTGRLPVDPEFGEKDLVKWVCS  918

Query  564   LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              + +     VLDP++   C    + ++  +   C      +RP + +V  +
Sbjct  919   TLDQKGVDHVLDPKLDC-CFKEEICKVLNIGLLCTSPLPINRPAMRRVVKL  968



>ref|XP_006361040.1| PREDICTED: serine/threonine-protein kinase-like protein CCR1-like 
[Solanum tuberosum]
Length=347

 Score =   354 bits (909),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 209/317 (66%), Positives = 245/317 (77%), Gaps = 23/317 (7%)
 Frame = -1

Query  1320  CCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGV  1141
             CCKKK    E+            K  A +Y+LM++  ATDGFN RRIIG+GR+G VY G+
Sbjct  31    CCKKKPIKAEET--------LPTKQIACSYSLMDIHGATDGFNYRRIIGQGRIGSVYVGI  82

Query  1140  LQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVME  961
             L    + VA+KR HPRLVLSNA GFGF+S+++WLSLA HPN+VPILGFSEAPGERIVV E
Sbjct  83    LPNGDQQVAIKRIHPRLVLSNA-GFGFTSMMKWLSLAYHPNIVPILGFSEAPGERIVVTE  141

Query  960   YGGMLSLEFYLHQNPD--------AAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGC  805
             +GGMLSL+FYLHQN D          +LL W+ RLRVAAG+ARG+E+LHE M PHIVHGC
Sbjct  142   FGGMLSLDFYLHQNRDHDGGAGSGGTSLLDWNCRLRVAAGIARGIEYLHEVMAPHIVHGC  201

Query  804   VKASNVLIDVEFSARLCDYGLYF-LASNERQEV--IGYVDEEYWV--EGRGGSKESDVYG  640
             +K SN+LIDV F AR+CDYGLYF L   +++E+  +GYVD+EYW+  E RG SKESDVYG
Sbjct  202   IKPSNILIDVNFCARVCDYGLYFFLTCYDKRELGLMGYVDDEYWIGNEKRGCSKESDVYG  261

Query  639   FGVVLLELLSGRK-SQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASAC  463
              GVVLLELLSGRK  QE LLVKWALPLIKEM+FGE LD R+ +P DI PLVRLAKVA AC
Sbjct  262   LGVVLLELLSGRKCDQESLLVKWALPLIKEMKFGEFLDNRLMLPSDIRPLVRLAKVALAC  321

Query  462   VGNSRKSRPTIVQVAAI  412
             VGNSRKSRP+IVQVA I
Sbjct  322   VGNSRKSRPSIVQVANI  338



>ref|XP_011001222.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Populus euphratica]
Length=337

 Score =   353 bits (906),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 237/306 (77%), Gaps = 9/306 (3%)
 Frame = -1

Query  1323  VCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSG  1144
             + C+K +P +E ++        AA +S   Y L  +D AT+GFN RRIIG GRLG VY+ 
Sbjct  29    IFCRKIKP-IESEES-----LPAANISVQGYPLTVIDDATEGFNHRRIIGTGRLGTVYAA  82

Query  1143  VLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVM  964
             VL  + + VAVKR HP LVLSNA GFGF+S+L+ LS A HPN+VPILGFS+APGERI+VM
Sbjct  83    VLPSDQKPVAVKRIHPSLVLSNA-GFGFTSILKTLSSARHPNIVPILGFSQAPGERIIVM  141

Query  963   EYGGMLSLEFYLHQNPD-AAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             E+   +SL++YLH+N D A++LL WSRRL +AAG ARGLE+LHE M P+IVHGC KASNV
Sbjct  142   EFVSAVSLDYYLHENSDGASSLLDWSRRLSIAAGAARGLEYLHEAMAPNIVHGCFKASNV  201

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRG-GSKESDVYGFGVVLLELLS  610
             L+D +  AR+ DYGL  LA  E++ + GYVD+E+W  GRG   KE DVYGFGVVLLELLS
Sbjct  202   LLDDKLCARVSDYGLSSLAPYEKRGLAGYVDDEHWRNGRGEACKEGDVYGFGVVLLELLS  261

Query  609   GRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTI  430
             GR+++EGLLV+WALPLIK+MRF E+LD R+ +P D+ P+ RLAKVASACV NSRKSRPTI
Sbjct  262   GRRAEEGLLVRWALPLIKQMRFSELLDLRLVMPSDMRPITRLAKVASACVSNSRKSRPTI  321

Query  429   VQVAAI  412
             VQVA I
Sbjct  322   VQVATI  327



>ref|XP_004248119.1| PREDICTED: serine/threonine-protein kinase-like protein CCR1 
[Solanum lycopersicum]
Length=348

 Score =   352 bits (904),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 207/318 (65%), Positives = 246/318 (77%), Gaps = 24/318 (8%)
 Frame = -1

Query  1320  CCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGV  1141
             CCKKK    E+            K  A +Y+LM++  ATDGFN RRIIG+GR+G VY G+
Sbjct  31    CCKKKPIKAEET--------LPTKQIACSYSLMDIHGATDGFNYRRIIGQGRIGSVYVGI  82

Query  1140  LQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVME  961
             L    + VA+KR HPRLVLSNA GFGF+S+++WLSLA HPN+VPILGFSE PGERIVVME
Sbjct  83    LPNGDQQVAIKRIHPRLVLSNA-GFGFTSMMKWLSLAYHPNIVPILGFSEGPGERIVVME  141

Query  960   YGGMLSLEFYLHQNPD---------AAALLHWSrrlrvaagvargLEFLHEGMVPHIVHG  808
             +GGMLSL+FYLHQN D           +LL W+ RLRVAAG+ARG+E+LHE MVPHIVHG
Sbjct  142   FGGMLSLDFYLHQNRDHDDGGGGGGGTSLLDWNCRLRVAAGIARGIEYLHEVMVPHIVHG  201

Query  807   CVKASNVLIDVEFSARLCDYGLY-FLASNERQEV--IGYVDEEYWV--EGRGGSKESDVY  643
             C+K SN+LIDV F AR+CDYGLY FL   +++++  +GYVD+EYW+  E +G SKESDVY
Sbjct  202   CIKPSNILIDVNFCARVCDYGLYTFLTCYDKRQLGLMGYVDDEYWIGNEKKGFSKESDVY  261

Query  642   GFGVVLLELLSGRK-SQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASA  466
             G GVVLLELLSGRK  QE LLVKWALPLIKEM+FGE LD R+ +P DI PLVRLAKVA A
Sbjct  262   GLGVVLLELLSGRKCDQESLLVKWALPLIKEMKFGEFLDNRLMLPNDIRPLVRLAKVALA  321

Query  465   CVGNSRKSRPTIVQVAAI  412
             CVGNSRK+RP+IVQVA I
Sbjct  322   CVGNSRKNRPSIVQVANI  339



>ref|XP_008383682.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Malus domestica]
Length=336

 Score =   350 bits (899),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 232/306 (76%), Gaps = 14/306 (5%)
 Frame = -1

Query  1317  CKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVL  1138
             CKKK    ++            K SA  Y L  +D ATDGFN RRI+G+GR G VY+ + 
Sbjct  34    CKKKPVQTQETP-------PPTKPSAQVYPLTNIDVATDGFNHRRIVGEGRFGTVYAAIF  86

Query  1137  QPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY  958
             + +G++ AVKR H R VLSNA GFGFS +LR +SLA HPN+VPI+G+SE PGERI+VME+
Sbjct  87    E-KGQIAAVKRIHSRHVLSNA-GFGFSRILRSISLAQHPNIVPIIGYSEGPGERIIVMEF  144

Query  957   GGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLID  778
              GM+ L++YLHQN D A+L  W+ RL++AAG A+GLE+LHEG+ P+I+HGCVKASN+LID
Sbjct  145   VGMVCLDYYLHQNSDGASL-DWNHRLKIAAGAAKGLEYLHEGVAPNIIHGCVKASNILID  203

Query  777   VEFSARLCDYGLYFLASNERQEVIGYVDEEYW----VEGRGGSKESDVYGFGVVLLELLS  610
             V F ARLCDYGL FLA  E++ ++G+VD+EYW      G G  KESDVYGFGVVLLELLS
Sbjct  204   VNFCARLCDYGLSFLAPQEKRGLLGHVDDEYWDGGLGGGGGACKESDVYGFGVVLLELLS  263

Query  609   GRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTI  430
             GR   EG LV W+LPLIKE RF E LDPR+AIP +I PLVRLAKVA+ACVGNSRKSRP+I
Sbjct  264   GRLCDEGRLVNWSLPLIKEKRFSEFLDPRLAIPSEILPLVRLAKVATACVGNSRKSRPSI  323

Query  429   VQVAAI  412
              QVA I
Sbjct  324   GQVATI  329



>ref|XP_011027769.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Populus euphratica]
Length=336

 Score =   349 bits (895),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 185/284 (65%), Positives = 230/284 (81%), Gaps = 3/284 (1%)
 Frame = -1

Query  1257  AAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSN  1078
             AA++SA  Y   ++DAATDGFN RRIIG GRLG VY+ VL  + + VAVKR HP LVLSN
Sbjct  44    AARISAQWYPSTDIDAATDGFNHRRIIGTGRLGTVYAAVLPSDQKPVAVKRIHPSLVLSN  103

Query  1077  AAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPD-AAAL  901
             A   GFSS+L+ LSLA HPN+VPILGFS+APGERI+VME+  ++SL++YLH+NPD A+++
Sbjct  104   AC-LGFSSMLKTLSLAQHPNVVPILGFSQAPGERIIVMEFVSVVSLDYYLHENPDGASSV  162

Query  900   LHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNE  721
             L WSRRL +AAG ARGLE+LH GM P+IVHGC KASNVL+D +  A++ DYGL  L +NE
Sbjct  163   LDWSRRLSIAAGAARGLEYLHGGMAPNIVHGCFKASNVLLDDKLRAKVTDYGLSSLVANE  222

Query  720   RQEVIGYVDEEYWV-EGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKEMRF  544
             ++ ++GYVD+E+W  EG    KESDVYGFGVVLLELL+GR+++EGLLV+WALPLIKEMR 
Sbjct  223   KRGLVGYVDDEFWSNEGGEACKESDVYGFGVVLLELLTGRRAEEGLLVRWALPLIKEMRL  282

Query  543   GEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              E+LD R+A P D   ++RLAKVASACV NSRKSRPT+ QVA I
Sbjct  283   SELLDLRLAKPSDTRAIIRLAKVASACVNNSRKSRPTMFQVATI  326



>ref|XP_002305775.2| kinase family protein [Populus trichocarpa]
 gb|EEE86286.2| kinase family protein [Populus trichocarpa]
Length=336

 Score =   348 bits (893),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 185/284 (65%), Positives = 229/284 (81%), Gaps = 3/284 (1%)
 Frame = -1

Query  1257  AAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSN  1078
             AA++SA  Y   ++DAATDGFN RRIIG GRLG VY+ VL  + + VAVKR HP LVLSN
Sbjct  44    AARISAQWYPSSDIDAATDGFNHRRIIGTGRLGTVYAAVLPSDQKPVAVKRIHPSLVLSN  103

Query  1077  AAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPD-AAAL  901
             A  FGFSS+++ LS+A HPN+VPILGFS+APGERI+VME+   +SL +YLH+N D A+++
Sbjct  104   AC-FGFSSMVKTLSMAQHPNVVPILGFSQAPGERIIVMEFVSAVSLNYYLHENSDGASSV  162

Query  900   LHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNE  721
             L WS RLR+AAG ARGLE+LH GM P+IVHGC KASNVL+D +  AR+ DYGL  L +NE
Sbjct  163   LDWSWRLRIAAGAARGLEYLHGGMAPNIVHGCFKASNVLLDDKLCARVSDYGLSSLVANE  222

Query  720   RQEVIGYVDEEYWVEGRG-GSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKEMRF  544
             ++ ++GYVD+E+W  GRG   KESDVYGFGVVLLELL+GR+++EGLLV+WALPLIKEMR 
Sbjct  223   KRGLVGYVDDEFWSNGRGEACKESDVYGFGVVLLELLTGRRAEEGLLVRWALPLIKEMRL  282

Query  543   GEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              E+LD R+A P D   ++RLAKVASACV NSRKSRPT+ QVA I
Sbjct  283   SELLDLRLAKPSDTRAIIRLAKVASACVNNSRKSRPTMFQVATI  326



>ref|XP_004168541.1| PREDICTED: phytosulfokine receptor 1-like [Cucumis sativus]
Length=341

 Score =   347 bits (889),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 184/308 (60%), Positives = 232/308 (75%), Gaps = 8/308 (3%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F  C++     +  D+        AK SA  +TL+++  AT+GFN RR+IG+GRLG VY+
Sbjct  29    FFLCRRNHSHRQLSDESP----PPAKPSARPHTLIDIYTATEGFNHRRVIGEGRLGTVYA  84

Query  1146  GVLQPEGELVAVKRFHPRLVLSNA-AGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIV  970
               L   GEL+AVKR +P LVLSN+ AGFGFSSV++ LS A HPNLV I G+SEAPGERI+
Sbjct  85    A-LSETGELIAVKRIYPWLVLSNSNAGFGFSSVIKSLSSAQHPNLVSITGYSEAPGERII  143

Query  969   VMEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASN  790
             VMEY G+++L+ YLHQN D A LL+W  R+++AAG ARGL++LHE M P ++HGCVK SN
Sbjct  144   VMEYAGVVNLDMYLHQNADGAFLLNWKHRVKIAAGAARGLQYLHESMAPSVIHGCVKPSN  203

Query  789   VLIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYW--VEGRGGSKESDVYGFGVVLLEL  616
             +LID +F  +L DYGL +LA+ E++ ++GYVD+EYW    G+G  KE+DVYG+GVVLLEL
Sbjct  204   ILIDAQFIPKLSDYGLNYLAAREKRGLVGYVDDEYWKGKSGQGNCKENDVYGYGVVLLEL  263

Query  615   LSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRP  436
             LSGR  +EG LVKWALPLIKEMRF EVLDPRI  P D+ PL+R+ KVA ACVGN RKSRP
Sbjct  264   LSGRGCEEGWLVKWALPLIKEMRFSEVLDPRIEYPSDLKPLMRMGKVALACVGNCRKSRP  323

Query  435   TIVQVAAI  412
              I QV AI
Sbjct  324   AIGQVVAI  331



>ref|XP_004134945.1| PREDICTED: phytosulfokine receptor 1-like [Cucumis sativus]
 gb|KGN49261.1| hypothetical protein Csa_6G518160 [Cucumis sativus]
Length=341

 Score =   345 bits (885),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 184/308 (60%), Positives = 231/308 (75%), Gaps = 8/308 (3%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F  C++     +  D+        AK SA  +TL+++  AT+GFN RR+IG+GRLG VY+
Sbjct  29    FFLCRRNHSHRQLSDESP----PPAKPSARPHTLIDIYTATEGFNHRRVIGEGRLGTVYA  84

Query  1146  GVLQPEGELVAVKRFHPRLVLSNA-AGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIV  970
               L   GEL+AVKR +P LVLSN  AGFGFSSV++ LS A HPNLV I G+SEAPGERI+
Sbjct  85    A-LSETGELIAVKRIYPWLVLSNNNAGFGFSSVIKSLSSAQHPNLVSITGYSEAPGERII  143

Query  969   VMEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASN  790
             VMEY G+++L+ YLHQN D A LL+W  R+++AAG ARGL++LHE M P ++HGCVK SN
Sbjct  144   VMEYAGVVNLDMYLHQNADGAFLLNWKHRVKIAAGAARGLQYLHESMAPSVIHGCVKPSN  203

Query  789   VLIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYW--VEGRGGSKESDVYGFGVVLLEL  616
             +LID +F  +L DYGL +LA+ E++ ++GYVD+EYW    G+G  KE+DVYG+GVVLLEL
Sbjct  204   ILIDAQFIPKLSDYGLNYLAAREKRGLVGYVDDEYWKGKSGQGNCKENDVYGYGVVLLEL  263

Query  615   LSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRP  436
             LSGR  +EG LVKWALPLIKEMRF EVLDPRI  P D+ PL+R+ KVA ACVGN RKSRP
Sbjct  264   LSGRGCEEGWLVKWALPLIKEMRFSEVLDPRIEYPSDLKPLMRMGKVALACVGNCRKSRP  323

Query  435   TIVQVAAI  412
              I QV AI
Sbjct  324   AIGQVVAI  331



>ref|XP_003593653.1| Receptor-like protein kinase BRI1-like protein [Medicago truncatula]
 gb|ABN08719.1| Protein kinase [Medicago truncatula]
 gb|AES63904.1| receptor-like kinase [Medicago truncatula]
Length=340

 Score =   345 bits (885),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 191/310 (62%), Positives = 239/310 (77%), Gaps = 15/310 (5%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F  CKKK   VE ++   +      K  A  Y L  +D AT+GFN RRIIGKGRLG VY+
Sbjct  28    FFSCKKK--PVESEETLPV------KQIALLYPLTVIDIATNGFNHRRIIGKGRLGTVYA  79

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
             G L+ E ELVAVKR H  LVLSNA GFGFSSV++WLSL+ HPN+VPI+GFSEAPGER+++
Sbjct  80    GKLENE-ELVAVKRIHSVLVLSNA-GFGFSSVMKWLSLSQHPNVVPIIGFSEAPGERVIL  137

Query  966   MEYGGMLSLEFYLHQNPD--AAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKAS  793
             ME+  M +LEFYLH+N D  +++LL W++R ++AAGVA+GL++LHE + P+IVHGCVK+S
Sbjct  138   MEFVRMANLEFYLHENQDGGSSSLLDWNKRFKIAAGVAKGLQYLHEVVAPNIVHGCVKSS  197

Query  792   NVLIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEG-RGGS--KESDVYGFGVVLL  622
             NVLIDV F A++ DYGL FL   E++ ++GYVD+EYW EG RGGS  KE+DVYG GV+LL
Sbjct  198   NVLIDVNFCAKISDYGLSFLGGVEKRGLVGYVDDEYWNEGIRGGSVCKENDVYGLGVILL  257

Query  621   ELLSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKS  442
             ELLSGR  + GLLVKW LPLIK+MRF EVLDPR+ IP ++N ++RLAKVASACVGN RK 
Sbjct  258   ELLSGRGCEGGLLVKWVLPLIKDMRFSEVLDPRLIIPSNMNAIIRLAKVASACVGNPRKC  317

Query  441   RPTIVQVAAI  412
             RP +  V  I
Sbjct  318   RPCVNHVMNI  327



>ref|XP_010686482.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 [Beta 
vulgaris subsp. vulgaris]
Length=340

 Score =   342 bits (876),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 222/306 (73%), Gaps = 11/306 (4%)
 Frame = -1

Query  1317  CKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVL  1138
             C+KK P       E I      KL    ++L E+D ATD FNP RIIGKGRLG  Y+ V 
Sbjct  32    CRKKPP----KKKESIS---TTKLCVQNFSLSEIDIATDRFNPSRIIGKGRLGTTYAAVF  84

Query  1137  QPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY  958
               + +LV VKR HP LVLS      F ++++ LSLA HPN+VPILGF EAPGER+++MEY
Sbjct  85    DDKDDLVVVKRIHPWLVLSKVGLGSFQAMIKSLSLAQHPNIVPILGFLEAPGERMIIMEY  144

Query  957   GGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLID  778
              G +SL+FYLHQN D  +LL W +R+ +AAG+ARGLE+LHE M P +VHGC+K +NVL+D
Sbjct  145   VGTMSLDFYLHQNIDGPSLLGWVQRVSIAAGMARGLEYLHEKMAPQVVHGCIKPTNVLVD  204

Query  777   VEFSARLCDYGLYFLAS-NERQEVIGYVDEEYWVE---GRGGSKESDVYGFGVVLLELLS  610
             V F A+ CDYGL FLA+  E+  V+GYVDEE+W+E     G  KESDVYGFGVVLLELL+
Sbjct  205   VNFCAKFCDYGLSFLAAKQEKMGVLGYVDEEFWLERNKSSGACKESDVYGFGVVLLELLT  264

Query  609   GRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTI  430
             GR S+ GLLV+W LPLIKEM+F E LD RI +P ++ P+VRLAKVA ACVGNSRK+RP I
Sbjct  265   GRTSEGGLLVRWVLPLIKEMKFNEFLDARIKMPTNMKPIVRLAKVALACVGNSRKTRPKI  324

Query  429   VQVAAI  412
              Q+  I
Sbjct  325   SQIVCI  330



>ref|XP_008439805.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Cucumis 
melo]
Length=372

 Score =   342 bits (878),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 178/277 (64%), Positives = 219/277 (79%), Gaps = 4/277 (1%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNA-AGFGFS  1057
             +TL+++  AT+GF  RR+IG+GRLG VY+  L   GEL+AVKR +P LVLSN  AGFGFS
Sbjct  56    HTLIDIYTATEGFTHRRVIGEGRLGTVYAA-LSETGELIAVKRIYPWLVLSNNNAGFGFS  114

Query  1056  SVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlr  877
             SV++ LS A HPNLV I G+SEAPGERI+VMEY G ++L+ YLHQNPD A LL+W  R++
Sbjct  115   SVIKSLSSAQHPNLVSITGYSEAPGERIIVMEYAGAVNLDMYLHQNPDGAFLLNWKHRVK  174

Query  876   vaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVIGYV  697
             +AAG ARGL++LHE M P ++HGCVK SN+LID EF  +L DYGL +LA+ E++ ++GYV
Sbjct  175   IAAGAARGLQYLHESMAPSVIHGCVKPSNILIDAEFIPKLSDYGLNYLAAREKRGLVGYV  234

Query  696   DEEYW--VEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKEMRFGEVLDPR  523
             D+EYW    G+G  KE+DVYG+GVVLLELLSGR  +EG LVKWALPLIKEMRF EVLDPR
Sbjct  235   DDEYWKGKNGQGNCKENDVYGYGVVLLELLSGRGCEEGWLVKWALPLIKEMRFSEVLDPR  294

Query  522   IAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             I  P D+ PL+R+ KVA ACVGN RKSRP I QV AI
Sbjct  295   IEYPSDLKPLMRMGKVALACVGNCRKSRPVIGQVVAI  331



>ref|XP_010260528.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Nelumbo nucifera]
Length=354

 Score =   342 bits (876),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 232/303 (77%), Gaps = 11/303 (4%)
 Frame = -1

Query  1317  CKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVL  1138
             C+KK      D +EG      AKL A AY+L ++D ATDGFN R IIG GRLG VY   L
Sbjct  50    CRKK----PMDPEEGF----PAKLCARAYSLTDVDVATDGFNQRLIIGAGRLGTVYEAHL  101

Query  1137  QPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY  958
                G++VA KR HPRLVLSNA GFGFSS+++ LS ADHP++VPI+G +EAPGERI++ME+
Sbjct  102   T-GGDVVAAKRIHPRLVLSNA-GFGFSSIVKSLSFADHPHVVPIIGLAEAPGERIILMEF  159

Query  957   GGMLSLEFYL-HQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLI  781
              GM SL+++L H   + A LL W  RLRVAAG ARG+E+LHE M P IVHGCVK SN+LI
Sbjct  160   MGMRSLDYHLRHDCCNGAPLLDWELRLRVAAGAARGIEYLHEKMTPPIVHGCVKPSNILI  219

Query  780   DVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK  601
             D  F AR+ DYGL FLA +ER+ ++GYVD+EYW +  G  K SDVYGFGVVLL++LSGR+
Sbjct  220   DSHFCARVSDYGLCFLAPHERRGLVGYVDDEYWKQRGGACKASDVYGFGVVLLQILSGRR  279

Query  600   SQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
              +EGL+ +WALPLI++M+  E+LDPR+ +P DI PL RLAKVASACV NSR++RP+IVQV
Sbjct  280   CEEGLIAEWALPLIRDMKLHELLDPRLVVPSDIEPLFRLAKVASACVSNSRRNRPSIVQV  339

Query  420   AAI  412
             AAI
Sbjct  340   AAI  342



>ref|XP_007213126.1| hypothetical protein PRUPE_ppa024055mg [Prunus persica]
 gb|EMJ14325.1| hypothetical protein PRUPE_ppa024055mg [Prunus persica]
Length=321

 Score =   337 bits (864),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 178/280 (64%), Positives = 216/280 (77%), Gaps = 13/280 (5%)
 Frame = -1

Query  1251  KLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAA  1072
             K SA  Y L  +DAATDGFN  RI+G+GRLG VY+ + + +GE+ AVKR H R       
Sbjct  48    KPSAQVYPLTNIDAATDGFNHHRIVGEGRLGTVYAAIFE-KGEIAAVKRIHSR------H  100

Query  1071  GFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHW  892
             G   S     +S A HPN+VPI+G+SE PGERI+VME+ GM+ L+FYLHQNP+ A+LL W
Sbjct  101   GLHIS-----ISSAQHPNVVPIIGYSEGPGERIIVMEFVGMVCLDFYLHQNPEGASLLDW  155

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
             + RL++AAG A+GLE+LHEG+ P+IVHGCVKASN+LIDV F AR+CDYGL FLA  E++ 
Sbjct  156   NHRLKIAAGAAKGLEYLHEGVAPNIVHGCVKASNILIDVNFCARICDYGLSFLALQEKRG  215

Query  711   VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKEMRFGEVL  532
             ++GYVD+EYW  G G  KESDVYGFG+VLLELLSGR  +EG LV WA PLIKEMR  E+L
Sbjct  216   LVGYVDDEYW-RGSGACKESDVYGFGIVLLELLSGRLCEEGRLVNWASPLIKEMRISELL  274

Query  531   DPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             DPR+ +P DI  LVRLAKVASACVGNSRKSRP+I QVA I
Sbjct  275   DPRLVLPDDIGALVRLAKVASACVGNSRKSRPSICQVATI  314



>ref|XP_010518776.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Tarenaya hassleriana]
Length=334

 Score =   310 bits (794),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 177/282 (63%), Positives = 214/282 (76%), Gaps = 13/282 (5%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A +Y L ++DAATDGFN R+IIG+GRLG VY+ VL  + +LVA+KR HP LVLS   G G
Sbjct  50    ARSYPLTDVDAATDGFNQRQIIGRGRLGTVYAAVLPGDNQLVAIKRIHPGLVLSKP-GSG  108

Query  1062  FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY-GGMLSLEFYLHQNPDA---AALLH  895
             FSSVLR LSLA HPN+V ILGFSEAPGERI + E+ G   +L+FYLH + ++   AA L 
Sbjct  109   FSSVLRTLSLAQHPNIVSILGFSEAPGERIFLTEFVGTAKNLDFYLHGDSNSGEDAAALE  168

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W +R RVAAGVARGLE+LHEG+ P IVHG +K+SN+LID EFS RL DYG  FL  +E+ 
Sbjct  169   WRKRFRVAAGVARGLEYLHEGINPSIVHGRIKSSNILIDAEFSGRLSDYGFGFLVPHEKS  228

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKEMRFGEV  535
              + G V+E Y        KESDVYGFGVVLLE+LSGR+S+ GL+VKWA P+IKE RFGE 
Sbjct  229   GIAGCVEEGY-------GKESDVYGFGVVLLEILSGRRSENGLMVKWAAPMIKEQRFGEF  281

Query  534   LDPRIAIPCDINPLV-RLAKVASACVGNSRKSRPTIVQVAAI  412
             LDPRI +  +I  LV R+AKVA ACVGNSR+SRP+I QVAAI
Sbjct  282   LDPRIVVESEIKCLVLRMAKVALACVGNSRRSRPSISQVAAI  323



>ref|XP_008798337.1| PREDICTED: putative receptor protein kinase CRINKLY4 [Phoenix 
dactylifera]
Length=338

 Score =   305 bits (781),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 224/311 (72%), Gaps = 18/311 (6%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F+ CKK R AV+ DD         A L A ++ L +++AATDGF+  +I+GKG LG VY 
Sbjct  30    FILCKK-RHAVDPDDTS-----LPAALHAHSHPLSDIEAATDGFHLSQIVGKGHLGTVYK  83

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
              +    G++ AVKR HP LVL N  G  FSS +R LS A+HPN+VPI+GFSEAPGER+++
Sbjct  84    AI-SATGDVFAVKRIHPHLVLGNP-GVSFSSRIRSLSFANHPNVVPIVGFSEAPGERVII  141

Query  966   MEYGGMLSLEFYLHQ-----NPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCV  802
              E+ GM SLE+YLH       P   AL +W  RLR+AAG ARGLE LHEG  P +VHGC+
Sbjct  142   SEFVGMKSLEYYLHGMTGDGGPPPEAL-NWGLRLRIAAGAARGLEHLHEGSAPSVVHGCI  200

Query  801   KASNVLIDVEFSARLCDYGLYFL-ASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVL  625
             K SNV+ID  F AR+CDYGL FL   +ER+ ++GYVD+    EG G  KE+DVYGFGVVL
Sbjct  201   KPSNVMIDANFGARVCDYGLTFLMGPSERRGMLGYVDDG---EGWGVCKENDVYGFGVVL  257

Query  624   LELLSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRK  445
             LELLSGR+S+ G++V+WALPLI+E + GEVL+ R+ +P D+ PL R+AKVASACVGN RK
Sbjct  258   LELLSGRRSEGGVMVEWALPLIREGKVGEVLEKRVGVPMDMKPLARMAKVASACVGNGRK  317

Query  444   SRPTIVQVAAI  412
             SRP++  VAAI
Sbjct  318   SRPSMSHVAAI  328



>emb|CBI30616.3| unnamed protein product [Vitis vinifera]
Length=291

 Score =   300 bits (768),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 174/305 (57%), Positives = 207/305 (68%), Gaps = 51/305 (17%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F+ C+KK   VE ++   I      KL A A  L ++DAATD FN RRIIGKGRLG VY+
Sbjct  28    FILCRKK--PVESEETLPI------KLCAQACPLTDIDAATDCFNHRRIIGKGRLGTVYA  79

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
               L   GELVAVKR HP LVLSNA  FGFSS+LR LSLA HPN+V I+GFSE PGERI+V
Sbjct  80    A-LSGRGELVAVKRIHPGLVLSNAC-FGFSSILRSLSLAQHPNIVSIVGFSEGPGERIIV  137

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
             ME+ GM+SL+FYL QN D A+LL W RRLR+AAG ARGLE+LHEGM PHIVHGC+KASN+
Sbjct  138   MEFAGMVSLDFYLQQNSDGASLLDWGRRLRIAAGAARGLEYLHEGMTPHIVHGCIKASNI  197

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSG  607
             +IDV+F AR+CDYGL FLA +E++ ++GY                               
Sbjct  198   IIDVKFCARVCDYGLSFLAPHEKRGLVGY-------------------------------  226

Query  606   RKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIV  427
                       WALPLIKEM    +LDPR+ IP D+  L+RLAKVASACVGNSRK+RP+I 
Sbjct  227   ----------WALPLIKEMNISALLDPRLVIPSDMKHLIRLAKVASACVGNSRKNRPSIA  276

Query  426   QVAAI  412
             QV AI
Sbjct  277   QVVAI  281



>ref|XP_010924407.1| PREDICTED: LOW QUALITY PROTEIN: putative receptor protein kinase 
CRINKLY4 [Elaeis guineensis]
Length=336

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 218/310 (70%), Gaps = 17/310 (5%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F+ CKK R AV+ DD         A L A +  L E++AATDGF+  RI+GKG LG VY 
Sbjct  29    FILCKK-RHAVDTDDTI-----LPAALHAQSLPLSEIEAATDGFHRSRIVGKGHLGTVYK  82

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
              +    G++ AVKR HP LVL N  G  FSS +R LSLA+HPN+VPI+GFSEAPGER+++
Sbjct  83    AI-SATGDVFAVKRIHPHLVLGNP-GVSFSSRIRSLSLANHPNVVPIIGFSEAPGERVII  140

Query  966   MEYGGMLSLEFYLH----QNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVK  799
              E+ GM SLE++L             L+W  R+R+AAGVARG+E LHEG  P +VHGC+K
Sbjct  141   SEFVGMKSLEYHLRGMTGDGLPPPEPLNWGIRIRIAAGVARGVEHLHEGNAPGVVHGCIK  200

Query  798   ASNVLIDVEFSARLCDYGLYFL-ASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLL  622
              SNV+ID  F A +CDYGL FL    ER+ ++GYVD E WV      KE+DVY FGVVLL
Sbjct  201   PSNVMIDTNFGAGVCDYGLSFLMGPEERRGMVGYVDGEGWVX----CKENDVYAFGVVLL  256

Query  621   ELLSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKS  442
             ELLSGR+S+ G++V WALPLI+E + GEVLD ++++P D+ PL R+AKVASACVGN RK+
Sbjct  257   ELLSGRRSEGGMVVAWALPLIREGKVGEVLDKKLSVPMDMKPLARMAKVASACVGNGRKN  316

Query  441   RPTIVQVAAI  412
             RP++  VAAI
Sbjct  317   RPSMSHVAAI  326



>ref|XP_002863430.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39689.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=330

 Score =   294 bits (752),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 210/304 (69%), Gaps = 15/304 (5%)
 Frame = -1

Query  1317  CKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVL  1138
             C+KK P   DD+          K +  AY L E+D+ATDGFN RRIIG GRLG VY+ ++
Sbjct  31    CRKK-PNRSDDES----LLPETKPAGLAYPLTELDSATDGFNQRRIIGSGRLGTVYAAII  85

Query  1137  QPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY  958
                  LVAVKR HP LVLS   GFGFS+V++ LS + HPN+V ILGFSEAPGERIVV E+
Sbjct  86    PDHKNLVAVKRIHPGLVLSKP-GFGFSTVIKSLSSSHHPNVVSILGFSEAPGERIVVTEF  144

Query  957   -GGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLI  781
              G   SL  +LH+    A    W  R ++AAG ARGLE+LHE   P IVHG   +SN+LI
Sbjct  145   VGEGKSLSDHLHEESAVAVEFGWKTRFKIAAGAARGLEYLHEIANPRIVHGRFTSSNILI  204

Query  780   DVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK  601
             D + +A++CDYG  FL   E+  + GY++E Y        KESDVYG+GVVL+E+LSGR+
Sbjct  205   DEKSTAKICDYGFGFLIPIEKSGIFGYIEEGY-------CKESDVYGYGVVLMEILSGRR  257

Query  600   SQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLV-RLAKVASACVGNSRKSRPTIVQ  424
             S+ GL+VKWA PLIKE RFGE LDPRI +  +I  LV RLAKVA ACVGNSR+SRP+I +
Sbjct  258   SENGLIVKWATPLIKEQRFGEFLDPRIVVQSEIKSLVIRLAKVALACVGNSRRSRPSISE  317

Query  423   VAAI  412
             VAAI
Sbjct  318   VAAI  321



>ref|XP_006280800.1| hypothetical protein CARUB_v10026769mg [Capsella rubella]
 gb|EOA13698.1| hypothetical protein CARUB_v10026769mg [Capsella rubella]
Length=329

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 173/304 (57%), Positives = 213/304 (70%), Gaps = 16/304 (5%)
 Frame = -1

Query  1317  CKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVL  1138
             C+KK P   DD+          K +  +Y L E+D+ATDGFNPRRIIG GRLG VY+ +L
Sbjct  31    CRKK-PNRSDDES----LLPETKPAGLSYPLTELDSATDGFNPRRIIGSGRLGTVYAAIL  85

Query  1137  QPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY  958
                  LVAVKR HP LVLS   GFGFS+VL+ LS + H N+V ILGFSEAPGERIVV E+
Sbjct  86    PGYKNLVAVKRIHPGLVLSKP-GFGFSTVLKTLSSSHHQNVVSILGFSEAPGERIVVSEF  144

Query  957   GGMLSLEFYLHQNPDAAAL-LHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLI  781
              G        H N D +A+ L W  R ++AAG ARGLE+LHE   P IVHG   +SN+LI
Sbjct  145   VGE-GKSLSDHLNGDGSAVELGWKTRFKIAAGAARGLEYLHEIANPRIVHGRFTSSNILI  203

Query  780   DVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK  601
             DV+ +A++CDYG  FL   E+  ++GYV+E Y        KESDVYG+GVVL+E+LSGR+
Sbjct  204   DVKSTAKICDYGFGFLIPVEKSGILGYVEEGY-------CKESDVYGYGVVLMEILSGRR  256

Query  600   SQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLV-RLAKVASACVGNSRKSRPTIVQ  424
             S+ GLLVKWA PLIKE RFGE+LDPRI +  ++  LV RLAKVA ACVGNSR+SRP+I +
Sbjct  257   SENGLLVKWATPLIKEQRFGELLDPRIVVQSEVKGLVIRLAKVALACVGNSRRSRPSISE  316

Query  423   VAAI  412
             VAAI
Sbjct  317   VAAI  320



>ref|XP_010494773.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Camelina sativa]
Length=329

 Score =   292 bits (747),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 172/302 (57%), Positives = 212/302 (70%), Gaps = 15/302 (5%)
 Frame = -1

Query  1311  KKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQP  1132
             +KRP   DD+          K +  +Y L E+D+ATDGFN RRIIG GRLG VY+G++  
Sbjct  32    RKRPNRSDDES----LLPETKPTGQSYPLTELDSATDGFNQRRIIGSGRLGTVYAGIIPD  87

Query  1131  EGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY-G  955
                LVAVKR HP LVLS   GFGFS+VL+ LS + H N+V ILGFSEAPGERIVV E+ G
Sbjct  88    HKNLVAVKRIHPGLVLSKP-GFGFSAVLKTLSSSHHQNVVSILGFSEAPGERIVVTEFIG  146

Query  954   GMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDV  775
                SL  +L+ + D+A    W  R ++AAG ARGLE+LHE   P IVHG   +SN+LIDV
Sbjct  147   EGKSLSDHLNGD-DSAVEFCWKTRFKIAAGAARGLEYLHELANPRIVHGRFTSSNILIDV  205

Query  774   EFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQ  595
             + +A++CDYG  FL   E+  + GYV+E Y        KESDVYG+GVVLLE+LSGR+S+
Sbjct  206   KSTAKICDYGFGFLIPVEKSGIYGYVEEGY-------CKESDVYGYGVVLLEILSGRRSE  258

Query  594   EGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLV-RLAKVASACVGNSRKSRPTIVQVA  418
              GLLVKWA PLIKE RFGE+LDPRI +  ++  LV RLAKVA ACVGNSR+S+P I QVA
Sbjct  259   NGLLVKWATPLIKEQRFGELLDPRIVVQSEVKGLVIRLAKVALACVGNSRRSQPLISQVA  318

Query  417   AI  412
             AI
Sbjct  319   AI  320



>ref|XP_006398289.1| hypothetical protein EUTSA_v10000955mg [Eutrema salsugineum]
 gb|ESQ39742.1| hypothetical protein EUTSA_v10000955mg [Eutrema salsugineum]
Length=335

 Score =   290 bits (741),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 170/288 (59%), Positives = 204/288 (71%), Gaps = 15/288 (5%)
 Frame = -1

Query  1254  AKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNA  1075
              K +  +Y L E+D+ATDGFN RRIIG GRLG VY+ VL     LVAVKR HP LVLS  
Sbjct  46    TKSAGLSYPLTELDSATDGFNQRRIIGSGRLGTVYAAVLPSHKNLVAVKRIHPSLVLSKP  105

Query  1074  AGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY-GGMLSLEFYLHQNPD-----  913
              G GFS+VL+ LS + HPN+V ILGFSEAPGERIVV E+ G   SL  +L+ + D     
Sbjct  106   -GSGFSTVLKTLSSSQHPNVVSILGFSEAPGERIVVTEFVGEARSLSDHLYGDSDVESAV  164

Query  912   AAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL  733
             +A    W +R RVAAG ARGLE+LHE + P IVHG   +SNVL+D +F A++ DYG  FL
Sbjct  165   SAVDFDWRKRFRVAAGAARGLEYLHEVINPRIVHGRFTSSNVLVDEKFMAKVSDYGFGFL  224

Query  732   ASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKE  553
                E+ E+ GYV+E Y        KESDVYGFGVVLLE+LSGR+S+ GL+VKWA PLIKE
Sbjct  225   IPREKSEISGYVEEGYC-------KESDVYGFGVVLLEILSGRRSENGLIVKWATPLIKE  277

Query  552   MRFGEVLDPRIAIPCDINPLV-RLAKVASACVGNSRKSRPTIVQVAAI  412
              RFGE+LDPRI +  +   LV R AKVA ACVGNSR+SRP+I QVAAI
Sbjct  278   QRFGELLDPRIVVQSETKCLVIRFAKVALACVGNSRRSRPSISQVAAI  325



>ref|NP_199420.1| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAB08253.1| serine/threonine protein kinase-like protein [Arabidopsis thaliana]
 gb|AED95335.1| protein kinase family protein [Arabidopsis thaliana]
Length=332

 Score =   289 bits (740),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 214/306 (70%), Gaps = 17/306 (6%)
 Frame = -1

Query  1317  CKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVL  1138
             C+KK      DD+  +   K A LS   Y+L E+D+ATDGFN RRIIG GRLG VY+ ++
Sbjct  31    CRKK--PNRSDDEYLLPETKPAGLS---YSLTELDSATDGFNQRRIIGSGRLGTVYAAII  85

Query  1137  QPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY  958
                  LVAVKR HP LVLS   GFGFS+V++ LS + HPN+V ILGFSEAPGERIVV E+
Sbjct  86    PDHKNLVAVKRIHPGLVLSKP-GFGFSTVIKSLSSSHHPNVVSILGFSEAPGERIVVTEF  144

Query  957   -GGMLSLEFYLHQNPDAAALLH--WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
              G   SL  +LH   ++A  +   W  R ++AAG ARGLE+LHE   P IVHG   +SNV
Sbjct  145   VGEGKSLSDHLHGGSNSATAVEFGWKTRFKIAAGAARGLEYLHEIANPRIVHGRFTSSNV  204

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSG  607
             L+D + +A++CDYG  FL   E+  + GY++E Y        KESDVYG+GVVL+E+LSG
Sbjct  205   LVDEKSTAKICDYGFGFLIPIEKSGIFGYIEEGYC-------KESDVYGYGVVLMEILSG  257

Query  606   RKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLV-RLAKVASACVGNSRKSRPTI  430
             R+S+ GL+VKWA PLIKE RF E+LDPRI +  +I  LV RLAKVA ACVGNSR+SRP+I
Sbjct  258   RRSENGLIVKWATPLIKEQRFAELLDPRIVVQSEIKSLVIRLAKVALACVGNSRRSRPSI  317

Query  429   VQVAAI  412
              +VAAI
Sbjct  318   SEVAAI  323



>ref|XP_010481501.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Camelina sativa]
Length=329

 Score =   289 bits (739),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 210/302 (70%), Gaps = 15/302 (5%)
 Frame = -1

Query  1311  KKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQP  1132
             +KRP   D++   +     AK +  +Y L E+D+ATDGFN RRIIG GRLG VY+G++  
Sbjct  32    RKRPNRSDNESLLL----EAKPAGQSYPLTELDSATDGFNQRRIIGSGRLGTVYAGIIPD  87

Query  1131  EGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGG  952
                LVAVKR HP LVLS   GFGFS+VL+ LS   H N+V ILGFSEAPGERIVV E+ G
Sbjct  88    RKNLVAVKRIHPGLVLSKP-GFGFSAVLKTLSSTYHQNVVSILGFSEAPGERIVVTEFIG  146

Query  951   MLSLEFYLHQNPDAAAL-LHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDV  775
                     H N D +A+   W  R ++AAG ARGLE+LHE   P IVHG   +SN+LIDV
Sbjct  147   E-GKSLTDHLNGDESAVEFCWKTRFKIAAGAARGLEYLHELANPRIVHGRFTSSNILIDV  205

Query  774   EFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQ  595
             + +A++CDYG  FL   E+  + GYV+E Y        KESDVYG+GVVLLE+LSGR+S+
Sbjct  206   KSTAKICDYGFGFLIPVEKSGIYGYVEEGY-------CKESDVYGYGVVLLEILSGRRSE  258

Query  594   EGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLV-RLAKVASACVGNSRKSRPTIVQVA  418
              GLLVKWA PLIKE RFGE+LDPRI +  ++  LV RLAKVA ACVGNSR+S+P I QVA
Sbjct  259   NGLLVKWATPLIKEQRFGELLDPRIVVQSEVKGLVIRLAKVALACVGNSRRSQPLISQVA  318

Query  417   AI  412
             AI
Sbjct  319   AI  320



>ref|XP_010441630.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Camelina sativa]
Length=329

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 209/302 (69%), Gaps = 15/302 (5%)
 Frame = -1

Query  1311  KKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQP  1132
             +KRP   DD+   +     AK +  +Y L E+D+ATDGFN RRIIG GRLG VY+G++  
Sbjct  32    RKRPNRSDDESLLL----EAKPAGQSYPLTELDSATDGFNQRRIIGSGRLGTVYAGIIPD  87

Query  1131  EGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGG  952
                LVAVKR HP LVLS   GFGFS+VL+ LS   H N+V ILGFSEAPGERIVV E+ G
Sbjct  88    RKNLVAVKRVHPGLVLSKP-GFGFSAVLKTLSSTHHQNVVSILGFSEAPGERIVVTEFIG  146

Query  951   MLSLEFYLHQNPDAAAL-LHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDV  775
                     H N D +A+   W  R ++AAG ARGLE+LH    P IVHG   +SN+LIDV
Sbjct  147   E-GKSLSDHLNGDESAVEFCWKTRFKIAAGAARGLEYLHVIANPRIVHGRFTSSNILIDV  205

Query  774   EFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQ  595
             + +A++CDYG  FL   E+  + GYV+E Y        KESDVYG+GVVLLE+LSGR+S+
Sbjct  206   KSTAKICDYGFGFLIPVEKSGIFGYVEEGY-------CKESDVYGYGVVLLEILSGRRSE  258

Query  594   EGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLV-RLAKVASACVGNSRKSRPTIVQVA  418
              GLLVKWA PLIKE RFGE+LDPRI +  ++  LV RLAKVA ACVGNSR+S+P I QVA
Sbjct  259   SGLLVKWATPLIKEQRFGELLDPRIVVQSEVKGLVIRLAKVALACVGNSRRSQPLISQVA  318

Query  417   AI  412
             AI
Sbjct  319   AI  320



>emb|CDY03245.1| BnaC09g19110D [Brassica napus]
Length=329

 Score =   283 bits (725),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 164/277 (59%), Positives = 202/277 (73%), Gaps = 12/277 (4%)
 Frame = -1

Query  1236  AYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFS  1057
             AY L E+D+ATDGFN RRIIG GRLG VY+ V+    +LVAVKR HP LVLS   G GFS
Sbjct  52    AYPLTEIDSATDGFNQRRIIGSGRLGTVYAAVIPTHKKLVAVKRIHPGLVLSKP-GSGFS  110

Query  1056  SVLRWLSLADHPNLVPILGFSEAPGERIVVMEY-GGMLSLEFYLHQNPDAAALLHWSrrl  880
             ++L+ LS + HPN+V ILGFSEAPGERIVV E+ G   SL  +LH +PD      W +R 
Sbjct  111   TILKTLSSSLHPNVVSILGFSEAPGERIVVTEFIGEARSLSDHLHGDPDPE--FDWRKRF  168

Query  879   rvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVIGY  700
             +VAAG ARGLE+LHE + P IVHG + +SN+L+D +F A++ DYG  FL   ER E+ G 
Sbjct  169   KVAAGAARGLEYLHEVVNPRIVHGRLTSSNILLDDKFMAKVSDYGFAFLIPRERSEISGC  228

Query  699   VDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKEMRFGEVLDPRI  520
             V+E Y        KESDV+GFGVVLLE+LSGR+S+ GL+VKWA P+IKE RF E+LD R+
Sbjct  229   VEEGY-------CKESDVFGFGVVLLEILSGRRSENGLIVKWATPMIKEQRFAELLDSRV  281

Query  519   AIPCDINPLV-RLAKVASACVGNSRKSRPTIVQVAAI  412
              +  +I  LV RLAKVA ACVGNSR+SRPT+ QVAAI
Sbjct  282   VVRSEIKCLVIRLAKVALACVGNSRRSRPTVSQVAAI  318



>ref|XP_009101550.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Brassica rapa]
Length=337

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 164/289 (57%), Positives = 200/289 (69%), Gaps = 16/289 (6%)
 Frame = -1

Query  1254  AKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNA  1075
              K +   Y L E+D+ATDGF+ RRIIG GRLG VY+ V+     LVAVKR HP LVLS  
Sbjct  46    TKPAGTTYPLTELDSATDGFSQRRIIGSGRLGTVYAAVIPSHKNLVAVKRIHPGLVLSKP  105

Query  1074  AGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY-GGMLSLEFYLHQNPDA----  910
              G GF++VL+ LS + HPN+V ILGFSEAPGERIVV E+ G   SL  +LH + D+    
Sbjct  106   -GSGFTTVLKTLSSSLHPNVVSILGFSEAPGERIVVTEFVGEAKSLSDHLHGDSDSDLEP  164

Query  909   --AALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYF  736
                 +  W +R R AAG ARGLE+LHE + P I+HG   +SNVL+D +F A++ DYG  F
Sbjct  165   AVTTVFDWRKRFRAAAGAARGLEYLHEIVNPRIIHGRFTSSNVLLDEKFMAKVSDYGFAF  224

Query  735   LASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIK  556
             L   E  EV  YV+E Y        KESDVYGFGVVLLE+LSGR+S+ G +VKWA PLIK
Sbjct  225   LIPRENSEVSWYVEEGY-------CKESDVYGFGVVLLEILSGRRSENGSIVKWATPLIK  277

Query  555   EMRFGEVLDPRIAIPCDINPLV-RLAKVASACVGNSRKSRPTIVQVAAI  412
             E RF E+LDPRI +  +I  LV RLAKVA ACVGNSR+SRP++ QVAAI
Sbjct  278   EKRFAELLDPRIVVESEIKCLVIRLAKVALACVGNSRRSRPSVSQVAAI  326



>emb|CDX77628.1| BnaC07g18820D [Brassica napus]
Length=336

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 164/288 (57%), Positives = 200/288 (69%), Gaps = 15/288 (5%)
 Frame = -1

Query  1254  AKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNA  1075
              K +   Y L E+D+ATDGF+ RRIIG GRLG VY+ V+     LVAVKR HP LVLS  
Sbjct  46    TKPAGTTYPLTELDSATDGFSQRRIIGSGRLGTVYAAVIPSHKNLVAVKRIHPGLVLSKP  105

Query  1074  AGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY-GGMLSLEFYLHQNPD-----  913
              G GF++VL+ LS A HPN+V ILGFSEAPGERI+V E+ G   SL  +LH + D     
Sbjct  106   -GSGFTTVLKTLSSALHPNVVSILGFSEAPGERILVTEFVGEAKSLSDHLHGDSDIESAV  164

Query  912   AAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL  733
             A  +  W +R R AAG ARGLE+LHE + P +VHG   +SNVL+D +F A++ DYG  FL
Sbjct  165   ANTVFDWRKRFRAAAGAARGLEYLHEIVNPRVVHGRFTSSNVLLDEKFMAKVSDYGFAFL  224

Query  732   ASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKE  553
                E  EV  YV+E Y        KESDVYGFGVVLLE+LSGR+S+ G +VKWA PLIKE
Sbjct  225   IPRENSEVSWYVEEGY-------CKESDVYGFGVVLLEILSGRRSENGSIVKWATPLIKE  277

Query  552   MRFGEVLDPRIAIPCDINPLV-RLAKVASACVGNSRKSRPTIVQVAAI  412
              RF E+LDPRI +  +I  LV RLAKVA ACVGNSR+SRP++ +VAAI
Sbjct  278   QRFAELLDPRIVVQSEIKCLVIRLAKVALACVGNSRRSRPSVSEVAAI  325



>ref|XP_009114378.1| PREDICTED: serine/threonine-protein kinase-like protein CCR1 
[Brassica rapa]
Length=326

 Score =   276 bits (706),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 165/278 (59%), Positives = 200/278 (72%), Gaps = 17/278 (6%)
 Frame = -1

Query  1236  AYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFS  1057
             AY L E+D+ATDGFN RRIIG GRLG VY+ V+     LVAVKR HP LVLS   GFGFS
Sbjct  52    AYPLTEIDSATDGFNQRRIIGSGRLGTVYAAVIPTHKNLVAVKRIHPGLVLSKP-GFGFS  110

Query  1056  SVLRWLSLADHPNLVPILGFSEAPGERIVVMEY-GGMLSLEFYLHQ-NPDAAALLHWSrr  883
             ++L+ LS + HPN+V ILGFSEAPGERIVV E+ G   SL  +LH  +PD      W +R
Sbjct  111   TILKTLSSSLHPNVVSILGFSEAPGERIVVTEFIGEARSLSDHLHHGDPDLE--FDWRKR  168

Query  882   lrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVIG  703
              +VAAG ARGLE+LHE     IVHG   +SN+L+D +F+A++ DYG  FL   E+ E+  
Sbjct  169   FKVAAGAARGLEYLHEV----IVHGRFTSSNILLDDKFTAKVSDYGFAFLIPREKSEIHW  224

Query  702   YVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKEMRFGEVLDPR  523
             YV+E Y        KESDVYGFGVVLLE+LSGR+S+ GL+VKWA PLIKE RF E+LD R
Sbjct  225   YVEEGY-------CKESDVYGFGVVLLEILSGRRSENGLIVKWATPLIKEQRFAELLDSR  277

Query  522   IAIPCDINPLV-RLAKVASACVGNSRKSRPTIVQVAAI  412
             + +  +I  LV RLAKVA ACVGNSR+SRPT+ QVAAI
Sbjct  278   VVVRSEIKCLVIRLAKVALACVGNSRRSRPTVSQVAAI  315



>emb|CDY58061.1| BnaA06g40290D [Brassica napus]
Length=337

 Score =   276 bits (706),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 164/289 (57%), Positives = 199/289 (69%), Gaps = 16/289 (6%)
 Frame = -1

Query  1254  AKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNA  1075
              K +   Y L E+D+ATDGF+ RRIIG GRLG VY+ V+     LVAVKR HP LVLS  
Sbjct  46    TKPAGTTYPLTELDSATDGFSQRRIIGSGRLGTVYAAVIPSHKNLVAVKRIHPGLVLSKP  105

Query  1074  AGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY-GGMLSLEFYLHQNPDA----  910
              G GF++VL+ LS A HPN+V ILGFSEAPGERIVV E+ G   SL  +LH + D+    
Sbjct  106   -GSGFTTVLKTLSSALHPNVVSILGFSEAPGERIVVTEFVGEAKSLSDHLHGDSDSDLEP  164

Query  909   --AALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYF  736
                 +  W +R R AAG ARGLE+LHE + P I+HG   +SNVL+D +F A++ DYG  F
Sbjct  165   AVTTVFDWRKRFRAAAGAARGLEYLHEIVNPRIIHGRFTSSNVLLDEKFMAKVSDYGFAF  224

Query  735   LASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIK  556
             L   E  EV  YV+E Y        KESDVYGFGVVLLE+LSGR+S+   +VKWA PLIK
Sbjct  225   LIPRENSEVSWYVEEGY-------CKESDVYGFGVVLLEILSGRRSENRSIVKWATPLIK  277

Query  555   EMRFGEVLDPRIAIPCDINPLV-RLAKVASACVGNSRKSRPTIVQVAAI  412
             E RF E+LDPRI +  +I  LV RLAKVA ACVGNSR+SRP++ QVAAI
Sbjct  278   EKRFAELLDPRIVVESEIKCLVIRLAKVALACVGNSRRSRPSVSQVAAI  326



>emb|CDY69005.1| BnaAnng29100D [Brassica napus]
Length=326

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 165/278 (59%), Positives = 200/278 (72%), Gaps = 17/278 (6%)
 Frame = -1

Query  1236  AYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFS  1057
             AY L E+D+ATDGFN RRIIG GRLG VY+ V+     LVAVKR HP LVLS   GFGFS
Sbjct  52    AYPLTEIDSATDGFNQRRIIGSGRLGTVYAAVIPTHRNLVAVKRIHPGLVLSKP-GFGFS  110

Query  1056  SVLRWLSLADHPNLVPILGFSEAPGERIVVMEY-GGMLSLEFYLHQ-NPDAAALLHWSrr  883
             ++L+ LS + HPN+V ILGFSEAPGERIVV E+ G   SL  +LH  +PD      W +R
Sbjct  111   TILKTLSSSLHPNVVSILGFSEAPGERIVVTEFIGEARSLSDHLHHGDPDLE--FDWRKR  168

Query  882   lrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVIG  703
              +VAAG ARGLE+LHE     IVHG   +SN+L+D +F+A++ DYG  FL   E+ E+  
Sbjct  169   FKVAAGAARGLEYLHEV----IVHGRFTSSNILLDDKFTAKVSDYGFAFLIPREKSEIHW  224

Query  702   YVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKEMRFGEVLDPR  523
             YV+E Y        KESDVYGFGVVLLE+LSGR+S+ GL+VKWA PLIKE RF E+LD R
Sbjct  225   YVEEGY-------CKESDVYGFGVVLLEILSGRRSENGLIVKWATPLIKEQRFAELLDSR  277

Query  522   IAIPCDINPLV-RLAKVASACVGNSRKSRPTIVQVAAI  412
             + +  +I  LV RLAKVA ACVGNSR+SRPT+ QVAAI
Sbjct  278   VVVRSEIKCLVIRLAKVALACVGNSRRSRPTVSQVAAI  315



>ref|XP_009394203.1| PREDICTED: serine/threonine-protein kinase-like protein CCR1 
[Musa acuminata subsp. malaccensis]
Length=337

 Score =   271 bits (693),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 165/308 (54%), Positives = 216/308 (70%), Gaps = 19/308 (6%)
 Frame = -1

Query  1311  KKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQP  1132
             KKR AV+ DD   +     A L A ++ L ++++ATDGF+  R++G+GRLG VY      
Sbjct  33    KKRCAVDPDDTSTV-----AILPAHSHQLSDVESATDGFHGSRVVGQGRLGTVYKAT-SA  86

Query  1131  EGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEY-G  955
              G+   VKR H  LVL N  G  FSS ++ LS A+HPNLVPILGFSEAPGER+++ E+ G
Sbjct  87    TGDTYTVKRIHHHLVLGNP-GVSFSSRMKSLSYANHPNLVPILGFSEAPGERLIISEFVG  145

Query  954   GMLSLEFYLHQN------PDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKAS  793
                SL+++LHQ+        ++ LL W  R+RVAAG ARG+E LH+G VP IVHGC+K S
Sbjct  146   NTKSLDYHLHQSYLEDCRRPSSGLLSWDIRIRVAAGTARGIEHLHDGSVPGIVHGCIKPS  205

Query  792   NVLIDVEFSARLCDYGLYFLAS-NERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLEL  616
             N+++D++F AR+CDYGL FL    +R+E++GY D E    G G  KE+DVYG GVVLLEL
Sbjct  206   NIMLDMDFCARICDYGLSFLVEPGDRREMVGYRDGE----GGGACKENDVYGLGVVLLEL  261

Query  615   LSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRP  436
             LSGR+   G LV+WALPLI+E R  E+LD R+ +P D+ PL R+AKVASACVGN RK+RP
Sbjct  262   LSGRRCDGGKLVEWALPLIRECRVQEILDGRMGLPMDLTPLTRMAKVASACVGNGRKTRP  321

Query  435   TIVQVAAI  412
             +I  VAAI
Sbjct  322   SIAHVAAI  329



>gb|KHN08485.1| Serine/threonine-protein kinase-like protein ACR4 [Glycine soja]
Length=197

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 154/187 (82%), Gaps = 2/187 (1%)
 Frame = -1

Query  966  MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
            ME+  M SL+FYLHQN D A+LL W++R R+AAGVARGL++LHE + P+IVHGCVK+SN+
Sbjct  1    MEFVHMASLDFYLHQNQDGASLLDWNKRFRIAAGVARGLQYLHEVVAPNIVHGCVKSSNI  60

Query  786  LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGG--SKESDVYGFGVVLLELL  613
            LIDV F AR+CDYGL FLA  E++ ++GYVD+EYW E RGG  +KESDVYG GVVLLELL
Sbjct  61   LIDVNFCARICDYGLNFLAPVEKRGIVGYVDDEYWSERRGGVATKESDVYGLGVVLLELL  120

Query  612  SGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPT  433
            SG+  + GLLVKWALPLI+E  F E+LDPR+ IP D+ PLVRLAKV SACVGNSRK RP+
Sbjct  121  SGKGCEGGLLVKWALPLIRETSFSELLDPRLVIPSDMKPLVRLAKVVSACVGNSRKCRPS  180

Query  432  IVQVAAI  412
            + QVA I
Sbjct  181  VAQVATI  187



>gb|AAO42178.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=208

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 148/206 (72%), Gaps = 11/206 (5%)
 Frame = -1

Query  1017  LVPILGFSEAPGERIVVMEY-GGMLSLEFYLHQNPDAAALLH--WSrrlrvaagvargLE  847
             +V ILGFSEAPGERIVV E+ G   SL  +LH   ++A  +   W  R ++AAG ARGLE
Sbjct  1     VVSILGFSEAPGERIVVTEFVGEGKSLSDHLHGGSNSATAVEFGWKTRFKIAAGAARGLE  60

Query  846   FLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRG  667
             +LHE   P IVHG   +SNVL+D + +A++CDYG  FL   E+  + GY++E Y      
Sbjct  61    YLHEIANPRIVHGRFTSSNVLVDEKSTAKICDYGFGFLIPIEKSGIFGYIEEGY------  114

Query  666   GSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLV-  490
               KESDVYG+GVVL+E+LSGR+S+ GL+VKWA PLIKE RF E+LDPRI +  +I  LV 
Sbjct  115   -CKESDVYGYGVVLMEILSGRRSENGLIVKWATPLIKEQRFAELLDPRIVVQSEIKSLVI  173

Query  489   RLAKVASACVGNSRKSRPTIVQVAAI  412
             RLAKVA ACVGNSR+SRP+I +VAAI
Sbjct  174   RLAKVALACVGNSRRSRPSISEVAAI  199



>ref|XP_006852578.1| hypothetical protein AMTR_s00021p00210750 [Amborella trichopoda]
 gb|ERN14045.1| hypothetical protein AMTR_s00021p00210750 [Amborella trichopoda]
Length=339

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 184/304 (61%), Gaps = 12/304 (4%)
 Frame = -1

Query  1320  CCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGV  1141
             C  + R     D +     H+     A  + L  + +AT  F+  R +G GRLG  Y  +
Sbjct  30    CKARNRLPQPSDPESPTPSHRPC---ATPWPLQTLHSATQAFSSNRALGHGRLGTTYRAI  86

Query  1140  LQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVME  961
             L P+G +VAVKR  P+LVL+ A G  FS+ ++ LS A HP++VPILG+ EAPGER++V +
Sbjct  87    L-PDGLVVAVKRVDPQLVLARA-GHSFSAEIKSLSRAHHPHVVPILGYCEAPGERLIVAD  144

Query  960   YGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLI  781
             +  + SLEF++H N   A  L W+ R+RVA+ VARGL++LH G  P IVH  V+ SN++ 
Sbjct  145   FAPLKSLEFHIHSNQGTA--LSWATRVRVASEVARGLDYLHNGTAPPIVHRAVRPSNIVF  202

Query  780   DVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRG-GSKESDVYGFGVVLLELLSGR  604
                  AR+ DYGL  +   E     G     ++ +G G  SK  DVY FGV+L+EL+SGR
Sbjct  203   GAGMVARVSDYGLAPMFGVESNAKAGC----WYRDGEGMASKAGDVYAFGVILIELMSGR  258

Query  603   KSQEGLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQ  424
             + +   + +WAL LI+E    E++D R++   +   + R+ +VA ACVGNSR+ RP I Q
Sbjct  259   RLEREEVKEWALRLIREGIGREMVDERLSGDAESEEVERMGRVALACVGNSRQCRPPIGQ  318

Query  423   VAAI  412
             VAAI
Sbjct  319   VAAI  322



>gb|EYU28017.1| hypothetical protein MIMGU_mgv1a025119mg, partial [Erythranthe 
guttata]
Length=194

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 116/147 (79%), Gaps = 5/147 (3%)
 Frame = -1

Query  849  EFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGR  670
            E+LH+   P ++HGCVK SN+L+DV+F ARLCDYGL+FLAS ERQ + GYVDEEYW+   
Sbjct  48   EYLHKVASPPVIHGCVKPSNILVDVKFCARLCDYGLHFLASQERQGLAGYVDEEYWLNKS  107

Query  669  GGSKESDVYGFGVVLLELLSGRKS---QEGL--LVKWALPLIKEMRFGEVLDPRIAIPCD  505
            G SKE DV+G GVVLLELLSGR+S   QE +  +V+WALPLIK ++F E+ D R+AIP +
Sbjct  108  GASKECDVFGLGVVLLELLSGRRSDYYQENVINIVQWALPLIKGLKFSELFDTRLAIPFN  167

Query  504  INPLVRLAKVASACVGNSRKSRPTIVQ  424
            I PLVRLA+VA ACVGNSR +RP I Q
Sbjct  168  IEPLVRLARVALACVGNSRPNRPCIAQ  194



>ref|XP_009413674.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Musa 
acuminata subsp. malaccensis]
Length=354

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 159/285 (56%), Gaps = 19/285 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+GR G VY G L  +G  +AVKR     V S+ A   F+ 
Sbjct  27    FSLKELSSATNNFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---VWSHQAEQEFAV  82

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L    H NL+ + G+     E ++V +Y   LSL  +LH +  A  +L W RR+  
Sbjct  83    EIEVLGRVRHKNLLSLRGYCAEGKEHLIVYDYMPNLSLHSHLHGHYSAECILDWGRRMST  142

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D++F ARL D+G   L       A+ + +
Sbjct  143   AIGSAEGIAYLHHQATPHIIHQDIKASNVLLDMDFQARLADFGFAKLIPDGATDATTDVK  202

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY   G+  S+ SDVY  GV+LLEL+ G++  E L       + +WALPL +
Sbjct  203   SNLGYLAPEYVSSGK-ASESSDVYSLGVLLLELVCGKRPVEKLSATMKLSITEWALPLAR  261

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             E +F E+ DP++        L R+  VA  C  NS + RPT+++V
Sbjct  262   ERKFNEIADPKLNGNYVEAELTRVVLVALFCAQNSPEKRPTVLEV  306



>ref|NP_001141596.2| uncharacterized LOC100273713 [Zea mays]
 gb|ACF86692.2| unknown [Zea mays]
 tpg|DAA57298.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=437

 Score =   160 bits (406),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 112/305 (37%), Positives = 173/305 (57%), Gaps = 21/305 (7%)
 Frame = -1

Query  1281  DEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRF  1102
             +E +G      + + A T  ++ AATDGF+ + ++G+G  G VY G+L+  GE++AVK+ 
Sbjct  90    EESLGVSNQ-NMPSRALTFSQLSAATDGFSSQNLLGEGGFGRVYKGLLEDTGEVIAVKQL  148

Query  1101  HPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQ  922
             +   +  N     F   +  LSL  HPNLV +LG+S    +RI+V EY    SLE +L  
Sbjct  149   NRDGLQGNGE---FLVEVLMLSLLHHPNLVKLLGYSTDSNQRILVYEYMPRGSLEDHLLD  205

Query  921   NPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGL  742
              P +   L W  R+R+A G A+G+++LHE   P +++  +KASN+L+D +F+A+L D+GL
Sbjct  206   LPPSWKPLPWHTRMRIAVGAAKGIQYLHEVANPPVIYRDLKASNILLDADFNAKLSDFGL  265

Query  741   YFLASNERQEVI--------GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-----  601
               L     Q  +        GY   EY + G+  +K SD+Y FGVVLLEL++GR+     
Sbjct  266   AKLGPMGDQSHVSTRVMGTYGYCAPEYAMTGK-LTKMSDIYSFGVVLLELITGRRAIDMA  324

Query  600   --SQEGLLVKWALPLIKEM-RFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTI  430
               S+E +L+ WA PL+++  RF ++ DP +     +  L +   VAS C+     SRP I
Sbjct  325   RPSEEQVLLNWASPLLRDKRRFVKLADPLLGNRYPVKALYQALAVASMCLQEDAASRPGI  384

Query  429   VQVAA  415
               V A
Sbjct  385   SDVVA  389



>ref|NP_001136610.1| LOC100216733 [Zea mays]
 gb|ACF82263.1| unknown [Zea mays]
 gb|AFW84869.1| putative protein kinase superfamily protein [Zea mays]
Length=461

 Score =   160 bits (406),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 115/301 (38%), Positives = 170/301 (56%), Gaps = 22/301 (7%)
 Frame = -1

Query  1269  GCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRL  1090
             GC++   + + A T  ++ AATDGF+ + ++G+G  G VY G+LQ   E++AVK+     
Sbjct  110   GCNQ--NMPSRALTFSQLGAATDGFSEQNLLGEGGFGRVYKGLLQDTREVIAVKQLDRNG  167

Query  1089  VLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDA  910
                N     F   +  LSL  HPNLV +LG+S    +RI+V EY    SLE +L   P +
Sbjct  168   FQGNRE---FLVEVLMLSLLHHPNLVKLLGYSTDSNQRILVYEYMPRGSLEDHLLDLPPS  224

Query  909   AALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLA  730
                L W  R+RVA G A+G+E+LHE   P +++  +KASN+L+D EF+A+L D+GL  L 
Sbjct  225   WKPLPWHTRMRVAVGAAKGIEYLHEVANPPVIYRDLKASNILLDREFNAKLSDFGLAKLG  284

Query  729   SNERQEVI--------GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-------SQ  595
                 Q  +        GY   EY + G+  +K SD+Y FGVVLLEL++GR+       S+
Sbjct  285   PMGDQSHVSTRVMGTYGYCAPEYAMTGK-LTKMSDIYSFGVVLLELITGRRAIDVTRPSE  343

Query  594   EGLLVKWALPLIKE-MRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVA  418
             E +LV WA PL+++  RF ++ DP +     +  L +   VAS C+     SRP I  V 
Sbjct  344   EQVLVHWATPLLRDRRRFMKLADPLLGKRYPVKGLFQALAVASMCLQEDAASRPGISDVV  403

Query  417   A  415
             +
Sbjct  404   S  404



>ref|XP_002882968.1| hypothetical protein ARALYDRAFT_479045 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59227.1| hypothetical protein ARALYDRAFT_479045 [Arabidopsis lyrata subsp. 
lyrata]
Length=359

 Score =   157 bits (398),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 104/292 (36%), Positives = 158/292 (54%), Gaps = 19/292 (7%)
 Frame = -1

Query  1245  SAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGF  1066
             S   ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       SN    
Sbjct  23    SWRVFSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSNREEI  78

Query  1065  GFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSr  886
              F+  +  L+   H NL+ + G+     ER++V EY   LSL  +LH    A  LL W++
Sbjct  79    DFAVEVEILARIRHKNLLSVRGYCAEGQERLLVYEYMPNLSLVSHLHGQHSAECLLDWTK  138

Query  885   rlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNER----  718
             R+++A   A+ + +LH+   PHIVHG V+ASNVL+D EF AR+ D+G   L  ++     
Sbjct  139   RMKIAISSAQAIAYLHDHATPHIVHGDVRASNVLLDSEFEARVTDFGYGKLMPDDTGDGA  198

Query  717   ---QEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWAL  568
                +   GY+  EY   G+  S+ SDVY FG++LL L+SG++  E L       + +W L
Sbjct  199   TRAKSNNGYISPEYVTSGK-ESETSDVYSFGILLLVLVSGKRPLERLNPTTTRGITEWVL  257

Query  567   PLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             PL+ E +FGE++D R++       L ++  V   C       RPT+ +V  +
Sbjct  258   PLVYERKFGEIVDKRLSEEHVEEKLKKVVLVGLMCAQTDPDKRPTMSEVVEM  309



>ref|XP_004303295.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Fragaria 
vesca subsp. vesca]
Length=371

 Score =   157 bits (396),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 158/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHAATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKAEMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A  LL W+RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAECLLDWTRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G   L        +   +
Sbjct  144   AIGSAEGIAYLHHHATPHIIHRDIKASNVLVDSDFQAQVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E L       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKLSATMKRTITDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DP++      + L R+  VA  C  N  + RPTI++V  +
Sbjct  263   ERKFDEIADPKLNGKYVEDELKRVVFVALLCAHNQPERRPTILEVVEL  310



>ref|XP_009607288.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Nicotiana tomentosiformis]
Length=893

 Score =   161 bits (408),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 113/293 (39%), Positives = 163/293 (56%), Gaps = 23/293 (8%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ AT GF     +GKG    V+ GVL+ +G  VAVKR     ++S+     
Sbjct  479   AQMFTYEELETATGGFKEESQVGKGSFSCVFKGVLK-DGTAVAVKR----AIMSSDMKKN  533

Query  1062  ---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLH  895
                F + L  LS  +H +L+ +LG+ E  GER++V EY    SL  +LH +N      L 
Sbjct  534   SKEFHTELDLLSRLNHAHLLDLLGYCEEAGERLLVYEYMANGSLHQHLHGKNKTVKEQLD  593

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L      
Sbjct  594   WIRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPANSS  653

Query  714   E--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKW  574
                       +GY+D EY+      +K SDVY FGV+LLE+LSGRK+      EG +V+W
Sbjct  654   SPLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYDEGNIVEW  712

Query  573   ALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             A+PLIK      +LDP +  P D+  L R+A +AS CV    K RP++ +V  
Sbjct  713   AVPLIKAGDIQAILDPVLKPPSDVEALRRIATIASKCVRMRGKERPSMDKVTT  765



>gb|EYU24637.1| hypothetical protein MIMGU_mgv1a009016mg [Erythranthe guttata]
Length=355

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 155/288 (54%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+  AT+ FN    +G+G  G VY G    +G  +AVKR       SN A   FS 
Sbjct  28    FSLKELQLATNNFNYDNKLGEGGFGSVYWGQ-SWDGSQIAVKRLKS---WSNKADMEFSI  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A   L WSRR+ +
Sbjct  84    EVEILARVRHKNLLTLRGYCAEGQERLIVYDYMNNLSLLSHLHGQHAAECHLDWSRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D EF A++ D+G   L        +   +
Sbjct  144   AIGAAEGIVYLHNHATPHIIHRDIKASNVLLDSEFKAQVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SGRK  E L       + +WALPL +
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGRKPLEKLGSTMKRTITEWALPLAR  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ D ++     +  L R+  V   C  N  + RPTI++V A+
Sbjct  263   ERKFDEIADKKMNGSYVVEELKRVVFVGLVCADNRPEKRPTILEVVAM  310



>ref|XP_010487434.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X2 [Camelina sativa]
Length=332

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 103/289 (36%), Positives = 154/289 (53%), Gaps = 20/289 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       SN     F+ 
Sbjct  13    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSNREEIDFAV  68

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V EY   LSL  +LH    A  LL WS+R+++
Sbjct  69    EVEILARIRHKNLLSVRGYCAEGQERLLVYEYMPNLSLVSHLHGQHSAECLLDWSKRMKI  128

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL--------ASNER  718
             A   A+ + +LH    P I+HG V+ASNVL+D EF AR+ D+G   L        A+  +
Sbjct  129   AISSAQAIAYLHHNATPQIIHGDVRASNVLLDSEFEARVTDFGYGKLMPDDTGDGATKAK  188

Query  717   QEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLI  559
                 GY+  E    G+  S+ SDVY FG++LL L+SG++  E L       + +W LPL+
Sbjct  189   SSNNGYISPECVASGK-ESETSDVYSFGILLLVLVSGKRPLERLNPTTTRGITEWVLPLV  247

Query  558   KEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              E +FGE++D R+        L ++  V   C     + RPT+ QV  +
Sbjct  248   YERKFGEIVDQRLGEEHVEEKLKKVVLVGLMCAQTEPEKRPTMSQVVEM  296



>emb|CDO98162.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 107/285 (38%), Positives = 156/285 (55%), Gaps = 19/285 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  27    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKAEMEFAV  82

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A  LL W+RR+ +
Sbjct  83    EVEILARVRHENLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAECLLDWNRRMNI  142

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  VKASNVL+D +F AR+ D+G            +   +
Sbjct  143   AIGSAEGIAYLHHHATPHIIHRDVKASNVLLDSDFQARVADFGFAKFIPDGATHVTTRVK  202

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E L       +  WALPL  
Sbjct  203   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKLNATTKRTITDWALPLAC  261

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             E +FGE+ DP++        L R+  VA  C  N  + RPT+++V
Sbjct  262   ESKFGELADPKLKGNYVEEELKRVVFVALICAQNRPEKRPTMLEV  306



>ref|XP_010487433.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Camelina sativa]
Length=345

 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 103/289 (36%), Positives = 154/289 (53%), Gaps = 20/289 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       SN     F+ 
Sbjct  26    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSNREEIDFAV  81

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V EY   LSL  +LH    A  LL WS+R+++
Sbjct  82    EVEILARIRHKNLLSVRGYCAEGQERLLVYEYMPNLSLVSHLHGQHSAECLLDWSKRMKI  141

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL--------ASNER  718
             A   A+ + +LH    P I+HG V+ASNVL+D EF AR+ D+G   L        A+  +
Sbjct  142   AISSAQAIAYLHHNATPQIIHGDVRASNVLLDSEFEARVTDFGYGKLMPDDTGDGATKAK  201

Query  717   QEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLI  559
                 GY+  E    G+  S+ SDVY FG++LL L+SG++  E L       + +W LPL+
Sbjct  202   SSNNGYISPECVASGK-ESETSDVYSFGILLLVLVSGKRPLERLNPTTTRGITEWVLPLV  260

Query  558   KEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              E +FGE++D R+        L ++  V   C     + RPT+ QV  +
Sbjct  261   YERKFGEIVDQRLGEEHVEEKLKKVVLVGLMCAQTEPEKRPTMSQVVEM  309



>gb|ACU18280.1| unknown [Glycine max]
Length=333

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 158/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A +LL W+RR+ +
Sbjct  84    EVEMLARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAESLLDWNRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F AR+ D+G   L        +   +
Sbjct  144   AIGSAEGIAYLHHQSTPHIIHRDIKASNVLLDSDFQARVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  ++  DVY FG++LLEL SG+K  E L       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ANESCDVYSFGILLLELASGKKPLEKLSSAVKRSINDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DP++        L R+  +A  C  +  + RPTI++V  +
Sbjct  263   EKKFSELADPKLEGNYAEEELKRVVLIALLCAQSQAEKRPTILEVVEL  310



>ref|XP_007215581.1| hypothetical protein PRUPE_ppa007548mg [Prunus persica]
 gb|EMJ16780.1| hypothetical protein PRUPE_ppa007548mg [Prunus persica]
Length=364

 Score =   154 bits (389),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 159/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHAATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A  LL W+RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAECLLDWNRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G   L        +   +
Sbjct  144   AIGSAEGIAYLHHHATPHIIHRDIKASNVLVDSDFQAQVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E L       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKLSSTMKRTVTDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DP++     ++ L R+  VA  C  +  + RPT+++V  +
Sbjct  263   ERKFDELADPKLNGKYAVDELKRVIFVALLCAHSRPERRPTMLEVVEL  310



>ref|XP_004486660.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Cicer 
arietinum]
Length=367

 Score =   154 bits (389),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 157/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A +LL W+RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAESLLDWNRRINI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  VKASNVL+D EF AR+ D+G   L        +   +
Sbjct  144   AIGSAEGIVYLHNQATPHIIHRDVKASNVLLDSEFQARVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  ++  DVY FG++LLEL SG+K  E L       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ANESCDVYSFGILLLELASGKKPLEKLSSSVKRSINDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DPR+        L R+  VA  C  +  + RP +V+V  +
Sbjct  263   EQKFSEIADPRLNGDYVEEELKRVVLVALICAQSQPEKRPNMVEVVEL  310



>ref|XP_008387599.1| PREDICTED: serine/threonine-protein kinase-like protein CCR1 
[Malus domestica]
Length=775

 Score =   159 bits (402),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 110/281 (39%), Positives = 160/281 (57%), Gaps = 26/281 (9%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  + L E+  AT+GF     +G+G  G VY  VL  +G+ VAVKR +   ++ +     
Sbjct  504   AQVFRLSELKDATNGFKEFNELGRGSFGFVYKAVLA-DGQQVAVKRANAATII-HTNSRD  561

Query  1062  FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrr  883
             F   L  LS   H N+V +LG+    GER++V EY    +L  +LH    A   L+WS R
Sbjct  562   FEMELEVLSKIRHCNIVNLLGYCSEMGERLLVYEYMAHGTLYDHLHGGLSA---LNWSLR  618

Query  882   lrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVIG  703
             L++A   A+GLE+LH+   P IVH  VK SN+L+D E+SAR+ D+GL  L SN+R     
Sbjct  619   LKIAMQAAKGLEYLHKEFXPPIVHRNVKTSNILLDAEWSARIADFGL--LTSNDRD----  672

Query  702   YVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQE-----GLLVKWALPLIKEMRFGE  538
                         G   SDVY FGVVLLE+LSGRK+ +       +V+WALPLIK+ +   
Sbjct  673   ----------LNGDLASDVYNFGVVLLEILSGRKAYDRDYTPPSVVEWALPLIKQNKAAA  722

Query  537   VLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             ++D  IA+P ++ PL++LA +A   +  +   RPT+  +A+
Sbjct  723   IIDRYIALPRNVEPLLKLADIAGLAIKENPTERPTMSDIAS  763



>gb|EPS59499.1| hypothetical protein M569_15303, partial [Genlisea aurea]
Length=334

 Score =   153 bits (386),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 156/288 (54%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+  AT+ FN    +G+G  G VY G L  +G  +AVKR       S+ A   FS 
Sbjct  20    FSLKELQMATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLKS---WSDKAELQFSV  75

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL+ +LH +  + + L W RR  +
Sbjct  76    EVETLARVRHTNLLTLRGYCAEGQERLIVYDYMPNLSLQSHLHGHHSSESHLDWPRRFAI  135

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV-----  709
             A G+A G+ +LH    PHI+H  +KASNVL+D  F AR+ D+G           V     
Sbjct  136   ALGIADGIAYLHHSSTPHIIHRDIKASNVLLDDAFRARVADFGFAKFVPEGATHVTTVVK  195

Query  708   --IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL +G++  + L       +  WALPL++
Sbjct  196   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELCTGKRPSKKLNSALRQTITDWALPLVR  254

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E RFGE+ DP++      + L R+  +   C  N  + RPTI+QV  +
Sbjct  255   EKRFGELADPKLKGEYVEDELKRVVLIGLICSQNQAEKRPTILQVVEL  302



>ref|NP_191501.1| serine/threonine-protein kinase-like protein ACR4 [Arabidopsis 
thaliana]
 sp|Q9LX29.1|ACR4_ARATH RecName: Full=Serine/threonine-protein kinase-like protein ACR4; 
AltName: Full=Protein CRINKLY 4; Short=AtCR4; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB91612.1| putative protein [Arabidopsis thaliana]
 dbj|BAB91132.1| putative receptor protein kinase ACR4 [Arabidopsis thaliana]
 gb|AEE79920.1| serine/threonine-protein kinase-like protein ACR4 [Arabidopsis 
thaliana]
Length=895

 Score =   159 bits (403),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 164/293 (56%), Gaps = 23/293 (8%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ A DGF    I+GKG    VY GVL+ +G  VAVKR     ++S+     
Sbjct  497   ARVFTYEELEKAADGFKEESIVGKGSFSCVYKGVLR-DGTTVAVKR----AIMSSDKQKN  551

Query  1062  ---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLH  895
                F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L 
Sbjct  552   SNEFRTELDLLSRLNHAHLLSLLGYCEECGERLLVYEFMAHGSLHNHLHGKNKALKEQLD  611

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W +R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +  
Sbjct  612   WVKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSG  671

Query  714   E--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKW  574
                       +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+W
Sbjct  672   SPLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMHYEEGNIVEW  730

Query  573   ALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             A+PLIK      +LDP +  P +I  L R+  VA  CV    K RP++ +V  
Sbjct  731   AVPLIKAGDINALLDPVLKHPSEIEALKRIVSVACKCVRMRGKDRPSMDKVTT  783



>ref|XP_002456468.1| hypothetical protein SORBIDRAFT_03g036860 [Sorghum bicolor]
 gb|EES01588.1| hypothetical protein SORBIDRAFT_03g036860 [Sorghum bicolor]
Length=454

 Score =   155 bits (392),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 110/295 (37%), Positives = 165/295 (56%), Gaps = 20/295 (7%)
 Frame = -1

Query  1251  KLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAA  1072
              + + A T  ++ AATDGF+ + ++G+G  G VY G+L+   E++AVK+        N  
Sbjct  113   NMPSRALTFSQLSAATDGFSEQNLLGEGGFGRVYKGLLEDTKEVIAVKQLDRNGFQGNRE  172

Query  1071  GFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHW  892
                F   +  LSL  HPNLV +LG+S    +RI+V EY    SLE +L   P     L W
Sbjct  173   ---FLVEVLMLSLLHHPNLVKLLGYSTDSDQRILVYEYMPKGSLEDHLLDLPPNWKPLPW  229

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
               R+++A G A+G+E+LHE   P +++  +KASN+L+D +F+A+L D+GL  L     Q 
Sbjct  230   HTRMQIAVGAAKGIEYLHEVANPPVIYRDLKASNILLDRDFNAKLSDFGLAKLGPMGDQS  289

Query  711   VI--------GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-------SQEGLLVK  577
              +        GY   EY + G+  +K SD+Y FGVVLLEL++GR+       S+E +LV 
Sbjct  290   HVSTRVMGTYGYCAPEYAMTGK-LTKMSDIYSFGVVLLELITGRRAIDVARPSEEQVLVH  348

Query  576   WALPLIKEM-RFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             WA PL+++  RF ++ DP +     +  L +   VAS C+     SRP I  V A
Sbjct  349   WASPLLRDKRRFMKLADPLLCRRYPVKGLYQALAVASMCLQEDAASRPGISDVVA  403



>ref|XP_003543684.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Glycine 
max]
 gb|KHN44185.1| PTI1-like tyrosine-protein kinase [Glycine soja]
Length=367

 Score =   153 bits (387),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 158/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A +LL W+RR+ +
Sbjct  84    EVEMLARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAESLLDWNRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F AR+ D+G   L        +   +
Sbjct  144   AIGSAEGIAYLHHQSTPHIIHRDIKASNVLLDSDFQARVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  ++  DVY FG++LLEL SG+K  E L       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ANESCDVYSFGILLLELASGKKPLEKLSSAVKRSINDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DP++        L R+  +A  C  +  + RPTI++V  +
Sbjct  263   EKKFSELADPKLEGNYAEEELKRVVLIALLCAQSQAEKRPTILEVVEL  310



>ref|XP_008795870.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Phoenix 
dactylifera]
Length=357

 Score =   153 bits (386),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 114/318 (36%), Positives = 162/318 (51%), Gaps = 31/318 (10%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAA--AYTLMEMDAATDGFNPRRIIGKGRLGVV  1153
             F CC K     E          K  K SA    ++L E+ +AT+ FN    +G+G  G V
Sbjct  6     FFCCGKASNGRE----------KGKKGSATWRIFSLKELQSATNNFNYDNKLGEGGFGSV  55

Query  1152  YSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERI  973
             Y G L  +G  +AVKR     V SN A   F+  +  L+   H NL+ + G+     ER+
Sbjct  56    YWGQLW-DGSQIAVKRLR---VWSNRAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERL  111

Query  972   VVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKAS  793
             +V +Y   LSL  +LH    A  LL W RR+ +A   A G+ +LH    PHI+H  +KAS
Sbjct  112   IVYDYMPNLSLLSHLHGQHSAECLLDWGRRMSIAIESAEGIAYLHHHATPHIIHRDIKAS  171

Query  792   NVLIDVEFSARLCDYGLYFL-------ASNERQEVIGYVDEEYWVEGRGGSKESDVYGFG  634
             NVL+D +F AR+ D+G   L        +   +  +GY+  EY + G+  S+  DVY  G
Sbjct  172   NVLLDSDFHARVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGK-ASESCDVYSLG  230

Query  633   VVLLELLSGRKSQEGL-------LVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKV  475
             ++LLEL SG+K  E L       +  WALPL +E R  EV DP++        L R+  V
Sbjct  231   ILLLELASGKKPIEKLSPTVKRTITDWALPLAREGRLKEVADPKLNGNFVEAELRRVVLV  290

Query  474   ASACVGNSRKSRPTIVQV  421
             A  C  N  + RPT+++V
Sbjct  291   ALVCAQNMPEKRPTMLEV  308



>ref|XP_003597913.1| Somatic embryogenesis receptor kinase [Medicago truncatula]
 gb|AES68164.1| Pti1-like kinase [Medicago truncatula]
Length=367

 Score =   153 bits (386),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 157/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH      +LL W+RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSTESLLDWNRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  VKASNVL+D +F AR+ D+G   L        +   +
Sbjct  144   AIGSAEGIVYLHVQATPHIIHRDVKASNVLLDSDFQARVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  ++  DVY FG++LLEL SG+K  E L       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ANESCDVYSFGILLLELASGKKPLEKLSSSVKRAINDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DPR+        L R+  VA  C  N  + RPT+V+V  +
Sbjct  263   EKKFSELADPRLNGDYVEEELKRVILVALICAQNQPEKRPTMVEVVEL  310



>ref|XP_002517653.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF44817.1| ATP binding protein, putative [Ricinus communis]
Length=365

 Score =   153 bits (386),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 157/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A  LL W RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAECLLDWKRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G   L        +   +
Sbjct  144   AIGSAEGIVYLHHHATPHIIHRDIKASNVLLDSDFQAQVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E L       ++ WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPLEKLNATMKRTIIDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DP++    +   L R+  VA  C  +  + RPT++ V  +
Sbjct  263   ERKFSELADPKLNGKFEEQELKRVVLVALMCAHSQPEKRPTMLDVVEL  310



>ref|XP_010503552.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Camelina sativa]
Length=350

 Score =   152 bits (385),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 154/289 (53%), Gaps = 20/289 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       SN     F+ 
Sbjct  26    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSNREEIDFAV  81

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V EY   LSL  +LH    A  L+ WS+R+++
Sbjct  82    EVEILARIRHKNLLSVRGYCAEGQERLLVYEYMPNLSLVSHLHGQHSAECLVDWSKRMKI  141

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL--------ASNER  718
             A   A+ + +LH    P I+HG V+ASNVL+D EF AR+ D+G   L        A+  +
Sbjct  142   AISSAQAIAYLHHNATPQIIHGDVRASNVLLDSEFEARVTDFGYGKLMPDGTGDGATKAK  201

Query  717   QEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLI  559
                 GY+  E    G+  S+ SDVY FG++LL L+SG++  E L       + +W LPL+
Sbjct  202   SSNNGYISPECVASGK-ESETSDVYSFGILLLVLVSGKRPLERLNPTTTRGITEWVLPLV  260

Query  558   KEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              E +FGE++D R+        L ++  V   C     + RPT+ QV  +
Sbjct  261   YERKFGEIVDQRLEEEHVEEKLKKVVLVGLMCAQTEPEKRPTMSQVVEM  309



>ref|XP_007026031.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY28653.1| Kinase superfamily protein [Theobroma cacao]
Length=392

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 164/294 (56%), Gaps = 20/294 (7%)
 Frame = -1

Query  1254  AKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNA  1075
             AK+SA  +TL E+  ATD FNP  +IG+G  G VY G ++   ++VAVK+   R  +  +
Sbjct  63    AKVSARIFTLRELVVATDNFNPDCLIGEGGFGRVYKGYIESIDKIVAVKQLD-RNGMQGS  121

Query  1074  AGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLH  895
               F FS VL  LSL  HPNLV ++G+     ++I+V EY    SLE +L   P     L 
Sbjct  122   REF-FSEVL-MLSLVHHPNLVNLIGYCADGDQKILVYEYLPNGSLEKHLLDLPPGKEPLD  179

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLA-----  730
             W+ R+++A G A+GLE+LH+   P I++   KASN+L+D +F+ +L D+GL  L      
Sbjct  180   WNTRMKIAEGAAKGLEYLHDFAEPPIIYRDFKASNILLDADFNPKLSDFGLAKLGPTGGR  239

Query  729   ---SNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-------SQEGLLV  580
                S       GY   EY + G+  +K SDVY FGVV LEL+SGR+       S+E  LV
Sbjct  240   DHVSTRVMGTYGYCAPEYAMTGQLTTK-SDVYSFGVVFLELISGRRAIDIERPSEEQNLV  298

Query  579   KWALPLIKE-MRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
              WA PL K+  +F  + DP +A    +  L +   VA+ C+     +RP I  V
Sbjct  299   AWAEPLFKDRQKFTLMADPLLAGNYTVKGLYQALAVAAMCLQEEADTRPLIGDV  352



>gb|AAM65900.1| protein kinase, putative [Arabidopsis thaliana]
Length=361

 Score =   152 bits (385),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 101/289 (35%), Positives = 155/289 (54%), Gaps = 20/289 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       SN     F+ 
Sbjct  27    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLKE---WSNREEIDFAV  82

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V EY   LSL  +LH    A  LL W++R+++
Sbjct  83    EVEILARIRHKNLLSVRGYCAEGQERLLVYEYMQNLSLVSHLHGQHSAECLLDWTKRMKI  142

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL--------ASNER  718
             A   A+ + +LH+   PHIVHG V+ASNVL+D EF AR+ D+G   L         + + 
Sbjct  143   AMSSAQAIAYLHDHATPHIVHGDVRASNVLLDSEFEARVTDFGYGKLMPDDDTGDGATKA  202

Query  717   QEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLI  559
             +   GY+  E    G+  S+ SDVY FG++L+ L+SG++  E L       + +W LPL+
Sbjct  203   KSNNGYISPECDASGK-ESETSDVYSFGILLMVLVSGKRPLERLNPTTTRCITEWVLPLV  261

Query  558   KEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              E  FGE++D R++       L ++  V   C       RPT+ +V  +
Sbjct  262   YERNFGEIVDKRLSEEHVAEKLKKVVLVGLMCAQTDPDKRPTMSEVVEM  310



>ref|XP_010503560.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X2 [Camelina sativa]
Length=337

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 154/289 (53%), Gaps = 20/289 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       SN     F+ 
Sbjct  13    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSNREEIDFAV  68

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V EY   LSL  +LH    A  L+ WS+R+++
Sbjct  69    EVEILARIRHKNLLSVRGYCAEGQERLLVYEYMPNLSLVSHLHGQHSAECLVDWSKRMKI  128

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL--------ASNER  718
             A   A+ + +LH    P I+HG V+ASNVL+D EF AR+ D+G   L        A+  +
Sbjct  129   AISSAQAIAYLHHNATPQIIHGDVRASNVLLDSEFEARVTDFGYGKLMPDGTGDGATKAK  188

Query  717   QEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLI  559
                 GY+  E    G+  S+ SDVY FG++LL L+SG++  E L       + +W LPL+
Sbjct  189   SSNNGYISPECVASGK-ESETSDVYSFGILLLVLVSGKRPLERLNPTTTRGITEWVLPLV  247

Query  558   KEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              E +FGE++D R+        L ++  V   C     + RPT+ QV  +
Sbjct  248   YERKFGEIVDQRLEEEHVEEKLKKVVLVGLMCAQTEPEKRPTMSQVVEM  296



>gb|KDP37071.1| hypothetical protein JCGZ_06127 [Jatropha curcas]
Length=371

 Score =   152 bits (385),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 157/285 (55%), Gaps = 19/285 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH +  A  LL W RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGHHSAECLLDWKRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G   L        +   +
Sbjct  144   AIGSAEGIAYLHHHATPHIIHRDIKASNVLLDSDFQAQVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SGRK  E +       +V WALP   
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGRKPLEKMNPTVKRTIVDWALPSAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             E +F E+ DP++    +   + R+  VA  C  N  + RPT+++V
Sbjct  263   EGKFNELADPKLNGNFEEEEMKRVVLVALMCAHNKPEKRPTMLEV  307



>emb|CDY06005.1| BnaA09g37750D [Brassica napus]
Length=730

 Score =   157 bits (397),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 164/293 (56%), Gaps = 23/293 (8%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ A +GF    I+GKG    VY GVL+ +G  VAVK+     ++S+     
Sbjct  336   ARVFTYEELEKAAEGFKEESIVGKGSFSCVYKGVLR-DGTTVAVKK----AIMSSDKQKN  390

Query  1062  ---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLH  895
                F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L 
Sbjct  391   SNEFRTELDLLSRLNHAHLLSLLGYCEEGGERLLVYEFMAHGSLYNHLHGKNKALKEQLD  450

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W +R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +  
Sbjct  451   WVKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSG  510

Query  714   E--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKW  574
                       +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+W
Sbjct  511   SPLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMHYEEGNIVEW  569

Query  573   ALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             A+PLIK      +LDP +  P +I  L R+  VA  CV    K RP++ +V  
Sbjct  570   AVPLIKAGDITSILDPVLKQPTEIEALRRIVSVACKCVRMRGKDRPSMDKVTT  622



>ref|XP_009342825.1| PREDICTED: serine/threonine-protein kinase-like protein CCR1 
[Pyrus x bretschneideri]
Length=775

 Score =   157 bits (398),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 111/281 (40%), Positives = 159/281 (57%), Gaps = 26/281 (9%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  + L E+  AT+GF     +G+G  G VY  VL  +G+ VAVKR +   ++ +     
Sbjct  504   AQVFRLSELKDATNGFKEFNELGRGSFGFVYKAVLA-DGQQVAVKRANAATII-HTNSRD  561

Query  1062  FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrr  883
             F   L  LS   H N V +LG+    GER++V EY    +L  +LH    A   L+WS R
Sbjct  562   FEMELEVLSKIRHCNNVNLLGYCSEMGERLLVYEYMAHGTLYDHLHGGLSA---LNWSLR  618

Query  882   lrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVIG  703
             L++A   A+GLE+LH+  VP IVH  VK SN+L+D E+SAR+ D+GL  L SN+R     
Sbjct  619   LKIAMQAAKGLEYLHKEFVPPIVHRNVKTSNILLDAEWSARIADFGL--LTSNDRD----  672

Query  702   YVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQE-----GLLVKWALPLIKEMRFGE  538
                         G   SDVY FGVVLLE+LSGRK+ +       +V+WALPLIK+ +   
Sbjct  673   ----------LNGDLASDVYNFGVVLLEILSGRKAYDRDYTLPSIVEWALPLIKQNKAAA  722

Query  537   VLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             ++D  IA+P ++ PL++LA +A      +   RPT+  +A+
Sbjct  723   IIDRYIALPRNVEPLLKLADIAGLAGKENPTERPTMSDIAS  763



>ref|XP_002878271.1| hypothetical protein ARALYDRAFT_486409 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54530.1| hypothetical protein ARALYDRAFT_486409 [Arabidopsis lyrata subsp. 
lyrata]
Length=894

 Score =   158 bits (400),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 111/293 (38%), Positives = 164/293 (56%), Gaps = 23/293 (8%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSN---AA  1072
             A  +T  E++ A DGF    I+GKG    VY GVL+ +G  VAVK+     ++S+     
Sbjct  497   ARVFTYEELEKAADGFKEESIVGKGSFSCVYKGVLR-DGTTVAVKK----AIMSSDKQKN  551

Query  1071  GFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLH  895
                F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L 
Sbjct  552   SNEFRTELDLLSRLNHAHLLSLLGYCEEGGERLLVYEFMAHGSLHNHLHGKNKALKEQLD  611

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W +R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +  
Sbjct  612   WVKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSG  671

Query  714   E--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKW  574
                       +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+W
Sbjct  672   SPLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMHYEEGNIVEW  730

Query  573   ALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             A+PLIK      +LDP +  P +I  L R+  VA  CV    K RP++ +V  
Sbjct  731   AVPLIKAGDINALLDPVLKHPSEIEALKRIVSVACKCVRMRGKDRPSMDKVTT  783



>ref|NP_566530.1| PTI1-like tyrosine-protein kinase [Arabidopsis thaliana]
 sp|Q9LSC2.1|Y3589_ARATH RecName: Full=PTI1-like tyrosine-protein kinase At3g15890 [Arabidopsis 
thaliana]
 dbj|BAB02873.1| protein kinase-like protein [Arabidopsis thaliana]
 gb|AEE75743.1| PTI1-like tyrosine-protein kinase [Arabidopsis thaliana]
Length=361

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 101/289 (35%), Positives = 155/289 (54%), Gaps = 20/289 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       SN     F+ 
Sbjct  27    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLKE---WSNREEIDFAV  82

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V EY   LSL  +LH    A  LL W++R+++
Sbjct  83    EVEILARIRHKNLLSVRGYCAEGQERLLVYEYMQNLSLVSHLHGQHSAECLLDWTKRMKI  142

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL--------ASNER  718
             A   A+ + +LH+   PHIVHG V+ASNVL+D EF AR+ D+G   L         + + 
Sbjct  143   AISSAQAIAYLHDHATPHIVHGDVRASNVLLDSEFEARVTDFGYGKLMPDDDTGDGATKA  202

Query  717   QEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLI  559
             +   GY+  E    G+  S+ SDVY FG++L+ L+SG++  E L       + +W LPL+
Sbjct  203   KSNNGYISPECDASGK-ESETSDVYSFGILLMVLVSGKRPLERLNPTTTRCITEWVLPLV  261

Query  558   KEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              E  FGE++D R++       L ++  V   C       RPT+ +V  +
Sbjct  262   YERNFGEIVDKRLSEEHVAEKLKKVVLVGLMCAQTDPDKRPTMSEVVEM  310



>ref|XP_008228699.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Prunus 
mume]
Length=364

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 159/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHAATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A  LL W+RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAECLLDWNRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G   L        +   +
Sbjct  144   AIGSAEGIAYLHHHATPHIIHRDIKASNVLVDSDFQAQVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E L       + +WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKLSSTMKRTVTEWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DP++      + L R+  VA  C  +  + RPT+++V  +
Sbjct  263   ERKFDELADPKLNGKYAEDELKRVIFVALLCAHSRPERRPTMLEVVEL  310



>ref|XP_011044847.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Populus 
euphratica]
Length=371

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 156/288 (54%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    +  LL W RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSSECLLDWKRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G   L        +   +
Sbjct  144   AIGSAEGIVYLHHHATPHIIHRDIKASNVLLDSDFQAQVADFGFAKLIPEGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL +G+K  E L       + +WA PL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELATGKKPLEKLSSTVKRTITEWAQPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DPR+    D   L R+  V+  C  N  + RPT++ V  +
Sbjct  263   ERKFSELADPRLNGKYDEEELKRVVLVSLVCAQNQPERRPTMLDVVEL  310



>ref|XP_008454209.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Cucumis 
melo]
Length=369

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 160/288 (56%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   FS 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKADMEFSV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH +  +   L W RR+++
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGHHSSECHLDWKRRMKI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F AR+ D+G   L        +   +
Sbjct  144   AIGSAEGIAYLHHQATPHIIHRDIKASNVLLDPDFQARVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL +G+K  E L       ++ WALP++ 
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELATGKKPLEKLSATMKRTIIDWALPIVV  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E  F E+ DP++    + + L R+  VA  C  +  + RPT+++V  +
Sbjct  263   EKNFEELADPKLNGDYNADELKRVILVALCCSHSRPEKRPTMLEVVEL  310



>emb|CDX87914.1| BnaC06g09760D [Brassica napus]
Length=370

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 106/289 (37%), Positives = 155/289 (54%), Gaps = 20/289 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             +TL E+ AAT+ FN    +G+GR G VY G L   G  +AVKR       S+     F+ 
Sbjct  28    FTLKELHAATNSFNYDNKLGEGRFGSVYWGQLSS-GSQIAVKRLKE---WSSGQETDFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER+ V EY   LSL  +LH    + +LL W+RR+ +
Sbjct  84    EVEILARIRHKNLLSLRGYCAEGQERLFVYEYMPNLSLVSHLHGLHSSESLLDWTRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV-----  709
             A   A+ + +LH    P IVHG V+ASNVL+D EF AR+ D+G   L  +E         
Sbjct  144   AVSSAQAIAYLHHHATPRIVHGDVRASNVLLDSEFEARVTDFGYCKLMPDEDGATKTTKG  203

Query  708   ---IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLI  559
                IGY+  E  +E   GS   DVY FGVVLLEL++G++  E L       + +W LPL+
Sbjct  204   ANNIGYLSPE-CIESVRGSYMGDVYCFGVVLLELVTGKRPIERLNQITKRGITEWVLPLV  262

Query  558   KEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              E ++G+++D R++       L R+  VA  C  N  + RPT+ +V  +
Sbjct  263   YEKKYGDIVDQRLSGKYVEEELKRVVLVALMCAQNEPEKRPTMSEVVEM  311



>gb|ABR17823.1| unknown [Picea sitchensis]
Length=350

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 109/312 (35%), Positives = 167/312 (54%), Gaps = 26/312 (8%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V S  A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGAFGSVYWGQLW-DGSQIAVKRLK---VWSTKAEMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L    H NL+ + G+     ER++V +Y   LS+  +LH    A  LL WSRR+ +
Sbjct  84    EVEILGRVRHKNLLSLRGYCSEGQERLIVYDYMPNLSILSHLHGQHAAECLLDWSRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV-----  709
             A G A GL +LH    PHI+H  +KASNVL+D +F A++ D+G   L       V     
Sbjct  144   AIGSAEGLAYLHHHATPHIIHRDIKASNVLLDSDFKAQVADFGFAKLIPEGETHVTTGVK  203

Query  708   --IGYVDEEY--WVEGRGGSKESDVYGFGVVLLELLSGRK-------SQEGLLVKWALPL  562
               +GY+  EY  W   R  S+  DVY FG++LLEL+SG+K       + +  +V WALPL
Sbjct  204   GTVGYLAPEYAMW---RKASENCDVYSFGILLLELVSGKKPVDKMDSNTKHTIVDWALPL  260

Query  561   IKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAIlnnletelnl  382
             + E ++ ++ DP+     +   L R+  VA  C  N+ + RPT+++V  +          
Sbjct  261   VLEGKYDQLADPKFHGKYNEEELKRVVHVAIMCAQNAPEKRPTMLEV--VDFLTGESKEK  318

Query  381   *FKL-SISLDKH  349
              FK+ +I++DK+
Sbjct  319   LFKMININIDKN  330



>ref|XP_010927378.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Elaeis 
guineensis]
Length=375

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 110/316 (35%), Positives = 163/316 (52%), Gaps = 27/316 (9%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F+CC K     E          K    +   ++L E+ +AT+ FN    +G+G  G VY 
Sbjct  6     FLCCGKTSNWREQ--------RKKRSTTWRVFSLKELHSATNNFNYDNKLGEGGFGSVYW  57

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
             G L  +G  +AVKR     V SN A   F+  +  L    H NL+ + G+     ER++V
Sbjct  58    GQLW-DGSQIAVKRLK---VWSNKAEMEFAVEVEVLGRVRHKNLLSLRGYCAEGQERLIV  113

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
              +Y   LSL  +LH    A   L W RR+ +A G A G+ +LH    PHI+H  +KASNV
Sbjct  114   YDYMPNLSLLSHLHGQHSAECHLDWGRRMSIAIGSAEGIAYLHHHATPHIIHRDIKASNV  173

Query  786   LIDVEFSARLCDYGLYFL-------ASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVV  628
             L+D +F AR+ D+G   L        + + +  +GY+  EY + G+  S+  DVY FG++
Sbjct  174   LLDSDFQARVADFGFAKLIPDGATHVTTKVKGTLGYLAPEYAMFGK-ASESCDVYSFGIL  232

Query  627   LLELLSGRKSQEGL-------LVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVAS  469
             LLEL SG+K  E +       +  WALPL +E RF E+ DPR+        L R+  VA 
Sbjct  233   LLELASGKKPIEKISRSVKQTITDWALPLARERRFKEMADPRLNGNYVEAELERVVLVAL  292

Query  468   ACVGNSRKSRPTIVQV  421
              C  +  + RPT++++
Sbjct  293   ICAQSKPEKRPTMLEL  308



>emb|CDY66068.1| BnaC08g48960D [Brassica napus]
Length=730

 Score =   156 bits (395),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 164/293 (56%), Gaps = 23/293 (8%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ A +GF    I+GKG    VY GVL+ +G  VAVK+     ++S+     
Sbjct  336   ARVFTYEELEKAAEGFKEESIVGKGSFSCVYKGVLR-DGTTVAVKK----AIMSSDKQKN  390

Query  1062  ---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLH  895
                F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L 
Sbjct  391   SNEFRTELDLLSRLNHAHLLSLLGYCEEGGERLLVYEFMAHGSLYNHLHGKNKALKEQLD  450

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W +R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +  
Sbjct  451   WVKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSG  510

Query  714   E--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKW  574
                       +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+W
Sbjct  511   SPLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMHYEEGNIVEW  569

Query  573   ALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             A+PLIK      +LDP +  P ++  L R+  VA  CV    K RP++ +V  
Sbjct  570   AVPLIKAGDITSILDPVLKQPTEVEALRRIVSVACKCVRMRGKDRPSMDKVTT  622



>ref|XP_009144835.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Brassica 
rapa]
Length=351

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 104/287 (36%), Positives = 157/287 (55%), Gaps = 18/287 (6%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             +TL E+ AAT+ FN    +G+GR+G VY G L   G  +AVKR       ++     F+ 
Sbjct  28    FTLKELHAATNSFNYDNKLGEGRIGSVYWGQLSS-GSQIAVKRLK---AWNSGEETDFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER+ V EY   LSL  +LH    + +LL W+RR+++
Sbjct  84    EVEILARIRHKNLLSLRGYCAEGQERLFVYEYMPNLSLVSHLHGLHSSESLLDWTRRMKI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV-----  709
             A   A+ + +LH    P IVHG V+ASNVL+D EF AR+ D+G   L  +E         
Sbjct  144   AVSCAQAIAYLHHHATPRIVHGDVRASNVLLDSEFEARVTDFGYGKLMPDEDGATKTTKG  203

Query  708   ---IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-----LVKWALPLIKE  553
                IGY+  E    GR G+   DVY FGVVLLEL++G++  E L     + +W LPL+ E
Sbjct  204   GNNIGYLSPECIESGR-GTYMGDVYSFGVVLLELVTGKRPIERLNQTRGITEWVLPLVYE  262

Query  552   MRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              ++G+++DPR+        L ++  VA  C  +  + RPT+ +V  +
Sbjct  263   KKYGDIVDPRLNGKYVEEELKKVVLVALMCAQSEPEKRPTMSEVVEM  309



>ref|XP_009772957.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Nicotiana 
sylvestris]
Length=365

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 155/288 (54%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKAEMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A +LL W RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAESLLDWKRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G            +   +
Sbjct  144   AIGSAEGIVYLHHHATPHIIHRDIKASNVLLDSDFQAQVADFGFAKFIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E L       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKLSPTVKRTITDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DPR+          RL  VA  C  N  + RPT+++V  +
Sbjct  263   EGKFSELADPRLNRNYVEEEFKRLVLVALICAHNRPEKRPTMLEVVEL  310



>ref|XP_006364223.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Solanum 
tuberosum]
Length=367

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 105/285 (37%), Positives = 155/285 (54%), Gaps = 19/285 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKAEMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A +LL W RR+ V
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAESLLDWKRRMNV  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G            +   +
Sbjct  144   AIGSAEGIAYLHHHATPHIIHRDIKASNVLLDSDFQAQVADFGFAKFIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E +       +  WALPL+ 
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKVDLTVKRTITDWALPLVC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             E +  E+ DPR++       L RL  VA  C  N  + RPT++ V
Sbjct  263   EGKLSELADPRLSGNYVEEELKRLVLVALVCAQNRPEKRPTMLDV  307



>gb|EMT10158.1| Putative receptor protein kinase CRINKLY4 [Aegilops tauschii]
Length=949

 Score =   157 bits (398),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 169/290 (58%), Gaps = 17/290 (6%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  ++  E++ ATDGF+    +GKG    V+ G+L+ +G +VAVKR   ++  +  +   
Sbjct  537   AQEFSYEELEQATDGFSEDSQVGKGSFSCVFRGILR-DGTVVAVKR-AIKVSDAKKSSKE  594

Query  1062  FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHWSr  886
             F + L  LS  +H +L+ +LG+ E   ER++V E+    SL  +LH ++ +    L+W+R
Sbjct  595   FHTELDLLSRLNHAHLLDLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDSNLKKQLNWTR  654

Query  885   rlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLA--------  730
             R+ +A   ARG+E+LH    P ++H  +K+SN+LID + +AR+ D+GL  +         
Sbjct  655   RVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPL  714

Query  729   SNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWALP  565
             S      +GY+D EY+      +K SDVY FGVVLLE+LSGRK+     +EG +V+WA P
Sbjct  715   SELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAP  773

Query  564   LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             LIK      +LDP ++ P D+  L ++A VA  CV    K RP++ +V  
Sbjct  774   LIKAGDISGILDPALSPPSDLEALKKIAAVACKCVRMRGKDRPSMDKVTT  823



>ref|XP_010469358.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Camelina sativa]
Length=897

 Score =   157 bits (397),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 164/293 (56%), Gaps = 23/293 (8%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ A DGF    I+GKG    VY GVL+ +G  VA+K+     ++S+     
Sbjct  499   ARVFTYEELEKAADGFKEESIVGKGSFSCVYKGVLR-DGTTVALKK----AIMSSDKQKN  553

Query  1062  ---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLH  895
                F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L 
Sbjct  554   SNEFRTELDLLSRLNHAHLLSLLGYCEEGGERLLVYEFMAHGSLHNHLHGKNKALKEQLD  613

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W +R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +  
Sbjct  614   WVKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSG  673

Query  714   E--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKW  574
                       +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+W
Sbjct  674   SPLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMHYEEGNIVEW  732

Query  573   ALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             A+PLIK      +LDP +  P +I  L R+  VA  CV    K RP++ +V  
Sbjct  733   AVPLIKAGDINALLDPVLKHPSEIEALKRIVSVACKCVRMRGKDRPSMDKVTT  785



>ref|XP_007023225.1| Brassinosteroid insensitive 1-associated receptor kinase 1 isoform 
1 [Theobroma cacao]
 gb|EOY25847.1| Brassinosteroid insensitive 1-associated receptor kinase 1 isoform 
1 [Theobroma cacao]
Length=371

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 153/285 (54%), Gaps = 19/285 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   FS 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKAEVEFSV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH        L W+RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSTDCQLEWTRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV-----  709
             A G A G+ +LH    PHI+H  +KASNVL+D +F  ++ D+G      +    V     
Sbjct  144   AIGSAEGIAYLHHHSTPHIIHRDIKASNVLLDSDFQPQVADFGFAKFIPDGATHVTTRVK  203

Query  708   --IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SGRK  E L       + +WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGRKPLEKLSATSKRSIAEWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             E +F EV DPR+        L RL  +A  C  N  + RPT+++V
Sbjct  263   EGKFSEVADPRLNGKYVEEELKRLVLIALVCADNRPEKRPTMLEV  307



>ref|XP_009398667.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Musa 
acuminata subsp. malaccensis]
Length=342

 Score =   150 bits (380),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 156/286 (55%), Gaps = 21/286 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR       S+ A   F+ 
Sbjct  29    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---TWSSKAEMEFAV  84

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   HPNL+ + G+     ER++V +Y   LSL  +LH    A  LL W RR+ +
Sbjct  85    EIEILARVRHPNLLTLRGYCAEGKERLIVYDYMPNLSLLSHLHGQQAAGCLLDWGRRMSI  144

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV-----  709
             A G A G+ +LH    PHI+H  +KASNVL+D EF AR+ D+G   L  +    V     
Sbjct  145   AIGSAEGIAYLHHHATPHIIHRDIKASNVLLDSEFQARVADFGFAKLIPDGATHVTTGVK  204

Query  708   --IGYVDEEYWVEGRGGSKES-DVYGFGVVLLELLSGRK--SQEGL-----LVKWALPLI  559
               +GY+  EY + G+  +KES DVY FG++LLEL SGRK   Q  L     + +WALPL 
Sbjct  205   GTLGYLAPEYAMLGK--AKESCDVYSFGILLLELASGRKPIDQSSLTSNHSIAEWALPLA  262

Query  558   KEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             ++ RF E+ DP++        L R+   A  C  +  + RP ++ V
Sbjct  263   RKQRFKEIADPKLNGHFVKEELRRMVLTALVCAQSKPEKRPIMLDV  308



>ref|XP_007023226.1| Brassinosteroid insensitive 1-associated receptor kinase 1 isoform 
2, partial [Theobroma cacao]
 gb|EOY25848.1| Brassinosteroid insensitive 1-associated receptor kinase 1 isoform 
2, partial [Theobroma cacao]
Length=347

 Score =   150 bits (380),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 153/285 (54%), Gaps = 19/285 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   FS 
Sbjct  4     FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKAEVEFSV  59

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH        L W+RR+ +
Sbjct  60    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSTDCQLEWTRRMNI  119

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV-----  709
             A G A G+ +LH    PHI+H  +KASNVL+D +F  ++ D+G      +    V     
Sbjct  120   AIGSAEGIAYLHHHSTPHIIHRDIKASNVLLDSDFQPQVADFGFAKFIPDGATHVTTRVK  179

Query  708   --IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SGRK  E L       + +WALPL  
Sbjct  180   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGRKPLEKLSATSKRSIAEWALPLAC  238

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             E +F EV DPR+        L RL  +A  C  N  + RPT+++V
Sbjct  239   EGKFSEVADPRLNGKYVEEELKRLVLIALVCADNRPEKRPTMLEV  283



>ref|XP_010250169.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Nelumbo 
nucifera]
Length=373

 Score =   151 bits (382),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 156/285 (55%), Gaps = 19/285 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+G  G VY G L  +G  +AVKR     V S  A   FS 
Sbjct  28    FSLKELHAATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSEKADMEFSV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L    H NL+ + G+     ER++V +Y   LSL  +LH +  A  LL W RR+++
Sbjct  84    EVEILGRVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLFSHLHGHHSAECLLDWERRMKI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+GL  L        + + +
Sbjct  144   AIGSAEGIVYLHHHATPHIIHSDIKASNVLLDSDFEAQVADFGLAKLIXDGITHVTTKVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEG-------LLVKWALPLIK  556
               +GY+  EY    +  S+  DVY FG++LLEL SG+K  E        ++  WALPL+ 
Sbjct  204   GTLGYLAPEYATLEK-ASESCDVYSFGILLLELASGKKPIEKPSATTMQIITDWALPLVC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             E +F EV DP++        L R+  +A  C  N  + RPT++++
Sbjct  263   EKKFSEVADPKLNGKYVEEELKRVILIALICCQNKPEKRPTMLEI  307



>ref|XP_004306242.1| PREDICTED: serine/threonine-protein kinase-like protein CCR1-like 
[Fragaria vesca subsp. vesca]
Length=777

 Score =   156 bits (395),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 115/309 (37%), Positives = 170/309 (55%), Gaps = 37/309 (12%)
 Frame = -1

Query  1305  RPAVEDDDDEGIGCHKAAKLS-------AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             +P +E D++E       A LS       A  + L E+  AT+GF     +G+G  G VY 
Sbjct  482   KPELEADNNE----DSEAPLSVVPCPGLAQVFRLSELKDATNGFKEFNELGRGSYGFVYK  537

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
              VL  EG+ VAVKR +   ++ +     F   L  L    H N+V +LG+    GER++V
Sbjct  538   AVLA-EGQQVAVKRANAATII-HTNSRDFEMELEVLCQIRHCNIVNLLGYCSEMGERLLV  595

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
              EY    +L  +LH      + L+W  RL++A   A+GLE+LH+  VP IVH  VK SN+
Sbjct  596   YEYMPHGTLYDHLH---GGLSPLNWGFRLKIAMQAAKGLEYLHKEFVPPIVHRDVKTSNI  652

Query  786   LIDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSG  607
             L+D E+SAR+ D+GL  L SN++                GG  E+DVY FG VLLE+LSG
Sbjct  653   LLDSEWSARIADFGL--LTSNDKD--------------LGGDLETDVYNFGRVLLEILSG  696

Query  606   RKSQE-----GLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKS  442
             RK+ +       +V+WALPLIK+ +   ++D  +A+P ++ PL++LA +A   V      
Sbjct  697   RKAYDRDYDPPSIVEWALPLIKQNKAAAIIDRYVALPRNVEPLLKLADIAGLAVKEKPNE  756

Query  441   RPTIVQVAA  415
             RPT+  +A+
Sbjct  757   RPTMSDIAS  765



>gb|EMS64811.1| Putative receptor protein kinase CRINKLY4 [Triticum urartu]
Length=949

 Score =   157 bits (397),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 169/290 (58%), Gaps = 17/290 (6%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  ++  E++ ATDGF+    +GKG    V+ G+L+ +G +VAVKR   ++  +  +   
Sbjct  537   AQEFSYEELEQATDGFSEDSQVGKGSFSCVFRGILR-DGTVVAVKR-AIKVSDAKKSSKE  594

Query  1062  FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHWSr  886
             F + L  LS  +H +L+ +LG+ E   ER++V E+    SL  +LH ++ +    L+W+R
Sbjct  595   FHTELDLLSRLNHAHLLDLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDSNLKKQLNWTR  654

Query  885   rlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLA--------  730
             R+ +A   ARG+E+LH    P ++H  +K+SN+LID + +AR+ D+GL  +         
Sbjct  655   RVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPL  714

Query  729   SNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWALP  565
             S      +GY+D EY+      +K SDVY FGVVLLE+LSGRK+     +EG +V+WA P
Sbjct  715   SELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAP  773

Query  564   LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             LIK      +LDP ++ P D+  L ++A VA  CV    K RP++ +V  
Sbjct  774   LIKAGDISGILDPALSPPSDLEALKKIAAVACKCVRMRGKDRPSMDKVTT  823



>gb|KHF99665.1| Serine/threonine-protein kinase PBS1 [Gossypium arboreum]
Length=387

 Score =   152 bits (383),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 168/305 (55%), Gaps = 21/305 (7%)
 Frame = -1

Query  1281  DEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRF  1102
             DE I   + AK+SA  +T  E+  ATD FNP  +IG+G  G VY G ++   ++VAVK+ 
Sbjct  55    DEEIQKIRKAKVSARIFTFRELVVATDNFNPDCLIGEGGFGRVYQGYIESIDQVVAVKQL  114

Query  1101  HPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQ  922
               R  L  +  F FS VL  LSL  HP+LV ++G+     +RI+V EY    SL+ +L  
Sbjct  115   D-RNGLQGSREF-FSEVL-MLSLVQHPSLVNLIGYCADGDQRILVYEYMPNGSLD-HLLD  170

Query  921   NPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGL  742
              P     L W+ R+++A G A+GLE+LH+   P I+    KASN+L+D  F+ +L D+GL
Sbjct  171   LPPGQQPLDWNTRMKIAVGAAKGLEYLHDFADPPIIFRDFKASNILLDANFNPKLSDFGL  230

Query  741   YFLASNERQEVI--------GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-----  601
               L   E +E +        GY   EY + G+   K SDVY FGVV LE++SGR+     
Sbjct  231   AKLGPTEGKEHVSTRVMGTYGYCAPEYAMTGKLTVK-SDVYSFGVVFLEIISGRRAIDLE  289

Query  600   --SQEGLLVKWALPLIKE-MRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTI  430
               ++E  LV WA PL K+  +F  ++DP +     I  L +   VA+ C+    +SRP I
Sbjct  290   RPTEEQNLVAWAEPLFKDRQKFELMVDPLLKGNYPIKGLCQALAVAAMCLQEEAESRPLI  349

Query  429   VQVAA  415
               V  
Sbjct  350   ADVVT  354



>ref|XP_003545853.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Glycine 
max]
 gb|KHN22437.1| PTI1-like tyrosine-protein kinase [Glycine soja]
Length=367

 Score =   151 bits (382),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 159/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A +LL W+RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAESLLDWNRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV-----  709
             A G A G+ +LH   +PHI+H  +KASNVL+D +F A++ D+G   L  +    V     
Sbjct  144   AIGSAEGIGYLHNQSMPHIIHRDIKASNVLLDSDFQAQVADFGFAKLIPDGATHVTTRVK  203

Query  708   --IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  ++  DVY FG++LLEL SG+K  E L       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ANESCDVYSFGILLLELASGKKPLEKLSSAVKRSINDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DP++        L R+   A  CV +  + RPTI++V  +
Sbjct  263   EKKFSELADPKLEGNYAEEELKRVVLTALLCVQSQPEKRPTILEVVEL  310



>ref|XP_006402689.1| hypothetical protein EUTSA_v10005780mg [Eutrema salsugineum]
 gb|ESQ44142.1| hypothetical protein EUTSA_v10005780mg [Eutrema salsugineum]
Length=895

 Score =   157 bits (396),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 164/293 (56%), Gaps = 23/293 (8%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ A +GF    I+GKG    VY GVL+ +G  VAVK+     ++S+     
Sbjct  496   ARVFTYEELEKAAEGFKEESIVGKGSFSCVYKGVLR-DGTTVAVKK----AIMSSDKQKN  550

Query  1062  ---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLH  895
                F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L 
Sbjct  551   SNEFRTELDLLSRLNHAHLLSLLGYCEEGGERLLVYEFMAHGSLHNHLHGKNKALKEQLD  610

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W +R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +  
Sbjct  611   WVKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSG  670

Query  714   E--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKW  574
                       +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+W
Sbjct  671   SPLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMHYEEGNIVEW  729

Query  573   ALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             A+PLIK      +LDP +  P +I  L R+  VA  CV    K RP++ +V  
Sbjct  730   AVPLIKAGDITAILDPVLKQPSEIEALRRIVSVACKCVRMRGKDRPSMDKVTT  782



>ref|XP_009607610.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Nicotiana tomentosiformis]
Length=365

 Score =   151 bits (381),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 155/288 (54%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKAEMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A +LL W RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAESLLDWKRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV-----  709
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G      +    V     
Sbjct  144   AIGSAEGIVYLHHHATPHIIHRDIKASNVLLDSDFQAQVADFGFAKFIPDGATHVTTRVK  203

Query  708   --IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E L       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKLNPTVKRTITDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DPR+          RL  +A  C  N  + RPT+++V  +
Sbjct  263   EGKFSELADPRLNRNYVEEEFKRLVLIALICAHNRPEKRPTMLEVVEL  310



>ref|XP_010512201.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Camelina sativa]
Length=895

 Score =   157 bits (396),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 164/293 (56%), Gaps = 23/293 (8%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ A DGF    I+GKG    VY GVL+ +G  VA+K+     ++S+     
Sbjct  497   ARVFTYEELEKAADGFKEESIVGKGSFSCVYKGVLR-DGTTVALKK----AIMSSDKQKN  551

Query  1062  ---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLH  895
                F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L 
Sbjct  552   SNEFRTELDLLSRLNHAHLLSLLGYCEEGGERLLVYEFMAHGSLHNHLHGKNKALKEQLD  611

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W +R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +  
Sbjct  612   WVKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSG  671

Query  714   E--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKW  574
                       +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+W
Sbjct  672   SPLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMHYEEGNIVEW  730

Query  573   ALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             A+PLIK      +LDP +  P +I  L R+  VA  CV    K RP++ +V  
Sbjct  731   AVPLIKAGDINALLDPVLKHPSEIEALKRIVSVACKCVRMRGKDRPSMDKVTT  783



>ref|XP_009407376.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Musa 
acuminata subsp. malaccensis]
Length=365

 Score =   151 bits (381),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 113/316 (36%), Positives = 164/316 (52%), Gaps = 27/316 (9%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F CC K      D  D+     K    +   ++L E+ +AT+ FN    IG+G  G VY 
Sbjct  6     FFCCGK----TSDRRDKW----KKNSSTWRVFSLKELQSATNNFNYDNKIGEGGFGSVYW  57

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
             G L  +G  +AVKR     V SN A   F+  +  L    H NL+ + G+     ER++V
Sbjct  58    GQLW-DGSQIAVKRLK---VWSNKAELQFAVEVEILGKVRHKNLLSLRGYCAEGQERLIV  113

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
              +Y   LSL  +LH +  A  LL W RR+ +A G A G+ +LH    P I+H  +KASNV
Sbjct  114   CDYLPNLSLISHLHGHNSAECLLDWDRRMSIAIGSAEGIAYLHHHATPRIIHRDIKASNV  173

Query  786   LIDVEFSARLCDYGLYFLASNERQEV-------IGYVDEEYWVEGRGGSKESDVYGFGVV  628
             L+D  F AR+ D+G   L  ++   V       +GY+  EY + G+  S+  DVY FG+V
Sbjct  174   LLDSNFQARVADFGFAKLIPDDATHVTTKVKGTLGYLAPEYAMYGK-ASESCDVYSFGIV  232

Query  627   LLELLSGRKSQEG-------LLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVAS  469
             LLEL SG+KS E         + +WALPL +E +F E+ D ++        L R+  VA 
Sbjct  233   LLELASGKKSIEKPSPTVKLPITEWALPLARERKFKEIADLKLKGNYAEAELKRMVLVAL  292

Query  468   ACVGNSRKSRPTIVQV  421
              C  +  + RPT+++V
Sbjct  293   ICAQSMPEKRPTMLEV  308



>ref|XP_009418509.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Musa 
acuminata subsp. malaccensis]
Length=373

 Score =   151 bits (381),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 108/320 (34%), Positives = 169/320 (53%), Gaps = 25/320 (8%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L+ +G  +AVKR     V SN A   F+ 
Sbjct  29    FSLKELYSATNNFNYDNKLGEGGFGSVYCGHLR-DGSQIAVKRLK---VWSNKAEMEFAV  84

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH       LL W RR+ +
Sbjct  85    EVEVLARIRHKNLLNLRGYCAEGKERLIVYDYMPNLSLTSHLHGQHAREGLLGWGRRMNI  144

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH   +PHI+H  VKASNVL+D EF AR+ D+G   L        +   +
Sbjct  145   AIGSAEGIAYLHHQAMPHIIHRDVKASNVLLDSEFQARVSDFGFAKLIPDGATHVTTRVK  204

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL +G++  E L       +  WALPL +
Sbjct  205   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELATGKRPIEKLSLTVKRPITDWALPLAR  263

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAIlnnletelnl*F  376
             E RF E+ DP++      + L R+  V   C  +  + RPT++ V  +L     +     
Sbjct  264   ERRFKEMADPKLKGDFVESELRRMVLVGLICAQSKPEKRPTMLDVINLLKEESKDKL---  320

Query  375   KLSISLDKHFIMSINISKCH  316
                ++L+   +   +++ CH
Sbjct  321   ---LNLENDELFRTDLAACH  337



>gb|EMT05325.1| Serine/threonine-protein kinase PBS1 [Aegilops tauschii]
Length=433

 Score =   152 bits (384),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 105/286 (37%), Positives = 158/286 (55%), Gaps = 20/286 (7%)
 Frame = -1

Query  1230  TLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSSV  1051
             T  E+ AAT+ F+P  ++G+G  G+VY G L+   E +AVKR        N     F   
Sbjct  114   TFRELSAATNNFSPNNLVGEGGFGMVYKGHLKDTKEDIAVKRLDKEGFQGNRE---FLVE  170

Query  1050  LRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrva  871
             +  LSL  HPNLV ++G+S    +RI+V EY    SLE +L   P+ A  L W  R+R+A
Sbjct  171   VLMLSLLSHPNLVNLIGYSTDLDQRILVYEYMPNGSLEDHLLDLPENAKALPWQTRMRIA  230

Query  870   agvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLA--------SNERQ  715
              G A+G+E+LHE   P +++  +KASN+L+D +F+++L D+GL  L         S    
Sbjct  231   VGAAKGIEYLHEVANPPVIYRDLKASNILLDKDFNSKLSDFGLAKLGPLGDESHVSTRVM  290

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-------SQEGLLVKWALPLIK  556
                GY   EY + G+  +K SD+Y FGVVLLEL++GR+       ++E +L+ WA PLI+
Sbjct  291   GTYGYCAPEYAMTGK-LTKMSDIYSFGVVLLELITGRRAIDPTKPTEEQVLIHWAAPLIR  349

Query  555   EMR-FGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             + + F  + DP +     +  L +   +AS C+      RP I  V
Sbjct  350   DRKMFVRLADPLLGKDFPVKGLYQALAIASMCMQEDPSKRPKIGDV  395



>ref|XP_011013943.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Populus 
euphratica]
Length=372

 Score =   150 bits (380),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 107/319 (34%), Positives = 166/319 (52%), Gaps = 28/319 (9%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
              +CC KK     D  + G       +L+   ++L E+ +AT+ FN    +G+G  G VY 
Sbjct  6     MLCCVKKL----DRKERG-----KKQLTWRIFSLKELHSATNNFNYDNKLGEGGFGSVYW  56

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
             G L  +G  +AVKR     V SN     F+  +  L+   H NL+ + G+     ER++V
Sbjct  57    GQLW-DGSQIAVKRLK---VWSNKGDMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIV  112

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
              +Y   LSL  +LH +  A  LL W RR+ +A G A G+ +LH    PHI+H  +KASNV
Sbjct  113   YDYMPNLSLLSHLHGHHSAECLLDWKRRMNIAIGSAAGITYLHHHATPHIIHRDIKASNV  172

Query  786   LIDVEFSARLCDYGLYFL-------ASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVV  628
             L+D +F A++ D+G   L        +   +  +GY+  EY + G+  S+  DVY FG++
Sbjct  173   LLDSDFQAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGK-ASESCDVYSFGIL  231

Query  627   LLELLSGRKSQEGL-------LVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVAS  469
             LLEL +G++  E +       +  WALPL  E +F E+ DP++    D   L R+  V+ 
Sbjct  232   LLELATGKRPLEKMSPTVKRTITDWALPLACERKFSELADPKLNGKYDEEELKRVVLVSL  291

Query  468   ACVGNSRKSRPTIVQVAAI  412
              C     + RPT++ V  +
Sbjct  292   VCAHTQPERRPTMLDVVEL  310



>ref|XP_002989320.1| hypothetical protein SELMODRAFT_129596, partial [Selaginella 
moellendorffii]
 gb|EFJ09594.1| hypothetical protein SELMODRAFT_129596, partial [Selaginella 
moellendorffii]
Length=335

 Score =   150 bits (378),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 160/288 (56%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+  AT+ F+    +G+G  G V+ G L  + E +AVKR     V++      F+ 
Sbjct  5     FSLKELQFATNNFSYENKLGEGGFGSVFYGQLGDKSE-IAVKRLK---VMNTTNEMSFAV  60

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L    H NL+ + G+     ER++V +Y   LSL  +LH +  +  LL W +R+ +
Sbjct  61    EVETLGRLHHKNLLKLRGYCAEGEERLIVYDYMPNLSLLSHLHGHFSSDKLLDWRKRVEI  120

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGL-YFLA------SNERQ  715
             A G A GL +LH    PHI+H  VKASN+LID  F A++ D+G   F+       +   +
Sbjct  121   AIGSAEGLAYLHHTANPHIIHRDVKASNILIDSNFQAQVADFGFAKFIPDGVTHLTTRVK  180

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL++GRK  E +       +++WA PL+ 
Sbjct  181   GTLGYLAPEYAMWGK-VSESCDVYSFGILLLELVTGRKPIEKIGPGKKRSIIQWAAPLVM  239

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E RF E+ DPR+    D   L R+ +VA+ C  N  + RPT+ +V A+
Sbjct  240   ERRFDELADPRLEGKYDGEELTRMIQVAALCAQNLPEHRPTMHEVVAM  287



>ref|XP_007150759.1| hypothetical protein PHAVU_005G178500g [Phaseolus vulgaris]
 gb|ESW22753.1| hypothetical protein PHAVU_005G178500g [Phaseolus vulgaris]
Length=366

 Score =   150 bits (380),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 157/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V  Y   LSL  +LH    A +LL W+RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYNYMPNLSLLSHLHGQHSAESLLDWNRRMII  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F AR+ D+G   L        +   +
Sbjct  144   AIGSAEGIAYLHLQATPHIIHRDIKASNVLLDSDFQARVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  ++  DVY FG++LLEL SG+K  E L       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ANESCDVYSFGILLLELASGKKPLEKLSSTVKRSINDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DP++        L R+  +A  C  +  + RPTI++V  +
Sbjct  263   EKKFSELADPKLEGNYVEEELKRVVLIALLCAQSQAEKRPTILEVVEL  310



>ref|NP_001061679.1| Os08g0376600 [Oryza sativa Japonica Group]
 dbj|BAC45097.1| serine/threonine protein kinase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD05295.1| serine/threonine protein kinase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF23593.1| Os08g0376600 [Oryza sativa Japonica Group]
 gb|EAZ06808.1| hypothetical protein OsI_29052 [Oryza sativa Indica Group]
Length=387

 Score =   151 bits (381),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 154/287 (54%), Gaps = 32/287 (11%)
 Frame = -1

Query  1227  LMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVL  1048
             L +++ ATDGF+P R+IG+GR   VY+         +A KR  P LVL    G  F + L
Sbjct  70    LADVERATDGFHPSRVIGQGRHFTVYAAAPG-----LAAKRMRPHLVLGEPGGRRFPAAL  124

Query  1047  RWLSLADHPNLVPILGFSEAPGERIVVMEY--GGMLSLEFYLHQNPDAAALLHWSrrlrv  874
             R L++  HPNL  I+G SE PGER++++E    G + L+  L+     A LL W  R  V
Sbjct  125   RSLAVPPHPNLAGIVGLSEGPGERVLIVERASAGSVGLDALLYHGGTDAPLLPWPERAAV  184

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSA------RLCDYGL-YFLASNERQ  715
             AAG ARGL  LH   V    HG V+  NVL+D   +A      R+ DYGL  FL S++  
Sbjct  185   AAGAARGLVHLHAHGV---AHGRVRPRNVLVDAAAAARGPCGVRVSDYGLSTFLHSDDGD  241

Query  714   EVI-GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIK--EMRF  544
                 G +D            E+DVY FG VLL LL+GR+   G L  WALPLI+      
Sbjct  242   GDDHGRLDAR---------AENDVYMFGAVLLHLLTGRQWDGGRLAHWALPLIRAGPPAL  292

Query  543   GEVLDPRIAIPCDINP---LVRLAKVASACVGNSRKSRPTIVQVAAI  412
              EVLD R   P D      L R A+VA ACV N  +SRP + +V+AI
Sbjct  293   AEVLDERAGKPADKAESRLLARTARVALACVANDGRSRPRMAEVSAI  339



>ref|XP_011009892.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Populus 
euphratica]
Length=372

 Score =   150 bits (380),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 107/319 (34%), Positives = 166/319 (52%), Gaps = 28/319 (9%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
              +CC KK     D  + G       +L+   ++L E+ +AT+ FN    +G+G  G VY 
Sbjct  6     MLCCVKKL----DRKERG-----KKQLTWRIFSLKELHSATNNFNYDNKLGEGGFGSVYW  56

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
             G L  +G  +AVKR     V SN     F+  +  L+   H NL+ + G+     ER++V
Sbjct  57    GQLW-DGSQIAVKRLK---VWSNKGDMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIV  112

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
              +Y   LSL  +LH +  A  LL W RR+ +A G A G+ +LH    PHI+H  +KASNV
Sbjct  113   YDYMPNLSLLSHLHGHHSAECLLDWKRRMNIAIGSAAGITYLHHHATPHIIHRDIKASNV  172

Query  786   LIDVEFSARLCDYGLYFL-------ASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVV  628
             L+D +F A++ D+G   L        +   +  +GY+  EY + G+  S+  DVY FG++
Sbjct  173   LLDSDFQAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGK-ASESCDVYSFGIL  231

Query  627   LLELLSGRKSQEGL-------LVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVAS  469
             LLEL +G++  E +       +  WALPL  E +F E+ DP++    D   L R+  V+ 
Sbjct  232   LLELATGKRPLEKMSPTVKRTITDWALPLACERKFSELADPKLNGKYDEEELKRVVLVSL  291

Query  468   ACVGNSRKSRPTIVQVAAI  412
              C     + RPT++ V  +
Sbjct  292   VCAHTQPERRPTMLDVVEL  310



>emb|CDY49913.1| BnaA05g14800D [Brassica napus]
Length=351

 Score =   150 bits (379),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 104/287 (36%), Positives = 155/287 (54%), Gaps = 18/287 (6%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             + L E+ AAT+ FN    +G+GR G VY G L   G  +AVKR       S+     F+ 
Sbjct  28    FALKELHAATNSFNYDNKLGEGRFGSVYWGQLSS-GSQIAVKRLK---AWSSGEETDFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER+ V EY   LSL  +LH    + +LL W+RR+++
Sbjct  84    EVEILARIRHKNLLSLRGYCAEGQERLFVYEYMPNLSLVSHLHGLHSSESLLDWTRRMKI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV-----  709
             A   A+ + +LH    P IVHG V+ASNVL+D EF AR+ D+G   L  +E         
Sbjct  144   AVSCAQAIAYLHHHATPRIVHGDVRASNVLLDSEFEARVTDFGYGKLMPDEDGATKTTKG  203

Query  708   ---IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-----LVKWALPLIKE  553
                IGY+  E    GR G+   DVY FGVVLLEL++G++  E L     + +W LPL+ E
Sbjct  204   GNNIGYLSPECIESGR-GTYMGDVYSFGVVLLELVTGKRPIERLNQTRGITEWVLPLVYE  262

Query  552   MRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              ++G+++DPR+        L ++  VA  C  +  + RPT+ +V  +
Sbjct  263   KKYGDIVDPRLNGKYVEEELKKVVLVALMCAQSEPEKRPTMSEVVEM  309



>ref|XP_009116601.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Brassica rapa]
Length=904

 Score =   156 bits (395),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 164/293 (56%), Gaps = 23/293 (8%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSN---AA  1072
             A  +T  E++ A +GF    I+GKG    VY GVL+ +G  VAVK+     ++S+     
Sbjct  494   ARVFTYEELEKAAEGFKEESIVGKGSFSCVYKGVLR-DGTTVAVKK----AIMSSDKQKN  548

Query  1071  GFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLH  895
                F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L 
Sbjct  549   SNEFRTELDLLSRLNHAHLLSLLGYCEEGGERLLVYEFMAHGSLYNHLHGKNKALKEQLD  608

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W +R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +  
Sbjct  609   WVKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSG  668

Query  714   E--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKW  574
                       +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+W
Sbjct  669   SPLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMHYEEGNIVEW  727

Query  573   ALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             A+PLIK      +LDP +  P +I  L R+  VA  CV    K RP++ +V  
Sbjct  728   AVPLIKAGDITSILDPVLKQPTEIEALRRIVSVACKCVRMRGKDRPSMDKVTT  780



>ref|XP_010413696.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Camelina sativa]
Length=895

 Score =   156 bits (394),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 164/293 (56%), Gaps = 23/293 (8%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ A DGF    I+GKG    VY G+L+ +G  VA+K+     ++S+     
Sbjct  498   ARVFTYEELEMAADGFKEESIVGKGSFSCVYKGILR-DGTTVALKK----AIMSSDKQKN  552

Query  1062  ---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLH  895
                F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L 
Sbjct  553   SNEFRTELDLLSRLNHAHLLSLLGYCEEGGERLLVYEFMAHGSLHNHLHGKNKALKEQLD  612

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W +R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +  
Sbjct  613   WVKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSG  672

Query  714   E--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKW  574
                       +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+W
Sbjct  673   SPLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMHYEEGNIVEW  731

Query  573   ALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             A+PLIK      +LDP +  P +I  L R+  VA  CV    K RP++ +V  
Sbjct  732   AVPLIKAGDINALLDPVLKHPSEIEALKRIVSVACKCVRMRGKDRPSMDKVTT  784



>ref|XP_003597519.1| Serine/threonine protein kinase-like protein ACR4 [Medicago truncatula]
 gb|AES67770.1| receptor-like kinase [Medicago truncatula]
Length=921

 Score =   156 bits (394),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 167/292 (57%), Gaps = 21/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKR--FHPRLVLSNAAG  1069
             A  ++  E++ AT GF    I+GKG    V+ GVL+ +G +VAVKR    P +  ++   
Sbjct  507   AQKFSYEELENATCGFKEESIVGKGSFSCVFKGVLK-DGTVVAVKRAIMSPNMQKNSKE-  564

Query  1068  FGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHW  892
               F + L  LS  +H +L+ +LG+ E  GER++V EY    SL  +LH +N +    L W
Sbjct  565   --FHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEYMAHGSLHQHLHGKNKELKEQLDW  622

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
              RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +   
Sbjct  623   IRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVSDFGLSLLGPTDSSS  682

Query  711   --------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWA  571
                      +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+W+
Sbjct  683   PLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYEEGNIVQWS  741

Query  570   LPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             +PLIK      +LDP +  P DI  L R+A VA  CV    K RP++ +V  
Sbjct  742   VPLIKSGDIASILDPCLKPPSDIEALRRIANVACKCVRMRGKDRPSMDKVTT  793



>ref|XP_006290261.1| hypothetical protein CARUB_v10016669mg [Capsella rubella]
 gb|EOA23159.1| hypothetical protein CARUB_v10016669mg [Capsella rubella]
Length=896

 Score =   156 bits (394),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 162/291 (56%), Gaps = 19/291 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKR-FHPRLVLSNAAGF  1066
             A  +T  E++ A DGF    I+GKG    VY GVL+ +G  VAVK+      V  N+  F
Sbjct  498   ARVFTYEELEKAADGFKEESIVGKGSFSCVYKGVLR-DGTTVAVKKAIMSSDVQKNSNEF  556

Query  1065  GFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHWS  889
                + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L W 
Sbjct  557   --RTELDLLSRLNHAHLLSLLGYCEEGGERLLVYEFMAHGSLHNHLHGKNKALKEQLDWV  614

Query  888   rrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE-  712
             +R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +    
Sbjct  615   KRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSP  674

Query  711   -------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWAL  568
                     +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA+
Sbjct  675   LAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMHYEEGNIVEWAV  733

Query  567   PLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
              LIK      +LDP +  P +I  L R+  VA  CV    K RP++ +V  
Sbjct  734   SLIKAGDINALLDPVLKHPSEIEALKRIVSVACKCVRMRGKDRPSMDKVTT  784



>gb|KFK35800.1| hypothetical protein AALP_AA4G038100 [Arabis alpina]
Length=336

 Score =   149 bits (376),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 154/291 (53%), Gaps = 22/291 (8%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR     V S+     F+ 
Sbjct  28    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---VWSSREEIDFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V EY   LSL  +LH    + +LL W+RR+ +
Sbjct  84    EVEILARIRHKNLLSVRGYCAEGQERLIVYEYMSNLSLVSHLHGQHSSESLLDWTRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL----------ASN  724
             A   A+ + +LH    P IVHG V+ASNVL+D EF AR+ D+G   L           + 
Sbjct  144   AVTSAQAIAYLHFHATPRIVHGDVRASNVLLDSEFEARVTDFGYGKLMPDNAENGANKTT  203

Query  723   ERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALP  565
             +    +GY+  E  +E    S   DVY FGVVLLEL++G++  E L       + +W LP
Sbjct  204   KGNSNLGYLSPEC-IESGKESDMGDVYSFGVVLLELVTGKRPTEKLNQTTKQGITEWVLP  262

Query  564   LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             L+ + +FGE++D R+        L R+  V   C     + RPT+ +V  +
Sbjct  263   LVYDKKFGEIVDQRLNGKYVEEELKRVVLVGLMCAQTEPEKRPTMSEVVEM  313



>ref|XP_002973593.1| hypothetical protein SELMODRAFT_99707, partial [Selaginella moellendorffii]
 gb|EFJ25253.1| hypothetical protein SELMODRAFT_99707, partial [Selaginella moellendorffii]
Length=317

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 158/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             +T  E+  AT  F+  R +G+G  G V+ G L  +G  +AVKR      L+      F+ 
Sbjct  6     FTFKELINATSNFSDDRKLGEGGFGSVFWGQLS-DGTQIAVKRLKN---LTTTNEMAFAV  61

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L    H NL+ + G+     ERI+V +Y   LSL  +LH    ++A L W +R+++
Sbjct  62    EVETLGRVQHRNLLKLRGYCTDGQERIIVYDYMPNLSLLSHLHGKLGSSACLSWPKRVKI  121

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLA-------SNERQ  715
             A G A  +E+LH    PHI+H  VKASNVLID  F A++ D+G            +   +
Sbjct  122   AMGSAEAIEYLHHDANPHIIHRDVKASNVLIDANFEAQIADFGFAKFVPEGVTHMTTRVK  181

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL+SGRK  E +       +V+WA PL+ 
Sbjct  182   GTLGYLAPEYAMWGK-VSESCDVYSFGILLLELISGRKPIEKMGSGMKRTIVEWAAPLVF  240

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             + +F +++DP++     +  L +L   A+ C  ++ ++RPT+ +V AI
Sbjct  241   QGKFEDLVDPKLQGKFSMLQLKKLVHAATLCAQSNPENRPTMREVVAI  288



>ref|XP_004152193.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Cucumis 
sativus]
 ref|XP_004171151.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Cucumis 
sativus]
 gb|KGN52913.1| hypothetical protein Csa_4G006200 [Cucumis sativus]
Length=369

 Score =   150 bits (378),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 158/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   FS 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKADMEFSV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH +  +   L W RR+++
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGHHSSECHLDWKRRMKI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F AR+ D+G   L        +   +
Sbjct  144   AIGSAEGIAYLHHQATPHIIHRDIKASNVLLDPDFQARVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL +G+K  E L       ++ WALP++ 
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELSTGKKPLEKLSATMKRTIIDWALPIVV  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E  F E+ DP++    +   L R+  VA  C     + RPT+++V  +
Sbjct  263   EKNFEELADPKLNGDYNAEELKRVILVALCCSHARPEKRPTMLEVVEL  310



>ref|XP_001782162.1| predicted protein [Physcomitrella patens]
 gb|EDQ53056.1| predicted protein [Physcomitrella patens]
Length=338

 Score =   149 bits (376),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 106/284 (37%), Positives = 159/284 (56%), Gaps = 18/284 (6%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+G  G VY G L   G+ +AVKR     V S  A   F+ 
Sbjct  5     FSLRELHAATNNFNYDNKLGEGGFGSVYWGQLA-SGDQIAVKRLK---VWSTRAEMEFAV  60

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L    H NL+ + G+     ER++V +Y   LSL  +LH    A + L W  R ++
Sbjct  61    EVEILGRVRHKNLLSLRGYCSEGQERLIVYDYMPKLSLLTHLHGQFAADSTLTWPNRFKI  120

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV-----  709
             A G A GL +LH    PHI+H  VKASNVL+D  F A + D+G   L  +    V     
Sbjct  121   AIGTAEGLAYLHHHATPHIIHRDVKASNVLLDENFEALVADFGFAKLIPDGATHVTTGVK  180

Query  708   --IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQE--GL----LVKWALPLIKE  553
               +GY+  EY + G+  S+  DVY +G++ LEL+SG+K  E  GL    +V+WA PL+ +
Sbjct  181   GTLGYLAPEYAMWGK-VSESCDVYSYGILTLELISGKKPIERVGLARRTIVEWAGPLVLQ  239

Query  552   MRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
              R+ +++DP++    D   L+RL +VA+ C  NS  +RPT+++V
Sbjct  240   GRYRDLVDPKLQGKFDEEELMRLVQVAALCAQNSPDNRPTMLEV  283



>ref|XP_010906578.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Elaeis 
guineensis]
Length=358

 Score =   149 bits (377),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 112/315 (36%), Positives = 161/315 (51%), Gaps = 27/315 (9%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F CC K     E          K +  +   ++L E+ +AT+ FN    +G+G  G VY 
Sbjct  6     FFCCGKASNGKEKG--------KKSAPTWRVFSLKELQSATNNFNYDNKLGEGGFGSVYW  57

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
             G L  +G  +AVKR     V SN A   F+  +  L+   H NL+ + G+     ER++V
Sbjct  58    GQLW-DGSQIAVKRLK---VWSNRAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIV  113

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
              +Y   LSL  +LH    A  LL W RRLR+A   A G+ +LH    PHI+H  +KASNV
Sbjct  114   YDYMPNLSLLSHLHGQHSAECLLDWGRRLRIAVESAEGIAYLHHHATPHIIHRDIKASNV  173

Query  786   LIDVEFSARLCDYGLYFL-------ASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVV  628
             L+D +F AR+ D+G   L        +   +  +GY+  EY + G+  S+  DVY FG+ 
Sbjct  174   LLDSDFQARVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGK-ASESCDVYSFGIF  232

Query  627   LLELLSGRKSQEGL-------LVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVAS  469
             LLEL+SG+K  E L       +  WAL L +E +F EV DP++        L R+  VA 
Sbjct  233   LLELVSGKKPIEKLSAMMKRTIADWALLLAREGKFKEVADPKLNGNFVEAELKRVVLVAL  292

Query  468   ACVGNSRKSRPTIVQ  424
              C  N    RPT+++
Sbjct  293   VCAQNLPDKRPTMLE  307



>ref|XP_002975616.1| hypothetical protein SELMODRAFT_103981, partial [Selaginella 
moellendorffii]
 gb|EFJ23245.1| hypothetical protein SELMODRAFT_103981, partial [Selaginella 
moellendorffii]
Length=318

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 158/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             +T  E+  AT  F+  R +G+G  G V+ G L  +G  +AVKR      L+      F+ 
Sbjct  7     FTFKELINATSNFSDDRKLGEGGFGSVFWGQLS-DGTQIAVKRLKN---LTTTNEMAFAV  62

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L    H NL+ + G+     ERI+V +Y   LSL  +LH    ++A L W +R+++
Sbjct  63    EVETLGRVQHRNLLKLRGYCTDGQERIIVYDYMPNLSLLSHLHGKLGSSACLSWPKRVKI  122

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLA-------SNERQ  715
             A G A  +E+LH    PHI+H  VKASNVLID  F A++ D+G            +   +
Sbjct  123   AMGSAEAIEYLHHDANPHIIHRDVKASNVLIDANFEAQIADFGFAKFVPEGVTHMTTRVK  182

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL+SGRK  E +       +V+WA PL+ 
Sbjct  183   GTLGYLAPEYAMWGK-VSESCDVYSFGILLLELISGRKPIEKMGSGMKRTIVEWAAPLVF  241

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             + +F +++DP++     +  L +L   A+ C  ++ ++RPT+ +V AI
Sbjct  242   QGKFEDLVDPKLQGKFSMLQLKKLVHAATLCAQSNPENRPTMREVVAI  289



>ref|XP_002983581.1| hypothetical protein SELMODRAFT_118274, partial [Selaginella 
moellendorffii]
 gb|EFJ15482.1| hypothetical protein SELMODRAFT_118274, partial [Selaginella 
moellendorffii]
Length=338

 Score =   149 bits (376),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 158/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V S  A   FS 
Sbjct  4     FSLKELHSATNSFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSTKAEMEFSV  59

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L    H NL+ + G+     ER++V +Y   LSL  +LH        L W +R+ +
Sbjct  60    EVEILGRVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQFAPDNQLDWDKRMNI  119

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A GLE+LH    PHI+H  VKASNVL++ +F A++ D+G   L        +   +
Sbjct  120   AIGSAEGLEYLHHNATPHIIHRDVKASNVLLNSDFEAQVADFGFAKLVPEGATHVTTRVK  179

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL+SG+K  E L       +V+WA PL+ 
Sbjct  180   GTLGYLAPEYAMWGK-VSESCDVYSFGILLLELISGKKPIEKLGPGTKRTIVEWAAPLVF  238

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             + R  E++DP++    +   L  +  VA+ C  N+ ++RPT+ +V  I
Sbjct  239   QGRLTELVDPKLQGKFNAEELKNVVHVATMCAQNTPENRPTMHEVVQI  286



>emb|CDM84543.1| unnamed protein product [Triticum aestivum]
Length=430

 Score =   151 bits (381),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 105/286 (37%), Positives = 156/286 (55%), Gaps = 20/286 (7%)
 Frame = -1

Query  1230  TLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSSV  1051
             T  E+ AAT+ F+P  ++G+G  G+VY G  +   E +AVKR        N     F   
Sbjct  100   TFRELSAATNNFSPNNLVGEGGFGMVYKGHFKDTNEDIAVKRLDKEGFQGNRE---FLVE  156

Query  1050  LRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrva  871
             +  LSL  HPNLV +LG+S    +RI+V EY    SLE +L   P  A  L W  R+R+A
Sbjct  157   VLMLSLLSHPNLVNLLGYSTDLDQRILVYEYMPNGSLEDHLLDLPGNAKALPWQTRMRIA  216

Query  870   agvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLA--------SNERQ  715
              G A+G+E+LHE   P +++  +KASN+L+D +F+++L D+GL  L         S    
Sbjct  217   VGAAKGIEYLHEVANPPVIYRDLKASNILLDKDFNSKLSDFGLAKLGPLGDESHVSTRVM  276

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-------SQEGLLVKWALPLIK  556
                GY   EY + G+  +K SD+Y FGVVLLEL++GR+       ++E +L+ WA PLI+
Sbjct  277   GTYGYCAPEYAMTGK-LTKMSDIYSFGVVLLELITGRRAIDPTKPTEEQVLIHWAAPLIR  335

Query  555   EMR-FGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             + + F  + DP +     +  L +   +AS C+      RP I  V
Sbjct  336   DRKMFVRLADPLLGKDFPVKGLYQALAIASMCMQEDPSKRPKIGDV  381



>gb|KFK40245.1| hypothetical protein AALP_AA3G349100 [Arabis alpina]
Length=893

 Score =   155 bits (392),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 164/293 (56%), Gaps = 23/293 (8%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSN---AA  1072
             A  +T  E++ A +GF    I+GKG    VY GVL+ +G  VAVK+     ++S+     
Sbjct  495   ARVFTYEELEKAAEGFKEESIVGKGSFSCVYKGVLR-DGTTVAVKK----AIMSSDKQKN  549

Query  1071  GFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLH  895
                F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L 
Sbjct  550   SNEFRTELDLLSRLNHAHLLSLLGYCEEGGERLLVYEFMAHGSLYNHLHGKNKALKEQLD  609

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W +R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +  
Sbjct  610   WVKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSG  669

Query  714   E--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKW  574
                       +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+W
Sbjct  670   SPLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMHYEEGNIVEW  728

Query  573   ALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             A+PLIK      +LDP +  P +I  L R+  VA  CV    K RP++ +V  
Sbjct  729   AVPLIKAGDITGILDPVLKQPSEIEALKRIVSVACKCVRMRGKDRPSMDKVTT  781



>ref|XP_010033970.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Eucalyptus 
grandis]
 gb|KCW53832.1| hypothetical protein EUGRSUZ_J03069 [Eucalyptus grandis]
Length=373

 Score =   150 bits (378),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 103/285 (36%), Positives = 156/285 (55%), Gaps = 19/285 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V S+ A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSDKAEMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    +  LL W+RR+ +
Sbjct  84    EVEILARVRHGNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSSECLLDWNRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH   +PHI+H  +KASNVL+D +F AR+ D+G            +   +
Sbjct  144   AIGSAEGIAYLHHRAIPHIIHRDIKASNVLLDSDFKARVADFGFAKFIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E L       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPLEKLNATTKRTITDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             E +F ++ DPRI        L R+  VA  C  +  + RPT+++V
Sbjct  263   EQKFSDLADPRINGNYVEEELKRVVLVALICAQSQPEKRPTMLEV  307



>gb|ABW81401.1| receptor-like kinase CR4 [Hordeum vulgare subsp. vulgare]
Length=897

 Score =   155 bits (392),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 168/290 (58%), Gaps = 17/290 (6%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  ++  E++ ATDGF+    +GKG    V+ G+L+ +G +VAVKR   ++  +  +   
Sbjct  485   AQEFSYEELEQATDGFSEDSQVGKGSFSCVFRGILR-DGTVVAVKR-AIKVSDAKKSSKE  542

Query  1062  FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHWSr  886
             F + L  LS  +H +L+ +LG+ E   ER++V E+    SL  +LH ++ +    L+W+R
Sbjct  543   FHTELDLLSRLNHAHLLDLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDSNLKKQLNWTR  602

Query  885   rlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLA--------  730
             R+ +A   ARG+E+LH    P ++H  +K+SN+LID + +AR+ D+GL  +         
Sbjct  603   RVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPL  662

Query  729   SNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWALP  565
             S      +GY+D EY+      +K SDVY FGVVLLE+LSGRK+     +EG +V+WA P
Sbjct  663   SELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAP  721

Query  564   LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             LIK      +LDP ++ P D   L ++A VA  CV    K RP++ +V  
Sbjct  722   LIKAGDISGILDPALSPPSDPEALKKIAAVACKCVRMRGKDRPSMDKVTT  771



>dbj|BAK05611.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=897

 Score =   155 bits (392),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 168/290 (58%), Gaps = 17/290 (6%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  ++  E++ ATDGF+    +GKG    V+ G+L+ +G +VAVKR   ++  +  +   
Sbjct  485   AQEFSYEELEQATDGFSEDSQVGKGSFSCVFRGILR-DGTVVAVKR-AIKVSDAKKSSKE  542

Query  1062  FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHWSr  886
             F + L  LS  +H +L+ +LG+ E   ER++V E+    SL  +LH ++ +    L+W+R
Sbjct  543   FHTELDLLSRLNHAHLLDLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDSNLKKQLNWTR  602

Query  885   rlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLA--------  730
             R+ +A   ARG+E+LH    P ++H  +K+SN+LID + +AR+ D+GL  +         
Sbjct  603   RVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPL  662

Query  729   SNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWALP  565
             S      +GY+D EY+      +K SDVY FGVVLLE+LSGRK+     +EG +V+WA P
Sbjct  663   SELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAP  721

Query  564   LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             LIK      +LDP ++ P D   L ++A VA  CV    K RP++ +V  
Sbjct  722   LIKAGDISGILDPALSPPSDPEALKKIAAVACKCVRMRGKDRPSMDKVTT  771



>ref|XP_008356531.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Malus 
domestica]
Length=380

 Score =   150 bits (378),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 159/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+G  G VY G L  +G  +AVKR     V S+ A   F+ 
Sbjct  28    FSLKELHAATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSDKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A  LL W+RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAECLLDWTRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH  + PHI+H  +KASNVL+D +F A++ D+G   L        +   +
Sbjct  144   AIGSAEGVAYLHHHLTPHIIHRDIKASNVLVDSDFQAQVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E +       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKVSRGMKRTVTDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DP++      + L R+  VA  C  +  + RPT+++V  +
Sbjct  263   ERKFDEIADPKLNGKYLEDELKRVVFVALLCAHSWPERRPTMLEVVEL  310



>gb|KHG17287.1| hypothetical protein F383_02161 [Gossypium arboreum]
Length=356

 Score =   149 bits (376),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 155/288 (54%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   FS 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKAEVQFSV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH +  +   L WSRR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGHHSSECHLDWSRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV-----  709
             A G A G+ +LH    PHI+H  +KASNVL+D +F  ++ D+G      +    V     
Sbjct  144   AIGSAEGIAYLHHHSTPHIIHRDIKASNVLLDSDFQPQVADFGFAKFIPDGATHVTTRVK  203

Query  708   --IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E L       + +WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPLEKLSPTVKRPIAEWALPLAS  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DPR+        L R+  VA  C     + RPTI++V  +
Sbjct  263   EGKFSELADPRLNGKYVEEELKRVVLVALVCADAQPEKRPTILEVVKL  310



>ref|XP_006465319.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Citrus 
sinensis]
 gb|KDO48607.1| hypothetical protein CISIN_1g015797mg [Citrus sinensis]
Length=400

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 103/285 (36%), Positives = 157/285 (55%), Gaps = 19/285 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKAEMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    +  LL+W+RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSSECLLNWNRRMDI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G   L        +   +
Sbjct  144   AIGSAEGIVYLHHHATPHIIHRDIKASNVLLDADFKAQVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E +       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKVNSAIKRTITDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             E +F E+ DPR+        L R+  VA  C  +  + RPT+++V
Sbjct  263   ERKFSELADPRLNGNFVEEELKRVVLVALTCAHSKPEKRPTMLEV  307



>ref|XP_002973814.1| hypothetical protein SELMODRAFT_149289 [Selaginella moellendorffii]
 gb|EFJ24769.1| hypothetical protein SELMODRAFT_149289 [Selaginella moellendorffii]
Length=360

 Score =   149 bits (377),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 158/288 (55%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V S  A   FS 
Sbjct  26    FSLKELHSATNSFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSTKAEMEFSV  81

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L    H NL+ + G+     ER++V +Y   LSL  +LH        L W +R+ +
Sbjct  82    EVEILGRVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQFAPDNQLDWDKRMNI  141

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A GLE+LH    PHI+H  VKASNVL++ +F A++ D+G   L        +   +
Sbjct  142   AIGSAEGLEYLHHNATPHIIHRDVKASNVLLNSDFEAQVADFGFAKLVPEGATHVTTRVK  201

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL+SG+K  E L       +V+WA PL+ 
Sbjct  202   GTLGYLAPEYAMWGK-VSESCDVYSFGILLLELISGKKPIEKLGPGTKRTIVEWAAPLVF  260

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             + R  E++DP++    +   L  +  VA+ C  N+ ++RPT+ +V  I
Sbjct  261   QGRLTELVDPKLQGKFNAEELKNVVHVATMCAQNTPENRPTMHEVVQI  308



>ref|XP_010930213.1| PREDICTED: putative receptor protein kinase CRINKLY4 [Elaeis 
guineensis]
Length=904

 Score =   155 bits (392),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 168/291 (58%), Gaps = 19/291 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKR-FHPRLVLSNAAGF  1066
             A  +T  E++ AT GF+   I+GKG    V+ G+L+ +G LVAVKR      V  N+  F
Sbjct  492   AQMFTYEELEKATGGFSEESIVGKGSFSYVFKGILK-DGTLVAVKRAIKASDVKKNSKEF  550

Query  1065  GFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHWS  889
                + L  LS  +H +L+ +LG+ E  GER++V EY    SL  +LH ++P     L W 
Sbjct  551   --HTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEYMAHGSLYQHLHGKDPTLKEQLGWV  608

Query  888   rrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE-  712
             RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL   A ++    
Sbjct  609   RRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEENNARVADFGLSLFAPDDSSAP  668

Query  711   -------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWAL  568
                     +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA+
Sbjct  669   LSELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAV  727

Query  567   PLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             PLIK      VLDP +  P D+  L ++A +A  CV    K RP++ +V  
Sbjct  728   PLIKAGDITAVLDPVLKTPADLEALKKIAAIACKCVRMRGKDRPSMDKVTT  778



>gb|KCW53833.1| hypothetical protein EUGRSUZ_J03069 [Eucalyptus grandis]
Length=366

 Score =   149 bits (377),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 103/285 (36%), Positives = 156/285 (55%), Gaps = 19/285 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V S+ A   F+ 
Sbjct  21    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSDKAEMEFAV  76

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    +  LL W+RR+ +
Sbjct  77    EVEILARVRHGNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSSECLLDWNRRMNI  136

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH   +PHI+H  +KASNVL+D +F AR+ D+G            +   +
Sbjct  137   AIGSAEGIAYLHHRAIPHIIHRDIKASNVLLDSDFKARVADFGFAKFIPDGATHVTTRVK  196

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E L       +  WALPL  
Sbjct  197   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPLEKLNATTKRTITDWALPLAC  255

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             E +F ++ DPRI        L R+  VA  C  +  + RPT+++V
Sbjct  256   EQKFSDLADPRINGNYVEEELKRVVLVALICAQSQPEKRPTMLEV  300



>ref|XP_006427299.1| hypothetical protein CICLE_v10025774mg [Citrus clementina]
 gb|ESR40539.1| hypothetical protein CICLE_v10025774mg [Citrus clementina]
Length=400

 Score =   150 bits (379),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/285 (36%), Positives = 157/285 (55%), Gaps = 19/285 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKAEMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    +  LL+W+RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSSECLLNWNRRMDI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G   L        +   +
Sbjct  144   AIGSAEGIVYLHHHATPHIIHRDIKASNVLLDADFKAQVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E +       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKVNSAIKRTITDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             E +F E+ DPR+        L R+  VA  C  +  + RPT+++V
Sbjct  263   ERKFSELADPRLNGNFVEEELKRVVLVALTCAHSKPEKRPTMLEV  307



>ref|XP_010465583.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Camelina sativa]
Length=350

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 100/288 (35%), Positives = 154/288 (53%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       SN     F+ 
Sbjct  27    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSNREEIDFAV  82

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V EY   LSL  +LH    A  LL W++R+++
Sbjct  83    EVEILARIRHKNLLSVRGYCAEGQERLLVYEYMPNLSLVSHLHGQHSAECLLDWTKRMKI  142

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNER-------Q  715
             A   A+ + +LH    P I+HG V+ASNVL+D EF AR+ D+G   L  ++        +
Sbjct  143   AISSAQAIAYLHHNATPQIIHGDVRASNVLLDSEFEARVTDFGYGKLMPDDTGDGATKAK  202

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
                GY+  E    G+  S+ SDVY FG++LL L+SG++  E L       + +W LPL+ 
Sbjct  203   SSNGYISPECVASGK-ESEASDVYSFGILLLVLVSGKRPLERLNATTTRGITEWVLPLVY  261

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E++D R++       L ++  V   C     + RPT+ QV  +
Sbjct  262   ERKFVEIVDQRLSEEHVEEKLKKVVLVGLMCAQTEPEKRPTMSQVVEM  309



>ref|XP_009374021.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Pyrus 
x bretschneideri]
Length=660

 Score =   153 bits (387),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 108/297 (36%), Positives = 169/297 (57%), Gaps = 31/297 (10%)
 Frame = -1

Query  1248  LSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAG  1069
              S + +T  E+  AT+GF+   ++G+G  G V+ GVL P G+ VAVK+      L   +G
Sbjct  268   FSKSTFTYEELALATEGFSDSNLLGQGGFGYVHKGVL-PNGKEVAVKQ------LKAGSG  320

Query  1068  FG---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALL  898
              G   F + +  +S   H +LV ++G+     ER++V E+    +LEF+LH        +
Sbjct  321   QGEREFQAEVEIISRVHHRHLVSLVGYCMTGSERLLVYEFVPNNTLEFHLHGK--GRPTM  378

Query  897   HWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNER  718
              WS RL++A G A+G+ +LHE   P I+H  +KA+N+L+D +F A++ D+GL  L+S+  
Sbjct  379   DWSTRLKIALGSAKGIAYLHEDCHPKIIHRDIKAANILLDFKFEAKVADFGLAKLSSDVN  438

Query  717   QEV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK----SQ---EGLLV  580
               +        GY+  EY   G+   K SDVY FGV+LLEL++GR+    SQ   E  LV
Sbjct  439   THISTRVMGTFGYLAPEYASSGKLTDK-SDVYSFGVMLLELITGRRPVDASQTYMEDSLV  497

Query  579   KWALPL----IKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
              WA P+    ++E  F E++DP++    D N + R+   A+ACV +S + RP + QV
Sbjct  498   DWARPVLNRALEERNFDELVDPKLQNSYDPNEMARMVACAAACVRHSARRRPRMSQV  554



>ref|XP_002969992.1| hypothetical protein SELMODRAFT_146686 [Selaginella moellendorffii]
 gb|EFJ29116.1| hypothetical protein SELMODRAFT_146686 [Selaginella moellendorffii]
Length=324

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 105/319 (33%), Positives = 168/319 (53%), Gaps = 28/319 (9%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F  C + R + +   D G             ++L E+  A++ FN    +G+GR G VY 
Sbjct  4     FKSCFRARTSADRSQDAGWRL----------FSLKELQNASNNFNYDNKLGEGRFGSVYW  53

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
             G L  +G  +AVKR     + S+     F+  +  L    H NL+ + G+     ER++V
Sbjct  54    GQLW-DGSQIAVKRLK---LWSSKREIDFAVEVEILGRVRHKNLLSLRGYCAEGKERLLV  109

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
               Y   LSL  +LH +  A + L W RR+ +A G A  L +LH    PHI+HG +K+SNV
Sbjct  110   YNYMPNLSLSAHLHGHLAAESNLDWERRMNIAIGSAEALAYLHHHATPHIIHGDLKSSNV  169

Query  786   LIDVEFSARLCDYGLYFL---ASNERQEVIGYVDEEYWVEGRGG-SKESDVYGFGVVLLE  619
             L++ EF A++ D+G   L    S      +GY   ++   G G  S++SDVY FGV+LLE
Sbjct  170   LLNAEFEAQVADFGFAELVPETSTVNAGAMGYFPPDHATPGDGKLSEKSDVYSFGVLLLE  229

Query  618   LLSGRK--SQEGL--------LVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVAS  469
             L+SGRK   ++G         +V+WA P+I E R  ++ DP+++   +   L ++ +VA 
Sbjct  230   LVSGRKPVEKQGFSASAKSQSIVEWATPMIYEGRLDDIADPKLSGNFNEVELKQVVQVAQ  289

Query  468   ACVGNSRKSRPTIVQVAAI  412
              C   S ++RP++++V  +
Sbjct  290   WCSQTSPENRPSMIKVVEL  308



>ref|XP_010465584.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X2 [Camelina sativa]
Length=349

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 100/288 (35%), Positives = 154/288 (53%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       SN     F+ 
Sbjct  26    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSNREEIDFAV  81

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V EY   LSL  +LH    A  LL W++R+++
Sbjct  82    EVEILARIRHKNLLSVRGYCAEGQERLLVYEYMPNLSLVSHLHGQHSAECLLDWTKRMKI  141

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNER-------Q  715
             A   A+ + +LH    P I+HG V+ASNVL+D EF AR+ D+G   L  ++        +
Sbjct  142   AISSAQAIAYLHHNATPQIIHGDVRASNVLLDSEFEARVTDFGYGKLMPDDTGDGATKAK  201

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
                GY+  E    G+  S+ SDVY FG++LL L+SG++  E L       + +W LPL+ 
Sbjct  202   SSNGYISPECVASGK-ESEASDVYSFGILLLVLVSGKRPLERLNATTTRGITEWVLPLVY  260

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E++D R++       L ++  V   C     + RPT+ QV  +
Sbjct  261   ERKFVEIVDQRLSEEHVEEKLKKVVLVGLMCAQTEPEKRPTMSQVVEM  308



>ref|XP_002980938.1| hypothetical protein SELMODRAFT_113448, partial [Selaginella 
moellendorffii]
 gb|EFJ18123.1| hypothetical protein SELMODRAFT_113448, partial [Selaginella 
moellendorffii]
Length=335

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 160/288 (56%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+  AT+ F+    +G+G  G V+ G L  + E +AVKR     V++      F+ 
Sbjct  5     FSLKELQFATNNFSYENKLGEGGFGSVFYGQLGDKSE-IAVKRLK---VMNTTNEMSFAV  60

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L    H NL+ + G+     ER++V +Y   LSL  +LH +  +  LL W +R+ +
Sbjct  61    EVETLGRLHHKNLLKLRGYCAEGEERLIVYDYMPNLSLLSHLHGHFSSDKLLDWRKRVEI  120

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGL-YFLA------SNERQ  715
             A G A GL +LH    PHI+H  VKASN+LID  F A++ D+G   F+       +   +
Sbjct  121   AIGSAEGLAYLHHTANPHIIHRDVKASNILIDSNFQAQVADFGFAKFIPDGVTHLTTRVK  180

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL++GRK  E +       +++WA PL+ 
Sbjct  181   GTLGYLAPEYAMWGK-VSESCDVYSFGILLLELVTGRKPIEKIGPGKKRSIIQWAAPLVM  239

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E RF E+ DP++    D   L R+ +VA+ C  N  + RPT+ +V A+
Sbjct  240   ERRFDELADPKLEGKYDGEELTRMIQVAALCAQNLPEHRPTMHEVVAM  287



>ref|NP_564609.3| protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AAM63304.1| somatic embryogenesis receptor-like kinase, putative [Arabidopsis 
thaliana]
 gb|AEE32820.1| protein kinase superfamily protein [Arabidopsis thaliana]
Length=350

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 100/287 (35%), Positives = 154/287 (54%), Gaps = 18/287 (6%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       S+     F+ 
Sbjct  28    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSSREEIDFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    + +LL W+RR+ +
Sbjct  84    EVEILARIRHKNLLSVRGYCAEGQERLIVYDYMPNLSLVSHLHGQHSSESLLDWTRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNE------RQE  712
             A   A+ + +LH    P IVHG V+ASNVL+D EF AR+ D+G   L  ++      +  
Sbjct  144   AVSSAQAIAYLHHFATPRIVHGDVRASNVLLDSEFEARVTDFGYDKLMPDDGANKSTKGN  203

Query  711   VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIKE  553
              IGY+  E  +E    S   DVY FGV+LLEL++G++  E +       + +W LPL+ E
Sbjct  204   NIGYLSPEC-IESGKESDMGDVYSFGVLLLELVTGKRPTERVNLTTKRGITEWVLPLVYE  262

Query  552   MRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              +FGE++D R+        L R+  V   C     + RPT+ +V  +
Sbjct  263   RKFGEIVDQRLNGKYVEEELKRIVLVGLMCAQRESEKRPTMSEVVEM  309



>ref|XP_001781813.1| predicted protein [Physcomitrella patens]
 gb|EDQ53367.1| predicted protein [Physcomitrella patens]
Length=342

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 102/287 (36%), Positives = 159/287 (55%), Gaps = 18/287 (6%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L   G+ +AVKR     V S  A   F+ 
Sbjct  9     FSLQELHSATNNFNYDNKLGEGGFGSVYWGQL-ANGDQIAVKRLK---VWSTKAEMEFAV  64

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L    H NL+ + G+     ER++V +Y   LSL  +LH      + L+W  R+++
Sbjct  65    EVEILGRVRHKNLLSLRGYCSEGHERLIVYDYMSKLSLLSHLHGQFATDSTLNWHNRMKI  124

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV-----  709
             A G A GL +LH    PHI+H  VKASN+L+D  F A++ D+G   L  N    +     
Sbjct  125   AIGSAEGLAYLHHHATPHIIHRDVKASNILLDENFEAQVADFGFAKLIPNGATHITTGVK  184

Query  708   --IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL------LVKWALPLIKE  553
               +GY+  EY + G+  S+  DVY +G+V+LEL+SG+K  E +      +V+WA PL+ +
Sbjct  185   GTLGYLAPEYAMWGK-VSESCDVYSYGIVILELISGKKPIERVDTARRTIVEWAGPLVLQ  243

Query  552   MRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              R   ++D ++    D   LVRL +VA+ C  NS ++RPT+ +V  +
Sbjct  244   GRCRNLVDHKLKDNYDEEELVRLIQVAALCAQNSPENRPTMQEVVGM  290



>ref|XP_010241557.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Nelumbo 
nucifera]
Length=369

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 159/288 (55%), Gaps = 20/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+G  G VY G L  +G  +AVKR     V S+ A   F+ 
Sbjct  28    FSLKELHAATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSDKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L    H NL+ + G+     ER++V +Y   LSL  +LH +  +A LL W RR+++
Sbjct  84    EVEILGRVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGH-HSAELLGWDRRMKI  142

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G   L        +   +
Sbjct  143   AIGSAEGITYLHHHATPHIIHRDIKASNVLLDSDFEAQVSDFGFAKLIPDGATHVTTRVK  202

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E L       L  WALPL+ 
Sbjct  203   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKLSPTMKRTLTGWALPLVC  261

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             + +F EV DP++        L R+  VA  C  N  + RPT+++V  +
Sbjct  262   QNKFSEVADPKLNGKYVEEELKRVLLVALICAQNQPEKRPTMLEVVEL  309



>ref|XP_007150432.1| hypothetical protein PHAVU_005G153100g [Phaseolus vulgaris]
 gb|ESW22426.1| hypothetical protein PHAVU_005G153100g [Phaseolus vulgaris]
Length=906

 Score =   154 bits (390),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 166/292 (57%), Gaps = 20/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKR--FHPRLVLSNAAG  1069
             A  +   E++ AT GF    I+GKG    V+ GVL+ +G +VAVKR   +P +  ++   
Sbjct  498   AQMFPYEELERATSGFKEESIVGKGSFSCVFKGVLK-DGSVVAVKRAIMYPNVQKNSKE-  555

Query  1068  FGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWS  889
               F + L  LS  +H +L+ +LG+ E  GER++V EY    SL  +LH N      + W 
Sbjct  556   --FHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEYMAHGSLHQHLHGNKVMKEQMDWV  613

Query  888   rrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE-  712
             RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +    
Sbjct  614   RRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSP  673

Query  711   -------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWAL  568
                     +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA+
Sbjct  674   LAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYEEGNIVQWAV  732

Query  567   PLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             PLIK      +LDP +  P DI+ L R+A VA   V    K RP++ +V  +
Sbjct  733   PLIKSGDIASILDPVLKPPNDIDALRRIANVACKSVRMRGKDRPSMDKVTTV  784



>ref|XP_010545758.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Tarenaya 
hassleriana]
Length=356

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 155/288 (54%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       SN     F+ 
Sbjct  28    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSNREELDFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A  LL W+RR+ +
Sbjct  84    EVEILARIRHKNLLSVRGYCAEGQERLIVYDYMPNLSLVSHLHGQHSAECLLDWTRRMAI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVI----  706
             A   ++ + +LH    PHI+HG V+ASNVL+D +F AR+ D+G   L  ++  + I    
Sbjct  144   ALSSSQAIAYLHHHATPHIIHGDVRASNVLLDSDFEARVTDFGYGKLIPDDATDGIAKTK  203

Query  705   ---GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
                GY+  E    G+  S++ DVY FG++LLEL+SG++  E +       + +W LPL +
Sbjct  204   GNLGYLAPECLAWGK-ESEKGDVYSFGILLLELVSGKRPIERVDPATKRTIAEWVLPLAR  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +FGE++D R+        L +   V   C  +  + RPT+ +   +
Sbjct  263   ERKFGEIVDSRLNGKYVEEELKKTVLVGLVCAQDKPEERPTMSEAVEM  310



>gb|KHG29718.1| Serine/threonine-protein kinase PBS1 [Gossypium arboreum]
Length=388

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 112/295 (38%), Positives = 163/295 (55%), Gaps = 20/295 (7%)
 Frame = -1

Query  1251  KLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAA  1072
             K+SA  +T  E+  ATD FNP  +IG+G  G VY G ++   ++VAVKR   R       
Sbjct  58    KVSAHIFTFRELVVATDNFNPDCLIGEGGFGRVYKGYIENLDQIVAVKRLD-RNGTQGTR  116

Query  1071  GFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHW  892
              F FS VL  LSL +H NLV ++G+     +RI+V EY    SLE +L   P     L W
Sbjct  117   EF-FSEVL-MLSLVNHQNLVNLIGYCADGDQRILVYEYMANGSLEHHLLDLPPGKEPLDW  174

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
             + R++VA G A+GLE+LH+     I++   KASN+L+D  F+ +L D+GL  L   E ++
Sbjct  175   NTRMKVAEGAAKGLEYLHDFADLPIIYRDFKASNILLDENFNPKLSDFGLAKLGPTEGKD  234

Query  711   VI--------GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-------SQEGLLVK  577
              +        GY   EY + G+  +K SDVY FGVV LEL+SGR+       ++E  LV 
Sbjct  235   HVSTRVMGTYGYCAPEYAMTGQLTTK-SDVYSFGVVFLELISGRRAIDLERPAEEQNLVL  293

Query  576   WALPLIKE-MRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             WA PL+K+  +F +++DP +     +  L +   +A+ C+     SRP I  V  
Sbjct  294   WAEPLLKDRQKFMKIIDPLLEENYPVKGLYQALAIAAMCLQEDANSRPLIGDVVT  348



>ref|XP_004235951.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Solanum 
lycopersicum]
Length=367

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 155/285 (54%), Gaps = 19/285 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKAEMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A +LL W RR+ V
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAESLLDWKRRMNV  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G            +   +
Sbjct  144   AIGSAEGIAYLHHHATPHIIHRDIKASNVLLDSDFQAQVADFGFAKFIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQE--GLLVK-----WALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E   L VK     WALPL+ 
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKVNLTVKRTITDWALPLVC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             E +  E+ DPR++         R+  VA  C  N  + RPT++ V
Sbjct  263   EGKLSELADPRLSGNYVEEEFKRVVLVALVCAQNRPEKRPTMLDV  307



>ref|XP_006852116.1| hypothetical protein AMTR_s00049p00025350 [Amborella trichopoda]
 gb|ERN13583.1| hypothetical protein AMTR_s00049p00025350 [Amborella trichopoda]
Length=947

 Score =   154 bits (390),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 112/290 (39%), Positives = 168/290 (58%), Gaps = 20/290 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKR-FHPRLVLSNAAGF  1066
             A A++  E++ AT GF    I+GKG    V+ GVL+ +G +VAVKR      V  N+  F
Sbjct  545   AQAFSYEELERATGGFKEESIVGKGSFSSVFKGVLK-DGTVVAVKRAIMASDVKKNSKEF  603

Query  1065  GFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSr  886
                + L  LS  +H +L+ +LG+ E  GER++V EY    SL  +LH N      L+W R
Sbjct  604   --HTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEYMAHGSLHEHLHGNRKEP--LNWVR  659

Query  885   rlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE--  712
             R+ +A   ARG+E+LH    P ++H  +K+SN+LID EF+AR+ D+GL  L   +     
Sbjct  660   RVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEFNARVADFGLSLLGPADSNSPL  719

Query  711   ------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWALP  565
                    +GY+D EY+      +K SDVY FGV+LLEL+SGRK+     ++G +V+WA+P
Sbjct  720   SELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLELISGRKAIDMKFEDGNIVEWAVP  778

Query  564   LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             LIK      +LDP +  P ++  + R+A +AS CV    + RP++ +V  
Sbjct  779   LIKAGNLNAILDPNLRPPVEMEAMRRIANIASRCVRMRGRERPSMEKVTT  828



>gb|AAD55610.1|AC008016_20 Contains PF|00069 Eukaryotic protein kinase domain. ESTs gb|W43822, 
gb|T20475 and gb|AA586152 come from this gene [Arabidopsis 
thaliana]
Length=347

 Score =   148 bits (373),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 100/287 (35%), Positives = 154/287 (54%), Gaps = 18/287 (6%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       S+     F+ 
Sbjct  25    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSSREEIDFAV  80

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    + +LL W+RR+ +
Sbjct  81    EVEILARIRHKNLLSVRGYCAEGQERLIVYDYMPNLSLVSHLHGQHSSESLLDWTRRMNI  140

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNE------RQE  712
             A   A+ + +LH    P IVHG V+ASNVL+D EF AR+ D+G   L  ++      +  
Sbjct  141   AVSSAQAIAYLHHFATPRIVHGDVRASNVLLDSEFEARVTDFGYDKLMPDDGANKSTKGN  200

Query  711   VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIKE  553
              IGY+  E  +E    S   DVY FGV+LLEL++G++  E +       + +W LPL+ E
Sbjct  201   NIGYLSPEC-IESGKESDMGDVYSFGVLLLELVTGKRPTERVNLTTKRGITEWVLPLVYE  259

Query  552   MRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              +FGE++D R+        L R+  V   C     + RPT+ +V  +
Sbjct  260   RKFGEIVDQRLNGKYVEEELKRIVLVGLMCAQRESEKRPTMSEVVEM  306



>gb|EYU45575.1| hypothetical protein MIMGU_mgv1a004753mg [Erythranthe guttata]
Length=511

 Score =   151 bits (381),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 114/319 (36%), Positives = 169/319 (53%), Gaps = 22/319 (7%)
 Frame = -1

Query  1323  VCCKKKRPAVEDDDDEGIGCHK--AAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVY  1150
             +  +K R     D  + IG  K   A ++A  +T  E+ AAT  F P  ++G+G  G VY
Sbjct  47    LSSEKSRARNSSDSKKEIGIPKEPTAHIAAQTFTFRELAAATKNFRPESLLGEGGFGRVY  106

Query  1149  SGVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIV  970
              G L+  G++VAVK+     +  N     F   +  LSL  HPNLV ++G+     +R++
Sbjct  107   KGRLESTGQVVAVKQLDRNGLQGNRE---FLVEVLMLSLLHHPNLVNLIGYCADGDQRLL  163

Query  969   VMEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASN  790
             V EY  + SLE +LH  P     L W+ R+++AAG A+GLE+LH+   P +++  +K+SN
Sbjct  164   VYEYMPLGSLEDHLHDRPPDKEPLDWNTRMKIAAGAAKGLEYLHDKANPPVIYRDLKSSN  223

Query  789   VLIDVEFSARLCDYGLYFLA--------SNERQEVIGYVDEEYWVEGRGGSKESDVYGFG  634
             +L+D E+S +L D+GL  L         S       GY   EY + G+   K SDVY FG
Sbjct  224   ILLDEEYSPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYAMTGQLTLK-SDVYSFG  282

Query  633   VVLLELLSGRK-------SQEGLLVKWALPLIKEMR-FGEVLDPRIAIPCDINPLVRLAK  478
             VV LEL++GRK       + E  LV WA PL K+ R F ++ DP +     +  L +   
Sbjct  283   VVFLELITGRKAIDNTREAGEHNLVAWARPLFKDRRKFPKMADPLLKGHYPMRGLYQALA  342

Query  477   VASACVGNSRKSRPTIVQV  421
             VA+ C+     +RP I  V
Sbjct  343   VAAMCLQEQAATRPLIGDV  361



>emb|CDX82425.1| BnaA03g33960D [Brassica napus]
Length=345

 Score =   148 bits (373),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 149/274 (54%), Gaps = 5/274 (2%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR   VY G L  +G  VAVKR       +N     F+ 
Sbjct  27    FSLKELHAATNSFNYDNKLGEGRFSSVYWGQL-SDGSQVAVKRLKS---WTNREDINFTL  82

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  LS   H NL+ + G+     ER++V +Y   LSL  +LH    A  +L  ++R+++
Sbjct  83    EVDILSRIRHKNLLSVRGYCNEGQERLLVYDYMPNLSLVSHLHGQHSAECILDCTKRIKI  142

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVIGYVD  694
             A   A+ + +LH    P IVHG V+ASNVL+D EF AR+ D+G   L   +  +     +
Sbjct  143   AITSAQAIAYLHHHATPRIVHGDVRASNVLLDSEFEARVTDFGYGKLMPEDEAKSNNNNN  202

Query  693   EEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAI  514
               Y       S+  DVY FG++LLEL+SG++++EG L +W LPL+ + +FGE++D R+  
Sbjct  203   NGYLPPECVASEAGDVYSFGILLLELVSGKRAKEG-LTEWVLPLVYQRKFGEIVDQRVKE  261

Query  513   PCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
                   L ++  V   C     + RPT+ QV  +
Sbjct  262   EDVGERLKKVVLVGLMCAQREAERRPTMSQVVEM  295



>ref|XP_004970226.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Setaria 
italica]
Length=455

 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 108/295 (37%), Positives = 162/295 (55%), Gaps = 20/295 (7%)
 Frame = -1

Query  1251  KLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAA  1072
              + + A    ++DAAT GF+ + ++G+G  G VY G L+   E++AVK+        N  
Sbjct  116   NMPSRALMFSQLDAATSGFSEKNLLGEGGFGRVYKGRLEDTKEVIAVKQLDRDGFQGNRE  175

Query  1071  GFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHW  892
                F   +  LSL  HPNLV +LG+     +RI+V EY    SLE +L   P     L W
Sbjct  176   ---FLVEVLMLSLLHHPNLVKLLGYCTDSNQRILVYEYMPKGSLEDHLLDLPPNWKPLPW  232

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
               R+++A G A+G+E+LHE   P +++  +KASN+L+D +F+A+L D+GL  L     Q 
Sbjct  233   HTRMQIAVGAAKGIEYLHEVANPPVIYRDLKASNILLDRDFNAKLSDFGLAKLGPMGDQS  292

Query  711   VI--------GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-------SQEGLLVK  577
              +        GY   EY + G+  +K SD+Y FGVVLLEL++GR+       S+E +LV 
Sbjct  293   HVSTRVMGTYGYCAPEYAMTGK-LTKMSDIYSFGVVLLELITGRRAIDISRPSEEQVLVH  351

Query  576   WALPLIKE-MRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             WA PL+++  RF ++ DP +     +  L +   VAS C+     SRP I  V A
Sbjct  352   WASPLLRDKKRFMKLADPLLGRRYPVKGLYQALAVASMCLQEDAASRPGISDVVA  406



>gb|AES67539.2| Serine/Threonine-kinase rlckvii-like protein, putative [Medicago 
truncatula]
Length=380

 Score =   149 bits (375),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 168/310 (54%), Gaps = 23/310 (7%)
 Frame = -1

Query  1296  VEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELV  1117
              ED+  +G+  +   KL A  +TL E+ AAT  F+    +G+G  G VY G LQ   + V
Sbjct  29    TEDELKDGVSTN--GKL-AKTFTLNELAAATGNFSANCFVGEGGFGKVYKGYLQKTNQFV  85

Query  1116  AVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLE  937
             A+K+  P+ +        F   +  LSLA+H NLV +LGF     +R++V EY  + SLE
Sbjct  86    AIKQLDPKGIQGTRE---FVVEVLTLSLAEHTNLVKLLGFGAEGDQRLLVYEYMPLGSLE  142

Query  936   FYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARL  757
              +LH  P     L W+ R+R+AAGVA+GLE+LH+ M P +++  +K SN+L+  ++  +L
Sbjct  143   SHLHDLPPGKNPLDWNTRMRIAAGVAKGLEYLHDEMKPPVIYRDLKCSNILLGNDYHPKL  202

Query  756   CDYGLYFLASNERQEVI--------GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK  601
              D+GL  +     Q  +        GY   +Y + G+   K SD+Y FGV LLEL++GRK
Sbjct  203   SDFGLAKIGPMGDQTHVSTRVMGTHGYCAPDYGMTGQLTFK-SDIYSFGVALLELITGRK  261

Query  600   -------SQEGLLVKWALPLIKEMR-FGEVLDPRIAIPCDINPLVRLAKVASACVGNSRK  445
                    S++  LVKWA PL ++ + F +++DP +        L +   +AS CV     
Sbjct  262   AYDESKPSKKRHLVKWATPLFRDQKNFSKMVDPLLKGQYPARGLYQALAIASMCVVEQTN  321

Query  444   SRPTIVQVAA  415
              RP I  V +
Sbjct  322   MRPVIADVVS  331



>ref|XP_009146898.1| PREDICTED: serine/threonine-protein kinase-like protein CCR1 
[Brassica rapa]
Length=765

 Score =   153 bits (387),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 158/282 (56%), Gaps = 27/282 (10%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  + L E+  AT+GF     +G+G  G VY  VL  +G  VAVKR +   ++   A   
Sbjct  495   AQVFRLSELKDATNGFKEFNELGRGSYGFVYKAVLS-DGRQVAVKRANASTIIHTNAR-E  552

Query  1062  FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrr  883
             F + L  L    H N+V ++G+S   GER++V EY    +L  +LH      + L W  R
Sbjct  553   FEAELEILCNIRHSNIVNLIGYSTEMGERLLVYEYMPHGTLHDHLHG---GFSPLSWGLR  609

Query  882   lrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVIG  703
             +R+A   A+GLE+LH    P IVHG VK+SNVL+D E++AR+ D+GL   +SNER   + 
Sbjct  610   VRIALQTAKGLEYLHVEAEPRIVHGDVKSSNVLLDSEWAARVADFGL-LTSSNERSLDV-  667

Query  702   YVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEG-----LLVKWALPLIKEMRFGE  538
                            + DVY FGVVLLE+L+GRK  +       +V+WA+PLI+E +   
Sbjct  668   ---------------KGDVYDFGVVLLEILTGRKRYDRDCDPPEIVEWAIPLIREGKAAA  712

Query  537   VLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             +LD  IA+P ++ PL++LA VA  CV      RPT+ ++  +
Sbjct  713   ILDKYIALPRNVEPLLKLADVAELCVREDPSQRPTMSELVNL  754



>emb|CAA18116.1| serine/threonine protein kinase like protein [Arabidopsis thaliana]
 emb|CAB79168.1| serine/threonine protein kinase like protein [Arabidopsis thaliana]
 gb|ABL66730.1| At4g22130 [Arabidopsis thaliana]
Length=338

 Score =   147 bits (372),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 102/293 (35%), Positives = 158/293 (54%), Gaps = 18/293 (6%)
 Frame = -1

Query  1254  AKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNA  1075
             + ++A+ YT+  +  AT+ F+   IIG+G LG VY     P G+++A+K+      LS  
Sbjct  11    SPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEF-PNGKIMAIKKID-NAALSLQ  68

Query  1074  AGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLH  895
                 F   +  +S   HPN+VP+ G+    G+R++V EY G  +L+  LH N D +  L 
Sbjct  69    EEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDTLHTNDDRSMNLT  128

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W+ R++VA G A+ LE+LHE  +P IVH   K++N+L+D E +  L D GL  L  N  +
Sbjct  129   WNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAALTPNTER  188

Query  714   EV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-------SQEGLLVK  577
             +V        GY   E+ + G    K SDVY FGVV+LELL+GRK         E  LV+
Sbjct  189   QVSTQVVGSFGYSAPEFALSGIYTVK-SDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVR  247

Query  576   WALPLIKEMR-FGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             WA P + ++    +++DP +        L R A + + C+    + RP + +V
Sbjct  248   WATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEV  300



>ref|XP_010062992.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Eucalyptus 
grandis]
Length=389

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 159/293 (54%), Gaps = 20/293 (7%)
 Frame = -1

Query  1251  KLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAA  1072
              ++A  +T  E+  AT+ FNP  +IG+G  G VY G ++ + ++VAVK+        N  
Sbjct  60    NIAAQIFTFRELCVATNNFNPDSLIGEGGFGRVYKGHIESKNQVVAVKQLDRNGFQGNRE  119

Query  1071  GFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHW  892
                F   +  LSL  HPNLV ++G+     +R++V EY    SLE +L + P   A L W
Sbjct  120   ---FLVEVLMLSLLHHPNLVNLVGYCADGDQRVLVYEYMSNGSLEDHLLELPPGKAPLDW  176

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLA------  730
             + R+++A+G A+GLE+LHE   P +++   KASN+L+D EF+ +L D+GL  L       
Sbjct  177   NTRMKIASGAAKGLEYLHEQANPPVIYRDFKASNILLDGEFNPKLSDFGLAKLGPTGDKS  236

Query  729   --SNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-------SQEGLLVK  577
               S       GY   EY + G+  +K SDVY FGVV LE+++GR+       ++E  LV 
Sbjct  237   HVSTRVMGTYGYCAPEYALTGQLTTK-SDVYSFGVVFLEIITGRRVIDNSRPTEEQNLVA  295

Query  576   WALPLIKEMR-FGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             WA PL K+ R F  + DP +     I  L +   VA+ C+     +RP I  V
Sbjct  296   WAQPLFKDRRKFTLMADPLLEGTYPIKGLYQALAVAAMCLQEEASTRPLISDV  348



>ref|XP_011073418.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Sesamum 
indicum]
Length=357

 Score =   148 bits (373),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 151/285 (53%), Gaps = 19/285 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+  AT+ FN    +G+G  G VY G L  +G  +AVKR       SN A   FS 
Sbjct  28    FSLKELQLATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLKS---WSNKAEMEFSI  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A   L W+RR+ +
Sbjct  84    EVEILARVRHKNLLTLRGYCAEGQERLIVYDYMTNLSLLSHLHGQHSAECHLDWTRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G            +   +
Sbjct  144   AIGAAEGIAYLHHYATPHIIHRDIKASNVLLDSDFKAQVADFGFAKFIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E L       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPLEKLSSTMKRTITDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             E +F E+ DPR+        L R+  V   C  N  + RPTI++V
Sbjct  263   ERKFNELADPRLDGKYIEEELKRVIFVGLICACNRPEKRPTILEV  307



>ref|XP_006372875.1| epidermal differentiation family protein [Populus trichocarpa]
 gb|ERP50672.1| epidermal differentiation family protein [Populus trichocarpa]
Length=922

 Score =   154 bits (388),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 165/292 (57%), Gaps = 21/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ AT GF    ++GKG    VY GVL+  G LVAVK+    +V S+     
Sbjct  509   AQMFTYEELEKATSGFKEESLVGKGSFSCVYKGVLR-NGTLVAVKK---AIVCSDKQKNS  564

Query  1062  --FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHW  892
               F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +NP     ++W
Sbjct  565   KEFHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEFMAHGSLHQHLHGKNPALKEQMNW  624

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
              RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L       
Sbjct  625   VRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVSDFGLSLLGPANSSS  684

Query  711   --------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWA  571
                      +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA
Sbjct  685   PLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWA  743

Query  570   LPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             +PLIK      +LDP +  P D   L R+A VA  CV    K RP++ +V  
Sbjct  744   VPLIKAGDISAILDPVLKPPSDPEALKRIANVACKCVRMRGKERPSMDKVTT  795



>ref|XP_002981460.1| hypothetical protein SELMODRAFT_114199, partial [Selaginella 
moellendorffii]
 gb|EFJ17648.1| hypothetical protein SELMODRAFT_114199, partial [Selaginella 
moellendorffii]
Length=307

 Score =   146 bits (369),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 100/288 (35%), Positives = 160/288 (56%), Gaps = 18/288 (6%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+  A++ FN    +G+GR G VY G L  +G  +AVKR     + S+     F+ 
Sbjct  8     FSLKELQNASNNFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---LWSSKREIDFAV  63

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L    H NL+ + G+     ER++V  Y   LSL  +LH +  A + L W RR+ +
Sbjct  64    EVEILGRVRHKNLLSLRGYCAEGKERLLVYNYMPNLSLSAHLHGHLAAESNLDWERRMNI  123

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL---ASNERQEVIG  703
             A G A  L +LH    PHI+HG +K+SNVL++ EF A++ D+G   L    S      +G
Sbjct  124   AIGSAEALAYLHHHATPHIIHGDLKSSNVLLNAEFEAQVADFGFAELVPETSTVNAGAMG  183

Query  702   YVDEEYWVEGRGG-SKESDVYGFGVVLLELLSGRK--SQEGL--------LVKWALPLIK  556
             Y   ++   G G  S++SDVY FGV+LLEL+SGRK   ++G         +V+WA P+I 
Sbjct  184   YFPPDHATPGDGKLSEKSDVYSFGVLLLELVSGRKPVEKQGFSASAKSQSIVEWATPMIY  243

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E R  ++ DP+++   +   L ++ +VA  C   S ++RP++++V  +
Sbjct  244   EGRLDDIADPKLSGNFNEVELKQVVQVAQWCSQTSPENRPSMIKVVEL  291



>ref|XP_002894383.1| hypothetical protein ARALYDRAFT_337406 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70642.1| hypothetical protein ARALYDRAFT_337406 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   147 bits (372),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 100/287 (35%), Positives = 154/287 (54%), Gaps = 18/287 (6%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       S+     F+ 
Sbjct  28    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSSREDIDFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    + +LL W+RR+ +
Sbjct  84    EVEILARIRHKNLLSVRGYCAEGQERLIVYDYMPNLSLVSHLHGQHSSESLLDWTRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNE------RQE  712
             A   A+ + +LH    P IVHG V+ASNVL+D EF AR+ D+G   L  ++      +  
Sbjct  144   AVTSAQAISYLHHFATPRIVHGDVRASNVLLDSEFEARVTDFGYDKLMPDDGANKSTKGN  203

Query  711   VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIKE  553
              IGY+  E  +E    S   DVY FGV+LLEL++G++  E +       + +W LPL+ E
Sbjct  204   NIGYLSPEC-IESGKESDMGDVYSFGVLLLELVTGKRPIEKVNLTTKRGITEWVLPLVYE  262

Query  552   MRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
              +FGE++D R+        L R+  V   C     + RPT+ +V  +
Sbjct  263   RKFGEIVDQRLNGKYVEEELKRVVLVGLMCARREPEKRPTMSEVVEM  309



>ref|XP_011037092.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Populus euphratica]
Length=922

 Score =   154 bits (388),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 165/292 (57%), Gaps = 21/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ AT GF    ++GKG    VY GVL+  G LVAVK+    +V S+     
Sbjct  509   AQMFTYEELEKATSGFKEESLVGKGSFSCVYKGVLR-NGTLVAVKK---AIVCSDKQKNS  564

Query  1062  --FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHW  892
               F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +NP     L+W
Sbjct  565   KEFHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEFMAHGSLHQHLHGKNPALKEQLNW  624

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
              RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L       
Sbjct  625   VRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVSDFGLSLLGPANSSS  684

Query  711   --------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWA  571
                      +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA
Sbjct  685   PLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWA  743

Query  570   LPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             +PLIK      +LDP +  P D   L R+A VA  CV    K RP++ +V  
Sbjct  744   VPLIKAGDIPAILDPVLKPPSDPEALKRIANVACKCVRMRGKERPSMDKVTT  795



>ref|XP_006647017.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Oryza 
brachyantha]
Length=377

 Score =   148 bits (373),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 156/288 (54%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR       SN A   F+ 
Sbjct  29    FSLKELQSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLKS---WSNKAETEFAI  84

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H +L+ + G+     ER++V +Y   LSL  +LH    A   L W RR+++
Sbjct  85    EVEVLATVRHKSLLSLRGYCAEGQERLIVYDYMPNLSLHSHLHGQHAAECHLGWERRMKI  144

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A   A G+ +LH    PHI+H  +K+SNVL+D  F AR+ D+G   L        + + +
Sbjct  145   AIDSAEGIAYLHHHATPHIIHRDIKSSNVLLDSNFQARVADFGFAKLIPDGATHVTTKVK  204

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DV+ FG++LLEL SG++  E L       + +WALPL +
Sbjct  205   GTLGYLAPEYAMLGK-ASESCDVFSFGILLLELASGKRPVEKLNPTTKLTITEWALPLAR  263

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             + +F EV DP++    +   L R+  V  AC  N ++ RP + +V  +
Sbjct  264   DKKFKEVADPKLKDVFEEAELKRMVLVGLACTQNKQEQRPVMSEVVEL  311



>ref|XP_010557823.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Tarenaya hassleriana]
Length=430

 Score =   149 bits (376),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 176/303 (58%), Gaps = 28/303 (9%)
 Frame = -1

Query  1281  DEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRF  1102
             + G    K  K+    Y+  +++AAT+GF+ ++++GKG  G VY  V++  G  VAVK+ 
Sbjct  28    NSGGKQEKPVKIRQFDYS--DLEAATNGFSAQKLLGKGSHGSVYKAVVR--GRRVAVKKP  83

Query  1101  HPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQ  922
                  LS       ++ +  LS    P LV +LGF++   +R++V+E+    +L   LH 
Sbjct  84    SKGQELSQE----VNNEIEILSKIHSPRLVNLLGFTDDSHDRLMVVEFMSNGTLYDVLHA  139

Query  921   NPDAAA-LLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYG  745
             NP +++  L+W RR+R+A  VA+ +E LH    P I+H  +K++NVLID  ++ARL D+G
Sbjct  140   NPSSSSRALNWGRRIRMALQVAKAVEILH-SQKPPIIHRDIKSANVLIDRNYNARLGDFG  198

Query  744   L--------YFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQE-  592
             L        Y L S      IGY+D  Y V     S ++DV+ FG++LLE++SGRK+ + 
Sbjct  199   LALRCSVDDYRLRSTPPAGTIGYLDPNY-VTPDNLSTKTDVFSFGILLLEIISGRKAIDI  257

Query  591   ----GLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVR--LAKVASACVGNSRKSRPTI  430
                   +V WA+PL+K+ +   + DPR A P D  PLVR  LA +A+ CV + R+ RP++
Sbjct  258   GHSPPSIVDWAIPLVKKGKILSIYDPRTAPPKD--PLVRKQLAAIAAKCVRSCRERRPSM  315

Query  429   VQV  421
              ++
Sbjct  316   KEM  318



>ref|XP_003597288.1| Protein kinase-like protein [Medicago truncatula]
Length=390

 Score =   148 bits (374),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 168/310 (54%), Gaps = 23/310 (7%)
 Frame = -1

Query  1296  VEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELV  1117
              ED+  +G+  +   KL A  +TL E+ AAT  F+    +G+G  G VY G LQ   + V
Sbjct  39    TEDELKDGVSTN--GKL-AKTFTLNELAAATGNFSANCFVGEGGFGKVYKGYLQKTNQFV  95

Query  1116  AVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLE  937
             A+K+  P+ +        F   +  LSLA+H NLV +LGF     +R++V EY  + SLE
Sbjct  96    AIKQLDPKGIQGTRE---FVVEVLTLSLAEHTNLVKLLGFGAEGDQRLLVYEYMPLGSLE  152

Query  936   FYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARL  757
              +LH  P     L W+ R+R+AAGVA+GLE+LH+ M P +++  +K SN+L+  ++  +L
Sbjct  153   SHLHDLPPGKNPLDWNTRMRIAAGVAKGLEYLHDEMKPPVIYRDLKCSNILLGNDYHPKL  212

Query  756   CDYGLYFLASNERQEVI--------GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK  601
              D+GL  +     Q  +        GY   +Y + G+   K SD+Y FGV LLEL++GRK
Sbjct  213   SDFGLAKIGPMGDQTHVSTRVMGTHGYCAPDYGMTGQLTFK-SDIYSFGVALLELITGRK  271

Query  600   -------SQEGLLVKWALPLIKEMR-FGEVLDPRIAIPCDINPLVRLAKVASACVGNSRK  445
                    S++  LVKWA PL ++ + F +++DP +        L +   +AS CV     
Sbjct  272   AYDESKPSKKRHLVKWATPLFRDQKNFSKMVDPLLKGQYPARGLYQALAIASMCVVEQTN  331

Query  444   SRPTIVQVAA  415
              RP I  V +
Sbjct  332   MRPVIADVVS  341



>ref|XP_006297987.1| hypothetical protein CARUB_v10014029mg [Capsella rubella]
 gb|EOA30885.1| hypothetical protein CARUB_v10014029mg [Capsella rubella]
Length=363

 Score =   147 bits (372),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 154/288 (53%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       SN     F+ 
Sbjct  27    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSNREETDFAV  82

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V EY   LSL  +LH    A  LL W++R+++
Sbjct  83    EIEILARIRHKNLLSVRGYCAEGQERLLVYEYLPNLSLVSHLHGQHSAECLLDWNKRMKI  142

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNER-------Q  715
             A   A+ + +LH+   PHI+HG V+ASNVL+D E+ AR+ D+G   L  ++        +
Sbjct  143   AISSAQAIAYLHQHATPHIIHGDVRASNVLLDSEYEARVTDFGYGKLMPDDTGDGATKAK  202

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
                GY+  E    G   S+ SDVY FG++LL L+SG++  E L       + +W LPL+ 
Sbjct  203   SSNGYISPECVASG-NESETSDVYSFGILLLVLVSGKRPLERLNPTTTRSITEWVLPLVY  261

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F +++D R+        L +L  V   C     + RPT+ +V  +
Sbjct  262   ERKFVDIVDQRLGDEHVEEKLRKLVLVGLMCAQTETEKRPTMSEVVEM  309



>ref|XP_010268133.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
isoform X2 [Nelumbo nucifera]
Length=905

 Score =   153 bits (387),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 112/290 (39%), Positives = 165/290 (57%), Gaps = 17/290 (6%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ AT GF     +GKG    V+ G+L+ +G +VAVKR      L   +   
Sbjct  492   AQTFTYEELERATGGFKEESQVGKGSFSCVFKGILK-DGTVVAVKRAIKSTDLKKNSK-E  549

Query  1062  FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHWSr  886
             F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH ++P     L W R
Sbjct  550   FHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEFMAHGSLHQHLHGKDPSLKEQLDWVR  609

Query  885   rlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE--  712
             R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +     
Sbjct  610   RVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPL  669

Query  711   ------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWALP  565
                    +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA+P
Sbjct  670   AELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQFEEGNIVEWAVP  728

Query  564   LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             LIK      +LDP +  P D+  L R+A VAS CV    K RP++ +V  
Sbjct  729   LIKAGDISAILDPVLKPPDDLEALRRIANVASKCVRMRGKERPSMDKVTT  778



>ref|XP_008361244.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Malus 
domestica]
Length=668

 Score =   151 bits (382),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 106/297 (36%), Positives = 167/297 (56%), Gaps = 31/297 (10%)
 Frame = -1

Query  1248  LSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAG  1069
              S + +T  E+  AT+GF+   ++G+G  G V+ GVL P G+ VAVK+      L   +G
Sbjct  276   FSKSTFTYEELALATEGFSDSNLLGQGGFGYVHKGVL-PNGKEVAVKQ------LKAGSG  328

Query  1068  FG---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALL  898
              G   F + +  +S   H +LV ++G+     ER++V E+    ++EF+LH        +
Sbjct  329   QGEREFQAEVEIISRVHHRHLVSLVGYCMTGSERLLVYEFVPNNTMEFHLHGK--GRPTM  386

Query  897   HWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNER  718
              WS RL++A G A+G  +LHE   P I+H  +KA+N+L+D +F A++ D+GL   +S+  
Sbjct  387   DWSTRLKIALGSAKGJAYLHEDCHPKIIHRDIKAANILLDFKFEAKVADFGLAKXSSDXN  446

Query  717   QEV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK----SQ---EGLLV  580
               +        GY+  EY   G+   K SDVY FGV+LLEL++GR+    SQ   E  LV
Sbjct  447   THISTRVMGTFGYLAPEYASSGKLTDK-SDVYSFGVMLLELITGRRPVDASQTYMEDSLV  505

Query  579   KWALPL----IKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
              WA P+    ++E  F E++DP++    D N + R+   A+ACV +S + RP + QV
Sbjct  506   DWARPVLNRALEERNFDELVDPKLQNSYDPNEMARMVACAAACVRHSARRRPRMSQV  562



>ref|XP_010046663.1| PREDICTED: serine/threonine-protein kinase-like protein CCR1 
[Eucalyptus grandis]
Length=767

 Score =   152 bits (385),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 110/308 (36%), Positives = 173/308 (56%), Gaps = 27/308 (9%)
 Frame = -1

Query  1320  CCKKKRPAVEDDDDEGIGCHKAAKLS-AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSG  1144
             C  KK   +E +DD          +  A  + L+E+  AT+GF     +G+G  G VY  
Sbjct  469   CIGKKEKEMETNDDSHPPLVSTQSVGLAQVFRLVEVKDATNGFKEFNELGRGSYGFVYKA  528

Query  1143  VLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVM  964
             VL P+G  VAVKR +   ++   +   F   L  L    H N+V +LG+    GER++V 
Sbjct  529   VL-PDGRQVAVKRANAATIIHTNS-REFEMELDILCKVRHANIVNLLGYCSEMGERLLVY  586

Query  963   EYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVL  784
             E+    +L  +LH      + L+W+ RLR+A   A+GLE+LH+  VP IVH  VK SN+L
Sbjct  587   EFMPHGTLHDHLH---GGLSPLNWTLRLRIAMQAAKGLEYLHKEAVPPIVHRDVKTSNIL  643

Query  783   IDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGR  604
             +D ++  R+ D+GL  L S+ER      V+E+          +SD+Y FG+VLLE+LSGR
Sbjct  644   LDADWGGRIADFGL--LTSSERD-----VNED---------TKSDIYNFGIVLLEILSGR  687

Query  603   KSQE-----GLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSR  439
             K+ +       +V+WA+PLIK  R   ++D  +A+P ++ PL++LA +A   + ++   R
Sbjct  688   KAYDIDYAPPNIVEWAVPLIKRGRAAAIIDRNVALPKNVEPLLKLADMAELALRDNPNER  747

Query  438   PTIVQVAA  415
             P+I ++A+
Sbjct  748   PSISEIAS  755



>ref|XP_002884755.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61014.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=775

 Score =   152 bits (385),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 108/301 (36%), Positives = 166/301 (55%), Gaps = 27/301 (9%)
 Frame = -1

Query  1305  RPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEG  1126
             +P ++ +  E +    +    A  + L E+  AT+GF     +G+G  G VY  +L P+G
Sbjct  484   KPDLDTEPLENVSPAPSVTPFAQVFRLSELKDATNGFKEFNELGRGSYGFVYKALL-PDG  542

Query  1125  ELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGML  946
               VAVKR +   ++ +     F + L  L    H N+V +LG+S   GER++V EY    
Sbjct  543   RQVAVKRANAATII-HTNTREFETELEILCNIRHCNIVNLLGYSTEMGERLLVYEYMPHG  601

Query  945   SLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFS  766
             +L  +LH      + L WS R+++A   A+GLE+LH    P IVHG VK+SNVL+D E+ 
Sbjct  602   TLHDHLHS---GFSPLSWSLRIKIAMQTAKGLEYLHNEAEPRIVHGDVKSSNVLLDAEWV  658

Query  765   ARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQE--  592
             AR+ D+GL   +SNE++  I                + DVY FGVVLLE+L+GRK  +  
Sbjct  659   ARVADFGL-VTSSNEKKLDI----------------KRDVYDFGVVLLEILTGRKRHDRD  701

Query  591   ---GLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
                  + +WA+ +I+E R   ++D  IA+P ++ PL++LA VA  CV      RPT+ ++
Sbjct  702   CDPPEIAEWAVTVIREGRAAAIVDKYIALPRNVEPLLKLADVAELCVREDPNQRPTMSEL  761

Query  420   A  418
             A
Sbjct  762   A  762



>gb|KCW87886.1| hypothetical protein EUGRSUZ_A00278 [Eucalyptus grandis]
Length=543

 Score =   150 bits (379),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 111/293 (38%), Positives = 164/293 (56%), Gaps = 23/293 (8%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ AT GF     +GKG    V+ GVL+  G +VAVKR     ++S+     
Sbjct  133   ARTFTYEELERATSGFKEESQVGKGSFSCVFKGVLK-NGTVVAVKR----AIMSSDKQKN  187

Query  1062  ---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLH  895
                F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L 
Sbjct  188   SKEFRTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEFMAHGSLHQHLHGKNKALKERLD  247

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +  
Sbjct  248   WVRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSG  307

Query  714   E--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKW  574
                       +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+W
Sbjct  308   SPLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYEEGNIVEW  366

Query  573   ALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             A+PLIK      +LDP +  P D+  L R+A +A  CV    K RP++ +V  
Sbjct  367   AVPLIKTGDISNILDPDLKPPSDLEALKRIANIACKCVRMRGKDRPSMDRVTT  419



>gb|KCW88817.1| hypothetical protein EUGRSUZ_A01154, partial [Eucalyptus grandis]
Length=725

 Score =   152 bits (384),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 110/308 (36%), Positives = 173/308 (56%), Gaps = 27/308 (9%)
 Frame = -1

Query  1320  CCKKKRPAVEDDDDEGIGCHKAAKLS-AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSG  1144
             C  KK   +E +DD          +  A  + L+E+  AT+GF     +G+G  G VY  
Sbjct  439   CIGKKEKEMETNDDSHPPLVSTQSVGLAQVFRLVEVKDATNGFKEFNELGRGSYGFVYKA  498

Query  1143  VLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVM  964
             VL P+G  VAVKR +   ++   +   F   L  L    H N+V +LG+    GER++V 
Sbjct  499   VL-PDGRQVAVKRANAATIIHTNS-REFEMELDILCKVRHANIVNLLGYCSEMGERLLVY  556

Query  963   EYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVL  784
             E+    +L  +LH      + L+W+ RLR+A   A+GLE+LH+  VP IVH  VK SN+L
Sbjct  557   EFMPHGTLHDHLH---GGLSPLNWTLRLRIAMQAAKGLEYLHKEAVPPIVHRDVKTSNIL  613

Query  783   IDVEFSARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGR  604
             +D ++  R+ D+GL  L S+ER      V+E+          +SD+Y FG+VLLE+LSGR
Sbjct  614   LDADWGGRIADFGL--LTSSERD-----VNED---------TKSDIYNFGIVLLEILSGR  657

Query  603   KSQE-----GLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSR  439
             K+ +       +V+WA+PLIK  R   ++D  +A+P ++ PL++LA +A   + ++   R
Sbjct  658   KAYDIDYAPPNIVEWAVPLIKRGRAAAIIDRNVALPKNVEPLLKLADMAELALRDNPNER  717

Query  438   PTIVQVAA  415
             P+I ++A+
Sbjct  718   PSISEIAS  725



>ref|XP_008337381.1| PREDICTED: LOW QUALITY PROTEIN: proline-rich receptor-like protein 
kinase PERK1 [Malus domestica]
Length=667

 Score =   151 bits (382),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 106/297 (36%), Positives = 168/297 (57%), Gaps = 31/297 (10%)
 Frame = -1

Query  1248  LSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAG  1069
              S + +T  E+  AT+GF+   ++G+G  G V+ GVL P G+ VAVK+      L   +G
Sbjct  275   FSKSTFTYEELALATEGFSDSNLLGQGGFGYVHKGVL-PNGKEVAVKQ------LKAGSG  327

Query  1068  FG---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALL  898
              G   F + +  +S   H +LV ++G+     ER++V E+    ++EF+LH        +
Sbjct  328   QGEREFQAEVEIISRVHHRHLVSLVGYCMTGSERLLVYEFVPNNTMEFHLHGK--GRPTM  385

Query  897   HWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNER  718
              WS RL++A G A+G+ +LHE   P I+H  +KA+N+L+D +F A++ D+GL   +S+  
Sbjct  386   DWSTRLKIALGSAKGIAYLHEDCHPKIIHRDIKAANILLDFKFEAKVADFGLAKFSSDVN  445

Query  717   QEV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK----SQ---EGLLV  580
               +        GY+  EY   G+   K SDVY FGV+LLEL++GR+    SQ   E  LV
Sbjct  446   THISTRVMGTFGYLAPEYASSGKLTDK-SDVYSFGVMLLELITGRRPVDASQTYMEDSLV  504

Query  579   KWALPL----IKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
              WA P+    ++E  F E++DP++    D N + R+   A+ACV +S + RP + QV
Sbjct  505   DWARPVLNRALEERNFDELVDPKLQNSYDPNEMARMVACAAACVRHSARRRPRMSQV  561



>ref|XP_010462090.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Camelina 
sativa]
 ref|XP_010462091.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Camelina 
sativa]
Length=353

 Score =   147 bits (371),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 158/291 (54%), Gaps = 23/291 (8%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       S+     F+ 
Sbjct  28    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSSREEITFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    + +LL W+RR+ +
Sbjct  84    EVEILARIRHKNLLSVRGYCAEGQERLIVYDYMPNLSLVSHLHGQHSSDSLLDWTRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNE---------  721
             A   A+ + +LH    P IVHG V+ASNVL+D EF AR+ D+G   +  ++         
Sbjct  144   AVTSAQAIAYLHHFATPRIVHGDVRASNVLLDSEFEARVTDFGYGKMMPDDAGNGGNKIT  203

Query  720   RQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK--------SQEGLLVKWALP  565
             +   IGY+  E  +E    S   DVY FGVVLLEL++G++        +++G + +W LP
Sbjct  204   KGNNIGYLSPEC-IESGQESDMGDVYSFGVVLLELVTGKRPIERASLTTKQG-ITEWVLP  261

Query  564   LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             L+ E +FGE++D R+    + + L R+  +   C     + RPT+ +V  +
Sbjct  262   LVYEKKFGEIVDQRLNGKYEEDELKRVVLIGLICAQREPEKRPTMSEVVEM  312



>ref|XP_003546987.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like, 
partial [Glycine max]
Length=857

 Score =   153 bits (386),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 165/292 (57%), Gaps = 20/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKR--FHPRLVLSNAAG  1069
             A  ++  E++ AT GF    I GKG    V+ GVL+ +G +VAVKR    P +  ++   
Sbjct  448   AQMFSYEELERATSGFKEESIAGKGSFSCVFKGVLK-DGTVVAVKRAIVSPNMQKNSKE-  505

Query  1068  FGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWS  889
               F + L  LS  +H +L+ +LG+ E  GER++V EY    SL  +LH N      + W 
Sbjct  506   --FHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEYMAHGSLHQHLHGNKVMQEQMDWV  563

Query  888   rrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE-  712
             RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +    
Sbjct  564   RRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSP  623

Query  711   -------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWAL  568
                     +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA+
Sbjct  624   LAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQFEEGNIVQWAV  682

Query  567   PLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             PLIK      +LDP +  P D++ L R+A VA   V    K RP++ +V  +
Sbjct  683   PLIKSGDIAAILDPTLKPPPDLDALRRIANVACKSVRMRGKDRPSMDKVTTV  734



>ref|XP_008243932.1| PREDICTED: serine/threonine-protein kinase-like protein CCR1 
[Prunus mume]
Length=775

 Score =   152 bits (384),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 103/281 (37%), Positives = 160/281 (57%), Gaps = 26/281 (9%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  + L E+  AT+GF     +G+G  G VY  VL  +G+ VAVKR +   ++ +     
Sbjct  504   AQVFRLSELKDATNGFKEFNELGRGSYGFVYKAVLA-DGQQVAVKRANAATII-HTNSRD  561

Query  1062  FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrr  883
             F   L  L    H N+V +LG+    GER++V EY    +L  +LH    A   L+W  R
Sbjct  562   FEMELEVLCKIRHCNIVNLLGYCSEMGERLLVYEYMPHGTLHDHLHGGLSA---LNWVLR  618

Query  882   lrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVIG  703
             L+++   A+GLE+LH+  VP I+H  VK+SN+L+D E++AR+ D+GL  L SN++     
Sbjct  619   LKISMQAAKGLEYLHKEFVPPIIHRDVKSSNILLDSEWNARIADFGL--LTSNDKD----  672

Query  702   YVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEG-----LLVKWALPLIKEMRFGE  538
                         G  ESDVY FG+VLLE+LSGRK+ +       +V+WA+PLIK+ +   
Sbjct  673   ----------HSGDLESDVYNFGIVLLEMLSGRKAFDTDYTPPSIVEWAVPLIKQNKAAA  722

Query  537   VLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             ++D  +A+P ++ PL++LA +A   V  +   RP +  +A+
Sbjct  723   IIDRYVALPRNVEPLLKLADIAGLAVKENPTERPAMSDIAS  763



>ref|XP_007207213.1| hypothetical protein PRUPE_ppa001914mg [Prunus persica]
 gb|EMJ08412.1| hypothetical protein PRUPE_ppa001914mg [Prunus persica]
Length=742

 Score =   152 bits (383),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 104/281 (37%), Positives = 160/281 (57%), Gaps = 26/281 (9%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  + L E+  AT+GF     +G+G  G VY  VL  +G+ VAVKR +   ++   +   
Sbjct  471   AQVFRLSELKDATNGFKEFNELGRGSYGFVYKAVLA-DGQQVAVKRANAATIIHTNSR-D  528

Query  1062  FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrr  883
             F   L  L    H N+V +LG+    GER++V EY    +L  +LH    A   L+W  R
Sbjct  529   FEVELEVLCKIRHCNIVNLLGYCSEMGERLLVYEYMPHGTLHDHLHGGLSA---LNWVLR  585

Query  882   lrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVIG  703
             L+++   A+GLE+LH+  VP IVH  VK+SN+L+D E++AR+ D+GL  L SN++     
Sbjct  586   LKISMQAAKGLEYLHKEFVPPIVHRDVKSSNILLDSEWNARIADFGL--LTSNDKD----  639

Query  702   YVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQE-----GLLVKWALPLIKEMRFGE  538
                         G  ESDVY FG+VLLE+LSGRK+ +       +V+WA+PLIK+ +   
Sbjct  640   ----------HSGDLESDVYNFGIVLLEMLSGRKAFDRDYTPPSIVEWAVPLIKQNKAAA  689

Query  537   VLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             ++D  +A+P ++ PL++LA +A   V  +   RP +  +A+
Sbjct  690   IIDRYVALPRNVEPLLKLADIAGLAVKENPTERPAMSDIAS  730



>ref|XP_010064568.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4, 
partial [Eucalyptus grandis]
Length=583

 Score =   150 bits (379),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 111/293 (38%), Positives = 164/293 (56%), Gaps = 23/293 (8%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ AT GF     +GKG    V+ GVL+  G +VAVKR     ++S+     
Sbjct  173   ARTFTYEELERATSGFKEESQVGKGSFSCVFKGVLK-NGTVVAVKR----AIMSSDKQKN  227

Query  1062  ---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLH  895
                F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L 
Sbjct  228   SKEFRTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEFMAHGSLHQHLHGKNKALKERLD  287

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +  
Sbjct  288   WVRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSG  347

Query  714   E--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKW  574
                       +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+W
Sbjct  348   SPLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYEEGNIVEW  406

Query  573   ALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             A+PLIK      +LDP +  P D+  L R+A +A  CV    K RP++ +V  
Sbjct  407   AVPLIKTGDISNILDPDLKPPSDLEALKRIANIACKCVRMRGKDRPSMDRVTT  459



>gb|KHN33307.1| Serine/threonine-protein kinase-like protein ACR4 [Glycine soja]
Length=873

 Score =   152 bits (385),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 165/292 (57%), Gaps = 20/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKR--FHPRLVLSNAAG  1069
             A  ++  E++ AT GF    I GKG    V+ GVL+ +G +VAVKR    P +  ++   
Sbjct  464   AQMFSYEELERATSGFKEESIAGKGSFSCVFKGVLK-DGTVVAVKRAIVSPNMQKNSKE-  521

Query  1068  FGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWS  889
               F + L  LS  +H +L+ +LG+ E  GER++V EY    SL  +LH N      + W 
Sbjct  522   --FHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEYMAHGSLHQHLHGNKVMQEQMDWV  579

Query  888   rrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE-  712
             RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +    
Sbjct  580   RRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSP  639

Query  711   -------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWAL  568
                     +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA+
Sbjct  640   LAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQFEEGNIVQWAV  698

Query  567   PLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             PLIK      +LDP +  P D++ L R+A VA   V    K RP++ +V  +
Sbjct  699   PLIKSGDIAAILDPTLKPPPDLDALRRIANVACKSVRMRGKDRPSMDKVTTV  750



>gb|EAZ06807.1| hypothetical protein OsI_29051 [Oryza sativa Indica Group]
Length=390

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 155/287 (54%), Gaps = 32/287 (11%)
 Frame = -1

Query  1227  LMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVL  1048
             L +++ ATDGF+P R+IG+G    VY+         +A KR  P LVL    G  F + L
Sbjct  73    LADVERATDGFHPSRVIGQGWHFTVYAAAPG-----LAAKRMRPHLVLGEPGGRRFPAAL  127

Query  1047  RWLSLADHPNLVPILGFSEAPGERIVVMEY--GGMLSLEFYLHQNPDAAALLHWSrrlrv  874
             R L++  HPNL  I+G SE PGER++++E    G + L+  L+     A LL W  R  V
Sbjct  128   RSLAVPPHPNLAGIVGLSEGPGERVLIVERASAGSVGLDALLYHGGTDAPLLPWPERAAV  187

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSA------RLCDYGL-YFLASNERQ  715
             AAG ARGL  LH   V  + HG V+  NVL+D   +A      R+ DYGL  FL S++  
Sbjct  188   AAGAARGLAHLH---VHGVAHGRVRPRNVLVDAAAAARGPCGVRVSDYGLSTFLHSDDGD  244

Query  714   EVI-GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIK--EMRF  544
                 G +D            E+DVY FG VLL+LL+GR+   G L  WALPLI+      
Sbjct  245   GDDHGRLDAR---------AENDVYMFGAVLLQLLTGRQWDGGRLAHWALPLIRAGPPAM  295

Query  543   GEVLDPRIAIPCDINP---LVRLAKVASACVGNSRKSRPTIVQVAAI  412
              E+LD R   P D      + R A+VA ACV N  +SRP + +V+AI
Sbjct  296   AELLDERAGKPADKAESRLVARTARVALACVANDGRSRPRMAEVSAI  342



>emb|CDX75852.1| BnaC03g39350D [Brassica napus]
Length=345

 Score =   146 bits (369),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 98/278 (35%), Positives = 150/278 (54%), Gaps = 14/278 (5%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR   VY G L  +G  +AVKR       +N     F+ 
Sbjct  27    FSLKELHAATNSFNYDNKLGEGRFSSVYWGQL-SDGSQIAVKRLKS---WTNREDINFTL  82

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
             V+  LS   H NL+ + G+     ER++V EY   LSL  +LH    A  +L  ++R+++
Sbjct  83    VVEILSRIRHKNLLSVRGYCNEGQERLLVYEYMPNLSLVSHLHGQHSAECILDCNKRIKI  142

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL----ASNERQEVI  706
             A   A+ + +LH    P +VHG V+ASNVL+D EF AR+ D+G   L     +       
Sbjct  143   AITSAQAIAYLHHHATPRVVHGDVRASNVLLDSEFEARVTDFGYGKLMPEDEAKSNNNNN  202

Query  705   GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKEMRFGEVLDP  526
             GY+  E        S+  DVY FG++LLEL+SG++++ G L +W LPL+ E +FGE++D 
Sbjct  203   GYLSPECV-----ASEAGDVYSFGILLLELVSGKRAKLG-LTEWVLPLVYERKFGEIVDQ  256

Query  525   RIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             R+        L ++  V   C     + RPT+ QV  +
Sbjct  257   RVKEEDVGEGLKKVVLVGLLCAQREAEMRPTMSQVVEM  294



>ref|XP_010268132.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
isoform X1 [Nelumbo nucifera]
Length=1061

 Score =   153 bits (386),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/290 (39%), Positives = 165/290 (57%), Gaps = 17/290 (6%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ AT GF     +GKG    V+ G+L+ +G +VAVKR      L   +   
Sbjct  648   AQTFTYEELERATGGFKEESQVGKGSFSCVFKGILK-DGTVVAVKRAIKSTDLKKNSK-E  705

Query  1062  FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHWSr  886
             F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH ++P     L W R
Sbjct  706   FHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEFMAHGSLHQHLHGKDPSLKEQLDWVR  765

Query  885   rlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE--  712
             R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +     
Sbjct  766   RVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPL  825

Query  711   ------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWALP  565
                    +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA+P
Sbjct  826   AELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQFEEGNIVEWAVP  884

Query  564   LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             LIK      +LDP +  P D+  L R+A VAS CV    K RP++ +V  
Sbjct  885   LIKAGDISAILDPVLKPPDDLEALRRIANVASKCVRMRGKERPSMDKVTT  934



>gb|KHN30097.1| Serine/threonine-protein kinase-like protein ACR4 [Glycine soja]
Length=871

 Score =   152 bits (385),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 165/292 (57%), Gaps = 20/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKR--FHPRLVLSNAAG  1069
             A  +   E++ AT GF    I+GKG    V+ GVL+ +G +VAVKR    P +  ++   
Sbjct  466   AQMFPYEELERATSGFKEESIVGKGSFSCVFKGVLK-DGTVVAVKRAIVSPNMQKNSKE-  523

Query  1068  FGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWS  889
               F + L  LS  +H +L+ +LG+ E  GER++V EY    SL  +LH N      + W 
Sbjct  524   --FHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEYMAHGSLHQHLHGNKVMQEQMDWV  581

Query  888   rrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE-  712
             RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +    
Sbjct  582   RRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSP  641

Query  711   -------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWAL  568
                     +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA+
Sbjct  642   LAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQFEEGNIVQWAV  700

Query  567   PLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             PLIK      +LDP +  P D++ L R+A VA   V    K RP++ +V  +
Sbjct  701   PLIKSGDIAAILDPVLKPPPDLDALRRIANVACKSVRMRGKDRPSMDKVTTV  752



>ref|XP_004167794.1| PREDICTED: proline-rich receptor-like protein kinase PERK9-like 
[Cucumis sativus]
Length=378

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 167/290 (58%), Gaps = 25/290 (9%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAG-FGFS  1057
             +T  E+  AT+ F+ + ++G+G  G VY G L P+G +VAVK     L +    G   F 
Sbjct  37    FTYEELFKATNAFSTQNLLGEGGFGSVYKGYL-PDGRVVAVKE----LKIGGGQGELEFK  91

Query  1056  SVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlr  877
             + +  +    H +LV ++G+  +  +R++V +Y    SL ++LH   +   +L W++R++
Sbjct  92    AEVEIIGRVHHRHLVSLVGYCISEHQRLLVYDYVSNNSLYYHLHLKGNGELVLEWAKRIK  151

Query  876   vaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV----  709
             +AAG ARG+ +LHE   P I+H  +K+SN+L+D  F AR+ D+GL  LA +E+  +    
Sbjct  152   IAAGAARGIAYLHEDCHPRIIHRDIKSSNILLDENFEARVSDFGLAKLALDEQTHITTRV  211

Query  708   ---IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEG-------LLVKWALPLI  559
                 GYV  EY   G+  ++ SDV+ FGVVLLEL++GRK+ +         LV+WA PL+
Sbjct  212   VGTFGYVAPEYASSGK-LTERSDVFSFGVVLLELITGRKAVDASQPMGNESLVEWARPLL  270

Query  558   K----EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
                     F  ++DPR+    D + ++R+  +A+ACV +S   RP + QV
Sbjct  271   NHALDNQDFETLVDPRLERNYDESEMLRMIGIAAACVRHSSAKRPQMGQV  320



>ref|XP_009351272.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Pyrus 
x bretschneideri]
Length=376

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 102/285 (36%), Positives = 156/285 (55%), Gaps = 19/285 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+G  G VY G L  +G  +AVKR     V S+ A   F+ 
Sbjct  28    FSLKELHAATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSDKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A  LL W+RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYLPNLSLLSHLHGQHSAECLLDWTRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G   L        +   +
Sbjct  144   AIGSAEGVAYLHHHATPHIIHRDIKASNVLVDSDFQAQVADFGFARLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E +       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKVGQGMKRTVTDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             E +F E+ DP++      + L R+  V   C  +  + RPT+++V
Sbjct  263   ERKFDEIADPKLNGKYLEDELKRVVFVGLLCAHSRPERRPTMLEV  307



>ref|XP_007139102.1| hypothetical protein PHAVU_008G001400g [Phaseolus vulgaris]
 gb|ESW11096.1| hypothetical protein PHAVU_008G001400g [Phaseolus vulgaris]
Length=474

 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 111/312 (36%), Positives = 163/312 (52%), Gaps = 22/312 (7%)
 Frame = -1

Query  1308  KRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPE  1129
             KR     +  EG G   A +++A  +T  E+  AT  F P   +G+G  G VY G L+  
Sbjct  64    KRELAPPNTKEGHGA--AGQIAAQTFTFRELATATKNFRPDSFVGEGGFGRVYKGRLETT  121

Query  1128  GELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGM  949
             G++VAVK+     +  N     F   +  LSL  HPNLV ++G+     +R++V E+  +
Sbjct  122   GQIVAVKQLDKNGLQGNRE---FLVEVLMLSLLHHPNLVNLIGYCADGEQRLLVYEFMAL  178

Query  948   LSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEF  769
              SLE +LH  P     L W+ R+++AAG A+GLE+LH+   P +++   K+SN+L+D  +
Sbjct  179   GSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYLHDKANPPVIYRDFKSSNILLDEGY  238

Query  768   SARLCDYGLYFLA--------SNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELL  613
               +L D+GL  L         S       GY   EY + G+   K SDVY FGVV LEL+
Sbjct  239   QPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEYAMTGQLTVK-SDVYSFGVVFLELI  297

Query  612   SGRKS-------QEGLLVKWALPLIKEMR-FGEVLDPRIAIPCDINPLVRLAKVASACVG  457
             +GRK+        E  LV WA PL  + R F ++ DPR+     +  L +   VAS C+ 
Sbjct  298   TGRKAIDSTQPHGEQNLVTWARPLFNDRRKFSKLADPRLEGRFPMRGLYQALAVASMCIQ  357

Query  456   NSRKSRPTIVQV  421
              S  +RP I  V
Sbjct  358   ESAATRPLIGDV  369



>ref|XP_008676673.1| PREDICTED: uncharacterized LOC100216921 isoform X1 [Zea mays]
 gb|ACN33757.1| unknown [Zea mays]
 gb|AFW66263.1| putative protein kinase superfamily protein [Zea mays]
Length=377

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 108/319 (34%), Positives = 162/319 (51%), Gaps = 26/319 (8%)
 Frame = -1

Query  1320  CCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGV  1141
             CCK+      D  + G    K    +   ++L E+ +AT+ FN    +G+G  G VY G 
Sbjct  6     CCKRS-----DGAEPGRRRRKKKDTAWRIFSLKELQSATNNFNYDNKLGEGGFGSVYWGQ  60

Query  1140  LQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVME  961
             L  +G  +AVKR       SN A   F+  +  L+   H +L+ + G+     ER++V +
Sbjct  61    LW-DGSQIAVKRLKS---WSNKAETEFAVEVEVLARVRHRSLLSLRGYCAEGQERLIVYD  116

Query  960   YGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLI  781
             Y   LS+   LH    A   L W RR+R+A   A G+ +LH    PHI+H  VKASNVL+
Sbjct  117   YMPNLSIHSQLHGQHAAECNLSWERRMRIAVDSAEGIAYLHHSATPHIIHRDVKASNVLL  176

Query  780   DVEFSARLCDYGLYFL-------ASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLL  622
             D +F AR+ D+G   L        + + +  +GY+  EY + G+  S+  DV+ FGV LL
Sbjct  177   DADFQARVADFGFAKLVPDGATHVTTKVKGTLGYLAPEYAMLGK-ASESCDVFSFGVTLL  235

Query  621   ELLSGRKSQEGL---------LVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVAS  469
             EL SGR+  E L         + +WALPL +  RFGE+ DP++        L R+  V  
Sbjct  236   ELASGRRPVEKLSPTAAAKQTVTEWALPLARARRFGEIADPKLGGGFVEEELKRVVLVGL  295

Query  468   ACVGNSRKSRPTIVQVAAI  412
              C  +  + RPT+ +V  +
Sbjct  296   VCAQDRPELRPTMSEVVQL  314



>ref|XP_006645667.1| PREDICTED: proline-rich receptor-like protein kinase PERK1-like 
[Oryza brachyantha]
Length=475

 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 168/300 (56%), Gaps = 31/300 (10%)
 Frame = -1

Query  1257  AAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSN  1078
             A   S   +T  ++ AATDGF+   ++G+G  G V+ GVL P G  VAVK+      L +
Sbjct  77    ALGFSRCTFTYEDLSAATDGFSSANLLGQGGFGYVHKGVL-PNGTEVAVKQ------LRD  129

Query  1077  AAGFG---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAA  907
              +G G   F + +  +S   H +LV ++G+  + G+R++V E+    +LEF+LH      
Sbjct  130   GSGQGEREFQAEVEIISRVHHKHLVTLVGYCISGGKRLLVYEFVANNTLEFHLHGR--GR  187

Query  906   ALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLAS  727
               + W  RLR+A G A+GL +LHE   P I+H  +KA+N+L+D  F A++ D+GL  LAS
Sbjct  188   PTMEWPTRLRIALGAAKGLAYLHEDCHPKIIHRDIKAANILLDARFEAKVADFGLAKLAS  247

Query  726   NERQEV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-------SQEG  589
             +    +        GY+  EY   G+  +++SDV+ FGV+LLEL++GR+         + 
Sbjct  248   DNNTHISTRVMGTFGYLAPEYASSGK-LTEKSDVFSFGVMLLELITGRRPVRSNQSQMDD  306

Query  588   LLVKWALPLI----KEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
              LV WA PL+    ++     ++DPR+    + N + R+   A+ACV +S + RP + QV
Sbjct  307   SLVDWARPLMTRASEDGNHDALVDPRLGQEYNSNEMARMIACAAACVRHSARRRPRMSQV  366



>ref|XP_006305213.1| hypothetical protein CARUB_v10009580mg [Capsella rubella]
 ref|XP_006305214.1| hypothetical protein CARUB_v10009580mg [Capsella rubella]
 gb|EOA38111.1| hypothetical protein CARUB_v10009580mg [Capsella rubella]
 gb|EOA38112.1| hypothetical protein CARUB_v10009580mg [Capsella rubella]
Length=353

 Score =   146 bits (369),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 157/291 (54%), Gaps = 23/291 (8%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       SN     F+ 
Sbjct  28    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSNREEIDFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    + +LL W+RR+ +
Sbjct  84    EVEILARIRHKNLLSVRGYCAEGQERLIVYDYMPNLSLVSHLHGQHSSDSLLDWTRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE------  712
             A   A+ + +LH    P IVHG V+ASNVL+D EF AR+ D+G   +  ++ ++      
Sbjct  144   AVTSAQAIAYLHHFATPRIVHGDVRASNVLLDSEFEARVTDFGYGKMMPDDARDGGNKII  203

Query  711   ---VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK--------SQEGLLVKWALP  565
                 IGY+  E  +E    S   DVY FG+VLLEL++G++        +++G + +W LP
Sbjct  204   KGNNIGYLSPEC-IESGKESDMGDVYSFGIVLLELVTGKRPIERANLTTKQG-ITEWVLP  261

Query  564   LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             L+ E +FGE++D R+        L R+  V   C     + RPT+ +V  +
Sbjct  262   LVYERKFGEIVDQRLNGKYVEEELKRVILVGLICAQREPEKRPTMSEVVEM  312



>ref|XP_008800064.1| PREDICTED: putative receptor protein kinase CRINKLY4 [Phoenix 
dactylifera]
Length=904

 Score =   152 bits (384),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 167/291 (57%), Gaps = 19/291 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKR-FHPRLVLSNAAGF  1066
             A  +   E++ AT GF+   I+GKG    V+ G+L+ +G LVAVKR      V  N+  F
Sbjct  492   AQMFAYEELEKATGGFSEESIVGKGSFSYVFKGILK-DGTLVAVKRAIKASDVKKNSKEF  550

Query  1065  GFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHWS  889
                + L  LS  +H +L+ +LG+ E  GER++V EY    SL  +LH ++P     L W 
Sbjct  551   --HTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEYMAHGSLYQHLHGKDPTLKEQLGWV  608

Query  888   rrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE-  712
             RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL   A ++    
Sbjct  609   RRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLFAPDDSSAP  668

Query  711   -------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWAL  568
                     +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA+
Sbjct  669   LSELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAV  727

Query  567   PLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             PLIK      +LDP +  P D+  L ++A +A  CV    K RP++ +V  
Sbjct  728   PLIKAGDISTLLDPVLKPPADLEALKKIASIACKCVRMRGKDRPSMDKVTT  778



>ref|XP_010526052.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Tarenaya hassleriana]
 ref|XP_010526059.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Tarenaya hassleriana]
Length=898

 Score =   152 bits (384),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 107/292 (37%), Positives = 163/292 (56%), Gaps = 21/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ A  GF    ++GKG    VY G+L+ +G  VAVK+    ++ S+     
Sbjct  499   ARVFTYDELEKAAGGFKEESMVGKGSFSCVYKGILR-DGTTVAVKK---AIMTSDKQKKS  554

Query  1062  --FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHW  892
               F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L W
Sbjct  555   KEFHTELDLLSRLNHAHLLSLLGYCEEGGERLLVYEFMAHGSLYNHLHGKNKALKEQLDW  614

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
              +R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +   
Sbjct  615   VKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSA  674

Query  711   --------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWA  571
                      +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA
Sbjct  675   PLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWA  733

Query  570   LPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             +PLIK      +LDP +  P D+  L R+A  A  CV    + RP++ +V  
Sbjct  734   VPLIKAGDIAAILDPVLKPPPDMESLRRIASAAYKCVRMRGRDRPSMDKVTT  785



>ref|XP_007156929.1| hypothetical protein PHAVU_002G029200g [Phaseolus vulgaris]
 ref|XP_007156930.1| hypothetical protein PHAVU_002G029200g [Phaseolus vulgaris]
 gb|ESW28923.1| hypothetical protein PHAVU_002G029200g [Phaseolus vulgaris]
 gb|ESW28924.1| hypothetical protein PHAVU_002G029200g [Phaseolus vulgaris]
Length=631

 Score =   150 bits (379),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 106/300 (35%), Positives = 170/300 (57%), Gaps = 31/300 (10%)
 Frame = -1

Query  1248  LSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAG  1069
             L    +T  E+ AAT+GF+  ++IG+G  G V+ GVL P G+ VAVK       L   +G
Sbjct  272   LKGGTFTYEELSAATNGFDDSKLIGQGGFGYVHKGVL-PNGKEVAVKS------LKAGSG  324

Query  1068  FG---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALL  898
              G   F + +  +S   H +LV ++G+S + G+R++V E+    +LE++LH        +
Sbjct  325   QGEREFQAEIDIISRVHHRHLVSLVGYSISGGQRMLVYEFIPNNTLEYHLHGK--GRPTM  382

Query  897   HWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNER  718
              W  R+R+A G ++GL +LHE   P I+H  +KA+NVLID  F A++ D+GL  L S+  
Sbjct  383   DWPTRMRIAIGSSKGLAYLHEDCHPRIIHRDIKAANVLIDDSFEAKVADFGLAKLTSDNN  442

Query  717   QEV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK------SQEGLLVK  577
               V        GY+  EY   G+  +++SDV+ FGV+LLEL++GR+      + +  LV 
Sbjct  443   THVSTRVMGTFGYLAPEYASSGK-LTEKSDVFSFGVMLLELITGRRPVDHTSAIDDSLVD  501

Query  576   WALPLI-----KEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             WA PL+     ++  FGE++DP +    +   L R+A  A++ + +S K RP + Q+  I
Sbjct  502   WARPLLNRGLEEDGNFGELVDPFLEGNYNPQELARMAACAASSIRHSSKKRPKMSQIVRI  561



>gb|KDP43834.1| hypothetical protein JCGZ_20844 [Jatropha curcas]
Length=819

 Score =   152 bits (383),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 166/292 (57%), Gaps = 21/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  ++  E++ AT+GF    ++GKG    VY GV++  G +VAVK+    +V S+     
Sbjct  406   AQMFSYEELERATNGFKEESLVGKGSFSCVYKGVMK-NGTVVAVKK---AIVSSDKQKNS  461

Query  1062  --FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHW  892
               F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L W
Sbjct  462   KEFHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEFMAHGSLHQHLHGKNKSLKEQLDW  521

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
              RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +   
Sbjct  522   VRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPADSGS  581

Query  711   --------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWA  571
                      +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA
Sbjct  582   PLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWA  640

Query  570   LPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             +PLIK      +LDP +  P DI  L R+A VA  CV    K RP++ +V  
Sbjct  641   VPLIKSADISAILDPLLKPPPDIEALKRIANVACKCVRMKGKERPSMDKVTT  692



>gb|EPS72385.1| hypothetical protein M569_02367 [Genlisea aurea]
Length=888

 Score =   152 bits (384),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 110/290 (38%), Positives = 165/290 (57%), Gaps = 17/290 (6%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++AATDGF    ++GKG    V+ G+L+ +G  VAVKR    L L       
Sbjct  468   ARMFTYEELEAATDGFKEESLVGKGSFSCVFKGILK-DGTTVAVKRAIVSLDLKKNLK-E  525

Query  1062  FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHWSr  886
             F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N +    L W +
Sbjct  526   FHTELDLLSRLNHAHLLNLLGYCEDGGERLLVYEFMANGSLHHHLHGENKELREKLDWVK  585

Query  885   rlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE--  712
             R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L         
Sbjct  586   RVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVSDFGLSLLGPANSSSPL  645

Query  711   ------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWALP  565
                    +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA+P
Sbjct  646   AELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDLQYEEGNIVEWAVP  704

Query  564   LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             L+K      +LDP +  P ++  + R+A VA  CV    K RP++ +V  
Sbjct  705   LVKSGDVEAILDPNLKPPAELEAVKRIANVAIKCVRMRGKERPSMDKVTT  754



>ref|XP_009770850.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Nicotiana sylvestris]
Length=893

 Score =   152 bits (384),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 113/293 (39%), Positives = 164/293 (56%), Gaps = 23/293 (8%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ AT GF     +GKG    V+ GVL+ +G  VAVKR     ++S+     
Sbjct  479   AQMFTYEELETATGGFKEESQVGKGSFSCVFKGVLK-DGTAVAVKR----AIMSSDMKKN  533

Query  1062  ---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLH  895
                F + L  LS  +H +L+ +LG+ E  GER++V EY    SL  +LH +N      L 
Sbjct  534   SKEFHTELDLLSRLNHAHLLNLLGYCEEAGERLLVYEYMANGSLHQHLHGKNNTVKEQLD  593

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L      
Sbjct  594   WIRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPANSS  653

Query  714   E--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKW  574
                       +GY+D EY+      +K SDVY FGV+LLE+LSGRK+      EG +V+W
Sbjct  654   SPLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYDEGNIVEW  712

Query  573   ALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             A+PLIK      +LDP + +P D+  L R+A +AS CV    K RP++ +V  
Sbjct  713   AVPLIKAGDIQAILDPVLKLPSDVEALRRIANIASKCVRMRGKERPSMDKVTT  765



>ref|XP_007014100.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
 gb|EOY31719.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
Length=382

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/318 (32%), Positives = 165/318 (52%), Gaps = 24/318 (8%)
 Frame = -1

Query  1323  VCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSG  1144
             +CC        D  DEG+        +   +T  E+  AT+GF    ++G+G  G VY G
Sbjct  5     LCC-----CSSDKVDEGVSVVTPGNTTWRIFTYKELHTATNGFRDDNMLGEGGFGSVYLG  59

Query  1143  VLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVM  964
                 +G  +AVK+      +++ A   F+  +  L    H NL+ + G+     +R++V 
Sbjct  60    KTS-DGLQIAVKKLK---AMTSKAEMEFAVEVEVLGRVRHKNLLGLRGYCVGTDQRLIVY  115

Query  963   EYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVL  784
             +Y   LSL  +LH       LL W RR+++A G A G+ +LH  + PHI+H  +KASNVL
Sbjct  116   DYMPNLSLLSHLHGQYSREVLLDWKRRMKIAIGSAEGILYLHHEVTPHIIHRDIKASNVL  175

Query  783   IDVEFSARLCDYGLYFL-------ASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVL  625
             +D +F   + D+G   L        +   +  +GY+  EY + G+  S+  DVY FG++L
Sbjct  176   LDSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGK-VSESCDVYSFGILL  234

Query  624   LELLSGRKSQEGL-------LVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASA  466
             LELL+GRK  E L       + +WA P I + RF +++DP++    D N L +   VA+ 
Sbjct  235   LELLTGRKPIEKLPGGVKRTITEWAEPFIAKGRFKDLVDPKLRGNFDENQLKQAINVAAL  294

Query  465   CVGNSRKSRPTIVQVAAI  412
             CV N  + RP++ +V  +
Sbjct  295   CVQNEPEKRPSMKEVVGM  312



>ref|XP_011012925.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Populus euphratica]
Length=922

 Score =   152 bits (383),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 164/292 (56%), Gaps = 21/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ AT GF    I+GKG    VY GVL+  G +VAVK+    +V S+     
Sbjct  509   ARMFTYEELEGATSGFKEESIVGKGSFSCVYKGVLK-NGTVVAVKK---AIVCSDKQKNS  564

Query  1062  --FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHW  892
               F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +NP     L W
Sbjct  565   KEFHNELDLLSRLNHAHLLNLLGYCEEGGERLLVYEFMAHGSLHQHLHGKNPALIEQLDW  624

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
              RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +   
Sbjct  625   VRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVSDFGLSLLGPADSSS  684

Query  711   --------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWA  571
                      +GY+D EY+      +K SDVY FGV+LLE+LS RK+     +EG +V+WA
Sbjct  685   PLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSSRKAIDMQYEEGNIVEWA  743

Query  570   LPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             +PLIK      +LDP +  P D   L R+A VA  CV    K RP++ +V  
Sbjct  744   VPLIKAGDISAILDPALKPPSDPEALKRIANVACKCVRMRGKERPSMDKVTT  795



>ref|XP_009793904.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nicotiana 
sylvestris]
Length=386

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 109/304 (36%), Positives = 160/304 (53%), Gaps = 20/304 (7%)
 Frame = -1

Query  1278  EGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFH  1099
             E I  +    +SA  +T  E+  ATD FNP  ++G+G  G VY G L+   ++VAVK+  
Sbjct  49    EDILRYGNVNISAEVFTFRELAHATDNFNPEFLVGEGGFGRVYKGHLKRTNQVVAVKQLD  108

Query  1098  PRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQN  919
                V  N     F + +  LSL +HPNLV ++G+     +RI+V E+    SLE +L   
Sbjct  109   RNGVQGNRE---FLAEVLTLSLVNHPNLVNLIGYCADGNQRILVYEFMHNGSLEDHLLDL  165

Query  918   PDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLY  739
             P     L+W  R+++A G A+GLE+LH+   P I++   KASN+L+D  F  +L D+GL 
Sbjct  166   PSNKKPLNWYTRMKIAKGAAQGLEYLHDIANPPIIYRDFKASNILLDECFIPKLSDFGLA  225

Query  738   FLA--------SNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----  598
              L         S       GY   EY + G+  SK SDVY FGVVLLE++SGR++     
Sbjct  226   KLGPTGGEDHVSTRVMGTYGYCAPEYAMTGQLTSK-SDVYSFGVVLLEIISGRRAIDNTR  284

Query  597   --QEGLLVKWALPLIKEM-RFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIV  427
               +E  L+ WA PL K+  R  E+ DP +        L +   +A+ C+ +   +RP I 
Sbjct  285   SLEEQNLISWAKPLFKDKNRLDEMADPLLGGNYPAKGLRQALAIANMCLQDEANTRPLIC  344

Query  426   QVAA  415
              V  
Sbjct  345   DVVT  348



>ref|XP_009135465.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Brassica 
rapa]
Length=346

 Score =   145 bits (367),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/274 (35%), Positives = 149/274 (54%), Gaps = 5/274 (2%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR   VY G L  +G  VAVKR       +N     F+ 
Sbjct  28    FSLKELHAATNSFNYDNKLGEGRFSSVYWGQL-SDGSQVAVKRLKS---WTNREDINFTL  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  LS   H NL+ + G+     ER++V +Y   LSL  +LH    A  +L  ++R+++
Sbjct  84    EVDILSRIRHKNLLSVRGYCNEGQERLLVYDYMPNLSLVSHLHGQHSAECILDCTKRIKI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVIGYVD  694
             A   A+ + +LH    P +VHG V+ASNVL+D EF AR+ D+G   L   +  +     +
Sbjct  144   AITSAQAIAYLHHHATPRVVHGDVRASNVLLDSEFEARVTDFGYGKLMPEDEAKSNNNNN  203

Query  693   EEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGLLVKWALPLIKEMRFGEVLDPRIAI  514
               Y       S+  DVY FG++LLEL+SG++++EG L +W LPL+ + +FGE++D R+  
Sbjct  204   NGYLPPECVASEAGDVYSFGILLLELVSGKRAKEG-LTEWVLPLVYQRKFGEIVDQRVKE  262

Query  513   PCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
                   L ++  V   C     + RPT+ QV  +
Sbjct  263   EDVGERLKKVVLVGLLCGQREAERRPTMSQVVEM  296



>ref|XP_010665554.1| PREDICTED: serine/threonine-protein kinase CDL1 [Beta vulgaris 
subsp. vulgaris]
Length=443

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 107/302 (35%), Positives = 162/302 (54%), Gaps = 23/302 (8%)
 Frame = -1

Query  1278  EGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFH  1099
             E +  HK+   SA  +T  +M  AT+ F+   ++G+G  G VY G +    ++VAVK+  
Sbjct  82    ESVAGHKS---SAQTFTFRQMANATNNFSIENLVGEGGFGRVYKGYIPGVEKVVAVKQLD  138

Query  1098  PRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQN  919
                   N     F S +  LSL DHPNLV ++G+     +RI+V E+    S+E +L   
Sbjct  139   RNGQQGNRE---FLSEVFMLSLVDHPNLVNLIGYCADGDQRILVYEFMANGSVEDHLLDL  195

Query  918   PDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLY  739
             P     L W  R+++A G A+GLE+LHE   P +++   KASN+L+D EF+++L D+GL 
Sbjct  196   PPNKEPLDWHTRMKIAEGAAKGLEYLHETNKPQVIYRDFKASNILLDEEFNSKLSDFGLA  255

Query  738   FLASNERQEVI--------GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK------  601
              +     +E +        GY   EY + G+  +K SDVY FGVV LEL+SGR+      
Sbjct  256   RIGPTGDKEHVSTRVMGTYGYCAPEYAMTGQLTTK-SDVYSFGVVFLELISGRRAVDTTK  314

Query  600   -SQEGLLVKWALPLIKEMR-FGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIV  427
              + E  LV WA PL K+ + F ++ DP +A    +  L +   VA+ C+     +RP I 
Sbjct  315   PTAEQNLVSWAEPLFKDRKMFTKMADPLMADKYPVKGLYQALAVAAMCLQEEASTRPLIS  374

Query  426   QV  421
              V
Sbjct  375   DV  376



>ref|XP_006406905.1| hypothetical protein EUTSA_v10020984mg [Eutrema salsugineum]
 gb|ESQ48358.1| hypothetical protein EUTSA_v10020984mg [Eutrema salsugineum]
Length=366

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 156/288 (54%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GRLG VY G L  +G  VAVKR       SN     F  
Sbjct  27    FSLKELHAATNSFNYDNKLGEGRLGSVYWGQLW-DGSQVAVKRLK---AWSNREEIDFVV  82

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A  LL  ++R+++
Sbjct  83    EVEILARIRHKNLLSVRGYCAEGQERLLVYDYMPNLSLVSHLHGQHSAECLLDCTKRIKI  142

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE------  712
             A   A+ + +LH    PHIVHG V+ASNVL+D EF A++ D+G   L  ++ ++      
Sbjct  143   AISSAQAIAYLHHHATPHIVHGDVRASNVLLDSEFEAQVTDFGYGKLMPDDTEDGATKGK  202

Query  711   -VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
                GY+  E    G+  S+  DVY FG++LLEL+SG++  E L       + +W LPL+ 
Sbjct  203   SNNGYLSPECVASGK-ESETGDVYSFGILLLELVSGKRPIERLNTTTKRGITEWVLPLVY  261

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +FGE++D R++       L ++  V   C     + RPT+ +V  +
Sbjct  262   ERKFGEIVDQRLSGEHVEEKLKKVVLVGLMCAQTEPEKRPTMSEVVEL  309



>gb|KHN20676.1| Proline-rich receptor-like protein kinase PERK1 [Glycine soja]
Length=475

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 167/300 (56%), Gaps = 31/300 (10%)
 Frame = -1

Query  1257  AAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSN  1078
             A   S + +T  E+  ATDGF+   ++G+G  G V+ G+L P G+ VAVK+      L  
Sbjct  83    ALGFSKSTFTYEELARATDGFSDANLLGQGGFGYVHRGIL-PNGKEVAVKQ------LKA  135

Query  1077  AAGFG---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAA  907
              +G G   F + +  +S   H +LV ++G+     +R++V E+    +LEF+LH      
Sbjct  136   GSGQGEREFQAEVEIISRVHHKHLVSLVGYCITGSQRLLVYEFVPNNTLEFHLHGR--GR  193

Query  906   ALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLAS  727
               + W  RLR+A G A+GL +LHE   P I+H  +KA+N+L+D +F A++ D+GL   +S
Sbjct  194   PTMDWPTRLRIALGSAKGLAYLHEDCHPKIIHRDIKAANILLDFKFEAKVADFGLAKFSS  253

Query  726   NERQEV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGR----KSQ---EG  589
             +    V        GY+  EY   G+   K SDV+ +GV+LLEL++GR    K+Q   E 
Sbjct  254   DVNTHVSTRVMGTFGYLAPEYASSGKLTDK-SDVFSYGVMLLELITGRRPVDKNQTFMED  312

Query  588   LLVKWALPL----IKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
              LV WA PL    ++E  F  ++DPR+    D N + R+   A+AC+ +S K RP + QV
Sbjct  313   SLVDWARPLLTRALEEDDFDSIIDPRLQNDYDPNEMARMVASAAACIRHSAKRRPRMSQV  372



>ref|NP_189097.1| proline-rich receptor-like protein kinase PERK3 [Arabidopsis 
thaliana]
 gb|AEE76918.1| proline-rich receptor-like protein kinase PERK3 [Arabidopsis 
thaliana]
Length=509

 Score =   149 bits (375),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 110/324 (34%), Positives = 173/324 (53%), Gaps = 33/324 (10%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             F  CKKKRP  +      IG H++       +T  E+  AT+ F+   ++G+G  G VY 
Sbjct  142   FFLCKKKRPRDDKALPAPIGIHQST------FTYGELARATNKFSEANLLGEGGFGFVYK  195

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFG-FSSVLRWLSLADHPNLVPILGFSEAPGERIV  970
             G+L   G  VAVK+    L + +A G   F + +  +S   H NLV ++G+  A  +R++
Sbjct  196   GILN-NGNEVAVKQ----LKVGSAQGEKEFQAEVNIISQIHHRNLVSLVGYCIAGAQRLL  250

Query  969   VMEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASN  790
             V E+    +LEF+LH        + WS RL++A   ++GL +LHE   P I+H  +KA+N
Sbjct  251   VYEFVPNNTLEFHLHGK--GRPTMEWSLRLKIAVSSSKGLSYLHENCNPKIIHRDIKAAN  308

Query  789   VLIDVEFSARLCDYGLYFLASNERQEV-------IGYVDEEYWVEGRGGSKESDVYGFGV  631
             +LID +F A++ D+GL  +A +    V        GY+  EY   G+  +++SDVY FGV
Sbjct  309   ILIDFKFEAKVADFGLAKIALDTNTHVSTRVMGTFGYLAPEYAASGK-LTEKSDVYSFGV  367

Query  630   VLLELLSGRKS-------QEGLLVKWALPL----IKEMRFGEVLDPRIAIPCDINPLVRL  484
             VLLEL++GR+         +  LV WA PL    ++E  F  + D ++    D   + R+
Sbjct  368   VLLELITGRRPVDANNVYADDSLVDWARPLLVQALEESNFEGLADIKLNNEYDREEMARM  427

Query  483   AKVASACVGNSRKSRPTIVQVAAI  412
                A+ACV  + + RP + QV  +
Sbjct  428   VACAAACVRYTARRRPRMDQVVRV  451



>gb|KHN36118.1| Proline-rich receptor-like protein kinase PERK4 [Glycine soja]
Length=390

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 106/300 (35%), Positives = 167/300 (56%), Gaps = 31/300 (10%)
 Frame = -1

Query  1248  LSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAG  1069
             L    +T  E+ AAT+GFN   +IG+G  G V+ GVL P G+ VAVK       L   +G
Sbjct  30    LKGGTFTYEELAAATNGFNDANLIGQGGFGYVHKGVL-PSGKEVAVKS------LKAGSG  82

Query  1068  FG---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALL  898
              G   F + +  +S   H +LV ++G+S + G+R++V E+    +LE++LH        +
Sbjct  83    QGEREFQAEIDIISRVHHRHLVSLVGYSISGGQRMLVYEFIPNNTLEYHLHGK--GRPTM  140

Query  897   HWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNER  718
              W  R+R+A G A+GL +LHE   P I+H  +KA+NVLID  F A++ D+GL  L ++  
Sbjct  141   DWPTRMRIAIGSAKGLAYLHEDCHPRIIHRDIKAANVLIDDSFEAKVADFGLAKLTTDNN  200

Query  717   QEV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK------SQEGLLVK  577
               V        GY+  EY   G+  +++SDV+ FGV+LLEL++G++      + +  LV 
Sbjct  201   THVSTRVMGTFGYLAPEYASSGK-LTEKSDVFSFGVMLLELITGKRPVDHTNAMDDSLVD  259

Query  576   WALPLI-----KEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             WA PL+     ++  FGE++D  +    D   L R+A  A+  + +S K RP + Q+  I
Sbjct  260   WARPLLTRGLEEDGNFGELVDAFLEGNYDAQELSRMAACAAGSIRHSAKKRPKMSQIVRI  319



>ref|XP_011026418.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Populus euphratica]
Length=922

 Score =   152 bits (383),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 164/292 (56%), Gaps = 21/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ AT GF    I+GKG    VY GVL+  G +VAVK+    +V S+     
Sbjct  509   ARMFTYEELEGATSGFKEESIVGKGSFSCVYKGVLK-NGTVVAVKK---AIVCSDKQKNS  564

Query  1062  --FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHW  892
               F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +NP     L W
Sbjct  565   KEFHNELDLLSRLNHAHLLNLLGYCEEGGERLLVYEFMAHGSLHQHLHGKNPALIEQLDW  624

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
              RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +   
Sbjct  625   VRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVSDFGLSLLGPADSSS  684

Query  711   --------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWA  571
                      +GY+D EY+      +K SDVY FGV+LLE+LS RK+     +EG +V+WA
Sbjct  685   PLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSSRKAIDMQYEEGNIVEWA  743

Query  570   LPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             +PLIK      +LDP +  P D   L R+A VA  CV    K RP++ +V  
Sbjct  744   VPLIKAGDISAILDPALKPPSDPEALKRIANVACKCVRMRGKERPSMDKVTT  795



>ref|XP_003542059.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Glycine max]
Length=900

 Score =   152 bits (383),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 165/292 (57%), Gaps = 20/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKR--FHPRLVLSNAAG  1069
             A  +   E++ AT GF    I+GKG    V+ GVL+ +G +VAVKR    P +  ++   
Sbjct  495   AQMFPYEELERATSGFKEESIVGKGSFSCVFKGVLK-DGTVVAVKRAIVSPNMQKNSKE-  552

Query  1068  FGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWS  889
               F + L  LS  +H +L+ +LG+ E  GER++V EY    SL  +LH N      + W 
Sbjct  553   --FHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEYMAHGSLHQHLHGNKVMQEQMDWV  610

Query  888   rrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE-  712
             RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +    
Sbjct  611   RRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSP  670

Query  711   -------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWAL  568
                     +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA+
Sbjct  671   LAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQFEEGNIVQWAV  729

Query  567   PLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             PLIK      +LDP +  P D++ L R+A VA   V    K RP++ +V  +
Sbjct  730   PLIKSGDIAAILDPVLKPPPDLDALRRIANVACKSVRMRGKDRPSMDKVTTV  781



>gb|KHN25294.1| Serine/threonine-protein kinase-like protein ACR4 [Glycine soja]
Length=876

 Score =   151 bits (382),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 165/292 (57%), Gaps = 21/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKR--FHPRLVLSNAAG  1069
             A  +T  E++ AT GF    I+GKG    V+ GVL+ +G +VAVKR    P +  ++   
Sbjct  462   AQTFTYEELETATSGFKEESIVGKGSFSCVFKGVLK-DGTVVAVKRAIVSPNMQKNSKE-  519

Query  1068  FGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHW  892
               F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH  N      L W
Sbjct  520   --FHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEFMAHGSLHQHLHATNQVLREQLDW  577

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
              RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +   
Sbjct  578   IRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPADSGS  637

Query  711   --------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWA  571
                      +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA
Sbjct  638   PLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWA  696

Query  570   LPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             +PLIK      +LDP +  P D+  L R+A VA  CV    K RP++ +V  
Sbjct  697   VPLIKSGDITAILDPVLKPPPDLEALKRIANVACKCVRMRGKERPSMDKVTT  748



>ref|XP_009595311.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nicotiana 
tomentosiformis]
Length=386

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 109/304 (36%), Positives = 160/304 (53%), Gaps = 20/304 (7%)
 Frame = -1

Query  1278  EGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFH  1099
             E I  +    +SA  +T  E+  ATD FNP  ++G+G  G VY G L+   ++VAVK+  
Sbjct  49    EDILRYGNVNISAEVFTFRELAHATDNFNPEFLVGEGGFGRVYKGHLKRTNQVVAVKQLD  108

Query  1098  PRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQN  919
                V  N     F + +  LSL +HPNLV ++G+     +RI+V E+    SLE +L   
Sbjct  109   RNGVQGNRE---FLAEVLTLSLVNHPNLVNLIGYCADGNQRILVYEFMHNGSLEDHLLGL  165

Query  918   PDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLY  739
             P     L W  R+++A G A+GLE+LH+   P I++   KASN+L+D  F  +L D+GL 
Sbjct  166   PSNKKPLDWYTRMKIAKGAAQGLEYLHDIANPPIIYRDFKASNILLDECFIPKLSDFGLA  225

Query  738   FLA--------SNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----  598
              L         S       GY   EY + G+  SK SDVY FGVVLLE++SGR++     
Sbjct  226   KLGPTGGEDHVSTRVMGTYGYCAPEYAMTGQLTSK-SDVYSFGVVLLEIISGRRAIDNTR  284

Query  597   --QEGLLVKWALPLIKEM-RFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIV  427
               +E  L+ WA PL K+  R  E+ DP +     +  L +   +A+ C+ +   +RP I 
Sbjct  285   SPEEQNLISWAKPLFKDKNRLDEMADPLLGGNYPVKGLRQALAIANMCLQDEANTRPLIC  344

Query  426   QVAA  415
              V  
Sbjct  345   DVVT  348



>ref|XP_011081421.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Sesamum 
indicum]
Length=360

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 151/288 (52%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+  AT+ FN    +G+G  G VY G L  +G  +AVKR       SN A   FS 
Sbjct  29    FSLKELQLATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLKS---WSNKAEVEFSV  84

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A   L W RR+ +
Sbjct  85    EVEILARVRHKNLLTLRGYCAEGQERLIVYDYMTNLSLLSHLHGQHSAECHLDWPRRMNI  144

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G            +   +
Sbjct  145   AVGAAEGIAYLHHYATPHIIHRDIKASNVLLDSDFKAQVADFGFAKFIPDGATHVTTRVK  204

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E L       +  WALPL +
Sbjct  205   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKLSSTIKRPITDWALPLAR  263

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E  FGE+ D R+        L R+  V   C  N  + RPT+++V  +
Sbjct  264   ERNFGELADQRLNGNYVEEELKRVIFVGLVCADNRPEKRPTMLEVVEL  311



>gb|KCW82429.1| hypothetical protein EUGRSUZ_C03826 [Eucalyptus grandis]
Length=383

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 110/313 (35%), Positives = 170/313 (54%), Gaps = 32/313 (10%)
 Frame = -1

Query  1326  FVCCKKKR---PAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGV  1156
             F+ CKKK     +    +D G   H         +T  E++ +TDGF+   ++G+G  G 
Sbjct  77    FIHCKKKGWRFCSASSSNDLGFSVHH--------FTFDELEKSTDGFSEANLLGEGGFGH  128

Query  1155  VYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGER  976
             VY GVL   G+ VAVKR     V S      F + +  +S   H ++V ++G+  A  ER
Sbjct  129   VYRGVLS-TGKDVAVKRLK---VGSGQGEREFLTEVEIISRVHHKHVVSLVGYCTAGSER  184

Query  975   IVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKA  796
             I+V E     +LEF+LH   +    L W  RL++A G A GL +LHEG  P+I+H  +KA
Sbjct  185   ILVYELVPNKTLEFHLHG--EGQPTLDWPTRLKIAFGAAEGLAYLHEGCDPNIIHRDIKA  242

Query  795   SNVLIDVEFSARLCDYGLYFLASNERQEV-------IGYVDEEYWVEGRGGSKESDVYGF  637
             +N+L+D EF A++ D+G+  + SN    V       IGY+D EY+   R  +++SDV+ F
Sbjct  243   TNILVDHEFKAKIADFGIAKVTSNANSHVSTNVKGSIGYLDPEYF-SSRNPTEKSDVFSF  301

Query  636   GVVLLELLSGRKSQEGLLVKWALP----LIKEMRFGEVLDPRIAIPCDINPLVRLAKVAS  469
             GVVL EL++GR+     LV W  P     +++  F  ++DP +    D + + R+ + A+
Sbjct  302   GVVLWELITGRRPVG--LVDWVRPQLTRYLEDGNFDSLVDPGLQ-NYDPDEMARMVQCAA  358

Query  468   ACVGNSRKSRPTI  430
             ACV  S + RP +
Sbjct  359   ACVHPSGERRPKM  371



>ref|XP_010097212.1| PTI1-like tyrosine-protein kinase [Morus notabilis]
 gb|EXB67279.1| PTI1-like tyrosine-protein kinase [Morus notabilis]
Length=369

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 153/288 (53%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+G  G VY G L  +G  +A KR     V SN A   FS 
Sbjct  26    FSLKELHAATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAAKRLK---VWSNKADMEFSV  81

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A   L W+RR+ +
Sbjct  82    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAECQLDWNRRMNI  141

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
               G A G+ +LH    PHI+H  +KASNVL+D  F A++ D+G   L        +   +
Sbjct  142   VIGSAEGIAYLHHHSTPHIIHRDIKASNVLLDSNFVAQVADFGFAKLIPDGATHVTTRVK  201

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SGRK  E L       +  WALPL  
Sbjct  202   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGRKPIEKLSATLKRTISDWALPLAC  260

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DP++      + L R+  V   C  +  + RPT+++V  +
Sbjct  261   EKKFEELADPKLNGSYVEDELKRVILVGLLCAHSRPEKRPTMLEVVEL  308



>ref|XP_008373969.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Malus 
domestica]
Length=376

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 155/288 (54%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHAATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNNADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    A  LL W+RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSAECLLDWTRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
               G A G+ +LH    PHI+H  +KASNVL+D +F A++ D+G   L        +   +
Sbjct  144   VIGSAEGVAYLHHHATPHIIHRDIKASNVLVDSDFQAQVADFGFAKLIPDGATHVTTRVK  203

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DVY FG++LLEL SG+K  E +       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ASESCDVYSFGILLLELASGKKPIEKVSATMKRTITDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             E +F E+ DP++      + L R+  VA  C  +  + R T+++   +
Sbjct  263   ERKFDEIADPKLNGKYVEDELKRVVFVALLCAHSQPERRLTMLEAVEL  310



>ref|XP_009787085.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Nicotiana sylvestris]
Length=462

 Score =   147 bits (372),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 175/320 (55%), Gaps = 28/320 (9%)
 Frame = -1

Query  1326  FVCCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             ++ CK +      +  +     K   +    +   +++AAT+GF+ ++++G+G  G+VY 
Sbjct  3     YLSCKAESSISISNSQKTHNQEKEKPIKIQEFNYRDLEAATNGFSDQKLLGRGSHGLVYK  62

Query  1146  GVLQPEGELVAVKRFH---PRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGER  976
             G+L+  G LVAVKR     PR    N       + +  LS    P LV ++G S    +R
Sbjct  63    GILR-NGRLVAVKRSSRGAPRFSTDNCNEV--ENEIDILSKLQSPRLVNLVGVSTDSHDR  119

Query  975   IVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKA  796
             ++V+E+    +L   LH N  +   + W RR+++A   A+ ++ LH  + P ++H  +K+
Sbjct  120   LLVVEFMSNGTLYDVLHSNSRS---ISWGRRIKLALQTAKAVDILHS-LSPPVIHRDIKS  175

Query  795   SNVLIDVEFSARLCDYGL--------YFLASNERQEVIGYVDEEYWVEGRGGSKESDVYG  640
             +NVLID  F+ARL D+GL        + L S      +GY+D  Y V     S ++DV+ 
Sbjct  176   ANVLIDRNFNARLGDFGLALRCHLDDFRLRSTPPAGTMGYLDPCY-VTPDNLSTKTDVFS  234

Query  639   FGVVLLELLSGRKSQEGL-----LVKWALPLIKEMRFGEVLDPRIAIPCDINPLVR--LA  481
             FG++LLE++SGRK+ + +     +V WA+PLIK  +   V DPRI  P D  PLVR  LA
Sbjct  235   FGILLLEIISGRKAIDVVYSPPSIVDWAIPLIKRGKLLAVYDPRIPPPKD--PLVRKQLA  292

Query  480   KVASACVGNSRKSRPTIVQV  421
              VA+ CV   R+ RPT+ +V
Sbjct  293   IVAAKCVRTCRERRPTMKEV  312



>gb|KDO48899.1| hypothetical protein CISIN_1g014904mg [Citrus sinensis]
Length=406

 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 104/297 (35%), Positives = 166/297 (56%), Gaps = 31/297 (10%)
 Frame = -1

Query  1248  LSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAG  1069
              S + +T  E+  ATDGF+   ++G+G  G V+ GVL P G+ VA+K+      L   +G
Sbjct  29    FSKSTFTYEELARATDGFSDANLLGQGGFGYVHRGVL-PNGKEVAIKQ------LKAGSG  81

Query  1068  FG---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALL  898
              G   F + +  +S   H +LV ++G+  A  +R++V E+    +LEF+LH        +
Sbjct  82    QGEREFQAEVEIISRVHHKHLVSLVGYYTAGSQRMLVYEFVPNNTLEFHLHGK--GRPTM  139

Query  897   HWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNER  718
              W  RL++A G A+GL +LHE   P I+H  +KA+N+L+D +F A++ D+GL  +AS+  
Sbjct  140   DWLTRLKIALGSAKGLAYLHEDCHPKIIHRDIKAANILLDFKFEAKVADFGLAKIASDVN  199

Query  717   QEV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-------QEGLLV  580
               V        GY+  EY   G+   K SDV+ FGV+LLEL++GR+         E  LV
Sbjct  200   THVSTRVMGTFGYLAPEYASSGKLTEK-SDVFSFGVMLLELITGRRPVDSTHTFVEDSLV  258

Query  579   KWALPL----IKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
              WA PL    I++  F  ++DP++    + N + R+   A+ACV +S + RP + Q+
Sbjct  259   DWARPLLNRAIEDGNFDTLVDPKLHNEYNHNEMARMVACAAACVRHSARRRPRMSQI  315



>ref|XP_008453980.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase-like 
protein ACR4 [Cucumis melo]
Length=921

 Score =   151 bits (382),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 165/292 (57%), Gaps = 21/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKR--FHPRLVLSNAAG  1069
             A  +T  E++ AT GF    I+GKG    V+ GVL+ +G +VAVKR    P +  ++   
Sbjct  508   AQMFTYEELERATCGFKEESIVGKGSFSCVFRGVLK-DGTVVAVKRAIMSPNVQKNSKE-  565

Query  1068  FGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHW  892
               F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L W
Sbjct  566   --FHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEFMAHGSLHQHLHGKNTALKEQLDW  623

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
              RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +   
Sbjct  624   IRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPTDSSS  683

Query  711   --------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWA  571
                      +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA
Sbjct  684   PLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWA  742

Query  570   LPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             +PLI+      +LDP +  P D   L R+A VA  CV    K RP++ +V  
Sbjct  743   VPLIRSGDISAILDPILKPPSDTEALKRIANVACKCVRMRAKERPSMDKVTT  794



>ref|XP_004152097.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Cucumis sativus]
 ref|XP_004156935.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Cucumis sativus]
 gb|KGN53088.1| hypothetical protein Csa_4G015780 [Cucumis sativus]
Length=921

 Score =   151 bits (382),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 165/292 (57%), Gaps = 21/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKR--FHPRLVLSNAAG  1069
             A  +T  E++ AT GF    I+GKG    V+ GVL+ +G +VAVKR    P +  ++   
Sbjct  508   AQMFTYEELERATCGFKEESIVGKGSFSCVFRGVLK-DGTVVAVKRAIMSPNMQKNSKE-  565

Query  1068  FGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHW  892
               F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +N      L W
Sbjct  566   --FHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEFMAHGSLHQHLHGKNTALKEQLDW  623

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
              RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +   
Sbjct  624   IRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPTDSSS  683

Query  711   --------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWA  571
                      +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA
Sbjct  684   PLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWA  742

Query  570   LPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             +PLI+      +LDP +  P D   L R+A VA  CV    K RP++ +V  
Sbjct  743   VPLIRSGDISAILDPILKPPSDAEALKRIANVACKCVRMRAKERPSMDKVTT  794



>ref|XP_010479762.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Camelina sativa]
 ref|XP_010479763.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Camelina sativa]
Length=353

 Score =   145 bits (366),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 157/291 (54%), Gaps = 23/291 (8%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       S+     F+ 
Sbjct  28    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSSREEITFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    + +LL W+RR+ +
Sbjct  84    EVEILARIRHKNLLSVRGYCAEGQERLIVYDYMPNLSLVSHLHGQHSSDSLLDWTRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNE---------  721
             A   A+ + +LH    P IVHG V+ASNVL+D EF AR+ D+G   +  ++         
Sbjct  144   AVTSAQAIAYLHHFATPRIVHGDVRASNVLLDSEFEARVTDFGYGKMMPDDAGDGGNKIT  203

Query  720   RQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK--------SQEGLLVKWALP  565
             +   IGY+  E    G+    E DVY FGVVLLEL++G++        +++G + +W LP
Sbjct  204   KGNNIGYLSPECIESGKESDME-DVYSFGVVLLELVTGKRPIERASLTTKQG-ITEWVLP  261

Query  564   LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             L+ E +FGE++D R+      + L R+  +   C     + RPT+ +V  +
Sbjct  262   LVYERKFGEIVDHRLNGKYVEDELKRVVLIGLICAQKEPEKRPTMSEVVEM  312



>ref|XP_007052432.1| Serine/threonine-protein kinase protein [Theobroma cacao]
 gb|EOX96589.1| Serine/threonine-protein kinase protein [Theobroma cacao]
Length=478

 Score =   147 bits (372),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 110/282 (39%), Positives = 166/282 (59%), Gaps = 26/282 (9%)
 Frame = -1

Query  1221  EMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRW  1042
             +++AAT+GF+ +R++GKG  G VY  V++  G  VA+K+   R   +N       + +  
Sbjct  46    DLEAATNGFSDQRLLGKGSHGCVYKAVIR--GRHVAIKKPSSRNQETNPEA---DNEIEI  100

Query  1041  LSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagv  862
             LS    P LV +LGF+    +R++V+E+    +L   LH N  ++  L+W RR+R+A  V
Sbjct  101   LSKIQSPRLVNLLGFTNGTKDRLLVVEFMSNGTLYDVLHSN--SSRPLYWGRRIRLALQV  158

Query  861   argLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGL--------YFLASNERQEVI  706
             A+ LE LH    P I+H  VK++NVLID  F+ARL D+GL        Y L S      I
Sbjct  159   AKALETLHS-QKPPIIHRDVKSANVLIDRNFNARLGDFGLALRCGVDDYRLRSTPPAGTI  217

Query  705   GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQE-----GLLVKWALPLIKEMRFG  541
             GY+D  Y V     S ++DV+ FG++LLE++SGRK+ +       +V WA+PL+K+ +  
Sbjct  218   GYLDPCY-VTPDNLSTKTDVFSFGILLLEIISGRKAIDVAHSPPSIVDWAIPLVKKGKIV  276

Query  540   EVLDPRIAIPCDINPLVR--LAKVASACVGNSRKSRPTIVQV  421
              V DPRIA P D  P+VR  LA +A+ CV + R+ RP + +V
Sbjct  277   AVYDPRIAPPKD--PIVRKQLAVIAAKCVRSYRERRPAMKEV  316



>gb|KDO48900.1| hypothetical protein CISIN_1g014904mg [Citrus sinensis]
Length=416

 Score =   146 bits (369),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 104/297 (35%), Positives = 166/297 (56%), Gaps = 31/297 (10%)
 Frame = -1

Query  1248  LSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAG  1069
              S + +T  E+  ATDGF+   ++G+G  G V+ GVL P G+ VA+K+      L   +G
Sbjct  29    FSKSTFTYEELARATDGFSDANLLGQGGFGYVHRGVL-PNGKEVAIKQ------LKAGSG  81

Query  1068  FG---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALL  898
              G   F + +  +S   H +LV ++G+  A  +R++V E+    +LEF+LH        +
Sbjct  82    QGEREFQAEVEIISRVHHKHLVSLVGYYTAGSQRMLVYEFVPNNTLEFHLHGK--GRPTM  139

Query  897   HWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNER  718
              W  RL++A G A+GL +LHE   P I+H  +KA+N+L+D +F A++ D+GL  +AS+  
Sbjct  140   DWLTRLKIALGSAKGLAYLHEDCHPKIIHRDIKAANILLDFKFEAKVADFGLAKIASDVN  199

Query  717   QEV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-------QEGLLV  580
               V        GY+  EY   G+   K SDV+ FGV+LLEL++GR+         E  LV
Sbjct  200   THVSTRVMGTFGYLAPEYASSGKLTEK-SDVFSFGVMLLELITGRRPVDSTHTFVEDSLV  258

Query  579   KWALPL----IKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
              WA PL    I++  F  ++DP++    + N + R+   A+ACV +S + RP + Q+
Sbjct  259   DWARPLLNRAIEDGNFDTLVDPKLHNEYNHNEMARMVACAAACVRHSARRRPRMSQI  315



>ref|XP_003564375.1| PREDICTED: serine/threonine-protein kinase At3g07070-like [Brachypodium 
distachyon]
Length=471

 Score =   147 bits (371),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 155/288 (54%), Gaps = 20/288 (7%)
 Frame = -1

Query  1230  TLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSSV  1051
             T  E+  ATD F+   ++G+G  G VY G L+   E++AVK+        N     F   
Sbjct  130   TFRELSNATDMFSCNNLLGEGGFGRVYKGHLKDTNEVIAVKQLDKEGFQGNRE---FLVE  186

Query  1050  LRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrva  871
             +  LSL  +PNLV ++G+S    +RI+V EY    SLE +L   P  A  L W  R+++ 
Sbjct  187   VLMLSLVRNPNLVKLIGYSTDLDQRILVYEYMQNGSLEDHLLDLPPNAVGLPWQTRMKIV  246

Query  870   agvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLA--------SNERQ  715
              G A+G+E+LHE   P +++  +KASN+L+D +F+ +L D+GL  L         S    
Sbjct  247   VGAAKGIEYLHEVANPPVIYRDLKASNILLDQDFNPKLSDFGLAKLGPVGDNSHVSTRVM  306

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-------SQEGLLVKWALPLIK  556
                GY   EY + G+  +K SD+Y FGVVLLEL++GR+       ++E +LV WA PLIK
Sbjct  307   GTYGYCAPEYAMTGK-LTKMSDIYSFGVVLLELITGRRAIDTSKPTEEQILVHWAAPLIK  365

Query  555   E-MRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             +  RF  + DP +     +  L +   +AS C+     SRP I  V A
Sbjct  366   DRQRFVRLADPLLEKKYPVKGLYQALAIASMCIQEEASSRPKIGDVVA  413



>emb|CDP04377.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   145 bits (367),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 109/313 (35%), Positives = 167/313 (53%), Gaps = 25/313 (8%)
 Frame = -1

Query  1311  KKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQP  1132
             K+R   ED     I  +   K++A  +T  E+ AATD FN   ++G+G  G VY G L+ 
Sbjct  43    KQRTVAED-----ILRYGHVKVAAEVFTFRELAAATDNFNSELLVGEGGFGRVYMGRLKK  97

Query  1131  EGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGG  952
               ++VAVK+     +  N     F + +  LSL  HPNLV ++G+     +RI+V EY  
Sbjct  98    TDQVVAVKQLDRNGLQGNRE---FLAEVLTLSLVHHPNLVNLIGYCADGRQRILVYEYMR  154

Query  951   MLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVE  772
               SLE +L   P     L W  R+++A G A+GLE+LH+   P I++  +KASN+L+D E
Sbjct  155   NGSLEDHLFDIPPHKKPLDWFTRMKIAKGAAQGLEYLHDTANPQIIYRDLKASNILLDDE  214

Query  771   FSARLCDYGLYFLASNERQEVI--------GYVDEEYWVEGRGGSKESDVYGFGVVLLEL  616
             F+ +L D+GL  L     ++ +        GY   EY + G+  +K SD+Y FGVVLLE+
Sbjct  215   FNPKLSDFGLAKLGPTGDKDHVSTRVMGTYGYCAPEYAMTGQLTTK-SDIYSFGVVLLEI  273

Query  615   LSGRK-------SQEGLLVKWALPLIKEMR-FGEVLDPRIAIPCDINPLVRLAKVASACV  460
             ++GR+       + E  L+ WA P  K+ R F  + DP +     +  L +   VA+ C+
Sbjct  274   ITGRRAIDNTRPTAEQNLISWAKPYFKDRRQFTFLADPLLEGDYPVKCLHQAVAVAAMCL  333

Query  459   GNSRKSRPTIVQV  421
              +   +RP I  V
Sbjct  334   QDEASTRPFIGDV  346



>ref|XP_001754560.1| predicted protein [Physcomitrella patens]
 gb|EDQ80530.1| predicted protein [Physcomitrella patens]
Length=893

 Score =   150 bits (380),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 167/294 (57%), Gaps = 21/294 (7%)
 Frame = -1

Query  1251  KLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAA  1072
             K+ A ++T  E+D AT GF     IG+G    VY G L  +G LVAVKR  P +  SN  
Sbjct  484   KVRAKSFTYKELDDATKGFAEECEIGRGSFSCVYKGDLG-DGRLVAVKR--PAIPASNQQ  540

Query  1071  GFG---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAAL  901
              +    F++ +  LS  +H +L+ ++G+     ER++V EY  M +   + H +      
Sbjct  541   SYNLQDFNNEIDLLSRLNHAHLLNLIGYCNEGSERLLVYEY--MENGTLFEHLHGSETEQ  598

Query  900   LHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNE  721
             L W  R+++A   ARGLE+LH    P ++H  +K++N+L+D  ++AR+ D+GL  L  ++
Sbjct  599   LSWVTRVKIAVQAARGLEYLHGYACPPVIHRDIKSANILLDGGYNARVADFGLSLLGPSD  658

Query  720   RQE--------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS----QEGLLVK  577
                         +GY+D EY+      +K SDVY FGV+L+E+L+G+ +    ++  LV+
Sbjct  659   SSRPLSELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLIEILTGKMAIDEYEDENLVE  717

Query  576   WALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             WA+PLIK+     +LDPR+  P D   L+R+A+VA+ CV    K RP++ +V  
Sbjct  718   WAVPLIKKGEIMSILDPRLQHPADPEGLLRIARVAARCVRMRGKDRPSMDRVTT  771



>ref|XP_003540697.2| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Glycine max]
Length=946

 Score =   150 bits (380),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 165/292 (57%), Gaps = 21/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKR--FHPRLVLSNAAG  1069
             A  +T  E++ AT GF    I+GKG    V+ GVL+ +G +VAVKR    P +  ++   
Sbjct  532   AQTFTYEELETATSGFKEESIVGKGSFSCVFKGVLK-DGTVVAVKRAIVSPNMQKNSKE-  589

Query  1068  FGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHW  892
               F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH  N      L W
Sbjct  590   --FHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEFMAHGSLHQHLHATNQVLREQLDW  647

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
              RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +   
Sbjct  648   IRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPADSGS  707

Query  711   --------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWA  571
                      +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA
Sbjct  708   PLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWA  766

Query  570   LPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             +PLIK      +LDP +  P D+  L R+A VA  CV    K RP++ +V  
Sbjct  767   VPLIKSGDITAILDPVLKPPPDLEALKRIANVACKCVRMRGKERPSMDKVTT  818



>ref|XP_006299975.1| hypothetical protein CARUB_v10016188mg [Capsella rubella]
 gb|EOA32873.1| hypothetical protein CARUB_v10016188mg [Capsella rubella]
Length=776

 Score =   150 bits (379),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 109/301 (36%), Positives = 164/301 (54%), Gaps = 27/301 (9%)
 Frame = -1

Query  1305  RPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEG  1126
             +P +E +  E I    +    A  + L E+  AT+GF     +G+G  G VY  VL  +G
Sbjct  485   KPDLETEPLEHISPAPSVTPFAQVFRLSELKDATNGFKEFNELGRGSYGFVYKAVLA-DG  543

Query  1125  ELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGML  946
               VAVKR +   ++ +     F + L  L    H N+V +LG+S   GER++V EY    
Sbjct  544   RQVAVKRANAATII-HTNTREFETELEILCNIRHCNIVNLLGYSTEMGERLLVYEYMPHG  602

Query  945   SLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFS  766
             +L  +LH      + L+WS R+++A   A+GLE+LH    P IVHG VK+SNVL+D ++ 
Sbjct  603   TLHDHLHG---GFSPLNWSIRMKIAMQTAKGLEYLHNEAEPRIVHGDVKSSNVLLDSDWV  659

Query  765   ARLCDYGLYFLASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQE--  592
             AR+ D+GL   +SNE+   I                  DVY FGVVLLE+L+GRK  +  
Sbjct  660   ARVADFGL-VTSSNEKNLDI----------------RRDVYDFGVVLLEILTGRKRHDRD  702

Query  591   ---GLLVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
                  +V W  P+I+E +   +LD  IA+P ++ PL++LA +A  CV +    RPT+ ++
Sbjct  703   CDPPEIVNWTAPVIREGKGAGILDKYIALPRNVEPLLKLADMAELCVRDDPNQRPTMSEL  762

Query  420   A  418
             A
Sbjct  763   A  763



>ref|XP_006392910.1| hypothetical protein EUTSA_v10011602mg [Eutrema salsugineum]
 gb|ESQ30196.1| hypothetical protein EUTSA_v10011602mg [Eutrema salsugineum]
Length=360

 Score =   145 bits (365),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 155/291 (53%), Gaps = 22/291 (8%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ AAT+ FN    +G+GR G VY G L  +G  +AVKR       S+     F+ 
Sbjct  28    FSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW-DGSQIAVKRLK---AWSSREEIDFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V EY   LSL  +LH    + +LL W+RR+ +
Sbjct  84    EVEILARIRHNNLLSVRGYCAEGQERLIVYEYMPNLSLVSHLHGLHSSESLLDWTRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ-------  715
             A   A+ + +LH    P IVHG V+ASNVL+D EF AR+ D+G   L + + +       
Sbjct  144   AVTSAQAIAYLHHHATPRIVHGDVRASNVLLDSEFEARVTDFGYGKLMAEDAENGVTKTT  203

Query  714   ---EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALP  565
                + +GY+  E  +E    S   DVY FG+VLLEL++G++  E L       + +W LP
Sbjct  204   TKGKDLGYLSPEC-IESGKESDMGDVYSFGIVLLELVTGKRPIEKLNQTTKQGITEWVLP  262

Query  564   LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             L+ E +FGE++D R+        L R+  V   C  +  + RPT+ +   +
Sbjct  263   LVYERKFGEIVDQRLDGKYVEEELKRVVLVGLMCAQSEPEKRPTMSEAVEM  313



>ref|XP_002519541.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF42955.1| ATP binding protein, putative [Ricinus communis]
Length=765

 Score =   150 bits (378),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 106/282 (38%), Positives = 161/282 (57%), Gaps = 28/282 (10%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVL-SNAAGF  1066
             A  + L E+  AT+GF     +G+G  G VY  VL  +G  VAVKR +   ++ SN+  F
Sbjct  496   AQVFRLSELKDATNGFKEFNELGRGSYGFVYKAVLA-DGRQVAVKRANAATIIHSNSRDF  554

Query  1065  GFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSr  886
                  L  L  A H N+V +LG+    GER++V EY    +L  +LH      + L+WS 
Sbjct  555   EME--LEVLCNARHCNIVNLLGYCAEMGERLLVYEYMPHGTLHDHLHS---GLSPLNWSL  609

Query  885   rlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEVI  706
             RL+V+  VA+GLE+LH+   P IVH  VK SN+L+D E+ AR+ D+GL  + SNE+    
Sbjct  610   RLKVSMQVAKGLEYLHKEAEPPIVHRNVKTSNILLDTEWGARIADFGL--ITSNEKDFC-  666

Query  705   GYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQE-----GLLVKWALPLIKEMRFG  541
                          G  ++DVY FG+VLLE+LSGRK+ +       +V+WA+PLI++ +  
Sbjct  667   -------------GDMKTDVYDFGIVLLEILSGRKAYDRDHTPPSIVEWAVPLIRQGKGA  713

Query  540   EVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
              ++D  +A+P ++ PL++L+ +A   V    K RPT+  +A 
Sbjct  714   AIIDEDVALPKNVEPLLKLSDIAELAVKEDPKDRPTMSDLAT  755



>ref|XP_010907662.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X2 [Elaeis guineensis]
Length=406

 Score =   146 bits (368),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 108/295 (37%), Positives = 155/295 (53%), Gaps = 20/295 (7%)
 Frame = -1

Query  1257  AAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSN  1078
              + +SA  +T  E+ AAT  F P   +G+G  G VY G L+  G++VAVK+     +  N
Sbjct  8     GSNISAHTFTFRELAAATKNFRPECFLGEGGFGRVYKGHLESTGQVVAVKQLDRNGLQGN  67

Query  1077  AAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALL  898
                  F   +  LSL  HPNLV ++G+     +R++V EY  + SLE +LH  P     L
Sbjct  68    RE---FLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPGKEPL  124

Query  897   HWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLA----  730
              W+ R+++AAG A+GLE+LH+   P +++   K+SN+L+D  F  +L D+GL  L     
Sbjct  125   DWNTRMKIAAGAAKGLEYLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPVGD  184

Query  729   ----SNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-------QEGLL  583
                 S       GY   EY + G+   K SDVY FGVVLLEL++GRK+        E  L
Sbjct  185   KSHVSTRVMGTYGYCAPEYAMTGQLTVK-SDVYSFGVVLLELITGRKAIDSTRAHGEQNL  243

Query  582   VKWALPLIKEMR-FGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             V WA P+  + R   +V DP++        L +   VAS C+     SRP I  V
Sbjct  244   VSWARPMFNDRRKLPKVADPKLQGRYPTRGLYQALAVASMCIQEEAASRPLIADV  298



>ref|NP_001046121.1| Os02g0186500 [Oryza sativa Japonica Group]
 dbj|BAD15416.1| receptor protein kinase PERK1-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD15446.1| receptor protein kinase PERK1-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF08035.1| Os02g0186500 [Oryza sativa Japonica Group]
 dbj|BAG90735.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93882.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72639.1| hypothetical protein OsI_06147 [Oryza sativa Indica Group]
Length=377

 Score =   145 bits (366),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 155/288 (54%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR       SN A   F+ 
Sbjct  29    FSLKELQSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLKS---WSNKAETEFAI  84

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H +L+ + G+     ER++V +Y   LSL  +LH    A   L W RR+++
Sbjct  85    EVEVLATVRHKSLLSLRGYCAEGQERLIVYDYMPNLSLHSHLHGQHAAECHLGWERRMKI  144

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL-------ASNERQ  715
             A   A G+ +LH    PHI+H  +K+SNVL+D  F AR+ D+G   L        + + +
Sbjct  145   AIDSAEGIAYLHHQATPHIIHRDIKSSNVLLDKNFQARVADFGFAKLIPDGATHVTTKVK  204

Query  714   EVIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  S+  DV+ FGV+LLEL SG++  E L       + +WALPL +
Sbjct  205   GTLGYLAPEYAMLGK-ASESCDVFSFGVLLLELASGKRPVEKLNPTTKLTITEWALPLAR  263

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
             + +F E+ DP++        L R+  V  AC  N ++ RP + +V  +
Sbjct  264   DKKFKEIADPKLKDVFVEAELKRMVLVGLACSQNKQEQRPIMSEVVEL  311



>gb|AFK40964.1| unknown [Lotus japonicus]
Length=366

 Score =   145 bits (365),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 154/288 (53%), Gaps = 19/288 (7%)
 Frame = -1

Query  1233  YTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSS  1054
             ++L E+ +AT+ FN    +G+G  G VY G L  +G  +AVKR     V SN A   F+ 
Sbjct  28    FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLW-DGSQIAVKRLK---VWSNKADMEFAV  83

Query  1053  VLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrv  874
              +  L+   H NL+ + G+     ER++V +Y   LSL  +LH    +  LL W+RR+ +
Sbjct  84    EVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSSECLLDWNRRMNI  143

Query  873   aagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQEV-----  709
             A G A G+ +LH    PHI+H  +KASNVL+D +F AR+ D+G   L  +    V     
Sbjct  144   AIGSAEGIVYLHHQATPHIIHRDIKASNVLLDSDFQARVADFGFAKLIPDGATHVTTRVK  203

Query  708   --IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKSQEGL-------LVKWALPLIK  556
               +GY+  EY + G+  ++  DV+ FG++LLEL SG+K  E L       +  WALPL  
Sbjct  204   GTLGYLAPEYAMLGK-ANECCDVFSFGILLLELASGKKPLEKLSSTVKRSINDWALPLAC  262

Query  555   EMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAAI  412
               +F E  DPR+        L R+  VA  C  +    RPT+++V  +
Sbjct  263   AKKFTEFADPRLNGEYVEEELKRIVLVALICAQSQPDKRPTMIEVVEL  310



>ref|XP_011092892.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Sesamum indicum]
 ref|XP_011092893.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Sesamum indicum]
 ref|XP_011092894.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Sesamum indicum]
Length=908

 Score =   150 bits (380),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 171/292 (59%), Gaps = 21/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRF--HPRLVLSNAAG  1069
             A  +T  E++ AT+GF    ++G G    V+ GVL+ +G +VAVKR    P L  ++   
Sbjct  495   ARKFTYQELERATEGFKEESVVGTGSFSCVFKGVLK-DGTIVAVKRAIGSPDLKKNSKE-  552

Query  1068  FGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHW  892
               F + L  LS  +H +L+ +LG+ E  GE ++V E+    SL  +LH +N +    L W
Sbjct  553   --FQTELDLLSRLNHAHLLNLLGYCEEGGEMLLVYEFMANGSLHQHLHGKNKELKEQLDW  610

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFL----ASN  724
              +R+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L    +S+
Sbjct  611   VKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVNSSS  670

Query  723   ERQEV----IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWA  571
                E+    +GY+D EY+      +K SDVY FGV+LLE+LSGRK+     +EG +V+WA
Sbjct  671   PLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSGRKAIDMQCEEGNIVEWA  729

Query  570   LPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             +PLIK      +LDP +  P D+  L R+A +AS CV    K RP++ +V  
Sbjct  730   VPLIKAGDIEAILDPALKHPSDLEALKRIANIASKCVRMRGKERPSMDKVTT  781



>gb|KCW52764.1| hypothetical protein EUGRSUZ_J02110 [Eucalyptus grandis]
Length=361

 Score =   145 bits (365),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 159/296 (54%), Gaps = 20/296 (7%)
 Frame = -1

Query  1260  KAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLS  1081
             KA    A  +T  +++AAT  F P   +G+G  G VY G L+   + VA+K+     V  
Sbjct  16    KANGKRARTFTFSQLEAATGNFRPDCFVGEGGFGKVYKGHLEGTDQAVAIKQLDQNGVQG  75

Query  1080  NAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAAL  901
                   F   +  LSL DHPNLV ++GF     +R++V EY  + SLE +LH  P     
Sbjct  76    TKE---FLVEVTMLSLVDHPNLVKLIGFCAERDQRLLVYEYMPLGSLETHLHDLPPTRKG  132

Query  900   LHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLA-SN  724
             L W+ R+++AAG A+GLE+LH+ + P I++  +K SN+L+  E+  +L D+GL  +  S 
Sbjct  133   LDWNMRMKIAAGAAKGLEYLHDKLKPPIIYRDLKCSNILLGDEYHPKLSDFGLAKVGPSG  192

Query  723   ERQEV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-------SQEGL  586
             +R  V        GY   +Y + G+   K SD+Y FGVVLLEL++GRK       S++  
Sbjct  193   DRTHVSTRVMGTYGYCAPDYAMTGQLTFK-SDIYSFGVVLLELITGRKAFDPMKESKDQY  251

Query  585   LVKWALPLIKE-MRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             LV WA PL ++  +F ++ DP +     +  L +   +A+ CV      RP I  V
Sbjct  252   LVAWARPLFRDRKKFSQMADPTLEGRYPVRGLYQALAIAAMCVQEQPTMRPVIGDV  307



>ref|XP_002309807.2| epidermal differentiation family protein [Populus trichocarpa]
 gb|EEE90257.2| epidermal differentiation family protein [Populus trichocarpa]
Length=906

 Score =   150 bits (379),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 164/292 (56%), Gaps = 21/292 (7%)
 Frame = -1

Query  1242  AAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAGFG  1063
             A  +T  E++ AT GF    I+GKG    VY GVL+  G +VAVK+    +V ++     
Sbjct  493   ARMFTYEELEGATSGFKEESIVGKGSFSCVYKGVLK-NGTVVAVKK---AIVCTDKQKNS  548

Query  1062  --FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLH-QNPDAAALLHW  892
               F + L  LS  +H +L+ +LG+ E  GER++V E+    SL  +LH +NP     L W
Sbjct  549   KEFHTELDLLSRLNHAHLLNLLGYCEEGGERLLVYEFMAHGSLYQHLHGKNPALIEQLDW  608

Query  891   SrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQE  712
              RR+ +A   ARG+E+LH    P ++H  +K+SN+LID E +AR+ D+GL  L   +   
Sbjct  609   VRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVSDFGLSLLGPADSSS  668

Query  711   --------VIGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-----QEGLLVKWA  571
                      +GY+D EY+      +K SDVY FGV+LLE+LS RK+     +EG +V+WA
Sbjct  669   PLAELPAGTLGYLDPEYYRLHYLTTK-SDVYSFGVLLLEILSSRKAIDMQYEEGNIVEWA  727

Query  570   LPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQVAA  415
             +PLIK      +LDP +  P D   L R+A VA  CV    K RP++ +V  
Sbjct  728   VPLIKAGDISAILDPALKPPSDPEALKRIANVACKCVRMRGKERPSMDKVTT  779



>ref|XP_009380552.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Musa 
acuminata subsp. malaccensis]
Length=643

 Score =   148 bits (374),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 105/297 (35%), Positives = 169/297 (57%), Gaps = 31/297 (10%)
 Frame = -1

Query  1248  LSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNAAG  1069
              S + +T  E+  ATDGF+   ++G+G  G V+ GVL P G+ VAVK+      L   +G
Sbjct  258   FSKSTFTYEELAMATDGFSDANLLGQGGFGYVHRGVL-PNGKEVAVKQ------LKTGSG  310

Query  1068  FG---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALL  898
              G   F + +  +S   H +LV ++G+  + G+R++V EY    +LEF+LH        +
Sbjct  311   QGEREFQAEVETISRVHHKHLVSLVGYCISGGKRLLVYEYVPNNTLEFHLHGR--GRPTM  368

Query  897   HWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNER  718
              W  RLR+A G A+GL +LHE   P I+H  +KA+N+L+D +F A++ D+GL   AS+  
Sbjct  369   EWPTRLRIALGSAKGLAYLHEDCHPKIIHRDIKAANILLDYKFVAKVADFGLAKFASDNN  428

Query  717   QEV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK----SQ---EGLLV  580
               V        GY+  EY   G+   K SDV+ FG++LLEL++GR+    SQ   +  LV
Sbjct  429   THVSTRVMGTFGYLAPEYASSGKLTDK-SDVFSFGIMLLELITGRRPVDSSQTFMDDSLV  487

Query  579   KWALPL----IKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
              WA PL    +++  +  ++DP++ +  + N + R+   A+ACV +S + RP + Q+
Sbjct  488   DWARPLLTRALEDGNYDALVDPKLGMNYNPNEMARMIACAAACVRHSSRRRPRMSQI  544



>ref|XP_002453424.1| hypothetical protein SORBIDRAFT_04g005810 [Sorghum bicolor]
 gb|EES06400.1| hypothetical protein SORBIDRAFT_04g005810 [Sorghum bicolor]
Length=374

 Score =   145 bits (365),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 104/317 (33%), Positives = 163/317 (51%), Gaps = 25/317 (8%)
 Frame = -1

Query  1320  CCKKKRPAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGV  1141
             CCK+       D  E     K    +   ++L E+ +AT+ FN    +G+G  G VY G 
Sbjct  8     CCKRS------DGAEPGRRKKKKDTTWRIFSLKELQSATNNFNYDNKLGEGGFGSVYWGQ  61

Query  1140  LQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVME  961
             L  +G  +AVKR       SN A   F+  +  L+   H +L+ + G+     ER++V +
Sbjct  62    LW-DGSQIAVKRLKS---WSNKAEREFAVEVEILARVRHKSLLSLRGYCAEGQERLIVYD  117

Query  960   YGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLI  781
             Y   LS+   LH    A   L W RR+++A   A G+ +LH    PHI+H  VKASNVL+
Sbjct  118   YMPNLSIHSQLHGQHAAECNLSWERRMKIAVDSAEGIAYLHHYATPHIIHRDVKASNVLL  177

Query  780   DVEFSARLCDYGLYFL-------ASNERQEVIGYVDEEYWVEGRGGSKESDVYGFGVVLL  622
             D  F AR+ D+G   L        + + +  +GY+  EY + G+  S+  DV+ FG++LL
Sbjct  178   DSNFQARVADFGFAKLIPDGATHVTTKVKGTLGYLAPEYAMLGK-ASESCDVFSFGIMLL  236

Query  621   ELLSGRKSQEGL-------LVKWALPLIKEMRFGEVLDPRIAIPCDINPLVRLAKVASAC  463
             EL SG+K  E L       + +WALPL+++ +F E+ DP++      + L R+  V  AC
Sbjct  237   ELASGKKPVEKLNPTTKKTITEWALPLVRDKKFKEIADPKLKDSFVEDELKRMVLVGIAC  296

Query  462   VGNSRKSRPTIVQVAAI  412
               +  + RP + +V  +
Sbjct  297   SQDKPEQRPIMSEVVEL  313



>ref|XP_010049677.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X2 [Eucalyptus grandis]
Length=532

 Score =   147 bits (371),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 110/315 (35%), Positives = 170/315 (54%), Gaps = 31/315 (10%)
 Frame = -1

Query  1317  CKKKR---PAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYS  1147
             CKKK     +    +D G+  H         +    ++ +T+GF+   ++G+G  G VY 
Sbjct  133   CKKKGWWLCSTSSSNDLGVSGHH--------FPFDALEKSTNGFSGANLLGEGSFGHVYR  184

Query  1146  GVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVV  967
             GVL   G+ VAVKR     V S      F + +  +S   H ++V ++G+     ERI+V
Sbjct  185   GVLS-SGKDVAVKRLK---VGSVQGEREFLTEVEIISRVHHKHVVSLVGYCTTGSERILV  240

Query  966   MEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNV  787
              E     +LEF+LH   +    L+W  RL++A+G A GL +LHEG  P+IVH  +KA+N+
Sbjct  241   YELVPNKTLEFHLHG--EGQPTLNWPTRLKIASGAAEGLAYLHEGCDPNIVHRDIKATNI  298

Query  786   LIDVEFSARLCDYGLYFLASNERQEV-------IGYVDEEYWVEGRGGSKESDVYGFGVV  628
             L+D EF A++ D+GL    S+E   V        GY+D EY + G    K SDVY FGVV
Sbjct  299   LVDCEFEAKIADFGLAKFTSDENSHVSTNVKGTFGYLDPEYILSGNPTGK-SDVYSFGVV  357

Query  627   LLELLSGRKS--QEGLLVKWALP----LIKEMRFGEVLDPRIAIPCDINPLVRLAKVASA  466
             LLEL++GR++   +  LV WA P     +++  F  ++DPR+      + + R+   A+A
Sbjct  358   LLELITGRRAVDMDVSLVNWARPQLTRYLEDGNFDSLVDPRLQNDYKHDEMARMVACAAA  417

Query  465   CVGNSRKSRPTIVQV  421
             CV +S   RP + ++
Sbjct  418   CVCHSLGHRPKMSKI  432



>ref|XP_010051588.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Eucalyptus 
grandis]
 gb|KCW82428.1| hypothetical protein EUGRSUZ_C03826 [Eucalyptus grandis]
Length=492

 Score =   147 bits (370),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 110/316 (35%), Positives = 172/316 (54%), Gaps = 32/316 (10%)
 Frame = -1

Query  1326  FVCCKKKR---PAVEDDDDEGIGCHKAAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGV  1156
             F+ CKKK     +    +D G   H         +T  E++ +TDGF+   ++G+G  G 
Sbjct  77    FIHCKKKGWRFCSASSSNDLGFSVHH--------FTFDELEKSTDGFSEANLLGEGGFGH  128

Query  1155  VYSGVLQPEGELVAVKRFHPRLVLSNAAGFGFSSVLRWLSLADHPNLVPILGFSEAPGER  976
             VY GVL   G+ VAVKR     V S      F + +  +S   H ++V ++G+  A  ER
Sbjct  129   VYRGVLS-TGKDVAVKRLK---VGSGQGEREFLTEVEIISRVHHKHVVSLVGYCTAGSER  184

Query  975   IVVMEYGGMLSLEFYLHQNPDAAALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKA  796
             I+V E     +LEF+LH   +    L W  RL++A G A GL +LHEG  P+I+H  +KA
Sbjct  185   ILVYELVPNKTLEFHLHG--EGQPTLDWPTRLKIAFGAAEGLAYLHEGCDPNIIHRDIKA  242

Query  795   SNVLIDVEFSARLCDYGLYFLASNERQEV-------IGYVDEEYWVEGRGGSKESDVYGF  637
             +N+L+D EF A++ D+G+  + SN    V       IGY+D EY+   R  +++SDV+ F
Sbjct  243   TNILVDHEFKAKIADFGIAKVTSNANSHVSTNVKGSIGYLDPEYF-SSRNPTEKSDVFSF  301

Query  636   GVVLLELLSGRKSQEGLLVKWALP----LIKEMRFGEVLDPRIAIPCDINPLVRLAKVAS  469
             GVVL EL++GR+     LV W  P     +++  F  ++DP +    D + + R+ + A+
Sbjct  302   GVVLWELITGRRPVG--LVDWVRPQLTRYLEDGNFDSLVDPGLQN-YDPDEMARMVQCAA  358

Query  468   ACVGNSRKSRPTIVQV  421
             ACV  S + RP + ++
Sbjct  359   ACVHPSGERRPKMSKI  374



>ref|NP_001119030.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
 gb|AEE84561.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
Length=562

 Score =   147 bits (372),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 102/293 (35%), Positives = 158/293 (54%), Gaps = 18/293 (6%)
 Frame = -1

Query  1254  AKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSNA  1075
             + ++A+ YT+  +  AT+ F+   IIG+G LG VY     P G+++A+K+      LS  
Sbjct  235   SPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEF-PNGKIMAIKKID-NAALSLQ  292

Query  1074  AGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALLH  895
                 F   +  +S   HPN+VP+ G+    G+R++V EY G  +L+  LH N D +  L 
Sbjct  293   EEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDTLHTNDDRSMNLT  352

Query  894   WSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNERQ  715
             W+ R++VA G A+ LE+LHE  +P IVH   K++N+L+D E +  L D GL  L  N  +
Sbjct  353   WNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAALTPNTER  412

Query  714   EV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK-------SQEGLLVK  577
             +V        GY   E+ + G    K SDVY FGVV+LELL+GRK         E  LV+
Sbjct  413   QVSTQVVGSFGYSAPEFALSGIYTVK-SDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVR  471

Query  576   WALPLIKEMR-FGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             WA P + ++    +++DP +        L R A + + C+    + RP + +V
Sbjct  472   WATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEV  524



>ref|XP_006654162.1| PREDICTED: proline-rich receptor-like protein kinase PERK1-like 
[Oryza brachyantha]
Length=444

 Score =   146 bits (368),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 102/297 (34%), Positives = 167/297 (56%), Gaps = 25/297 (8%)
 Frame = -1

Query  1257  AAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSN  1078
             A   S + +T  E+  ATDGF+   ++G+G  G V+ GVL P G+ +AVK+     V S 
Sbjct  48    ALGFSKSTFTYEELLRATDGFSDANLLGQGGFGYVHRGVL-PTGKEIAVKQLK---VGSG  103

Query  1077  AAGFGFSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAAALL  898
                  F + +  +S   H +LV ++G+  + G+R++V E+    +LEF+LH        +
Sbjct  104   QGEREFQAEVEIISRVHHKHLVSLVGYCISGGKRLLVYEFVPNNTLEFHLHGK--GRPTM  161

Query  897   HWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLASNER  718
              W  RL++A G A+GL +LHE   P I+H  +KASN+L+D +F A++ D+GL    S+  
Sbjct  162   EWPTRLKIALGAAKGLAYLHEDCHPKIIHRDIKASNILLDFKFEAKVADFGLAKFTSDNN  221

Query  717   QEV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRKS-------QEGLLV  580
               V        GY+  EY   G+  +++SDV+ +GV+LLEL++GR+         +  LV
Sbjct  222   THVSTRVMGTFGYLAPEYASSGK-LTEKSDVFSYGVMLLELITGRRPVDTTQTFMDDSLV  280

Query  579   KWALPL----IKEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
              WA PL    +++  +  ++DPR+A   + N + R+   A+ACV +S + RP + QV
Sbjct  281   DWARPLLMRALEDGNYDSLVDPRLAKDFNPNEIARMIACAAACVRHSARRRPRMSQV  337



>gb|KHN41988.1| Proline-rich receptor-like protein kinase PERK4 [Glycine soja]
Length=441

 Score =   146 bits (368),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 169/303 (56%), Gaps = 31/303 (10%)
 Frame = -1

Query  1257  AAKLSAAAYTLMEMDAATDGFNPRRIIGKGRLGVVYSGVLQPEGELVAVKRFHPRLVLSN  1078
             A  L    ++  E+ AAT+GFN   +IG+G  G V+ GVL P G+ VAVK       L  
Sbjct  78    ALGLKGGTFSYEELAAATNGFNDANLIGQGGFGYVHKGVL-PSGKEVAVKS------LKA  130

Query  1077  AAGFG---FSSVLRWLSLADHPNLVPILGFSEAPGERIVVMEYGGMLSLEFYLHQNPDAA  907
              +G G   F + +  +S   H +LV ++G+S + G+R++V E+    +LE++LH      
Sbjct  131   GSGQGEREFQAEIDIISRVHHRHLVSLVGYSISGGQRMLVYEFIPNNTLEYHLH--GKGR  188

Query  906   ALLHWSrrlrvaagvargLEFLHEGMVPHIVHGCVKASNVLIDVEFSARLCDYGLYFLAS  727
               + W+ R+R+A G A+GL +LHE   P I+H  +KA+NVLID  F A++ D+GL  L +
Sbjct  189   PTMDWATRMRIAIGSAKGLAYLHEDCHPRIIHRDIKAANVLIDDSFEAKVADFGLAKLTT  248

Query  726   NERQEV-------IGYVDEEYWVEGRGGSKESDVYGFGVVLLELLSGRK------SQEGL  586
             +    V        GY+  EY   G+  +++SDV+ FGV+LLEL++G++      + +  
Sbjct  249   DNNTHVSTRVMGTFGYLAPEYASSGK-LTEKSDVFSFGVMLLELITGKRPVDHTNAMDDS  307

Query  585   LVKWALPLI-----KEMRFGEVLDPRIAIPCDINPLVRLAKVASACVGNSRKSRPTIVQV  421
             LV WA PL+     ++  FGE++D  +    D   L R+A  A+  + +S K RP + Q+
Sbjct  308   LVDWARPLLTRGLEEDGNFGELVDAFLEGNYDAQELSRMAACAAGSIRHSAKKRPKMSQI  367

Query  420   AAI  412
               I
Sbjct  368   VRI  370



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4791533042520