BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84170_g1_i1 len=661 path=[639:0-660]

Length=661
                                                                      Score     E

gb|AFB73932.1|  LAT52-like protein                                      166   7e-48   
gb|AFB73931.1|  LAT52-like protein                                      166   8e-48   
ref|XP_009794171.1|  PREDICTED: anther-specific protein LAT52           164   6e-47   
ref|XP_009604804.1|  PREDICTED: anther-specific protein LAT52           162   3e-46   
ref|XP_006360048.1|  PREDICTED: anther-specific protein LAT52-like      158   1e-44   
ref|XP_004248244.1|  PREDICTED: anther-specific protein LAT52           157   3e-44   
ref|XP_009602640.1|  PREDICTED: anther-specific protein LAT52-like      149   4e-41   
ref|XP_009778120.1|  PREDICTED: anther-specific protein LAT52-like      148   9e-41   
ref|XP_004251892.1|  PREDICTED: anther-specific protein LAT52-like      147   2e-40   
ref|XP_006358942.1|  PREDICTED: anther-specific protein LAT52-like      147   2e-40   
ref|XP_009761932.1|  PREDICTED: anther-specific protein LAT52-like      130   5e-34   
ref|XP_011098227.1|  PREDICTED: anther-specific protein LAT52-like      127   9e-33   
ref|XP_009598969.1|  PREDICTED: anther-specific protein LAT52-like      127   9e-33   
ref|XP_002523378.1|  Anther-specific protein LAT52 precursor, put...    126   2e-32   Ricinus communis
ref|XP_011070069.1|  PREDICTED: anther-specific protein LAT52-like      126   2e-32   
ref|XP_004244268.1|  PREDICTED: anther-specific protein LAT52-like      125   4e-32   
ref|XP_010277041.1|  PREDICTED: anther-specific protein LAT52           125   7e-32   
ref|XP_006348395.1|  PREDICTED: anther-specific protein LAT52-like      123   2e-31   
ref|XP_002316866.1|  pollen Ole e 1 allergen and extensin family ...    122   7e-31   Populus trichocarpa [western balsam poplar]
ref|XP_007021723.1|  Pollen Ole e 1 allergen and extensin family ...    122   8e-31   
ref|XP_011006522.1|  PREDICTED: olee1-like protein                      120   3e-30   
ref|XP_011029563.1|  PREDICTED: olee1-like protein                      120   3e-30   
gb|EYU45018.1|  hypothetical protein MIMGU_mgv1a015317mg                120   5e-30   
ref|XP_006370166.1|  pollen Ole e 1 allergen and extensin family ...    119   7e-30   
gb|EYU26327.1|  hypothetical protein MIMGU_mgv1a015422mg                118   2e-29   
ref|XP_008371469.1|  PREDICTED: olee1-like protein                      117   4e-29   
ref|XP_009348994.1|  PREDICTED: olee1-like protein                      117   6e-29   
ref|XP_009759546.1|  PREDICTED: olee1-like protein                      116   1e-28   
gb|KHG10520.1|  Olee1-like protein                                      116   2e-28   
ref|XP_009617824.1|  PREDICTED: olee1-like protein                      114   1e-27   
gb|KDP32532.1|  hypothetical protein JCGZ_14735                         113   2e-27   
emb|CDP06002.1|  unnamed protein product                                113   2e-27   
ref|XP_009773994.1|  PREDICTED: olee1-like protein                      113   2e-27   
ref|XP_008383629.1|  PREDICTED: olee1-like protein                      113   3e-27   
ref|XP_009352776.1|  PREDICTED: olee1-like protein                      112   5e-27   
ref|XP_009396935.1|  PREDICTED: pollen-specific protein C13-like        112   6e-27   
gb|KHG25858.1|  Olee1-like protein                                      111   1e-26   
emb|CDP16229.1|  unnamed protein product                                110   2e-26   
emb|CDP16230.1|  unnamed protein product                                110   3e-26   
ref|XP_004233077.1|  PREDICTED: major pollen allergen Lig v 1-like      110   3e-26   
ref|XP_009608960.1|  PREDICTED: olee1-like protein                      110   4e-26   
ref|XP_007212169.1|  hypothetical protein PRUPE_ppa012463mg             107   3e-25   
ref|XP_009403224.1|  PREDICTED: pollen-specific protein C13-like        105   1e-24   
gb|ACG33223.1|  pollen-specific protein C13 precursor                   106   1e-24   Zea mays [maize]
ref|XP_007225977.1|  hypothetical protein PRUPE_ppa012675mg             105   1e-24   
gb|ACF82695.1|  unknown                                                 105   1e-24   Zea mays [maize]
ref|XP_009421183.1|  PREDICTED: pollen-specific protein C13-like        105   1e-24   
gb|ADI55168.1|  AS1                                                     105   2e-24   
gb|KHG13789.1|  Anther-specific LAT52                                   106   2e-24   
sp|O49813.1|OLEE1_BETPN  RecName: Full=Olee1-like protein; Flags:...    105   2e-24   Betula pendula [white birch]
ref|XP_009408781.1|  PREDICTED: pollen-specific protein C13-like        105   2e-24   
ref|NP_001148343.1|  LOC100281953 precursor                             104   4e-24   Zea mays [maize]
gb|AAN76546.1|AF393475_1  LLP-B3 protein                                103   5e-24   Lilium longiflorum [Easter lily]
ref|XP_009402012.1|  PREDICTED: pollen-specific protein C13-like        103   7e-24   
ref|XP_008234009.1|  PREDICTED: pollen-specific protein C13             103   8e-24   
ref|XP_009334049.1|  PREDICTED: olee1-like protein                      103   9e-24   
ref|XP_011016068.1|  PREDICTED: pollen-specific protein C13-like        103   1e-23   
gb|EPS72638.1|  hypothetical protein M569_02120                         103   1e-23   
ref|XP_002307393.1|  pollen Ole e 1 allergen and extensin family ...    102   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010057097.1|  PREDICTED: olee1-like protein                      103   2e-23   
ref|XP_008359333.1|  PREDICTED: olee1-like protein                      102   2e-23   
ref|NP_001131377.1|  uncharacterized protein LOC100192702 precursor     102   2e-23   Zea mays [maize]
ref|XP_002522577.1|  Pollen allergen Che a 1 precursor, putative        102   2e-23   Ricinus communis
ref|XP_009340070.1|  PREDICTED: olee1-like protein                      102   2e-23   
sp|Q7M1X5.1|LOLB_LOLPR  RecName: Full=Major pollen allergen Lol p...    101   2e-23   Lolium perenne [perennial ryegrass]
ref|XP_004960638.1|  PREDICTED: pollen allergen Phl p 11-like           102   2e-23   
ref|NP_001105351.1|  pollen-specific protein C13 precursor              102   2e-23   Zea mays [maize]
ref|XP_006652233.1|  PREDICTED: pollen-specific protein C13-like        102   3e-23   
ref|XP_011085997.1|  PREDICTED: olee1-like protein                      102   4e-23   
gb|KCW69946.1|  hypothetical protein EUGRSUZ_F03264                     102   4e-23   
gb|EYU43331.1|  hypothetical protein MIMGU_mgv1a014984mg                102   4e-23   
ref|XP_006857531.1|  hypothetical protein AMTR_s00061p00032820          101   5e-23   
ref|XP_007213539.1|  hypothetical protein PRUPE_ppa019680mg             101   5e-23   
ref|XP_011080816.1|  PREDICTED: major pollen allergen Ole e 1-like      101   5e-23   
ref|XP_004485892.1|  PREDICTED: olee1-like protein-like                 101   8e-23   
ref|XP_004975466.1|  PREDICTED: pollen-specific protein C13-like        100   9e-23   
ref|XP_010062811.1|  PREDICTED: olee1-like protein                      101   1e-22   
sp|Q8H6L7.1|PHLB_PHLPR  RecName: Full=Pollen allergen Phl p 11; A...    100   1e-22   Phleum pratense [timothy]
ref|NP_001150330.1|  pollen allergen Phl p 11 precursor                 100   1e-22   Zea mays [maize]
ref|XP_002447728.1|  hypothetical protein SORBIDRAFT_06g014740          100   1e-22   Sorghum bicolor [broomcorn]
ref|XP_009342278.1|  PREDICTED: olee1-like protein                      100   2e-22   
ref|XP_007141147.1|  hypothetical protein PHAVU_008G171500g             100   2e-22   
ref|XP_003566418.1|  PREDICTED: major pollen allergen Lol p 11-like     100   2e-22   
ref|XP_008226528.1|  PREDICTED: olee1-like protein                    99.8    2e-22   
ref|XP_011079002.1|  PREDICTED: olee1-like protein                      100   2e-22   
ref|XP_008363638.1|  PREDICTED: olee1-like protein                    99.8    2e-22   
sp|Q8LGR0.1|CHE1_CHEAL  RecName: Full=Pollen allergen Che a 1; Al...  99.8    3e-22   Chenopodium album [lamb's-quarters]
ref|XP_007025385.1|  Olee1-like protein                               99.8    3e-22   
gb|AFW77548.1|  pollen allergen Phl p 11                              99.4    3e-22   
gb|AFK47865.1|  unknown                                               99.8    3e-22   
dbj|BAK06698.1|  predicted protein                                    99.4    3e-22   
gb|ADK22842.1|  Sal k 5                                               99.0    4e-22   
ref|XP_008376286.1|  PREDICTED: pollen-specific protein C13-like      99.0    4e-22   
ref|XP_011006159.1|  PREDICTED: pollen-specific protein C13-like      99.0    4e-22   
ref|XP_002513885.1|  Pollen-specific protein C13 precursor, putative  98.6    6e-22   Ricinus communis
gb|EAY93952.1|  hypothetical protein OsI_15725                        98.6    7e-22   Oryza sativa Indica Group [Indian rice]
emb|CAH66537.1|  H0209H04.4                                           98.6    7e-22   Oryza sativa [red rice]
ref|NP_001052674.1|  Os04g0398700                                     98.2    8e-22   Oryza sativa Japonica Group [Japonica rice]
gb|KDP32694.1|  hypothetical protein JCGZ_11986                       98.2    8e-22   
dbj|BAJ86956.1|  predicted protein                                    98.6    9e-22   
gb|KDO80906.1|  hypothetical protein CISIN_1g031458mg                 98.2    9e-22   
gb|AFK37732.1|  unknown                                               98.2    9e-22   
ref|XP_010103032.1|  hypothetical protein L484_005787                 98.2    1e-21   
ref|XP_006472638.1|  PREDICTED: pollen-specific protein C13-like      98.2    1e-21   
ref|XP_006434027.1|  hypothetical protein CICLE_v10002743mg           98.2    1e-21   
gb|AAX93750.1|  pollen allergen Cro s 1                               98.2    1e-21   Crocus sativus [saffron crocus]
ref|NP_001148443.1|  pollen allergen Phl p 11 precursor               98.2    1e-21   Zea mays [maize]
ref|XP_008467237.1|  PREDICTED: olee1-like protein                    97.8    1e-21   
ref|XP_002454899.1|  hypothetical protein SORBIDRAFT_03g001020        97.8    1e-21   Sorghum bicolor [broomcorn]
ref|XP_003546028.1|  PREDICTED: olee1-like protein-like               97.8    2e-21   
ref|XP_011101379.1|  PREDICTED: olee1-like protein                    97.8    2e-21   
gb|AEW90941.1|  group 11 grass pollen allergen F7-4                   97.8    2e-21   
ref|XP_004983223.1|  PREDICTED: pollen-specific protein C13-like      97.4    2e-21   
dbj|BAK07321.1|  predicted protein                                    97.1    2e-21   
ref|XP_010686203.1|  PREDICTED: pollen allergen Che a 1               97.1    2e-21   
gb|ABK92993.1|  unknown                                               97.1    2e-21   Populus trichocarpa [western balsam poplar]
ref|XP_006664913.1|  PREDICTED: pollen allergen Phl p 11-like         97.1    3e-21   
gb|ACU23617.1|  unknown                                               97.1    3e-21   Glycine max [soybeans]
gb|AEW90942.1|  group 11 grass pollen allergen F7-6                   97.1    3e-21   
ref|XP_003573867.1|  PREDICTED: pollen-specific protein C13           97.1    3e-21   
ref|XP_004143635.1|  PREDICTED: olee1-like protein-like               96.7    3e-21   
ref|XP_002440811.1|  hypothetical protein SORBIDRAFT_09g007260        96.7    3e-21   Sorghum bicolor [broomcorn]
gb|EMT13715.1|  Pollen allergen Phl p 11                              96.7    3e-21   
gb|AEW90946.1|  pollen-specific protein F8-4                          96.7    3e-21   
ref|XP_004500607.1|  PREDICTED: pollen-specific protein C13-like      96.7    4e-21   
gb|ABC86745.1|  pollen-specific protein                               96.7    4e-21   Vitis pseudoreticulata
ref|XP_002301038.1|  pollen Ole e 1 allergen and extensin family ...  96.3    4e-21   Populus trichocarpa [western balsam poplar]
gb|AEW90943.1|  group 11 grass pollen allergen F8-6                   96.7    4e-21   
ref|XP_004489034.1|  PREDICTED: olee1-like protein-like               96.7    4e-21   
ref|NP_001238723.1|  uncharacterized protein LOC100499710 precursor   96.3    4e-21   
gb|ABK94215.1|  unknown                                               96.3    5e-21   Populus trichocarpa [western balsam poplar]
gb|AFK47744.1|  unknown                                               96.3    5e-21   
ref|XP_008378536.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        97.4    5e-21   
ref|NP_001057857.1|  Os06g0556600                                     96.3    5e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003565925.1|  PREDICTED: pollen allergen Phl p 11              96.3    6e-21   
ref|XP_009386950.1|  PREDICTED: pollen-specific protein C13-like      95.9    6e-21   
gb|KHG12773.1|  Olee1-like protein                                    96.3    7e-21   
gb|KHN19737.1|  Pollen-specific protein C13                           95.9    8e-21   
ref|XP_010269200.1|  PREDICTED: pollen-specific protein C13-like      95.5    8e-21   
ref|XP_002310579.1|  hypothetical protein POPTR_0007s05750g           95.5    8e-21   Populus trichocarpa [western balsam poplar]
ref|XP_008450951.1|  PREDICTED: olee1-like protein                    95.5    9e-21   
ref|XP_004144129.1|  PREDICTED: olee1-like protein-like               95.5    9e-21   
ref|XP_010529196.1|  PREDICTED: pollen-specific protein-like At4g...  95.9    9e-21   
ref|XP_009764546.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        95.5    9e-21   
ref|XP_002268073.1|  PREDICTED: pollen-specific protein C13           95.5    9e-21   Vitis vinifera
gb|AEW90948.1|  pollen-specific protein F8-6                          95.5    1e-20   
ref|XP_010538209.1|  PREDICTED: pollen-specific protein-like At4g...  95.5    1e-20   
ref|XP_003541705.1|  PREDICTED: olee1-like protein-like               95.5    1e-20   
gb|EMS52933.1|  hypothetical protein TRIUR3_31283                     95.1    1e-20   
ref|XP_002392460.1|  hypothetical protein MPER_07958                  95.1    1e-20   Moniliophthora perniciosa FA553
gb|AEW90940.1|  group 11 grass pollen allergen F7-1                   95.1    1e-20   
ref|XP_010060161.1|  PREDICTED: protein DOWNSTREAM OF FLC             94.4    2e-20   
ref|XP_009366359.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        94.4    3e-20   
ref|NP_001146979.1|  LOC100280588 precursor                           94.4    3e-20   Zea mays [maize]
gb|ACG32277.1|  pollen-specific protein C13 precursor                 94.4    3e-20   Zea mays [maize]
ref|XP_008225283.1|  PREDICTED: olee1-like protein                    94.0    3e-20   
emb|CDY52214.1|  BnaAnng11370D                                        94.0    4e-20   
ref|XP_009108374.1|  PREDICTED: pollen-specific protein-like At4g...  94.0    4e-20   
ref|XP_009114385.1|  PREDICTED: pollen-specific protein-like At4g...  94.0    4e-20   
ref|XP_011075627.1|  PREDICTED: olee1-like protein                    93.6    4e-20   
emb|CDY65576.1|  BnaC09g52000D                                        94.0    4e-20   
ref|XP_010527375.1|  PREDICTED: major pollen allergen Lol p 11-like   93.6    4e-20   
ref|XP_007148052.1|  hypothetical protein PHAVU_006G176500g           93.6    5e-20   
ref|XP_011075462.1|  PREDICTED: olee1-like protein                    93.6    5e-20   
emb|CAA78897.1|  pollen specific gene                                 93.6    5e-20   Oryza sativa [red rice]
gb|EPS70684.1|  hypothetical protein M569_04073                       93.6    5e-20   
ref|XP_007136225.1|  hypothetical protein PHAVU_009G028900g           93.6    5e-20   
ref|XP_003634471.1|  PREDICTED: pollen-specific protein C13           93.2    6e-20   
ref|XP_007153183.1|  hypothetical protein PHAVU_003G013900g           93.2    6e-20   
ref|XP_006464247.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        93.2    6e-20   
ref|XP_006428158.1|  hypothetical protein CICLE_v10027141mg           94.7    7e-20   
ref|XP_003638771.1|  Pollen allergen Phl p                            93.2    7e-20   
gb|AFK46977.1|  unknown                                               92.8    9e-20   
ref|XP_004289324.1|  PREDICTED: pollen-specific protein C13-like      92.8    9e-20   
ref|XP_006284941.1|  hypothetical protein CARUB_v10006240mg           93.2    9e-20   
ref|XP_003543768.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        92.8    1e-19   
gb|EYU31033.1|  hypothetical protein MIMGU_mgv1a015328mg              92.4    1e-19   
ref|XP_009409254.1|  PREDICTED: major pollen allergen Lol p 11-like   92.8    1e-19   
gb|AEW90945.1|  group 11 grass pollen allergen R1-2                   92.4    1e-19   
ref|XP_010441660.1|  PREDICTED: pollen-specific protein-like At4g...  92.8    1e-19   
ref|XP_010518802.1|  PREDICTED: pollen-specific protein-like At4g...  92.8    1e-19   
ref|XP_009797814.1|  PREDICTED: major pollen allergen Lol p 11-like   92.4    1e-19   
ref|XP_007206364.1|  hypothetical protein PRUPE_ppa017800mg           92.4    1e-19   
ref|XP_008348540.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        92.4    1e-19   
ref|XP_010481521.1|  PREDICTED: pollen-specific protein-like At4g...  92.4    2e-19   
gb|AAM08621.1|AC107314_12  Putative Pollen specific protein C13 p...  92.4    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001237189.1|  uncharacterized protein LOC100305566 precursor   92.0    2e-19   
ref|XP_006366520.1|  PREDICTED: olee1-like protein-like               92.0    2e-19   
ref|NP_001064462.2|  Os10g0371000                                     92.4    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009109686.1|  PREDICTED: pollen-specific protein-like At4g...  91.7    3e-19   
ref|XP_004971474.1|  PREDICTED: pollen allergen Phl p 11-like         91.7    3e-19   
ref|XP_010321468.1|  PREDICTED: LOW QUALITY PROTEIN: major pollen...  91.3    3e-19   
emb|CDX99789.1|  BnaC05g22110D                                        91.7    3e-19   
ref|XP_009600627.1|  PREDICTED: major pollen allergen Lol p 11-like   91.3    3e-19   
emb|CDY01556.1|  BnaC07g35460D                                        91.7    3e-19   
ref|XP_006281481.1|  hypothetical protein CARUB_v10027565mg           91.3    4e-19   
ref|XP_010911793.1|  PREDICTED: pollen-specific protein C13-like      91.3    4e-19   
ref|XP_006442530.1|  hypothetical protein CICLE_v10024378mg           90.9    4e-19   
ref|XP_010535648.1|  PREDICTED: major pollen allergen Lol p 11-like   91.3    4e-19   
gb|ACJ83911.1|  unknown                                               91.3    4e-19   Medicago truncatula
ref|NP_567562.1|  pollen Ole e 1 allergen and extensin family pro...  91.3    4e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AFK42345.1|  unknown                                               90.9    5e-19   
emb|CDX99452.1|  BnaC01g11000D                                        90.9    5e-19   
ref|XP_002489221.1|  hypothetical protein SORBIDRAFT_0012s014630      90.9    5e-19   Sorghum bicolor [broomcorn]
ref|XP_006645671.1|  PREDICTED: pollen allergen Phl p 11-like         90.5    5e-19   
ref|XP_008245042.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        90.9    5e-19   
ref|XP_010538956.1|  PREDICTED: major pollen allergen Lol p 11        90.5    5e-19   
ref|XP_007149397.1|  hypothetical protein PHAVU_005G066800g           90.5    5e-19   
ref|XP_010261236.1|  PREDICTED: pollen-specific protein C13-like      90.5    5e-19   
ref|XP_008797140.1|  PREDICTED: major pollen allergen Lol p 11-like   90.9    6e-19   
ref|XP_010494740.1|  PREDICTED: pollen-specific protein-like At4g...  90.9    6e-19   
ref|XP_009136942.1|  PREDICTED: pollen-specific protein-like At4g...  90.5    7e-19   
ref|XP_010434511.1|  PREDICTED: pollen-specific protein-like At4g...  90.5    7e-19   
ref|XP_007018845.1|  Pollen-specific protein C13, putative            90.5    7e-19   
ref|XP_003581152.1|  PREDICTED: pollen-specific protein C13-like      90.5    7e-19   
emb|CDY43319.1|  BnaC03g58910D                                        90.5    8e-19   
ref|XP_007153182.1|  hypothetical protein PHAVU_003G013800g           90.1    8e-19   
ref|XP_009132011.1|  PREDICTED: pollen-specific protein-like At4g...  90.5    8e-19   
gb|EYU24008.1|  hypothetical protein MIMGU_mgv1a015363mg              90.1    9e-19   
ref|XP_009115274.1|  PREDICTED: pollen-specific protein-like At4g...  90.1    9e-19   
ref|XP_007149396.1|  hypothetical protein PHAVU_005G066700g           90.1    1e-18   
ref|XP_010496255.1|  PREDICTED: pollen-specific protein-like At4g...  90.1    1e-18   
ref|NP_174209.1|  pollen Ole e 1 allergen and extensin family pro...  90.1    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870034.1|  pollen ole e 1 allergen and extensin family ...  90.1    1e-18   
ref|XP_011030966.1|  PREDICTED: protein DOWNSTREAM OF FLC             89.7    1e-18   
ref|XP_010521200.1|  PREDICTED: major pollen allergen Lol p 11        89.7    1e-18   
ref|XP_010439832.1|  PREDICTED: pollen-specific protein-like At4g...  89.7    1e-18   
ref|XP_006414083.1|  hypothetical protein EUTSA_v10026398mg           89.7    1e-18   
ref|XP_010540511.1|  PREDICTED: pollen-specific protein-like At4g...  89.7    2e-18   
gb|AAM65838.1|  Ole e I (main olive allergen)-like protein            89.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006661725.1|  PREDICTED: pollen-specific protein C13-like      89.7    2e-18   
ref|XP_006398273.1|  hypothetical protein EUTSA_v10001051mg           89.7    2e-18   
ref|XP_008234688.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        89.0    2e-18   
gb|KFK44745.1|  hypothetical protein AALP_AA1G297400                  89.4    2e-18   
gb|EPS62385.1|  hypothetical protein M569_12405                       88.6    2e-18   
ref|XP_009134109.1|  PREDICTED: pollen-specific protein C13           89.0    2e-18   
ref|XP_010942360.1|  PREDICTED: pollen allergen Phl p 11-like         89.0    2e-18   
ref|XP_010549400.1|  PREDICTED: pollen-specific protein-like At4g...  89.0    2e-18   
dbj|BAB09316.1|  Ole e I (main olive allergen)-like protein           89.0    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002533139.1|  Pollen-specific protein C13 precursor, putative  88.6    3e-18   Ricinus communis
pir||S43243  allergen-like protein Syr v I isoform 2 - Syringa vu...  88.2    3e-18
ref|NP_568650.1|  pollen_Ole_e_I-domain containing protein            89.0    3e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDY12288.1|  BnaA09g24880D                                        88.6    3e-18   
ref|XP_010941451.1|  PREDICTED: pollen-specific protein C13-like      88.6    3e-18   
emb|CDY69202.1|  BnaCnng62360D                                        89.0    3e-18   
ref|XP_006304746.1|  hypothetical protein CARUB_v10012122mg           88.6    3e-18   
ref|XP_010460686.1|  PREDICTED: pollen-specific protein-like At4g...  88.6    3e-18   
gb|KHG30321.1|  Anther-specific LAT52                                 88.6    3e-18   
ref|XP_010499433.1|  PREDICTED: pollen-specific protein-like At4g...  88.6    4e-18   
ref|XP_009102877.1|  PREDICTED: pollen-specific protein-like At4g...  88.6    4e-18   
pir||I53806  major allergen OLE16 - common olive (fragment)           87.8    4e-18
ref|XP_002863445.1|  hypothetical protein ARALYDRAFT_494394           88.6    4e-18   
pir||S43242  allergen-like protein Syr v I isoform 1 - Syringa vu...  87.8    5e-18
gb|KGN49303.1|  hypothetical protein Csa_6G519560                     88.2    5e-18   
gb|KHG18492.1|  Anther-specific LAT52                                 88.2    5e-18   
gb|ABP58633.1|  major pollen allergen Ole e 1                         87.4    5e-18   Olea europaea
gb|ABP58635.1|  major pollen allergen Ole e 1                         87.4    5e-18   Olea europaea
emb|CDY05022.1|  BnaC03g28200D                                        87.8    5e-18   
ref|XP_011097595.1|  PREDICTED: major pollen allergen Lol p 11-like   87.8    6e-18   
gb|KFK31513.1|  hypothetical protein AALP_AA6G122400                  88.2    6e-18   
gb|KFK28529.1|  hypothetical protein AALP_AA7G008600                  87.8    7e-18   
emb|CDX87759.1|  BnaC02g31900D                                        87.8    7e-18   
ref|XP_006289520.1|  hypothetical protein CARUB_v10003061mg           87.4    7e-18   
emb|CAA16739.1|  pollen-specific protein - like                       92.8    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001235303.1|  uncharacterized protein LOC100306199 precursor   87.8    7e-18   
ref|XP_002307104.1|  hypothetical protein POPTR_0005s08000g           87.4    7e-18   Populus trichocarpa [western balsam poplar]
ref|XP_009128814.1|  PREDICTED: pollen-specific protein-like At4g...  87.8    8e-18   
gb|AAQ83588.1|  allergen Fra e 1                                      87.0    8e-18   Fraxinus excelsior
ref|XP_008453801.1|  PREDICTED: major pollen allergen Lol p 11-like   87.4    9e-18   
ref|XP_010478273.1|  PREDICTED: pollen-specific protein-like At4g...  87.4    9e-18   
ref|XP_009101556.1|  PREDICTED: pollen-specific protein-like At4g...  87.4    1e-17   
ref|XP_009760524.1|  PREDICTED: pollen-specific protein C13-like      87.0    1e-17   
ref|XP_004134662.1|  PREDICTED: olee1-like protein-like               87.0    1e-17   
ref|XP_004146873.1|  PREDICTED: pollen allergen Che a 1-like          87.0    1e-17   
pir||H53806  major allergen OLE6 - common olive (fragment)            86.3    1e-17
ref|XP_004134927.1|  PREDICTED: olee1-like protein-like               87.0    1e-17   
ref|XP_002273294.1|  PREDICTED: olee1-like protein                    87.0    1e-17   Vitis vinifera
ref|XP_010676978.1|  PREDICTED: major pollen allergen Lol p 11-like   86.7    1e-17   
emb|CDX77620.1|  BnaC07g18740D                                        87.0    2e-17   
ref|XP_009622218.1|  PREDICTED: pollen-specific protein C13-like      86.3    2e-17   
gb|KHN36879.1|  Olee1-like protein                                    86.7    2e-17   
ref|XP_004293940.1|  PREDICTED: olee1-like protein-like               86.7    2e-17   
ref|XP_006397273.1|  hypothetical protein EUTSA_v10029031mg           86.3    2e-17   
sp|O82015.2|LIGV1_LIGVU  RecName: Full=Major pollen allergen Lig ...  85.9    2e-17   
pir||S43244  allergen-like protein Syr v I isoform 3 - Syringa vu...  85.9    2e-17
ref|NP_567338.1|  protein SAH7                                        85.9    3e-17   
ref|XP_008775180.1|  PREDICTED: pollen-specific protein C13-like      85.9    3e-17   
gb|ABP58632.1|  major pollen allergen Ole e 1                         85.1    4e-17   
emb|CAA73036.1|  Ole e 1 protein                                      85.1    4e-17   
gb|ABP58636.1|  major pollen allergen Ole e 1                         85.1    4e-17   
pir||A38968  major allergen OLE20 - common olive (fragment)           84.7    5e-17
ref|XP_008445353.1|  PREDICTED: protein DOWNSTREAM OF FLC             85.1    5e-17   
ref|XP_006344595.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        85.1    5e-17   
ref|XP_006415610.1|  hypothetical protein EUTSA_v10008921mg           85.5    5e-17   
ref|XP_010436385.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        85.1    6e-17   
gb|AAM78187.1|  putative SAH7 protein                                 84.0    6e-17   
pir||B53806  major allergen OLE5c - common olive                      84.7    6e-17
gb|AAM78185.1|  putative SAH7 protein                                 83.6    7e-17   
emb|CAA73037.1|  Ole e 1.0103 protein                                 84.3    8e-17   
ref|XP_008782123.1|  PREDICTED: pollen-specific protein C13-like      85.1    8e-17   
ref|XP_010455288.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        84.7    8e-17   
pir||C53806  major allergen OLE1c - common olive (fragment)           84.3    8e-17
sp|P19963.2|ALL1_OLEEU  RecName: Full=Major pollen allergen Ole e...  84.3    9e-17   
ref|XP_004150698.1|  PREDICTED: pollen-specific protein C13-like      84.3    9e-17   
ref|XP_008439742.1|  PREDICTED: olee1-like protein isoform X1         84.3    1e-16   
emb|CAA73038.1|  Ole e 1.0102 protein                                 84.0    1e-16   
gb|AAT08700.1|  pollen-specific protein                               84.3    1e-16   
gb|KDP46869.1|  hypothetical protein JCGZ_24078                       84.0    1e-16   
gb|EPS69662.1|  hypothetical protein M569_05103                       84.0    1e-16   
ref|XP_011090511.1|  PREDICTED: major pollen allergen Lol p 11-like   84.0    1e-16   
emb|CAA54819.1|  major allergen                                       83.6    1e-16   
ref|XP_008439743.1|  PREDICTED: olee1-like protein isoform X2         84.0    1e-16   
ref|XP_008343344.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  83.2    1e-16   
gb|ABP58634.1|  major pollen allergen Ole e 1                         83.6    1e-16   
ref|XP_009383585.1|  PREDICTED: pollen-specific protein C13-like      83.6    3e-16   
gb|AEK85661.1|  major pollen allergen Ole e1                          82.4    3e-16   
ref|XP_002459879.1|  hypothetical protein SORBIDRAFT_02g012930        83.2    3e-16   
gb|AEK85660.1|  major pollen allergen Ole e1                          82.4    4e-16   
pir||E53806  major allergen OLE17 - common olive (fragment)           82.0    4e-16
ref|XP_010942359.1|  PREDICTED: major pollen allergen Lol p 11-like   82.8    4e-16   
gb|AEK85659.1|  major pollen allergen Ole e1                          82.0    5e-16   
ref|XP_010025486.1|  PREDICTED: protein DOWNSTREAM OF FLC             82.4    5e-16   
gb|AAF16869.1|AF109693_1  allergen-like protein BRSn20                82.0    6e-16   
ref|XP_007048005.1|  Pollen-specific protein C13, putative            82.0    6e-16   
pir||F53806  major allergen OLE19 - common olive (fragment)           81.3    8e-16
gb|AAQ08947.1|  allergen Fra e 1.0101                                 81.3    9e-16   
gb|KFK32118.1|  hypothetical protein AALP_AA6G200700                  81.6    9e-16   
ref|XP_004237415.1|  PREDICTED: pollen-specific protein C13           81.3    1e-15   
ref|XP_011078225.1|  PREDICTED: pollen allergen Che a 1-like          81.3    2e-15   
ref|XP_006355373.1|  PREDICTED: pollen-specific protein C13-like      80.9    2e-15   
gb|AAM78186.1|  putative SAH7 protein                                 79.7    2e-15   
ref|XP_010916905.1|  PREDICTED: pollen-specific protein C13-like      80.9    2e-15   
pir||G53806  major allergen OLE26 - common olive (fragment)           80.1    2e-15
ref|XP_010424432.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        82.0    2e-15   
gb|AAN18042.1|  major pollen allergen Ole e 1                         79.7    2e-15   
ref|XP_010317514.1|  PREDICTED: olee1-like protein                    79.3    3e-15   
ref|XP_006661014.1|  PREDICTED: pollen-specific protein C13-like      80.5    3e-15   
gb|AAM78189.1|  putative SAH7 protein                                 79.0    3e-15   
ref|XP_004502439.1|  PREDICTED: pollen-specific protein C13-like      80.1    4e-15   
ref|XP_004959259.1|  PREDICTED: pollen-specific protein C13-like      80.1    4e-15   
gb|EAZ45758.1|  hypothetical protein OsJ_30442                        79.7    4e-15   
gb|AAV74343.1|  Fra e 1.0102 major allergen                           79.3    5e-15   
dbj|BAD46623.1|  putative Pollen specific protein C13 precursor       79.7    6e-15   
gb|EEC85106.1|  hypothetical protein OsI_32490                        79.7    6e-15   
ref|NP_001064001.1|  Os09g0572800                                     79.7    6e-15   
ref|XP_002872410.1|  hypothetical protein ARALYDRAFT_489767           79.3    7e-15   
gb|KEH38612.1|  pollen Ole e I family allergen                        79.3    8e-15   
ref|XP_011101449.1|  PREDICTED: olee1-like protein                    79.3    8e-15   
ref|XP_006468202.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  77.8    9e-15   
gb|AEK85663.1|  major pollen allergen Ole e1                          78.2    1e-14   
ref|XP_006601773.1|  PREDICTED: uncharacterized protein LOC100527...  78.2    1e-14   
gb|AAQ07442.1|  major pollen allergen Ole e 1                         77.0    3e-14   
gb|AAM78188.1|  putative SAH7 protein                                 76.6    3e-14   
ref|XP_004299638.1|  PREDICTED: pollen allergen Phl p 11-like         76.3    3e-14   
ref|XP_010547621.1|  PREDICTED: protein DOWNSTREAM OF FLC             77.4    4e-14   
gb|AAQ10269.1|  major pollen allergen Ole e 1                         76.6    4e-14   
gb|AEK85658.1|  major pollen allergen Ole e1                          76.3    4e-14   
gb|AAQ10267.1|  major pollen allergen Ole e 1                         76.3    4e-14   
gb|AAQ10277.1|  major pollen allergen Ole e 1                         76.3    5e-14   
ref|NP_196575.1|  pollen_Ole_e_I-domain containing protein            77.0    5e-14   
gb|AEK85662.1|  major pollen allergen Ole e1                          75.9    7e-14   
ref|XP_008803750.1|  PREDICTED: pollen-specific protein C13           76.6    7e-14   
emb|CDX88408.1|  BnaC06g38520D                                        75.9    9e-14   
ref|XP_010090546.1|  hypothetical protein L484_016596                 76.3    1e-13   
ref|XP_009106450.1|  PREDICTED: protein DOWNSTREAM OF FLC             75.9    1e-13   
emb|CDX87484.1|  BnaA07g33890D                                        75.9    1e-13   
ref|XP_002890794.1|  hypothetical protein ARALYDRAFT_336019           79.3    1e-13   
gb|ACJ86288.1|  unknown                                               75.5    2e-13   
gb|AAQ08188.1|  major pollen allergen Ole e 1                         74.7    2e-13   
ref|XP_002887714.1|  pollen ole e 1 allergen and extensin family ...  75.1    2e-13   
gb|AAB32652.2|  main olive allergen                                   74.3    2e-13   
ref|XP_010105888.1|  hypothetical protein L484_021545                 75.1    2e-13   
gb|AAQ10272.1|  major pollen allergen Ole e 1                         74.3    2e-13   
ref|XP_002889170.1|  pollen ole e 1 allergen and extensin family ...  74.7    3e-13   
ref|XP_006399503.1|  hypothetical protein EUTSA_v10014875mg           74.3    4e-13   
gb|KEH38613.1|  pollen Ole e I family allergen                        74.3    4e-13   
gb|ABP58637.1|  major pollen allergen Ole e 1                         73.6    5e-13   
ref|XP_006288804.1|  hypothetical protein CARUB_v10002136mg           73.9    5e-13   
ref|XP_010422886.1|  PREDICTED: protein DOWNSTREAM OF FLC             73.9    5e-13   
ref|XP_010453035.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        73.9    6e-13   
gb|ACJ86286.1|  unknown                                               73.9    6e-13   
ref|XP_010491667.1|  PREDICTED: protein DOWNSTREAM OF FLC             73.6    6e-13   
gb|AAQ10274.1|  major pollen allergen Ole e 1                         72.8    6e-13   
gb|AAO22132.1|  major pollen allergen Ole e 1                         73.2    7e-13   
gb|EAZ40496.1|  hypothetical protein OsJ_24951                        73.2    7e-13   
gb|EAZ04544.1|  hypothetical protein OsI_26693                        73.2    7e-13   
ref|NP_001175282.1|  Os07g0590500                                     73.6    8e-13   
ref|XP_011101376.1|  PREDICTED: pollen allergen Che a 1-like isof...  72.8    1e-12   
gb|ACK44512.1|  AT5G10130-like protein                                72.8    1e-12   
ref|XP_011101377.1|  PREDICTED: olee1-like protein isoform X2         72.8    2e-12   
ref|XP_008343324.1|  PREDICTED: olee1-like protein                    70.1    4e-12   
ref|NP_177927.1|  pollen Ole e 1 allergen and extensin family pro...  71.2    5e-12   
ref|XP_002873440.1|  pollen ole e 1 allergen and extensin family ...  71.2    5e-12   
ref|XP_010428908.1|  PREDICTED: major pollen allergen Lol p 11-like   71.2    5e-12   
ref|XP_009789881.1|  PREDICTED: olee1-like protein                    71.2    5e-12   
gb|AAN60344.1|  unknown                                               70.5    6e-12   
gb|AAQ10273.1|  major pollen allergen Ole e 1                         70.1    6e-12   
gb|EMS61378.1|  Pollen-specific protein C13                           70.5    7e-12   
ref|XP_006302909.1|  hypothetical protein CARUB_v10021044mg           70.9    7e-12   
gb|AFO38383.1|  putative pollen-specific protein C13                  70.9    8e-12   
gb|KFK42186.1|  hypothetical protein AALP_AA2G222600                  70.5    9e-12   
gb|AAF17689.1|AC009243_16  F28K19.26                                  73.9    9e-12   
ref|XP_010680579.1|  PREDICTED: major pollen allergen Lol p 11-like   70.1    1e-11   
ref|XP_006390031.1|  hypothetical protein EUTSA_v10019236mg           70.1    1e-11   
ref|XP_010472003.1|  PREDICTED: major pollen allergen Lol p 11-like   70.1    1e-11   
ref|XP_010416770.1|  PREDICTED: major pollen allergen Lol p 11-like   70.1    1e-11   
ref|XP_003601984.1|  Pollen-specific protein C13                      69.7    1e-11   
gb|ACQ44229.1|  putative pollen Ole e 1 allergen and extensin fam...  69.7    2e-11   
gb|AAQ10281.1|  major pollen allergen Ole e 1                         68.6    2e-11   
emb|CDP01424.1|  unnamed protein product                              68.9    2e-11   
gb|KDP21093.1|  hypothetical protein JCGZ_21564                       69.3    3e-11   
ref|XP_011102257.1|  PREDICTED: olee1-like protein                    68.6    3e-11   
gb|AAQ10280.1|  major pollen allergen Ole e 1                         67.4    6e-11   
gb|ADM76637.1|  extensin-like protein                                 67.8    7e-11   
gb|AFW82075.1|  hypothetical protein ZEAMMB73_949741                  66.6    7e-11   
emb|CDY40079.1|  BnaC02g00510D                                        67.4    8e-11   
ref|XP_006838264.1|  hypothetical protein AMTR_s00103p00069180        66.6    1e-10   
ref|XP_010906302.1|  PREDICTED: pollen-specific protein C13-like      66.2    1e-10   
ref|XP_009125327.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        67.0    1e-10   
emb|CDX85777.1|  BnaA02g00360D                                        67.0    1e-10   
gb|ADM76653.1|  extensin-like protein                                 67.0    1e-10   
gb|KHN44330.1|  Pollen-specific protein C13                           65.9    2e-10   
gb|AAZ67595.1|  80A08_10                                              66.2    2e-10   
ref|XP_009122085.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        66.2    2e-10   
gb|AAO22133.1|  major pollen allergen Ole e 1                         65.5    3e-10   
emb|CDY21640.1|  BnaC09g46520D                                        65.5    3e-10   
gb|ABK21930.1|  unknown                                               65.9    3e-10   
gb|ABK22573.1|  unknown                                               65.9    3e-10   
ref|XP_009147847.1|  PREDICTED: pollen-specific protein-like At4g...  65.1    3e-10   
gb|ADM76665.1|  extensin-like protein                                 65.9    3e-10   
ref|XP_009413179.1|  PREDICTED: pollen-specific protein C13-like      64.7    3e-10   
gb|AAQ10279.1|  major pollen allergen Ole e 1                         65.1    4e-10   
gb|KDO56621.1|  hypothetical protein CISIN_1g041753mg                 64.3    5e-10   
gb|EMT21854.1|  hypothetical protein F775_27590                       62.4    3e-09   
gb|KDO44647.1|  hypothetical protein CISIN_1g045131mg                 61.2    5e-09   
ref|XP_008381078.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        62.0    6e-09   
emb|CDY14639.1|  BnaC02g24740D                                        61.6    7e-09   
gb|AAO41983.1|  unknown protein                                       60.8    1e-08   
ref|XP_009794836.1|  PREDICTED: pollen-specific protein C13-like      60.1    1e-08   
ref|XP_003596420.1|  Pollen allergen Che a                            60.1    4e-08   
emb|CDY21637.1|  BnaC09g46550D                                        59.7    6e-08   
gb|EMS67079.1|  hypothetical protein TRIUR3_25214                     57.8    9e-08   
ref|XP_003596434.1|  Major pollen allergen Lol p                      58.2    2e-07   
gb|AFK44177.1|  unknown                                               57.8    2e-07   
ref|XP_003596438.1|  Major pollen allergen Lol p                      57.0    4e-07   
ref|XP_003596443.1|  Major pollen allergen Lol p                      57.0    1e-06   
ref|XP_008391140.1|  PREDICTED: olee1-like protein                    54.3    2e-06   
ref|XP_003596436.1|  Major pollen allergen Lol p                      54.3    3e-06   
ref|XP_008357485.1|  PREDICTED: uncharacterized protein LOC103421237  55.8    4e-06   
sp|P82242.2|PLAL1_PLALA  RecName: Full=Major pollen allergen Pla ...  53.9    4e-06   
gb|KEH15235.1|  pollen protein Ole E I-like protein                   53.9    7e-06   
emb|CAC41634.1|  plantain pollen major allergen, Pla l 1.0102         53.1    7e-06   
emb|CAC41635.1|  plantain pollen major allergen, Pla l 1.0103         52.8    1e-05   
ref|NP_001237949.1|  uncharacterized protein LOC100527053             51.2    2e-05   
emb|CDO96791.1|  unnamed protein product                              50.8    4e-05   
ref|XP_003595687.1|  Olee1-like protein                               49.7    3e-04   
ref|XP_007208811.1|  hypothetical protein PRUPE_ppa024778mg           49.3    4e-04   
ref|XP_008238496.1|  PREDICTED: olee1-like protein                    48.5    6e-04   
ref|XP_007208803.1|  hypothetical protein PRUPE_ppa024703mg           48.5    7e-04   
ref|XP_007210061.1|  hypothetical protein PRUPE_ppa018487mg           48.1    9e-04   



>gb|AFB73932.1| LAT52-like protein [Lycium barbarum]
Length=161

 Score =   166 bits (420),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 109/141 (77%), Gaps = 1/141 (1%)
 Frame = -3

Query  548  CHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGT  369
            CHP E F V+GKVYCD CR++FET++S+NI  A V+L+CRN+TTE  T++ E  T+ DG 
Sbjct  22   CHP-EVFDVEGKVYCDTCRVQFETKLSQNIEGATVKLQCRNITTETETFSVEGVTDKDGK  80

Query  368  YMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMK  189
            Y +TVEG+H+++IC+VTV KSPREDCKEA +G EKA++ CSD VGMH+ VRYANPLFFMK
Sbjct  81   YKLTVEGDHQDDICEVTVVKSPREDCKEAVSGYEKARIECSDNVGMHNAVRYANPLFFMK  140

Query  188  EKVSKECAKVLKELDFVPLEM  126
             +  + C + L EL   PLE 
Sbjct  141  AEAVEGCKEALDELGLFPLEF  161



>gb|AFB73931.1| LAT52-like protein [Lycium barbarum]
Length=161

 Score =   166 bits (420),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 109/141 (77%), Gaps = 1/141 (1%)
 Frame = -3

Query  548  CHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGT  369
            CHP E F V+GKVYCD CR++FET++S+NI  A V+L+CRN+TTE  T++ E  T+ DG 
Sbjct  22   CHP-EVFDVEGKVYCDTCRVQFETKLSQNIEGATVKLQCRNITTETETFSVEGVTDKDGK  80

Query  368  YMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMK  189
            Y +TVEG+H+++IC+VTV KSPREDCKEA +G EKA++ CSD VGMH+ VRYANPLFFMK
Sbjct  81   YKLTVEGDHQDDICEVTVVKSPREDCKEAVSGYEKARIECSDNVGMHNAVRYANPLFFMK  140

Query  188  EKVSKECAKVLKELDFVPLEM  126
             +  + C + L EL   PLE 
Sbjct  141  AEAVEGCKEALDELGLFPLEF  161



>ref|XP_009794171.1| PREDICTED: anther-specific protein LAT52 [Nicotiana sylvestris]
Length=161

 Score =   164 bits (414),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = -3

Query  548  CHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGT  369
            CHP + F V+GKVYCD CR++FET++SEN+  A VRL+CRN++TE  T++ E  T+ DG 
Sbjct  22   CHP-QVFDVEGKVYCDTCRVQFETKLSENVEGATVRLQCRNISTEIETFSVEGVTDKDGK  80

Query  368  YMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMK  189
            Y +TVEG+H+++IC+VTV KSPREDCKEA  G EKA++ CSD VG+H+ VRYAN LFFMK
Sbjct  81   YKLTVEGDHQDDICEVTVVKSPREDCKEAVTGYEKARIECSDNVGIHNAVRYANALFFMK  140

Query  188  EKVSKECAKVLKELDFVPLEM  126
             +    C +VL EL   PLE 
Sbjct  141  SEAVSGCKEVLDELGLFPLEF  161



>ref|XP_009604804.1| PREDICTED: anther-specific protein LAT52 [Nicotiana tomentosiformis]
Length=161

 Score =   162 bits (409),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = -3

Query  548  CHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGT  369
            C P + F V+GKVYCD CR++FET++SEN+  A VRL+CRN++TE  T++ E  T+ DG 
Sbjct  22   CRP-QVFDVEGKVYCDTCRVQFETKLSENVEGATVRLQCRNISTETETFSVEGVTDKDGK  80

Query  368  YMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMK  189
            Y +TVEG+H+++IC+VTV KSPREDCKE+  G EKA++ CSD VG+H+ VRYANPLFFMK
Sbjct  81   YKLTVEGDHQDDICEVTVVKSPREDCKESVTGYEKARIECSDNVGIHNAVRYANPLFFMK  140

Query  188  EKVSKECAKVLKELDFVPLEM  126
             +    C +VL EL   PLE 
Sbjct  141  TEAVSGCKEVLDELGLFPLEF  161



>ref|XP_006360048.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=161

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = -3

Query  548  CHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGT  369
            CH  E F V+GKVYCD CR++FET++SEN+  A V+L+CRN++TE  T++ E  T+ DG 
Sbjct  22   CHS-EVFDVEGKVYCDTCRVQFETKLSENLDGATVKLQCRNISTEAETFSVEGVTDKDGK  80

Query  368  YMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMK  189
            Y +TV+G+HE +IC+VTV KSPREDCKE+ +G EKA++ CS+ VG+H+ VRYANPLFFMK
Sbjct  81   YKLTVDGDHENDICEVTVVKSPREDCKESVSGYEKARIECSNNVGIHNAVRYANPLFFMK  140

Query  188  EKVSKECAKVLKELDFVPLEM  126
             +  + C + L EL   PLE 
Sbjct  141  AESVQGCKEALDELGLFPLEF  161



>ref|XP_004248244.1| PREDICTED: anther-specific protein LAT52 [Solanum lycopersicum]
 sp|P13447.1|LAT52_SOLLC RecName: Full=Anther-specific protein LAT52; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA33854.1| LAT52 [Solanum lycopersicum]
Length=161

 Score =   157 bits (396),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = -3

Query  548  CHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGT  369
            C P E F V+GKVYCD CR++FET++SEN+  A V+L+CRN++TE  T++ E  T+ DG 
Sbjct  22   CRP-EVFDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK  80

Query  368  YMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMK  189
            Y +TV G+HE +IC+VTV KSPREDCKE+ +G EKA++ CSD VG+H+ VR+ANPLFFMK
Sbjct  81   YKLTVNGDHENDICEVTVVKSPREDCKESVSGYEKARIECSDNVGIHNAVRFANPLFFMK  140

Query  188  EKVSKECAKVLKELDFVPLEM  126
             +  + C + L EL   PLE 
Sbjct  141  AESVQGCKEALDELGLFPLEF  161



>ref|XP_009602640.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana tomentosiformis]
Length=163

 Score =   149 bits (375),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 101/143 (71%), Gaps = 0/143 (0%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
              CH  ++  V+G VYCD CR++F+T++SE I  A VRL C+++ TE+ TY+ E  T+ +
Sbjct  20   AQCHDSQAINVEGSVYCDTCRVQFQTKLSEYIEGATVRLACKDIETEKETYSVEGVTDKN  79

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFF  195
            G Y++ VEG+HE E+C+V++ KSPREDCKE+A G E ++VVCS  VG+H+  RYANPLFF
Sbjct  80   GKYIIKVEGDHENELCEVSIVKSPREDCKESAIGFENSRVVCSANVGIHNPTRYANPLFF  139

Query  194  MKEKVSKECAKVLKELDFVPLEM  126
            MK +    C  VL EL   PLE 
Sbjct  140  MKTEAVSGCKDVLDELGLFPLEF  162



>ref|XP_009778120.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana sylvestris]
Length=163

 Score =   148 bits (373),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 100/143 (70%), Gaps = 0/143 (0%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
              CH  ++  V+G VYCD CR++F+T++SE I  A VRL C+++ TE+ TY+ E  T+ +
Sbjct  20   AQCHDSQAINVEGSVYCDTCRVQFQTKLSEYIEGATVRLACKDIETEKETYSVEGVTDKN  79

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFF  195
            G Y++ VEG+HE E+C+V++ KSPREDCKE A G E ++VVCS  VG+H+  RYANPLFF
Sbjct  80   GKYIIKVEGDHENELCEVSIVKSPREDCKEPAIGFENSRVVCSGNVGIHNPTRYANPLFF  139

Query  194  MKEKVSKECAKVLKELDFVPLEM  126
            MK +    C  VL EL   PLE 
Sbjct  140  MKTEAVSGCKDVLDELGLFPLEF  162



>ref|XP_004251892.1| PREDICTED: anther-specific protein LAT52-like [Solanum lycopersicum]
Length=161

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E+F V+G VYCD CR++F+TRISE I  A V+L CR+M TE+VTYT E  T+ +G Y + 
Sbjct  25   EAFKVEGTVYCDTCRVQFQTRISEYIEGAKVKLTCRDMETEKVTYTAEALTDKNGKYTIE  84

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
              G+HE+E+CDV V +SPREDCK+ A G E ++VVCS+ VGMH+  RYANPLFFMK++  
Sbjct  85   ASGDHEKELCDVGVVQSPREDCKDPAIGFENSRVVCSNNVGMHNPTRYANPLFFMKKETL  144

Query  176  KECAKVLKELDFVPLEM  126
             +C  VL EL   PLE 
Sbjct  145  PDCKDVLDELGLFPLEF  161



>ref|XP_006358942.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=161

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 97/137 (71%), Gaps = 0/137 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E F V+G VYCD CR++F+T+ISENI  A V+L CR+M TE+VTYT E  T+ DG Y + 
Sbjct  25   EVFKVEGTVYCDTCRVQFQTKISENIEGAKVQLTCRDMETEKVTYTTEALTDKDGKYTIE  84

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
              G+HE+E+CDV V  SPREDCKE A G E  +VVCS+ VGMH+  RYANPLFFMK++  
Sbjct  85   ATGDHEKELCDVGVIHSPREDCKEPAIGFENTRVVCSNNVGMHNPTRYANPLFFMKKESL  144

Query  176  KECAKVLKELDFVPLEM  126
              C  VL EL   PLE 
Sbjct  145  PGCKDVLDELGLFPLEF  161



>ref|XP_009761932.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana sylvestris]
Length=164

 Score =   130 bits (327),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E F V+G+V+CD CRL F T +SE I  A VRL CR++ T   TY+ E  T+  G Y +T
Sbjct  25   EVFDVEGRVFCDTCRLGFATSLSEAIQGATVRLTCRDIETHNETYSTEGKTDMIGKYTLT  84

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            VEG+HE +IC+VTV  SPREDCKE  + L K +VVCS  VGMH+ VR+ NPLFF K+K  
Sbjct  85   VEGDHENDICEVTVVNSPREDCKEIVSELVKGRVVCSKNVGMHNAVRFTNPLFFQKDKPV  144

Query  176  KECAKVLKELD  144
              C ++++E++
Sbjct  145  PGCKELVEEME  155



>ref|XP_011098227.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=163

 Score =   127 bits (319),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E F V+G VYCDPCR++FET +S +IA A+VR+ECR++ T+++T++ E  T +DG Y + 
Sbjct  26   EKFYVEGDVYCDPCRVQFETELSYHIAGAMVRVECRDIETKKITFSMEGVTGSDGHYSIM  85

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            V G+HE++IC+V   +SP+ +C E     E+A+V C++  G+H+ +RYANP+ FM  KV 
Sbjct  86   VTGDHEKDICEVIPTRSPKNECSEPMGDYERAKVECTENSGLHNTIRYANPVGFMTPKVL  145

Query  176  KECAKVLKEL  147
             ECA +L +L
Sbjct  146  PECAPILADL  155



>ref|XP_009598969.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana tomentosiformis]
Length=164

 Score =   127 bits (319),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 90/131 (69%), Gaps = 0/131 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E F V+G+V+CD CRL F T +SE I  A V L CR++ T   TY+ E  T+  G Y +T
Sbjct  25   EVFDVEGRVFCDTCRLGFATSLSEVIQGATVGLTCRDIETHNETYSTEGKTDMIGKYTLT  84

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            VEG+HE +IC+VTV  SPREDCKE  + L K +VVCS  VGMH+ VR+ NPLFF K+K  
Sbjct  85   VEGDHENDICEVTVVNSPREDCKEIVSELVKGRVVCSKNVGMHNAVRFTNPLFFQKDKPV  144

Query  176  KECAKVLKELD  144
              C ++++E++
Sbjct  145  PGCKELVEEME  155



>ref|XP_002523378.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
 gb|EEF38957.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
Length=166

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 91/132 (69%), Gaps = 0/132 (0%)
 Frame = -3

Query  524  VKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVEGE  345
            V+GKVYCD CR++FET++SE I    V+LEC+N     +TY  E  T+A G Y + VEGE
Sbjct  32   VEGKVYCDTCRVEFETKLSEVIPGTRVKLECKNRENNTLTYAVEGVTDASGIYRLPVEGE  91

Query  344  HEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKECA  165
            HEE++C+V + KS + DC EA   ++ A+V+ +  VG+    RY NPL FMK+K S EC 
Sbjct  92   HEEDLCEVKLIKSGKPDCAEAFKSVDHARVLLTHNVGVVQPTRYTNPLGFMKQKASPECG  151

Query  164  KVLKELDFVPLE  129
            KVL+++ FVPL+
Sbjct  152  KVLQDMGFVPLD  163



>ref|XP_011070069.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=161

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E F V+G VYCDPCR++FET +S N+A A VRLECR++ T+ VTY+ E  T +DG Y +T
Sbjct  24   EKFHVEGDVYCDPCRVQFETELSYNLAGATVRLECRDIETKTVTYSMEGVTGSDGHYSLT  83

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            V+G+HE++IC+V   KSP+ +C E     E+A++ C++  G+H+ +RYANP+ FM  ++ 
Sbjct  84   VKGDHEKDICEVIPVKSPKAECSEPMGDYERAKIECTENSGLHNPIRYANPIGFMTPEIL  143

Query  176  KECAKVLKEL  147
              C  +L  L
Sbjct  144  PACGPILANL  153



>ref|XP_004244268.1| PREDICTED: anther-specific protein LAT52-like [Solanum lycopersicum]
Length=169

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E+F V+GKV+CD CRL F T +S  +  A VR+ C++M T   T+T E  T+  G Y + 
Sbjct  25   ETFNVEGKVFCDTCRLGFVTSLSNTLEGATVRMTCKDMETHNETFTTEGKTDGIGKYTLK  84

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            VEG+HE +IC+VT+  SP++DCKE    +   +V+CS  VGMH+ VR+ NPLF+ K+K  
Sbjct  85   VEGDHENDICEVTLVNSPKDDCKEVVPDMVNNRVICSKNVGMHNAVRFVNPLFYQKDKPI  144

Query  176  KECAKVLKELDFVPL  132
              CAK+++E++ V L
Sbjct  145  DGCAKLVEEMELVDL  159



>ref|XP_010277041.1| PREDICTED: anther-specific protein LAT52 [Nelumbo nucifera]
Length=165

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 92/140 (66%), Gaps = 0/140 (0%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            G  H  E F V+GKVYCD CR +FET++SE I+ A VRLECR+   ++V Y+ E  T+  
Sbjct  22   GFVHCDEQFFVQGKVYCDTCRTQFETKLSEPISGAKVRLECRSRENDDVAYSVEGETDTT  81

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFF  195
            G Y + VEG HEE+IC+V +  SPR+DC E A GL+ A+V+ S   G+ S  R+AN L F
Sbjct  82   GIYKLPVEGSHEEDICEVKLLSSPRKDCSEPAPGLDHARVLLSSNNGISSASRFANSLGF  141

Query  194  MKEKVSKECAKVLKELDFVP  135
            M  K  + C+ VLKEL  +P
Sbjct  142  MVLKPIEGCSDVLKELGLLP  161



>ref|XP_006348395.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=169

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E F V+GKV+CD CRL F T +S  +  A VRL C++M T   T+T E  T+  G Y +T
Sbjct  25   EIFDVEGKVFCDTCRLGFVTSLSNTLEGATVRLTCKDMETHNETFTTEGKTDYIGKYTLT  84

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            VEG+HE +IC+VT+  SP++DCKE    +   +V+CS  VGMH+ VR+ NPLFF K+K  
Sbjct  85   VEGDHENDICEVTLVNSPKDDCKEIVPDMVNNRVICSKNVGMHNAVRFVNPLFFQKDKPI  144

Query  176  KECAKVLKELDFVPL  132
              C ++++E++ V L
Sbjct  145  NGCRELVEEMELVDL  159



>ref|XP_002316866.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|EEE97478.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=164

 Score =   122 bits (306),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 96/141 (68%), Gaps = 0/141 (0%)
 Frame = -3

Query  551  SCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADG  372
            S +  +   V+GKVYCD CR++F+T+IS+ I  A V+L C N     +TYT E TT++ G
Sbjct  23   SAYAADYLDVEGKVYCDTCRVEFQTKISDAIPGAKVKLVCNNRENGTLTYTVEGTTDSSG  82

Query  371  TYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            TY + V G+HEE+IC+V + +SPR DC E    ++ A+++ +  VG+  N+RYAN L +M
Sbjct  83   TYRLPVVGDHEEDICEVRLVESPRADCNEPFKSVDSARILLTKNVGVVDNLRYANALGYM  142

Query  191  KEKVSKECAKVLKELDFVPLE  129
            K+    ECAKVL+E+ F+P+E
Sbjct  143  KKVAQPECAKVLEEMGFLPVE  163



>ref|XP_007021723.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
 gb|EOY13248.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
Length=162

 Score =   122 bits (305),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 97/136 (71%), Gaps = 1/136 (1%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtte-evtytkettTNADGTYMM  360
            ++F V+GKVYCD CR++FETR+S+ I  A V LECR+ T    +TY++E+ T+  G Y +
Sbjct  26   DTFFVEGKVYCDTCRVEFETRLSQPIKGATVILECRDRTVGGSITYSQESVTDESGKYRI  85

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             V+G+HEEEIC+V V KSPREDC E     ++A+V+ + K G+   +RYAN L F+K++ 
Sbjct  86   PVQGDHEEEICEVRVVKSPREDCNEFMEAWQRARVLLTKKNGVSDPIRYANNLGFLKKEA  145

Query  179  SKECAKVLKELDFVPL  132
               CA+VL+EL F+PL
Sbjct  146  VPGCAEVLEELGFLPL  161



>ref|XP_011006522.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=161

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 92/142 (65%), Gaps = 0/142 (0%)
 Frame = -3

Query  551  SCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADG  372
            S +  +   V+GKVYCDPCR++F+T+ISE I  A V+L C N      TYT E  T++ G
Sbjct  20   SAYAADYLNVEGKVYCDPCRVEFQTKISEGIPAAKVKLVCNNRDNGTETYTVEGATDSSG  79

Query  371  TYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            TY ++V G+HE++IC++ + +S R DC E    ++ A+++ +   G+    RY N L +M
Sbjct  80   TYRLSVAGDHEDDICEIRLVESSRPDCNEPFRSIDSAKILLTKNAGVVDKTRYPNALGYM  139

Query  191  KEKVSKECAKVLKELDFVPLEM  126
            K++   ECA VLKE+ F+PLE+
Sbjct  140  KKEAQPECANVLKEMGFLPLEV  161



>ref|XP_011029563.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=166

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 97/141 (69%), Gaps = 0/141 (0%)
 Frame = -3

Query  551  SCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADG  372
            S +  +   V+GKVYCD CR++F+T+IS+ +  A V+L C N     +TYT E +T++ G
Sbjct  23   SAYAADYLDVEGKVYCDTCRVEFQTKISDALPGAKVKLACNNRENGTLTYTVEGSTDSRG  82

Query  371  TYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            TY + V G+HEE+IC+V + +SPR DC E    ++ A+++ +  VG+ +++RYAN L +M
Sbjct  83   TYRLPVAGDHEEDICEVRLVESPRADCNEPFKSVDSARILLTKNVGVVNSLRYANALGYM  142

Query  191  KEKVSKECAKVLKELDFVPLE  129
            K+    ECAKVL+E+ F+P+E
Sbjct  143  KKVAQPECAKVLEEMGFLPVE  163



>gb|EYU45018.1| hypothetical protein MIMGU_mgv1a015317mg [Erythranthe guttata]
Length=161

 Score =   120 bits (300),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F ++G VYCDPCR++F T +S+ I  A VRLEC+N  T+ VTY+ E  TNADG Y + V+
Sbjct  30   FNIEGDVYCDPCRVQFHTELSKRIPGATVRLECQNEETKAVTYSVEGLTNADGHYSLRVD  89

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
            G+HE+++C V   KSP  +C E    + ++++VC++ +GMHS VR+ANP+ FM +  S +
Sbjct  90   GDHEKDVCVVKAIKSPIAECSEPMTDVRESRIVCTNNIGMHSAVRFANPIGFMTKVGSPQ  149

Query  170  CAKVLKEL  147
            C  VL++ 
Sbjct  150  CIPVLQDF  157



>ref|XP_006370166.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ERP66735.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=161

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 91/142 (64%), Gaps = 0/142 (0%)
 Frame = -3

Query  551  SCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADG  372
            S +  +   V+GKVYCDPCR++F+T+ISE I  A V+L C N      TYT E  T+  G
Sbjct  20   SAYAADYLDVEGKVYCDPCRVEFQTKISEGIPAAKVKLVCNNRDNGTETYTVEGATDNSG  79

Query  371  TYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            TY + V G+HE++IC+V + +S R DC E    ++ A+++ +  VG+    RY N L +M
Sbjct  80   TYRLPVAGDHEDDICEVRLVESSRPDCNEPFRSIDSARILLTKNVGVVDKTRYPNALGYM  139

Query  191  KEKVSKECAKVLKELDFVPLEM  126
            K++   ECA VLKE+ F+PLE+
Sbjct  140  KKEAQPECADVLKEMGFLPLEV  161



>gb|EYU26327.1| hypothetical protein MIMGU_mgv1a015422mg [Erythranthe guttata]
Length=158

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 84/133 (63%), Gaps = 0/133 (0%)
 Frame = -3

Query  545  HPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTY  366
            H  E F V+G VYCDPCR++FET +++ +  A VRLECR++  + VTY+ E  T  +G Y
Sbjct  21   HQTEHFNVEGDVYCDPCRVQFETVLAQRLIGATVRLECRDLVKKAVTYSVEGVTGFNGHY  80

Query  365  MMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKE  186
             + V G+H+ EIC+V V KSPR DC E      K+++ C+   G H+ VR+ANP+ FM  
Sbjct  81   SLPVVGDHQNEICEVAVVKSPRPDCIEPMGDFAKSRISCTTNDGTHAAVRFANPIGFMTG  140

Query  185  KVSKECAKVLKEL  147
                +C  VL +L
Sbjct  141  AAVPQCTPVLFDL  153



>ref|XP_008371469.1| PREDICTED: olee1-like protein [Malus domestica]
Length=172

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 93/144 (65%), Gaps = 3/144 (2%)
 Frame = -3

Query  557  SGSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNA  378
            +G  + GE+  V G VYCD CR++F TRISE +  A VRLECR     ++T +KE  T+ 
Sbjct  19   AGVAYCGETLNVHGIVYCDNCRIQFVTRISETLKGAKVRLECRENEGGKITLSKEADTDD  78

Query  377  DGTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLE---KAQVVCSDKVGMHSNVRYAN  207
             GTY + VEG+HEEE+C+V + KSP+EDC E +  L     A++  ++  G+    R AN
Sbjct  79   LGTYSIPVEGDHEEEVCEVILVKSPKEDCSEISNELHVKLSARISLTNHNGITGPHRMAN  138

Query  206  PLFFMKEKVSKECAKVLKELDFVP  135
            PL FMK++V  +CA+VLKEL   P
Sbjct  139  PLGFMKKEVDPKCAEVLKELGLTP  162



>ref|XP_009348994.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=172

 Score =   117 bits (293),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 92/143 (64%), Gaps = 3/143 (2%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            G  + GE+  V G VYCD CR++F TRISE +  A VRLECR     ++T +KE  T+  
Sbjct  20   GVAYCGETLNVHGIVYCDNCRIQFVTRISETLKGAKVRLECRENEGGKITLSKEADTDDL  79

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLE---KAQVVCSDKVGMHSNVRYANP  204
            GTY + VEG+HEEE+C+V + KSP+EDC E +  L     A++  ++  G+    R ANP
Sbjct  80   GTYSIPVEGDHEEEVCEVILVKSPKEDCSEISNELHVKLSARISLTNHNGITGPHRMANP  139

Query  203  LFFMKEKVSKECAKVLKELDFVP  135
            L FMK++V  +CA+VLKEL   P
Sbjct  140  LGFMKKEVDPKCAEVLKELGLTP  162



>ref|XP_009759546.1| PREDICTED: olee1-like protein [Nicotiana sylvestris]
Length=172

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 90/135 (67%), Gaps = 3/135 (2%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G VYCDPCR  F+T +S+ +A A VRL+CR+  TEEVT T  + TN+ G Y + VE
Sbjct  30   FIVEGIVYCDPCRSAFKTNLSQPLAGAGVRLQCRHPETEEVTITIASQTNSTGYYHLLVE  89

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGL---EKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
            G+HE EIC+  + KSP+EDC E    +   E ++V  ++  GM  N+R AN LFF+ +K 
Sbjct  90   GDHENEICETYLTKSPKEDCSEIPDEVHTKESSRVTLTNNNGMAGNLREANALFFLAKKS  149

Query  179  SKECAKVLKELDFVP  135
            S ECA+  K++ ++P
Sbjct  150  SSECAQEFKDMQYIP  164



>gb|KHG10520.1| Olee1-like protein [Gossypium arboreum]
Length=180

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 93/144 (65%), Gaps = 1/144 (1%)
 Frame = -3

Query  557  SGSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNA  378
            + + +P E F V+G+VYCD CR++FET+IS+ I  A V+LECRN+T E++    +     
Sbjct  23   AAAANPEEKFIVEGRVYCDTCRVEFETKISQPIKGASVKLECRNITNEKIVSHSQDVVTD  82

Query  377  D-GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPL  201
            + G Y + V+G+HE+EIC+V++ KSPR DC E      KA+VV +   G+    R+AN L
Sbjct  83   EAGGYKIEVKGDHEDEICEVSLVKSPRADCNEPTEVWRKARVVLTKADGVSGTYRFANNL  142

Query  200  FFMKEKVSKECAKVLKELDFVPLE  129
             +MK++   EC KVL E+ +  L+
Sbjct  143  GYMKKEALPECKKVLTEMGYFELQ  166



>ref|XP_009617824.1| PREDICTED: olee1-like protein [Nicotiana tomentosiformis]
Length=171

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 91/138 (66%), Gaps = 3/138 (2%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+GKVYCD CR  FE R+S+ +  A VRL+CRN T + VT T E  T+ +G Y + VE
Sbjct  31   FHVEGKVYCDFCRALFENRLSKPMPGAEVRLQCRNSTDDSVTLTVEGQTDKNGVYSLLVE  90

Query  350  GEHEEEICDVTVEKSPREDCKEA---AAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             +HE+EIC++ + KS +EDC E        E A++  +   GM   +R+ANPLFF+K++ 
Sbjct  91   RDHEDEICEMILMKSSKEDCSEIPNEGHAKESARITITSNNGMAETIRHANPLFFVKKEA  150

Query  179  SKECAKVLKELDFVPLEM  126
            + ECA+V KEL+ +P E+
Sbjct  151  APECAEVFKELELLPEEI  168



>gb|KDP32532.1| hypothetical protein JCGZ_14735 [Jatropha curcas]
Length=165

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 88/135 (65%), Gaps = 0/135 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G +  V+GKVYCD CR++FET++SE I  AVV+LEC+      +TY  E  T+  G Y +
Sbjct  27   GANMFVEGKVYCDVCRVEFETKLSEPIKGAVVKLECKIRENNTLTYAVEGETDPQGIYRL  86

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             VEGEHEE+IC+V + KS   DC E     ++A+++ S  VG+    RYANPL +MK++ 
Sbjct  87   PVEGEHEEDICEVRLVKSGMTDCIEPFKSTDRARILLSQNVGVVQASRYANPLGYMKKEA  146

Query  179  SKECAKVLKELDFVP  135
            +  C +VL ++ F+P
Sbjct  147  NPNCGQVLLDMGFLP  161



>emb|CDP06002.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 91/139 (65%), Gaps = 1/139 (1%)
 Frame = -3

Query  545  HPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTY  366
            H  E+FTVKG+VYCDPCR++F+T +S+NI  A V L+CR      VT +++ TT+A+G Y
Sbjct  21   HAQEAFTVKGRVYCDPCRVEFQTSLSKNIEGAEVELQCRVRENGTVTVSQKATTDANGNY  80

Query  365  MMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKE  186
             ++V+G+HEEEIC+V    SP  +C     G  KA+++ +   G+    R+ANPL +   
Sbjct  81   ELSVQGDHEEEICEVASVSSPSLECN-VPFGENKARILLTQNNGVQGTDRFANPLGYKTT  139

Query  185  KVSKECAKVLKELDFVPLE  129
            + + +C  +L+E+ ++P E
Sbjct  140  EANPDCKPILQEMGYIPDE  158



>ref|XP_009773994.1| PREDICTED: olee1-like protein [Nicotiana sylvestris]
Length=173

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 90/138 (65%), Gaps = 3/138 (2%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+GKVYCD CR  FE R+S+ +A A VRL+CRN T + VT T E  T+ +G Y + VE
Sbjct  33   FHVEGKVYCDFCRALFENRLSKPMAGAEVRLQCRNNTDDSVTLTVEGQTDKNGVYSLLVE  92

Query  350  GEHEEEICDVTVEKSPREDCKEA---AAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             +HE+EIC++ + KS  EDC E        E A++  +   GM    R+ANPLFF+K++ 
Sbjct  93   RDHEDEICEMILMKSSMEDCSEIPNEGHAKESARITITSNNGMAETTRHANPLFFVKKQA  152

Query  179  SKECAKVLKELDFVPLEM  126
            + ECA+V KEL+ +P E+
Sbjct  153  APECAEVFKELELLPEEI  170



>ref|XP_008383629.1| PREDICTED: olee1-like protein [Malus domestica]
Length=184

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 88/143 (62%), Gaps = 3/143 (2%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            G  +  E+  V G VYCD CR +F TRISE +  A VRLECR     +VT TKE  T   
Sbjct  20   GVAYSTETLNVHGIVYCDNCRTQFFTRISEPLTGAKVRLECRESEGGKVTLTKEXDTEEL  79

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLE---KAQVVCSDKVGMHSNVRYANP  204
            GTY + VEG+HEEE+C+V + KSP+EDC E +  L     A++  ++  G+    R ANP
Sbjct  80   GTYSIPVEGDHEEEVCEVILVKSPKEDCSEISNELHAKLSARISLTNHNGITGPHRMANP  139

Query  203  LFFMKEKVSKECAKVLKELDFVP  135
            L FMK++V   CA+VLKEL   P
Sbjct  140  LGFMKKEVDPRCAEVLKELGLTP  162



>ref|XP_009352776.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=180

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 88/143 (62%), Gaps = 3/143 (2%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            G  +  E+  V G VYCD CR +F TRISE +  A VRLECR     +VT TKE  T   
Sbjct  20   GVAYCAETLNVHGIVYCDNCRTQFFTRISEPLTGAKVRLECRESEGGKVTLTKEADTEEL  79

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLE---KAQVVCSDKVGMHSNVRYANP  204
            GTY + VEG+HEEE+C+V + KSP+EDC E +  L     A++  ++  G+    R ANP
Sbjct  80   GTYSIPVEGDHEEEVCEVILVKSPKEDCSEISNELHAKLSARISLTNHNGITGPHRMANP  139

Query  203  LFFMKEKVSKECAKVLKELDFVP  135
            L FMK++V   CA+VLKEL   P
Sbjct  140  LGFMKKEVDPRCAEVLKELGLTP  162



>ref|XP_009396935.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 83/125 (66%), Gaps = 0/125 (0%)
 Frame = -3

Query  524  VKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVEGE  345
            V+G+VYCD CR  FET  +E IA A V+LEC+N TT E+ +T + TT+A G Y +TV  +
Sbjct  32   VEGRVYCDTCRAGFETTATEYIAGAKVKLECKNYTTGEIIHTNQATTDATGKYQITVVDD  91

Query  344  HEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKECA  165
            H+EE C VT+  SPR DC E + G   A VV +  VG+ S VRYAN L F+KEK  + C 
Sbjct  92   HQEETCQVTLISSPRSDCSEISEGRNSALVVVTHNVGITSGVRYANSLGFLKEKPLETCG  151

Query  164  KVLKE  150
            ++L +
Sbjct  152  QLLLQ  156



>gb|KHG25858.1| Olee1-like protein [Gossypium arboreum]
Length=166

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V GKVYCD CR++FET++SE I  A V+LECR    E VTY+ E  T+A+G Y + VE
Sbjct  33   FVVLGKVYCDTCRVEFETKLSEPIPGAKVKLECRKEGDETVTYSHEAETDANGVYKIPVE  92

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
            G+HEE+IC V+   SPR DC E     EKAQV  +   G+    R AN L F K+     
Sbjct  93   GDHEEQICAVSTVSSPRADCNEKMEAFEKAQVELTSDDGLAEPSRKANNLGFKKKVAVPG  152

Query  170  CAKVLKELDFVPL  132
            CA+VLKE+ F PL
Sbjct  153  CAQVLKEMGF-PL  164



>emb|CDP16229.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 90/139 (65%), Gaps = 1/139 (1%)
 Frame = -3

Query  545  HPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTY  366
            H  E+FTVKG+VYCDPCR++F+T +S++I  A V L+CR      VT +++ TT+A+G Y
Sbjct  21   HAQEAFTVKGRVYCDPCRVEFQTSLSKSIEGAEVELQCRVRENGTVTVSQKATTDANGNY  80

Query  365  MMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKE  186
             ++ +G+HEEEIC+V    SP ++C    A   KA+V+ +   G+    RYAN L +   
Sbjct  81   ELSAQGDHEEEICEVVSVSSPSQECNVPFAE-NKARVLLTQNNGVQGTDRYANALGYKTT  139

Query  185  KVSKECAKVLKELDFVPLE  129
            K + +C  +L+E+ ++P E
Sbjct  140  KTNPDCKAILQEMGYIPDE  158



>emb|CDP16230.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 90/139 (65%), Gaps = 1/139 (1%)
 Frame = -3

Query  545  HPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTY  366
            H  E+FTVKG+VYCDPCR++F+T +S++I  A V L+CR    E VT +++  T+A G Y
Sbjct  21   HAQEAFTVKGRVYCDPCRVEFQTSLSKSIEGAEVELQCRVRENETVTVSQKAKTDAIGNY  80

Query  365  MMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKE  186
             ++V+G+HEEEIC+V    SP ++C     G  KA+V+ +   G+    RYAN L +   
Sbjct  81   ELSVQGDHEEEICEVVSVSSPSQECN-VPFGENKARVLLTQNNGVQGTDRYANALGYKTA  139

Query  185  KVSKECAKVLKELDFVPLE  129
            + + +C  VL+E+ ++P E
Sbjct  140  EANPDCKAVLQEMGYIPDE  158



>ref|XP_004233077.1| PREDICTED: major pollen allergen Lig v 1-like [Solanum lycopersicum]
Length=175

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F ++G VYCDPCR  F+T +SE + DA V ++CR+  TE VT T   +TN+ G Y M +E
Sbjct  33   FILEGMVYCDPCRSIFKTNLSEPVVDARVGMQCRHPETERVTITVTASTNSTGYYHMLIE  92

Query  350  GEHEEEICDVTVEKSPREDCKEAAA---GLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
            G+HE EIC+  + KSP+EDC E        E ++V  + K G+    R +NPLFF+ +KV
Sbjct  93   GDHENEICETYLIKSPKEDCSEIPTEGHTRELSRVTLTSKNGIAGKNRESNPLFFLTKKV  152

Query  179  SKECAKVLKELDFVP  135
            + EC +  KE++++P
Sbjct  153  APECQQEFKEMEYLP  167



>ref|XP_009608960.1| PREDICTED: olee1-like protein [Nicotiana tomentosiformis]
Length=172

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G VYCDPCR  F+T +S+ +A A VRL+CR+  TEEVT T  + TN  G Y + VE
Sbjct  30   FIVEGIVYCDPCRSAFKTNLSQPLAGAGVRLQCRHPETEEVTITIASETNTTGYYHLLVE  89

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGL---EKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
            G+HE EIC+  + KS +EDC E    +   E ++V  ++  G+  N+R AN LFF+ +  
Sbjct  90   GDHENEICETYLTKSSKEDCSEIPDEVHTKESSRVTLTNNNGIAGNLREANALFFLAKNA  149

Query  179  SKECAKVLKELDFVP  135
            S ECA+  K++ ++P
Sbjct  150  SSECAQEFKDMQYIP  164



>ref|XP_007212169.1| hypothetical protein PRUPE_ppa012463mg [Prunus persica]
 gb|EMJ13368.1| hypothetical protein PRUPE_ppa012463mg [Prunus persica]
Length=168

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 87/143 (61%), Gaps = 3/143 (2%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            G  +  ++ +V G VYCD CR++F TRISE +  A V+LECR+     VT + ET T+  
Sbjct  21   GFAYCADNLSVDGLVYCDNCRIQFMTRISEPLQGATVKLECRDREGGTVTLSSETDTDEQ  80

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLE---KAQVVCSDKVGMHSNVRYANP  204
            G Y + VEG+HEEE+C+V + KSPR+DC E +        A++  ++  G+    R  NP
Sbjct  81   GRYQIPVEGDHEEEVCEVLLVKSPRDDCSEVSTDSHAKLSARISLTNNNGIAGPHRIPNP  140

Query  203  LFFMKEKVSKECAKVLKELDFVP  135
            L F+K +   +CA+VLKEL   P
Sbjct  141  LGFLKTEPDAKCAEVLKELGLTP  163



>ref|XP_009403224.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 84/127 (66%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F ++G+VYCD CR  FET +S+ I  A V+L+CR+  T+ + +T    T+  GTY + VE
Sbjct  27   FVIQGRVYCDTCRAGFETVVSQYIPGAKVKLQCRHYETDSIEHTAVGVTDGTGTYNIEVE  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
              HEEEIC+V++ +SP   C E +    +A+V+ + + G+ S+VRYAN L F+K++  KE
Sbjct  87   DNHEEEICEVSLVQSPVPGCSEVSGTRNRARVLVTGRNGLASDVRYANSLGFLKDEPLKE  146

Query  170  CAKVLKE  150
            C  +L++
Sbjct  147  CGLLLQQ  153



>gb|ACG33223.1| pollen-specific protein C13 precursor [Zea mays]
Length=167

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 85/128 (66%), Gaps = 0/128 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            + ++G+VYCD CR  F T ++E IA A VRLEC++  T ++  + +  T+A+GTY + ++
Sbjct  32   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERSIDGVTDANGTYTIELK  91

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
              HEE+IC+V + +SPR+DC +  A  ++A V+ +  VG+  N+R ANPL + K+     
Sbjct  92   DSHEEDICEVVLVESPRKDCDQVQADRDRAGVLLTRNVGISDNLRPANPLGYFKDVPLPI  151

Query  170  CAKVLKEL  147
            CA +LK+L
Sbjct  152  CASLLKQL  159



>ref|XP_007225977.1| hypothetical protein PRUPE_ppa012675mg [Prunus persica]
 gb|EMJ27176.1| hypothetical protein PRUPE_ppa012675mg [Prunus persica]
Length=159

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 84/128 (66%), Gaps = 0/128 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            FTV+GKV+CDPCR  FET  +  I  A VRLECR+  T ++ YTKE  T++ GTY + V 
Sbjct  27   FTVEGKVFCDPCRAGFETSATTYIPGATVRLECRDRKTMDIRYTKEGRTDSTGTYKIPVT  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +HE++ CD  +  S ++DC  AA G ++A+V+ +   G+ S  R+AN + FMK +    
Sbjct  87   EDHEDQFCDAVLVSSSQKDCAAAAPGRDRARVILTGYNGIASYNRFANAMGFMKNEAVSG  146

Query  170  CAKVLKEL  147
            CA++LK+L
Sbjct  147  CAQILKQL  154



>gb|ACF82695.1| unknown [Zea mays]
 tpg|DAA38042.1| TPA: pollen-specific protein C13 [Zea mays]
Length=167

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 85/128 (66%), Gaps = 0/128 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            + ++G+VYCD CR  F T ++E IA A VRLEC++  T ++  + +  T+ +GTY + ++
Sbjct  32   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERSIDGVTDGNGTYTIELK  91

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
              HEE+IC+V + +SPR+DC +  A  ++A V+ +  VG+  N+R ANPL ++K+     
Sbjct  92   DSHEEDICEVVLVESPRKDCDQVQADRDRAGVLLTRNVGISDNLRPANPLGYLKDVPLPI  151

Query  170  CAKVLKEL  147
            CA +LK+L
Sbjct  152  CASLLKQL  159



>ref|XP_009421183.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = -3

Query  533  SFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTV  354
            +F ++G+VYCD CR  FET  ++ I  A V+LECR   T  V  T    T+A GTY + V
Sbjct  26   TFRIQGRVYCDKCRAGFETSATDYIEGAKVKLECRQYDTGVVEQTATAVTDASGTYTLEV  85

Query  353  EGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
            E  HEEEIC+V + +SPR  C E   G ++A+V+ S + G+ ++VRYAN L F+      
Sbjct  86   EDNHEEEICEVVLVESPRPGCSEIMTGRDRARVLISAESGLTTSVRYANSLGFLNAAPLP  145

Query  173  ECAKVLKE  150
            EC  +L++
Sbjct  146  ECGLLLQK  153



>gb|ADI55168.1| AS1 [Gossypium hirsutum]
Length=182

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD-GTYMMTV  354
            F V G VYCD CR++FET ISE I  A VRLECRN T E++TY     T  D G Y + V
Sbjct  40   FEVLGHVYCDTCRVEFETSISEPIPGATVRLECRNRTDEKITYQSPEITAGDKGNYKIQV  99

Query  353  EGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
             G++EE  CDV + KSPR DC +      KA+VV +   G+   +R+AN L F K++   
Sbjct  100  TGDYEESDCDVMLVKSPRADCNDPTEEWRKARVVLTTLDGVSGEIRFANNLGFKKKEALP  159

Query  173  ECAKVLKELDFVPLE  129
            EC KVL E+ +  L+
Sbjct  160  ECTKVLTEMGYFELQ  174



>gb|KHG13789.1| Anther-specific LAT52 [Gossypium arboreum]
Length=188

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 84/142 (59%), Gaps = 1/142 (1%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRN-MtteevtytkettTNA  378
            G+      + V G VYCD CR++FET++SE I+ AVV+LECRN         + E   ++
Sbjct  25   GAAEENMHYMVVGHVYCDTCRVEFETKLSEPISGAVVKLECRNRTNEAITFQSSEIVADS  84

Query  377  DGTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLF  198
             G Y + VEG++EE  CDV + +SPR DC +      K++VV +   G+ + +R+AN L 
Sbjct  85   HGDYHIIVEGDYEESDCDVALVRSPRADCSDPTEAWRKSRVVLTTFDGLSNKLRFANNLG  144

Query  197  FMKEKVSKECAKVLKELDFVPL  132
            F K+    +C ++LKE+ +  L
Sbjct  145  FKKDIALPQCTRILKEMGYYEL  166



>sp|O49813.1|OLEE1_BETPN RecName: Full=Olee1-like protein; Flags: Precursor [Betula pendula]
 emb|CAA74365.1| putative Ole e 1 protein [Betula pendula]
Length=166

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 88/143 (62%), Gaps = 3/143 (2%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            G  +    F V+GKVYCD CR +F T++S  +  A V LECRN     + Y+ ++ T+  
Sbjct  19   GFAYSESRFFVEGKVYCDNCRTQFVTKLSTYMKGAKVSLECRNREGGTLIYSSDSETDKS  78

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAG--LEK-AQVVCSDKVGMHSNVRYANP  204
            GTY + V+G+HEEEIC++ ++KS   DC E +    L+K A++  +   G+ + VR ANP
Sbjct  79   GTYRIPVDGDHEEEICEIALKKSSDPDCSEVSKDPFLKKSARISLTKNNGISTPVRLANP  138

Query  203  LFFMKEKVSKECAKVLKELDFVP  135
            L FMK+K   ECAK L+EL   P
Sbjct  139  LGFMKKKPLPECAKALRELGMNP  161



>ref|XP_009408781.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 77/128 (60%), Gaps = 0/128 (0%)
 Frame = -3

Query  533  SFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTV  354
            +  V+G+VYCD CR  FET+ +E I  A V+LEC+N TT   T T    TN  GTY + V
Sbjct  29   NLVVEGRVYCDTCRAGFETKATEYIEGAKVKLECKNYTTGASTLTAVAVTNNKGTYQIPV  88

Query  353  EGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
              +H+EE C V +  SPR DC E + G   A VV +  VG+ S+VRYAN L F+K+    
Sbjct  89   SDDHQEESCAVMLVSSPRSDCSEISDGRNHAAVVLTHNVGITSSVRYANSLGFLKDVPLA  148

Query  173  ECAKVLKE  150
             C ++L +
Sbjct  149  SCGQMLMQ  156



>ref|NP_001148343.1| LOC100281953 precursor [Zea mays]
 gb|ACG30892.1| pollen-specific protein C13 precursor [Zea mays]
Length=167

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 84/128 (66%), Gaps = 0/128 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            + ++G+VYCD CR  F T ++E IA A VRLEC++  T ++  + +  T+ +GTY   ++
Sbjct  32   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERSIDGVTDGNGTYTXELK  91

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
              HEE+IC+V + +SPR+DC +  A  ++A V+ +  VG+  N+R ANPL ++K+     
Sbjct  92   DSHEEDICEVVLVESPRKDCDQVQADRDRAGVLLTRNVGISDNLRPANPLGYLKDVPLPI  151

Query  170  CAKVLKEL  147
            CA +LK+L
Sbjct  152  CASLLKQL  159



>gb|AAN76546.1|AF393475_1 LLP-B3 protein [Lilium longiflorum]
Length=160

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 80/130 (62%), Gaps = 0/130 (0%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            P  +F V+G+VYCD CR  FET I+  I  A V+LECR+   + + +T E  TN+ GTY 
Sbjct  24   PNPTFIVEGRVYCDSCRAGFETNITTYIEGAKVKLECRHFDNDSIAHTVEGVTNSTGTYS  83

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEK  183
            + +E +HE EIC+V +  SP  DC E     ++A+V  ++  G+ S +RYAN L F++E+
Sbjct  84   IQLENDHESEICEVVLVSSPIFDCNEIDYDRDRARVTLTNNNGIDSPIRYANSLGFLQEQ  143

Query  182  VSKECAKVLK  153
                C  +LK
Sbjct  144  PDIICGDLLK  153



>ref|XP_009402012.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   103 bits (258),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F ++G+VYCD CR  F+T +S+ IA A V+L+CRN  T+ V +  E  T++ GTY + VE
Sbjct  27   FVIEGRVYCDTCRAGFQTAVSQYIAGAKVKLQCRNYETDAVEHLVEAVTDSTGTYHIEVE  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEK  183
              HEEEIC+V++ +SP+  C E A    +A+++ + + G+ S++RYAN L F+K++
Sbjct  87   DSHEEEICEVSLLQSPQPGCTEVAQSRNRARILVTGRSGLASDIRYANSLGFLKDE  142



>ref|XP_008234009.1| PREDICTED: pollen-specific protein C13 [Prunus mume]
Length=159

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 83/128 (65%), Gaps = 0/128 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            FTV+GKVYCD CR  FET  +  I  A VRLECR+  T ++ YTKE  T++ GTY + V 
Sbjct  27   FTVEGKVYCDTCRAGFETSATTYIPGATVRLECRDRKTMDIRYTKEGRTDSTGTYKIPVT  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +HE++ CD  +  S ++DC  AA G ++A+V+ +   G+ S  R+AN + FMK +    
Sbjct  87   EDHEDQFCDAVLVSSSQKDCAAAAPGRDRARVILTGYNGIASYNRFANAMGFMKNEAVPG  146

Query  170  CAKVLKEL  147
            CA++LK+L
Sbjct  147  CAQILKQL  154



>ref|XP_009334049.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   103 bits (257),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 83/129 (64%), Gaps = 1/129 (1%)
 Frame = -3

Query  533  SFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTV  354
            +  V+GKVYCDPCR++FETR+S  I  A V LECR+     + Y  E  T+ +G Y +  
Sbjct  31   TLFVEGKVYCDPCRVQFETRLSTPIDGATVALECRSRENGTIVYVVEGKTDKNGIYSLAT  90

Query  353  EGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
              E EE+IC+V   +SP ++C +    +E+A+++ +   G+++  RYANPL FMK++ + 
Sbjct  91   HKEFEEQICEVRTVRSPTDECAD-HFDIERARILLTHNNGVNALARYANPLGFMKKESTS  149

Query  173  ECAKVLKEL  147
            EC  VLKEL
Sbjct  150  ECEAVLKEL  158



>ref|XP_011016068.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011027685.1| PREDICTED: pollen-specific protein C13 isoform X1 [Populus euphratica]
 ref|XP_011027686.1| PREDICTED: pollen-specific protein C13 isoform X2 [Populus euphratica]
Length=159

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = -3

Query  551  SCHPGES-FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            +  PG + F+V+G+VYCD C   FET  +  IA + V++ECR+  T+++ Y+KE TT++ 
Sbjct  19   AARPGRNPFSVQGRVYCDTCHAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDST  78

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFF  195
            GTY++TV+ +H+++ICD  +  SPR+DC   +AG E+A+V+ ++  G+ S  RYAN + F
Sbjct  79   GTYIITVDEDHKDQICDAMLVSSPRQDCSSPSAGRERARVILTNYNGLVSTTRYANSMGF  138

Query  194  MKEKVSKECAKVLK  153
            M  +    C ++L+
Sbjct  139  MAAQPMSGCTELLR  152



>gb|EPS72638.1| hypothetical protein M569_02120, partial [Genlisea aurea]
Length=161

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 78/127 (61%), Gaps = 1/127 (1%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLEC-RNMtteevtytkettTNADGTYMMTV  354
            F V G+VYCDPCR++F T +S  +  A VRL+C R   T  +TY+ E  T  DG Y + V
Sbjct  35   FDVVGEVYCDPCRVQFMTELSRRLVGATVRLQCHRYNDTGCITYSVEGKTGFDGRYRLQV  94

Query  353  EGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
            +G+HE ++C V V  SPR DC      + ++++VC+  VG+ S VRYANPL FM    + 
Sbjct  95   KGDHESDLCFVKVIGSPRADCAVPMTDVVESRIVCTKNVGISSPVRYANPLGFMTRAAAP  154

Query  173  ECAKVLK  153
             C  VLK
Sbjct  155  RCLPVLK  161



>ref|XP_002307393.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK95954.1| unknown [Populus trichocarpa]
 gb|EEE94389.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 85/126 (67%), Gaps = 0/126 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G VYCD C   FET  + NIA A VRLEC++  T+++ Y+KE TT++ G Y +TV+
Sbjct  27   FVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDSTGKYTITVD  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +HE++ICD  +  SPR+DC+  +AG ++A+V+ ++  G+ S  RYAN + FM  +    
Sbjct  87   EDHEDQICDCMLVSSPRKDCRSPSAGRDRARVILTNDNGLVSTTRYANAMGFMAAQPMSG  146

Query  170  CAKVLK  153
            C ++L+
Sbjct  147  CTELLR  152



>ref|XP_010057097.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
 gb|KCW74109.1| hypothetical protein EUGRSUZ_E02748 [Eucalyptus grandis]
Length=168

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 89/139 (64%), Gaps = 3/139 (2%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            G+ +    F V+GKVYCD CR +F T++S+++ DA VRLEC++     VTY+ E  T+  
Sbjct  22   GAVYGDSRFFVEGKVYCDTCRTQFITKVSKDMPDAKVRLECKDREGGSVTYSIEGVTDNT  81

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAG--LEK-AQVVCSDKVGMHSNVRYANP  204
            G Y + V+GEHEEEIC++ + KS +  C+E +    L K A++  +   GM + VR ANP
Sbjct  82   GMYRLPVDGEHEEEICEIVLVKSSQPGCEEVSNDPFLRKTARISLTKNNGMATPVRQANP  141

Query  203  LFFMKEKVSKECAKVLKEL  147
            L +MK +   ECA VL+EL
Sbjct  142  LGYMKNESLPECADVLREL  160



>ref|XP_008359333.1| PREDICTED: olee1-like protein [Malus domestica]
Length=166

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 82/130 (63%), Gaps = 1/130 (1%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E+  V+GKVYCDPCR++FETR+S  +  A V LECR+     + YT E  T+ +G Y + 
Sbjct  30   ETLFVEGKVYCDPCRVQFETRLSTPLDGATVALECRSRENGTMVYTLEGKTDKNGIYSLP  89

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
             +   EE+IC+V    SP  DC +    +EKA+++ +   G+ +  RYANPL FMK++ +
Sbjct  90   ADKNFEEQICEVRTVSSPTGDCAD-HFDIEKARILLTHNNGVKAMARYANPLGFMKKEST  148

Query  176  KECAKVLKEL  147
             EC  VLKEL
Sbjct  149  TECEAVLKEL  158



>ref|NP_001131377.1| uncharacterized protein LOC100192702 precursor [Zea mays]
 gb|ACF79764.1| unknown [Zea mays]
 gb|AFW82076.1| hypothetical protein ZEAMMB73_949741 [Zea mays]
Length=164

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 79/135 (59%), Gaps = 1/135 (1%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            PG  F V G++YCD CR  FET +S  I  A V +ECR+  +++V    E TT   G Y 
Sbjct  22   PGVGFVVTGRIYCDNCRAGFETNVSHAIQGATVEMECRHFESQQVHDKAEATTGPGGWYR  81

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKE  186
            M + G+H++EICDV + KSP  DC E     ++ +V  +   G+  S VRYANP+ F+++
Sbjct  82   MEISGDHQDEICDVRLLKSPEADCAEIDHSRDRCRVPLTRNDGIKQSGVRYANPIAFLRK  141

Query  185  KVSKECAKVLKELDF  141
            +    C ++L+  D 
Sbjct  142  EPLPNCGELLRAYDL  156



>ref|XP_002522577.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
 gb|EEF39877.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
Length=171

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 84/140 (60%), Gaps = 5/140 (4%)
 Frame = -3

Query  539  GES-FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevty-tkettTNADGTY  366
            GES FTV+GKVYCD CR++F T+ +  I  A VRLEC++         + E  T+A GTY
Sbjct  27   GESHFTVEGKVYCDTCRVQFITKATSYIKGARVRLECKDREGGGAITFSAEAETDATGTY  86

Query  365  MMTVEGEHEEEICDVTVEKSPREDCKEAAAGL---EKAQVVCSDKVGMHSNVRYANPLFF  195
             + V GEHEEE+C++   KSP  DC E        + AQ+  ++  G+ S  R ANP+ F
Sbjct  87   HIPVNGEHEEELCEIIPLKSPDPDCNEINQDPFVKKAAQITLTNHNGIASPTRSANPIGF  146

Query  194  MKEKVSKECAKVLKELDFVP  135
            +K++   EC+ +L+E+   P
Sbjct  147  LKQQAVPECSGILREMGITP  166



>ref|XP_009340070.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 81/130 (62%), Gaps = 1/130 (1%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E+  V+GKVYCDPCR++FETR+S  +  A V LECR+     + Y  E  T+ +G Y + 
Sbjct  30   ETLFVEGKVYCDPCRVQFETRLSTPLDGATVALECRSRENGTMVYRLEGKTDKNGIYSLP  89

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
             +   EE+IC+V    SP  DC +    +EKA+++ +   G+ +  RYANPL FMK++ +
Sbjct  90   ADKNFEEQICEVRTVSSPTGDCAD-HFDIEKARILLTHNNGVKAMARYANPLGFMKKEST  148

Query  176  KECAKVLKEL  147
             EC  VLKEL
Sbjct  149  PECEAVLKEL  158



>sp|Q7M1X5.1|LOLB_LOLPR RecName: Full=Major pollen allergen Lol p 11; AltName: Full=Allergen 
Lol p XI; AltName: Allergen=Lol p 11 [Lolium perenne]
 prf||2118270A allergen Lol p XI
Length=134

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 77/130 (59%), Gaps = 1/130 (1%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G  F V G+VYCDPCR  FET +S N+  A V ++CR     E     E TT+ DG Y +
Sbjct  3    GPGFVVTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKI  62

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKEK  183
             ++ +H+EEIC+V + KSP + C E     ++A+V  +   G+    +RYANP+ F +++
Sbjct  63   EIDQDHQEEICEVVLAKSPDKSCSEIEEFRDRARVPLTSNXGIKQQGIRYANPIAFFRKE  122

Query  182  VSKECAKVLK  153
              KEC  +L+
Sbjct  123  PLKECGGILQ  132



>ref|XP_004960638.1| PREDICTED: pollen allergen Phl p 11-like [Setaria italica]
Length=172

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 80/132 (61%), Gaps = 1/132 (1%)
 Frame = -3

Query  545  HPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTY  366
             P +   V G+VYCD CR  FET  S NIA A V++ECR+  T ++    E TT+A G Y
Sbjct  29   QPHKGLVVTGRVYCDNCRAGFETTASHNIAGATVQMECRHFETMQLHDKAEATTDAGGWY  88

Query  365  MMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSN-VRYANPLFFMK  189
             M +  +H+EEIC+V + KSP  DC E     +++++  +   GM  N VRYANP+ F +
Sbjct  89   RMDIGDDHQEEICEVVLLKSPEADCAEIEQFRDRSRIALTRNNGMEQNAVRYANPIAFFR  148

Query  188  EKVSKECAKVLK  153
            ++  + C ++L+
Sbjct  149  KEPLQNCGEILR  160



>ref|NP_001105351.1| pollen-specific protein C13 precursor [Zea mays]
 sp|P33050.1|PSC13_MAIZE RecName: Full=Pollen-specific protein C13; Flags: Precursor [Zea 
mays]
 gb|AAB23277.1| pollen specific protein [Zea mays]
 gb|AFW58125.1| male-gametophyte specific1 [Zea mays]
 prf||2209273A Zm13
Length=170

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            + ++G+VYCD CR  F T ++E IA A VRLEC++  T ++    +  T+A GTY + ++
Sbjct  35   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERAIDGVTDATGTYTIELK  94

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
              HEE+IC V +  SPR+DC E  A  ++A V+ +  VG+  ++R ANPL + K+     
Sbjct  95   DSHEEDICQVVLVASPRKDCDEVQALRDRAGVLLTRNVGISDSLRPANPLGYFKDVPLPV  154

Query  170  CAKVLKEL  147
            CA +LK+L
Sbjct  155  CAALLKQL  162



>ref|XP_006652233.1| PREDICTED: pollen-specific protein C13-like [Oryza brachyantha]
Length=166

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 82/130 (63%), Gaps = 0/130 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            + V+G+VYCD CR  FET ++E I  A VRLEC++  T  +    +  T+  GTY + ++
Sbjct  31   YLVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHYGTGNIERAVDGVTDETGTYKIELK  90

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
              HEE+IC+V + KSP  +C E  A  ++A+V+ +  VG+  N+R+ANPL ++K+     
Sbjct  91   DSHEEDICEVVLVKSPLANCGEVQAERDRARVLLTRNVGICDNLRFANPLGYLKDIPLPV  150

Query  170  CAKVLKELDF  141
            C ++LK+ D 
Sbjct  151  CGELLKQFDL  160



>ref|XP_011085997.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=170

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 82/136 (60%), Gaps = 4/136 (3%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V G+VYC+ CRL F  ++SE +  A V+LEC+      +TYT+E  TN  G Y + VE
Sbjct  32   FFVVGEVYCEVCRLNFINKLSEPMPGAKVKLECKGEEAGNITYTQEGETNEGGQYRLKVE  91

Query  350  GEHEEEICDVTVEKSPREDCK----EAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEK  183
            G+HEEE C +T+ KS R DC     E  A    + +  +   G H + RYANPL F K+K
Sbjct  92   GDHEEEECGITLVKSSRADCNEIPDEGWASKPSSLITLTKNNGFHGSSRYANPLGFTKKK  151

Query  182  VSKECAKVLKELDFVP  135
             + ECA+++KEL+  P
Sbjct  152  ANPECAELIKELEINP  167



>gb|KCW69946.1| hypothetical protein EUGRSUZ_F03264 [Eucalyptus grandis]
Length=167

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 86/141 (61%), Gaps = 1/141 (1%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            G  +  E   V GKV+CD CR+ FET++S  +AD+ VRLEC N T+  +T + E  T+  
Sbjct  22   GFAYGHEKLDVVGKVFCDTCRVDFETKVSYGLADSKVRLECHNRTSGALTLSAEAVTDKT  81

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAG-LEKAQVVCSDKVGMHSNVRYANPLF  198
            G Y + VEG+HEEEIC+V + +S   +C     G +  A+V  ++K G+    R+AN L 
Sbjct  82   GEYRLEVEGDHEEEICEVQLIESSEPECSSLLEGAVHNARVALTNKNGVAQPARFANALA  141

Query  197  FMKEKVSKECAKVLKELDFVP  135
            F K++   +CA+VL E+  +P
Sbjct  142  FAKKETLADCAQVLLEMGVLP  162



>gb|EYU43331.1| hypothetical protein MIMGU_mgv1a014984mg [Erythranthe guttata]
Length=171

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 87/149 (58%), Gaps = 4/149 (3%)
 Frame = -3

Query  560  GSGSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTN  381
            G+ S      F+V+G VYC+ CR  F  ++S+ +A A VRL+C+  T   +TY+ E  T+
Sbjct  23   GAQSNAAATKFSVEGDVYCEVCRTNFINKLSQPMAGATVRLQCKGETEGNITYSLEGITD  82

Query  380  ADGTYMMTVEGEHEEEICDVTVEKSPREDCK----EAAAGLEKAQVVCSDKVGMHSNVRY  213
              G Y +TVEG+H E+ C++T+ +S R DC     E  A    +++  +   G H N R 
Sbjct  83   DKGQYHLTVEGDHGEDECEITLVRSSRPDCNVVPDEGWATKPTSRITLTKNSGFHDNTRK  142

Query  212  ANPLFFMKEKVSKECAKVLKELDFVPLEM  126
            ANPL F K+K   +CA++ KEL+  P E+
Sbjct  143  ANPLGFTKKKADPQCAQLFKELEINPEEL  171



>ref|XP_006857531.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
 gb|ERN18998.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
Length=159

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 82/130 (63%), Gaps = 0/130 (0%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            P  +F V+G+VYCD CR  FET  +  I  + VRLEC++  T ++TY+ E  T+A GTY 
Sbjct  23   PTPNFEVEGRVYCDTCRAGFETSATTYIKGSTVRLECKDRATHQLTYSIEGVTDATGTYR  82

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEK  183
            + V  + + EIC+V V  SP   C +A  G E+A+V+ +   G+ SN RYAN L F+K++
Sbjct  83   LPVSDDRQHEICEVVVVSSPEAGCGKAMLGRERARVLLTHNNGIVSNTRYANALAFLKDE  142

Query  182  VSKECAKVLK  153
                CA++LK
Sbjct  143  PLPRCAELLK  152



>ref|XP_007213539.1| hypothetical protein PRUPE_ppa019680mg [Prunus persica]
 gb|EMJ14738.1| hypothetical protein PRUPE_ppa019680mg [Prunus persica]
Length=163

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 81/126 (64%), Gaps = 1/126 (1%)
 Frame = -3

Query  524  VKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVEGE  345
            V+G+VYCDPCR++FETR+S  +  AVV LECR      + YT +  T+ +G Y +  + +
Sbjct  31   VEGRVYCDPCRVQFETRLSVPLEGAVVALECRGRENGTLAYTLQGKTDKNGIYSLPTDED  90

Query  344  HEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKECA  165
             EE+IC+V    SPR +C E     E+A+V+ +   G+ S  RYANPL FM+++   EC 
Sbjct  91   MEEQICEVRTVSSPRANCNEHFE-FERARVLLTYNNGVKSMARYANPLGFMQKESVTECE  149

Query  164  KVLKEL  147
            +VLKEL
Sbjct  150  QVLKEL  155



>ref|XP_011080816.1| PREDICTED: major pollen allergen Ole e 1-like [Sesamum indicum]
Length=166

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 83/136 (61%), Gaps = 4/136 (3%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V G+VYC+ CR+ F  ++SE +  A V+LECR   T  +TYT+E  TN  G Y + VE
Sbjct  28   FFVVGEVYCEVCRINFINKLSEPMPGAKVKLECRGEETGNITYTQEGVTNEAGQYRLKVE  87

Query  350  GEHEEEICDVTVEKSPREDC----KEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEK  183
            G+HEEE C +T+ KS R DC     E  A    + +  +   G H + RYANPL F K+K
Sbjct  88   GDHEEEECGITLVKSGRADCDEIPNEGWASKPSSLITLTKNNGFHGSSRYANPLGFTKKK  147

Query  182  VSKECAKVLKELDFVP  135
             + ECA+++KEL+  P
Sbjct  148  ANHECAELIKELEIDP  163



>ref|XP_004485892.1| PREDICTED: olee1-like protein-like [Cicer arietinum]
Length=165

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            GS +  + F V+G VYCD CR +F T+++E +  A VR+EC+      VT++KE  T+A 
Sbjct  19   GSVYCNDRFFVEGVVYCDTCRTQFITKLTEFMEGATVRMECKE-DNGTVTFSKEAVTDAS  77

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKE--AAAGLEK-AQVVCSDKVGMHSNVRYANP  204
            GTY + V+G+HE+E+C++T+ KSPR+DC E  + + LE+ A++  ++  G+ S +R ANP
Sbjct  78   GTYRVEVDGDHEDEVCEITLAKSPRKDCSEVDSDSHLEQAARISITNNNGIVSPLRTANP  137

Query  203  LFFMKEKVSKECAKVLKEL  147
            L F+K++    CA VLK+L
Sbjct  138  LGFLKKERLPGCADVLKDL  156



>ref|XP_004975466.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=163

 Score =   100 bits (250),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F ++G+VYCD CR  F+T ++E I  A VRLEC++  T  V    +  T+  G Y + ++
Sbjct  29   FVIQGRVYCDTCRAGFQTNVTEYIKGAKVRLECKHFGTGAVERAIDGVTDESGFYTIKLK  88

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
            G HEE+IC+V + +SPR+DC E  A  ++A V+ +   G+  ++R+ NPL + K+     
Sbjct  89   GGHEEDICEVILIESPRKDCAEVPAHSDRASVLLAKDAGISDDMRFPNPLGYFKDVPLPV  148

Query  170  CAKVLKE  150
            C  VLKE
Sbjct  149  CGAVLKE  155



>ref|XP_010062811.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
Length=196

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 86/141 (61%), Gaps = 1/141 (1%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            G  +  E   V GKV+CD CR+ FET++S  +AD+ VRLEC N T+  +T + E  T+  
Sbjct  51   GFAYGHEKLDVVGKVFCDTCRVDFETKVSYGLADSKVRLECHNRTSGALTLSAEAVTDKT  110

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAG-LEKAQVVCSDKVGMHSNVRYANPLF  198
            G Y + VEG+HEEEIC+V + +S   +C     G +  A+V  ++K G+    R+AN L 
Sbjct  111  GEYRLEVEGDHEEEICEVQLIESSEPECSSLLEGAVHNARVALTNKNGVAQPARFANALA  170

Query  197  FMKEKVSKECAKVLKELDFVP  135
            F K++   +CA+VL E+  +P
Sbjct  171  FAKKETLADCAQVLLEMGVLP  191



>sp|Q8H6L7.1|PHLB_PHLPR RecName: Full=Pollen allergen Phl p 11; AltName: Allergen=Phl 
p 11 [Phleum pratense]
 gb|AAN32987.1| pollen allergen Phl p 11 [Phleum pratense]
Length=143

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 1/134 (1%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G  F V G+VYCDPCR  FET +S N+  A V ++CR     E     E TT+  G Y +
Sbjct  3    GPGFVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKI  62

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKEK  183
             ++ +H+EEIC+V + KSP   C E     ++A+V  +   G+    +RYANP+ F +++
Sbjct  63   EIDQDHQEEICEVVLAKSPDTTCSEIEEFRDRARVPLTSNNGIKQQGIRYANPIAFFRKE  122

Query  182  VSKECAKVLKELDF  141
              KEC  +L+  D 
Sbjct  123  PLKECGGILQAYDL  136



>ref|NP_001150330.1| pollen allergen Phl p 11 precursor [Zea mays]
 gb|ACG38668.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 79/135 (59%), Gaps = 1/135 (1%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            P   F V G+VYCD CR  FET +S  I  A V +ECR+  ++EV    E TT+A G Y 
Sbjct  23   PSPGFVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRHFESQEVHDKAEATTDAGGWYR  82

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKE  186
            M + G+H++EIC+V + KSP  DC E     E+ +V  +   G+  S +RYANP+ F ++
Sbjct  83   MEISGDHQDEICEVLLLKSPEADCAEIERTRERCRVPLTRNDGIRQSGIRYANPIAFFRK  142

Query  185  KVSKECAKVLKELDF  141
            +    C ++L+  D 
Sbjct  143  EPLSNCGELLRAYDL  157



>ref|XP_002447728.1| hypothetical protein SORBIDRAFT_06g014740 [Sorghum bicolor]
 gb|EES12056.1| hypothetical protein SORBIDRAFT_06g014740 [Sorghum bicolor]
Length=173

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 82/129 (64%), Gaps = 0/129 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            + ++G+VYCD CR  F T ++E +A A VRLEC++  T EV    +  T+A GTY + ++
Sbjct  38   YVIQGRVYCDTCRAGFVTNVTEYMAGAKVRLECKHFGTGEVERAIDGVTDATGTYTIELK  97

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
              HEE+IC V + +SPR+DC +     ++A V+ +  VG+  ++R ANPL + K+     
Sbjct  98   DSHEEDICQVVLVQSPRKDCDQTQPLRDRAGVLLTRNVGIADSLRPANPLGYFKDVPLPV  157

Query  170  CAKVLKELD  144
            CA +LK+LD
Sbjct  158  CAALLKQLD  166



>ref|XP_009342278.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 82/129 (64%), Gaps = 1/129 (1%)
 Frame = -3

Query  533  SFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTV  354
            +  V+GKVYCDPCR++FETR+S  I  A V LECR+     + Y  E  T+ +G Y +  
Sbjct  31   TLFVEGKVYCDPCRVQFETRLSTPIDGATVALECRSRENGTIVYVVEGKTDKNGIYSLAT  90

Query  353  EGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
              E EE+IC+V   +S  ++C +    +E+A+++ +   G+++  RYANPL FMK++ + 
Sbjct  91   HKEFEEQICEVRTVRSSTDECAD-HFDIERARILLTHNNGVNALARYANPLGFMKKESTS  149

Query  173  ECAKVLKEL  147
            EC  VLKEL
Sbjct  150  ECEAVLKEL  158



>ref|XP_007141147.1| hypothetical protein PHAVU_008G171500g [Phaseolus vulgaris]
 gb|ESW13141.1| hypothetical protein PHAVU_008G171500g [Phaseolus vulgaris]
Length=160

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 79/127 (62%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F VKG+VYCDPCR  FET ++  IA A V +ECR+     + Y+K+  T++ G+Y + V+
Sbjct  25   FYVKGRVYCDPCRAGFETPLTTYIAGAEVTMECRDRMRGNIVYSKKVKTDSSGSYTIFVD  84

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
                 + CD ++  SP  DC+E   G + ++VV +   G+ +N R+ N L FMK+KV+  
Sbjct  85   ANQANQNCDASLVTSPLRDCREPTPGRDHSRVVLNRFNGIATNDRFVNNLGFMKQKVASA  144

Query  170  CAKVLKE  150
            CAK+L+ 
Sbjct  145  CAKILRR  151



>ref|XP_003566418.1| PREDICTED: major pollen allergen Lol p 11-like [Brachypodium 
distachyon]
Length=169

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = -3

Query  557  SGSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNA  378
             G   PG  F V G+VYCD CR  FET  S +I  AVV++ECR+  T E+ +  E TT+A
Sbjct  24   QGYSKPG--FLVTGRVYCDTCRAGFETNASHSIPGAVVQMECRHFETNELHHKAEATTDA  81

Query  377  DGTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPL  201
             G Y M V  +H+EEIC+V + +SP +DC E     ++ +V  +   G+  S VRYANP+
Sbjct  82   QGWYKMEVGEDHQEEICEVALLRSPEKDCAEIEKSRDRCRVPLTRNNGIKQSGVRYANPI  141

Query  200  FFMKEKVSKECAKVLKELDF  141
             F +++    C  VL++ D 
Sbjct  142  AFFRKEPLANCGDVLRKYDL  161



>ref|XP_008226528.1| PREDICTED: olee1-like protein [Prunus mume]
Length=163

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 79/126 (63%), Gaps = 1/126 (1%)
 Frame = -3

Query  524  VKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVEGE  345
            V+G+VYCDPCR++FETR+S  +  AVV LECR      + YT +  T+ +G Y +  + +
Sbjct  31   VEGRVYCDPCRVQFETRLSVPLEGAVVALECRGRENGTLAYTLQGKTDKNGIYSLPADED  90

Query  344  HEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKECA  165
             EE+IC+V    SPR +C +     E+A+V+ +   G+ S  RYANPL FM+     EC 
Sbjct  91   MEEQICEVRTVSSPRANCND-HFDFERARVLLTHNNGVKSMARYANPLGFMQNASVTECE  149

Query  164  KVLKEL  147
            +VLKEL
Sbjct  150  EVLKEL  155



>ref|XP_011079002.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=165

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 78/129 (60%), Gaps = 0/129 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V GKVYC+ CR  F  R SE +A A V+LEC+N  TE VTYT E  TN  G Y +T E
Sbjct  31   FIVDGKVYCEVCRANFTNRYSEPMAGAKVKLECKNEVTESVTYTLEGETNEKGVYTLTAE  90

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
            G+H E++C VT+ KS   DC E       A+V  +   G H   R+ANPL F +++   E
Sbjct  91   GDHGEDLCAVTLLKSSMADCAEVPDEKPAAEVTLTLNNGFHDEFRHANPLTFTRKEALPE  150

Query  170  CAKVLKELD  144
            CA++ KEL+
Sbjct  151  CAELFKELE  159



>ref|XP_008363638.1| PREDICTED: olee1-like protein [Malus domestica]
Length=163

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = -3

Query  533  SFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTV  354
            +  V+GKVYCDPCR++FETR+S  +  A V LECR+     + Y  E  T+ +G Y +  
Sbjct  28   TLFVEGKVYCDPCRVQFETRLSTPVDGATVALECRSRENGTIVYVVEGKTDKNGIYSLAS  87

Query  353  EGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
                EE+IC+V   +SP + C +     E+A+++ +D  G+++  RYANPL FM ++ + 
Sbjct  88   HKXFEEQICEVRTVRSPTDQCAD-HFDFERARILLTDNNGVNALARYANPLGFMTKESTY  146

Query  173  ECAKVLKEL  147
            EC  VLKEL
Sbjct  147  ECEAVLKEL  155



>sp|Q8LGR0.1|CHE1_CHEAL RecName: Full=Pollen allergen Che a 1; AltName: Allergen=Che 
a 1; Flags: Precursor [Chenopodium album]
 gb|AAL07319.1| Che a 1 allergen precursor [Chenopodium album]
Length=168

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 83/133 (62%), Gaps = 3/133 (2%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G VYCD CR++F TRIS  +  A V+LECRN+T    T+  E  T+  G Y + V 
Sbjct  30   FKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVN  89

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGL---EKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
            G+ E++IC++ + KSP  +C E +  +   + A+V  +   G  S++R AN L FM+++ 
Sbjct  90   GDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEP  149

Query  179  SKECAKVLKELDF  141
             KEC +VLKELD 
Sbjct  150  LKECPEVLKELDL  162



>ref|XP_007025385.1| Olee1-like protein [Theobroma cacao]
 gb|EOY28007.1| Olee1-like protein [Theobroma cacao]
Length=170

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 87/133 (65%), Gaps = 3/133 (2%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E F V+GKVYCD CR +F T+IS+ +A A VRLECR+    ++TY+ +  T+  GTY + 
Sbjct  30   EQFFVEGKVYCDNCRAQFVTKISKYMAGAQVRLECRDREGGDITYSVDGETDESGTYHIK  89

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAA--GLEK-AQVVCSDKVGMHSNVRYANPLFFMKE  186
            VEG+HEEEIC+V++ +S   +C E      L K A++  +   G+ S+ R ANPL FM +
Sbjct  90   VEGDHEEEICEVSLVQSSDPECSEIDKENFLRKSARISLTKYSGITSDSRLANPLGFMVK  149

Query  185  KVSKECAKVLKEL  147
            K   EC +VL+EL
Sbjct  150  KPLPECTEVLREL  162



>gb|AFW77548.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 79/135 (59%), Gaps = 1/135 (1%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            P   F V G+VYCD CR  FET +S  I  A V +ECR+  ++EV    E TT+A G Y 
Sbjct  23   PSPGFVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRHFESQEVHDKAEATTDAGGWYR  82

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKE  186
            M + G+H++EIC+V + KSP  DC E     ++ +V  +   G+  S +RYANP+ F ++
Sbjct  83   MEISGDHQDEICEVLLLKSPEADCAEIERTRDRCRVPLTRNDGIRQSGIRYANPIAFFRK  142

Query  185  KVSKECAKVLKELDF  141
            +    C ++L+  D 
Sbjct  143  EPLSNCGELLRAYDL  157



>gb|AFK47865.1| unknown [Lotus japonicus]
Length=168

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 88/133 (66%), Gaps = 3/133 (2%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F V+G VYCD CR +F T++SE +  A VR+EC+      VT+TKE  T+A G+Y + 
Sbjct  26   DRFFVEGVVYCDTCRTQFITKLSEFLEGATVRVECKEEGNGSVTFTKEVVTDAKGSYKVE  85

Query  356  VEGEHEEEICDVTVEKSPREDCKE--AAAGLEK-AQVVCSDKVGMHSNVRYANPLFFMKE  186
            V+G+HEEE+C V + KSPR DC E  + + LE+ A++  +   G+ S VR ANPL F+K+
Sbjct  86   VDGDHEEELCQVVLVKSPRSDCSEIDSDSHLEQAAKISITKNNGIVSPVRAANPLGFLKK  145

Query  185  KVSKECAKVLKEL  147
            +    CA VLKEL
Sbjct  146  ERLPGCADVLKEL  158



>dbj|BAK06698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 80/130 (62%), Gaps = 0/130 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            + V+G+VYCD CR  FET ++E I  A VRLECR   T+++  + +  T+  GTY + ++
Sbjct  32   YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECRRFGTDKLERSIDGVTDESGTYKIELK  91

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
              H E+IC++ + +SP  +C E  A   +A++V S  VG+  N+R ANPL ++K+K    
Sbjct  92   DSHPEDICEMVLVQSPLPNCNEIQALRNRAEIVLSRNVGISDNIRLANPLGYLKDKPLPV  151

Query  170  CAKVLKELDF  141
            C  +LK  + 
Sbjct  152  CPDLLKMFNL  161



>gb|ADK22842.1| Sal k 5, partial [Salsola kali]
Length=151

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 81/133 (61%), Gaps = 3/133 (2%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            + VKG VYCD CR++F TR+S  +  A V L+CRN+T    T+  E  T+  G Y + V+
Sbjct  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD  68

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGL---EKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
            G+HE++IC + + KSP ++C E    +   + A+V  +   G  S+VR AN L F+K+  
Sbjct  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP  128

Query  179  SKECAKVLKELDF  141
              EC +VLKELD 
Sbjct  129  LPECPEVLKELDM  141



>ref|XP_008376286.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008343323.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008353938.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_009369651.1| PREDICTED: pollen-specific protein C13-like [Pyrus x bretschneideri]
Length=159

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 82/128 (64%), Gaps = 0/128 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            FTV+GKVYCD CR  +ET+    IA A VRLECR+ ++  + YTKE TT++ G Y + V 
Sbjct  27   FTVEGKVYCDTCRAGYETKAITYIAGAKVRLECRDKSSMALVYTKEGTTDSAGCYKIPVA  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H ++ CD  +  SP++DC   + G E+A+V+ +   G+ S  R+AN + FM+ +    
Sbjct  87   EDHLDQFCDAVLVSSPQKDCATVSPGRERARVILTGYNGIASYTRFANAMGFMRTEALSG  146

Query  170  CAKVLKEL  147
            C ++LKEL
Sbjct  147  CTQILKEL  154



>ref|XP_011006159.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011016058.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
Length=159

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 83/126 (66%), Gaps = 0/126 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G VYCD C   FET  + NIA A VRLEC++  T+++ Y+KE TT++ G Y +TV+
Sbjct  27   FVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDSTGKYTITVD  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H+++ICD  +  SPR+DC+  +AG ++A+V+ ++  G+ S  RY N + FM       
Sbjct  87   EDHKDQICDCMLVSSPRKDCRSPSAGRDRARVILTNNNGLVSTTRYVNAMGFMAAHPMSG  146

Query  170  CAKVLK  153
            C ++L+
Sbjct  147  CTELLR  152



>ref|XP_002513885.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
 gb|EEF48468.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
Length=159

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G+VYCD CR  FET  +  +A A VR+EC++  T E+ Y+KE TT++ GTY + V+
Sbjct  27   FEVEGRVYCDTCRAGFETSKTTYVAGAKVRVECKDRKTMELVYSKEGTTDSTGTYRIHVD  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H++++CD  +  SP+ DC + ++G ++A+V+ ++  G+ SN RYAN + FMKE     
Sbjct  87   EDHQDQLCDAMLVSSPQHDCMKPSSGRDRARVILTNNNGIVSNKRYANSIGFMKEDAMSG  146

Query  170  CAKVLKE  150
            C ++L++
Sbjct  147  CFELLRQ  153



>gb|EAY93952.1| hypothetical protein OsI_15725 [Oryza sativa Indica Group]
Length=165

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 81/130 (62%), Gaps = 0/130 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            + V+G+VYCD CR  FET ++E I  A VRLEC++  T++V    +  T+  GTY + ++
Sbjct  30   YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
              HEE+IC+V +  SP  +C E  A  ++A+V+ +  VG+  N+R ANPL ++K+     
Sbjct  90   DSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDIPLPV  149

Query  170  CAKVLKELDF  141
            C  +LK+ D 
Sbjct  150  CGALLKQFDL  159



>emb|CAH66537.1| H0209H04.4 [Oryza sativa Indica Group]
 gb|AFI71825.1| pollen specific protein [Oryza sativa]
Length=165

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 81/130 (62%), Gaps = 0/130 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            + V+G+VYCD CR  FET ++E I  A VRLEC++  T++V    +  T+  GTY + ++
Sbjct  30   YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
              HEE+IC+V +  SP  +C E  A  ++A+V+ +  VG+  N+R ANPL ++K+     
Sbjct  90   DSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDIPLPV  149

Query  170  CAKVLKELDF  141
            C  +LK+ D 
Sbjct  150  CGALLKQFDL  159



>ref|NP_001052674.1| Os04g0398700 [Oryza sativa Japonica Group]
 emb|CAE05158.2| OSJNBa0039C07.14 [Oryza sativa Japonica Group]
 dbj|BAF14588.1| Os04g0398700 [Oryza sativa Japonica Group]
 gb|EAZ30594.1| hypothetical protein OsJ_14643 [Oryza sativa Japonica Group]
Length=165

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 81/130 (62%), Gaps = 0/130 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            + V+G+VYCD CR  FET ++E I  A VRLEC++  T++V    +  T+  GTY + ++
Sbjct  30   YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
              HEE+IC+V +  SP  +C E  A  ++A+V+ +  VG+  N+R ANPL ++K+     
Sbjct  90   DSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDIPLPI  149

Query  170  CAKVLKELDF  141
            C  +LK+ D 
Sbjct  150  CGALLKQFDL  159



>gb|KDP32694.1| hypothetical protein JCGZ_11986 [Jatropha curcas]
Length=159

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G+VYCD CR  FET  +  IA A VRLEC++  + E+ Y+KE TT++ GTY + V+
Sbjct  27   FEVEGRVYCDTCRAGFETPKTTYIAGAKVRLECKDRKSMELVYSKEGTTDSTGTYKIYVD  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H +++CD  +  SP++DC+  ++G ++A+V+ +   G+ SN R+AN + F K+ +   
Sbjct  87   DDHADQLCDAVLVSSPKKDCRSPSSGRDRARVILTSYNGIASNKRFANAIGFEKDDIESG  146

Query  170  CAKVLKE  150
            C ++L++
Sbjct  147  CTELLRQ  153



>dbj|BAJ86956.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=169

 Score = 98.6 bits (244),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 80/131 (61%), Gaps = 1/131 (1%)
 Frame = -3

Query  545  HPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTY  366
            HP + F V+G+V+CD CR  FET  S  IA A VR+EC++ +T   T + E  T+  GTY
Sbjct  31   HPTQ-FVVRGRVWCDTCRAGFETPASTFIAGAKVRVECKSRSTGAQTCSFEGHTDHTGTY  89

Query  365  MMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKE  186
             + V+ EHE E+C+  +  SP   C +A AG E+A V  ++  G+ SNVR AN L F K+
Sbjct  90   NIPVDDEHEHELCESVLVSSPDTACAKAVAGRERAPVFLNNNNGVASNVRLANALGFEKD  149

Query  185  KVSKECAKVLK  153
                 CA++LK
Sbjct  150  TPLAACAQILK  160



>gb|KDO80906.1| hypothetical protein CISIN_1g031458mg [Citrus sinensis]
Length=159

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 83/126 (66%), Gaps = 0/126 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F+V+G+VYCD C+  FET  +  IA A V++EC++  + +V Y++E  T++ GTY + V 
Sbjct  27   FSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKILVS  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H++++CD  +  SP+ DCK  A G E+++V+ +   G+ S  RYAN + FMK +    
Sbjct  87   EDHQDQLCDAVLVSSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPMSG  146

Query  170  CAKVLK  153
            CA+VL+
Sbjct  147  CAEVLR  152



>gb|AFK37732.1| unknown [Lotus japonicus]
Length=162

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 78/129 (60%), Gaps = 0/129 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F VKG VYCDPCR  FET  +  IA   V L CR   + EV YTK   TN+ G Y ++V 
Sbjct  28   FIVKGCVYCDPCRAGFETSATTRIAGTEVMLLCRQKNSNEVVYTKRGWTNSKGEYTISVS  87

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H ++ICD  +  SP   CKEA  G ++A+V+ +   G+ S+ R+AN + FM E V+  
Sbjct  88   EDHGDQICDAKLISSPHPTCKEATPGRDQARVILTRYNGIASDDRFANAMGFMSENVAAG  147

Query  170  CAKVLKELD  144
            C ++LK+ +
Sbjct  148  CTQILKQYE  156



>ref|XP_010103032.1| hypothetical protein L484_005787 [Morus notabilis]
 gb|EXB94630.1| hypothetical protein L484_005787 [Morus notabilis]
Length=166

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 80/135 (59%), Gaps = 3/135 (2%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
              V+G+VYCD CR +F T++S  I  A VRLECR      VTY+ +  T+  GTY + V+
Sbjct  28   LIVEGRVYCDTCRAQFVTKVSNYIKGAKVRLECRESEGGSVTYSNDGVTDESGTYRIAVD  87

Query  350  GEHEEEICDVTVEKSPREDCKEAA---AGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
            G+HEEE+C+V + KS   DC E +        A+V  +   G+ S VR ANPL F+K+  
Sbjct  88   GDHEEEVCEVKLVKSSVPDCSEISNDPYNKLNARVSLTSNNGITSPVRQANPLGFLKKNS  147

Query  179  SKECAKVLKELDFVP  135
              EC +VL+EL   P
Sbjct  148  LPECPEVLRELGITP  162



>ref|XP_006472638.1| PREDICTED: pollen-specific protein C13-like [Citrus sinensis]
Length=159

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 83/126 (66%), Gaps = 0/126 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F+V+G+VYCD C+  FET  +  IA A V++EC++  + +V Y++E  T++ GTY + V 
Sbjct  27   FSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKILVS  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H++++CD  +  SP+ DCK  A G E+++V+ +   G+ S  RYAN + FMK +    
Sbjct  87   EDHQDQLCDAVLVSSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPMSG  146

Query  170  CAKVLK  153
            CA+VL+
Sbjct  147  CAEVLR  152



>ref|XP_006434027.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
 gb|ESR47267.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
Length=159

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 83/126 (66%), Gaps = 0/126 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F+V+G+VYCD C+  FET  +  IA A V++EC++  + +V Y++E  T++ GTY + V 
Sbjct  27   FSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKILVS  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H++++CD  +  SP+ DCK  A G E+++V+ +   G+ S  RYAN + FMK +    
Sbjct  87   EDHQDQLCDAVLISSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPMSG  146

Query  170  CAKVLK  153
            CA+VL+
Sbjct  147  CAEVLR  152



>gb|AAX93750.1| pollen allergen Cro s 1 [Crocus sativus]
Length=168

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 83/133 (62%), Gaps = 3/133 (2%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G VYCD CR++F TR+S  +  A V+LECRN+T    T+  E  T+  G Y + V 
Sbjct  30   FKVQGMVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVH  89

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGL---EKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
            G+ +++IC++ + KSP  +C E +  +   + A+V  +   G  S++R AN L FM+++ 
Sbjct  90   GDFQDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEP  149

Query  179  SKECAKVLKELDF  141
             KEC +VLKELD 
Sbjct  150  LKECPEVLKELDL  162



>ref|NP_001148443.1| pollen allergen Phl p 11 precursor [Zea mays]
 gb|ACG31481.1| pollen allergen Phl p 11 [Zea mays]
 gb|ACN35276.1| unknown [Zea mays]
 gb|AFW80473.1| pollen allergen Phl p 11 [Zea mays]
Length=178

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 79/141 (56%), Gaps = 1/141 (1%)
 Frame = -3

Query  560  GSGSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTN  381
            G  S      F V G+VYCDPCR  FET +S ++A A V + CR+    + T   E TT+
Sbjct  31   GVASAEKAGGFVVTGRVYCDPCRAGFETNVSRSVAGATVEVVCRHFGASKETLKAEATTD  90

Query  380  ADGTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANP  204
              G Y + ++ +H+EEIC+V + +SP   C E     ++A+V  +   G+    VRYANP
Sbjct  91   DSGWYKLEIDQDHQEEICEVVLARSPDPGCAEIEEFRDRARVPLTSNNGIKQQGVRYANP  150

Query  203  LFFMKEKVSKECAKVLKELDF  141
            + F ++   KEC  +L++ D 
Sbjct  151  IAFFRKDPLKECGALLEKYDL  171



>ref|XP_008467237.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=166

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 88/134 (66%), Gaps = 6/134 (4%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+GKVYCD CR++F T+ S+ +  A V+L C+ +    VT +KE  T+  G+Y +  +
Sbjct  28   FLVEGKVYCDACRVQFFTKASKFLEGATVKLVCKEIEGGSVTLSKEAVTDKTGSYSIEAD  87

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEK----AQVVCSDKVGMHSNVRYANPLFFMKEK  183
            G+HEEE+C+VT+ KS   DC E +  LEK    A+V  ++  G+ + VR+ANPL FMK++
Sbjct  88   GDHEEELCEVTLVKSNDPDCSEIS--LEKYEHMARVSITNNSGITNPVRHANPLAFMKKE  145

Query  182  VSKECAKVLKELDF  141
               EC ++L+EL F
Sbjct  146  KLPECKEILRELGF  159



>ref|XP_002454899.1| hypothetical protein SORBIDRAFT_03g001020 [Sorghum bicolor]
 gb|EES00019.1| hypothetical protein SORBIDRAFT_03g001020 [Sorghum bicolor]
Length=166

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 79/141 (56%), Gaps = 1/141 (1%)
 Frame = -3

Query  560  GSGSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTN  381
            G  S      F V G+VYCDPCR  FET +S+++A A V + CR+    + T   E TT+
Sbjct  19   GVASAEKAGGFVVTGRVYCDPCRAGFETNVSKSVAGATVEVVCRHFEASKETLKAEATTD  78

Query  380  ADGTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANP  204
              G Y + ++ +H+EEIC+V ++KSP   C E      +A+V  +   G+     RYANP
Sbjct  79   DFGWYKLEIDQDHQEEICEVVLKKSPDPACAEIEEQRARARVPLTSNNGIKQKGTRYANP  138

Query  203  LFFMKEKVSKECAKVLKELDF  141
            + F ++   KEC  +L++ D 
Sbjct  139  IAFFRKDPLKECGAILQKYDL  159



>ref|XP_003546028.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN18912.1| Olee1-like protein [Glycine soja]
Length=169

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 86/140 (61%), Gaps = 4/140 (3%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevty-tkettTNA  378
            GS +  + F V+G VYCD CR++F T++SE +  A VR+ C  +   +    +KE  T+A
Sbjct  20   GSAYARDRFMVEGTVYCDTCRVQFLTKLSEILEGATVRVTCSQVDNAKNVTFSKEAVTDA  79

Query  377  DGTYMMTVEGEHEEEICDVTVEKSPREDCKEA---AAGLEKAQVVCSDKVGMHSNVRYAN  207
             G+Y + VEG+HEE+ C+VT+ KSPR DC E    +   + A++  +   G+ S +R AN
Sbjct  80   SGSYKVEVEGDHEEDTCEVTLLKSPRPDCSEIDRESHLQQAARISITKNNGIVSPLRQAN  139

Query  206  PLFFMKEKVSKECAKVLKEL  147
            PL F+K+     CA +LKEL
Sbjct  140  PLGFLKKDRLPGCADLLKEL  159



>ref|XP_011101379.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=176

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 85/148 (57%), Gaps = 8/148 (5%)
 Frame = -3

Query  533  SFTVKGKVYCDPCRLKFETRISENIADAVVRLECRN-MtteevtytkettTNADGTYMMT  357
             F VKGKV+C+ CRL F  + S  +  A V+LECR+  T + +       TN +G Y + 
Sbjct  31   QFIVKGKVFCEVCRLNFINKFSHPMPKAEVKLECRDEGTGKVMYRLTGGQTNDNGEYTLY  90

Query  356  VEGEHEEEICDVTVEKSPREDCKEA----AAGLEKAQVVCSDKVGMHSNVRYANPLFFMK  189
             EG+H EEIC+VT+ KS + DC E     +   + A++  +   G H N+R ANPL F +
Sbjct  91   AEGDHGEEICEVTLVKSSQHDCAEIPTDDSGEKQAAEITLTVNNGFHDNIRLANPLSFTR  150

Query  188  EKVSKECAKVLKELDFVPLEM*SDQPLP  105
            +K   +CAK+LKEL     +   D+PLP
Sbjct  151  KKALPKCAKLLKEL---AEDKEDDEPLP  175



>gb|AEW90941.1| group 11 grass pollen allergen F7-4 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 1/135 (1%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            P   F V G+VYCDPCR  FET +S+N+  A V ++CR     E     E TT+  G Y 
Sbjct  26   PESGFIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYK  85

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKE  186
            + ++ +H++EIC+V + KSP   C E     ++A+V  +   GM     R+ANP+ F+ +
Sbjct  86   IEIDQDHQDEICEVVLTKSPDASCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFLPK  145

Query  185  KVSKECAKVLKELDF  141
            +  KEC  +L+  D 
Sbjct  146  EPRKECGGILQAYDL  160



>ref|XP_004983223.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=170

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = -3

Query  533  SFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTV  354
            SF V+G+V+CD CR  FET +S  IA A VR+ECR+ TT   + T E  T+  GTY + V
Sbjct  35   SFVVRGRVWCDTCRAGFETPVSTYIAGAKVRVECRSKTTGLKSCTYEGHTDRTGTYNILV  94

Query  353  EGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
              EHE+E+C+  +  SP   C     G E+A V  +   G+ SNVR AN L F K+    
Sbjct  95   TDEHEDELCESVLISSPDMRCATTVPGRERAPVFLTSNNGVASNVRMANALGFQKDVALP  154

Query  173  ECAKVLK  153
             CA+VLK
Sbjct  155  RCAQVLK  161



>dbj|BAK07321.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 74/135 (55%), Gaps = 1/135 (1%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            P   F V G+VYCDPCR  FET IS+N+  A V ++CR     E     E TT+  G Y 
Sbjct  26   PEGGFLVTGRVYCDPCRAGFETNISKNVEGATVAMDCRPFGGGESKLKAEATTDKQGWYK  85

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKE  186
            + ++ +H++EIC+V + KSP   C E     ++A+V  +   GM     RYANP+ F  +
Sbjct  86   IEIDQDHQDEICEVVLTKSPDPACAEIEEFRDRARVPLTSNNGMKQQGTRYANPIAFFPK  145

Query  185  KVSKECAKVLKELDF  141
            +   EC  +L+  D 
Sbjct  146  QPRPECGGILQAYDL  160



>ref|XP_010686203.1| PREDICTED: pollen allergen Che a 1 [Beta vulgaris subsp. vulgaris]
Length=169

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 82/133 (62%), Gaps = 3/133 (2%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G VYCD CR++F TR+S  +  A VRLECRN+T    T+  E  T+  G Y + V+
Sbjct  30   FKVQGMVYCDTCRIQFITRVSTMMEGATVRLECRNITAGTETFKSEAITDKLGMYSINVD  89

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGL---EKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
            G++E++IC++ + KS   +C + +  +   + A+V  +   G  S+VR AN L FM++  
Sbjct  90   GDYEDDICEIVLAKSSNNECTDISHDVYAKQAAKVSLTSNNGESSDVRSANALGFMRKTP  149

Query  179  SKECAKVLKELDF  141
              EC +VLKELD 
Sbjct  150  LPECPEVLKELDL  162



>gb|ABK92993.1| unknown [Populus trichocarpa]
Length=159

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = -3

Query  551  SCHPGE-SFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            +  PG  +F+V+G VYCD C   FET  +  IA + V++ECR+  T+++ Y+KE TT++ 
Sbjct  19   AARPGRNTFSVQGLVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDST  78

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFF  195
            G Y++TV+ +H+++ICD  +  SPR+DC   +AG ++A+V+ +   G+ S  RYAN + F
Sbjct  79   GKYIITVDEDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLVSTTRYANSMGF  138

Query  194  MKEKVSKECAKVLKE  150
            M  +    C ++L+ 
Sbjct  139  MAAQPMSGCTELLRS  153



>ref|XP_006664913.1| PREDICTED: pollen allergen Phl p 11-like [Oryza brachyantha]
Length=175

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 78/135 (58%), Gaps = 3/135 (2%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            PG  FTV G+VYCD CR  FET +S +I  A V++ECR+  T+EV +  E   N  G Y 
Sbjct  34   PG--FTVTGRVYCDNCRAGFETNVSHSIKGATVQMECRHFETQEVKHRAEAAANEWGWYK  91

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSN-VRYANPLFFMKE  186
            M V GEHE EIC+V + +SP  +C E     ++++V  +   G+  +  RYANP+ F ++
Sbjct  92   MEVGGEHEAEICEVALVRSPEAECAEIERFRDRSRVPLTRNNGIKQDGFRYANPIAFFRK  151

Query  185  KVSKECAKVLKELDF  141
                 C  +L+  D 
Sbjct  152  DPPPACGDILRSYDL  166



>gb|ACU23617.1| unknown [Glycine max]
Length=169

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 85/140 (61%), Gaps = 4/140 (3%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevty-tkettTNA  378
            GS +  + F V+G VYCD CR++F T++SE +  A VR+ C  +   +    +KE  T+A
Sbjct  20   GSAYARDRFMVEGTVYCDTCRVQFLTKLSEILEGATVRVTCSQVDNAKNVTFSKEAVTDA  79

Query  377  DGTYMMTVEGEHEEEICDVTVEKSPREDCKEA---AAGLEKAQVVCSDKVGMHSNVRYAN  207
             G+Y + VEG+HEE+ C+VT+ KSPR DC E    +   + A++  +   G+ S  R AN
Sbjct  80   SGSYKVEVEGDHEEDTCEVTLLKSPRPDCSEIDRESHLQQAARISITKNNGIVSPFRQAN  139

Query  206  PLFFMKEKVSKECAKVLKEL  147
            PL F+K+     CA +LKEL
Sbjct  140  PLGFLKKDRLPGCADLLKEL  159



>gb|AEW90942.1| group 11 grass pollen allergen F7-6 [Secale cereale x Triticum 
turgidum subsp. durum]
 gb|AEW90944.1| group 11 grass pollen allergen F8-9 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 1/135 (1%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            P   F V G+VYCDPCR  FET +S+N+  A V ++CR     E     E TT+  G Y 
Sbjct  26   PESGFIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYK  85

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKE  186
            + ++ +H++EIC+V + KSP   C E     ++A+V  +   GM     R+ANP+ F  +
Sbjct  86   IEIDQDHQDEICEVVLTKSPDASCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFFPK  145

Query  185  KVSKECAKVLKELDF  141
            +  KEC  +L+  D 
Sbjct  146  EPRKECGGILQAYDL  160



>ref|XP_003573867.1| PREDICTED: pollen-specific protein C13 [Brachypodium distachyon]
Length=169

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G V+CD CR  FET  S  IA A VR+EC++ +T   T + E  T+  GTY ++V+
Sbjct  35   FVVRGSVWCDTCRAGFETPASTYIAGAKVRVECKSKSTGVKTCSFEGHTDHTGTYNISVD  94

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             EHE E+C+  +  SP   C +  AG E+A V  ++K G+ SNVR AN L F K+     
Sbjct  95   DEHEHELCESVLVSSPDRGCAKLVAGRERAPVFLNNKNGVASNVRLANALGFQKDVALAA  154

Query  170  CAKVLK  153
            CA++LK
Sbjct  155  CAQILK  160



>ref|XP_004143635.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004168700.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN50408.1| hypothetical protein Csa_5G172880 [Cucumis sativus]
Length=166

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 88/134 (66%), Gaps = 6/134 (4%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+GKVYCD CR++F T+ S+ +  A V+L C+ +    VT +KE  T+  G+Y +  +
Sbjct  28   FLVEGKVYCDACRVQFFTKASKFLEGATVKLVCKEIEGGSVTLSKEAVTDKTGSYSIEAD  87

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEK----AQVVCSDKVGMHSNVRYANPLFFMKEK  183
            G+HEE++C+VT+ KS   DC E +  LEK    A+V  ++  G+ + VR+ANPL FMK++
Sbjct  88   GDHEEDLCEVTLVKSNDPDCSEIS--LEKYEHMARVSITNNSGITNPVRHANPLAFMKKE  145

Query  182  VSKECAKVLKELDF  141
               EC +VL+EL F
Sbjct  146  KLPECKEVLRELGF  159



>ref|XP_002440811.1| hypothetical protein SORBIDRAFT_09g007260 [Sorghum bicolor]
 gb|EES19241.1| hypothetical protein SORBIDRAFT_09g007260 [Sorghum bicolor]
Length=169

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 75/127 (59%), Gaps = 1/127 (1%)
 Frame = -3

Query  518  GKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVEGEHE  339
            G++YCD CR  FET IS  I  A V +ECR+  ++++    + TT+A G Y M + G+H+
Sbjct  35   GRIYCDNCRAGFETNISHAIQGATVEMECRHFESQQIHDKAQATTDAGGWYKMEIAGDHQ  94

Query  338  EEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKEKVSKECAK  162
            +EICDV + KSP  DC E     ++ +V  +   G+  S VRYANP+ F ++     C +
Sbjct  95   DEICDVRLLKSPEADCAEIEVNRDRCRVPLTGNDGIKQSGVRYANPIAFFRKDPLPNCGE  154

Query  161  VLKELDF  141
            +L+  D 
Sbjct  155  LLRAYDL  161



>gb|EMT13715.1| Pollen allergen Phl p 11 [Aegilops tauschii]
Length=167

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 1/135 (1%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            P   F V G+VYCDPCR  FET +S+N+  A V ++CR     E     E TT+  G Y 
Sbjct  26   PEGGFIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYK  85

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKE  186
            + ++ +H++EIC+V + KSP   C E     ++A+V  +   GM     R+ANP+ F  +
Sbjct  86   IEIDQDHQDEICEVVLTKSPDPSCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFFPK  145

Query  185  KVSKECAKVLKELDF  141
            +  KEC  +L+  D 
Sbjct  146  EPRKECGGILQAYDL  160



>gb|AEW90946.1| pollen-specific protein F8-4 [Secale cereale x Triticum turgidum 
subsp. durum]
 gb|AEW90947.1| pollen-specific protein F8-5 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 83/139 (60%), Gaps = 0/139 (0%)
 Frame = -3

Query  560  GSGSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTN  381
            G+   +    + V+G+VYCD CR  FET ++E I  A VRLEC+   TE+V  + +  T+
Sbjct  20   GTAVANDLPDYIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKRFGTEKVERSIDGVTD  79

Query  380  ADGTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPL  201
              GTY + ++  H E+IC++ + +SP  +C E     ++A++V S  VG+  N+R ANPL
Sbjct  80   ETGTYKIELKDSHPEDICEMVLVQSPLANCNEIQDLRDRAEIVLSRNVGISDNIRMANPL  139

Query  200  FFMKEKVSKECAKVLKELD  144
             ++K+K    C  +LK  +
Sbjct  140  GYLKDKPLPVCPDLLKTFN  158



>ref|XP_004500607.1| PREDICTED: pollen-specific protein C13-like [Cicer arietinum]
Length=162

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 82/125 (66%), Gaps = 0/125 (0%)
 Frame = -3

Query  524  VKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVEGE  345
            +KG+VYCD CR  FET    NIA A V L+C+   + EV Y+K   T++ G+Y M V+ +
Sbjct  30   LKGRVYCDACRAGFETTAITNIAGAEVLLQCKERISNEVVYSKRGWTDSTGSYTMYVDED  89

Query  344  HEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKECA  165
            H +++CDV +  S +  C+EA  G ++A+V+ +   G+ SN RYAN + FM ++V+  CA
Sbjct  90   HADQVCDVKLVSSHQHFCREATPGRDQARVILTRFNGIASNDRYANAMGFMAQEVASGCA  149

Query  164  KVLKE  150
            +VLK+
Sbjct  150  EVLKQ  154



>gb|ABC86745.1| pollen-specific protein [Vitis pseudoreticulata]
Length=159

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 81/129 (63%), Gaps = 0/129 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G+VYCD CR  FET  +  IA A VR+EC++  + ++ Y+ E  T++ GTY + 
Sbjct  25   QPFVLQGRVYCDTCRAGFETSATTYIAGAKVRVECKDRNSMQLLYSIEGITDSTGTYKIM  84

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            V  +HE+++CD  +  SP+ DC     G ++A V+ +   G+ S+ RYAN + F+K+   
Sbjct  85   VTEDHEDQLCDAVLVSSPQSDCASVDPGRDRAAVILTRYNGIVSDNRYANSMGFLKDHPM  144

Query  176  KECAKVLKE  150
             EC ++L++
Sbjct  145  SECTQLLQQ  153



>ref|XP_002301038.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK93129.1| unknown [Populus trichocarpa]
 gb|ABK94485.1| unknown [Populus trichocarpa]
 gb|ABK95752.1| unknown [Populus trichocarpa]
 gb|EEE80311.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = -3

Query  551  SCHPGES-FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            +  PG + F+V+G VYCD C   FET  +  IA + V++ECR+  T+++ Y+KE TT++ 
Sbjct  19   AARPGRNPFSVQGLVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDST  78

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFF  195
            G Y++TV+ +H+++ICD  +  SPR+DC   +AG ++A+V+ +   G+ S  RYAN + F
Sbjct  79   GKYIITVDEDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLVSTTRYANSMGF  138

Query  194  MKEKVSKECAKVLKE  150
            M  +    C ++L+ 
Sbjct  139  MAAQPMSGCTELLRS  153



>gb|AEW90943.1| group 11 grass pollen allergen F8-6 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 1/135 (1%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            P   F V G+VYCDPCR  FET +S+N+  A V ++CR     E     E TT+  G Y 
Sbjct  26   PESGFIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYK  85

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKE  186
            + ++ +H++EIC+V + KSP   C E     ++A+V  +   GM     R+ANP+ F  +
Sbjct  86   IEIDRDHQDEICEVVLTKSPDASCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFFPK  145

Query  185  KVSKECAKVLKELDF  141
            +  KEC  +L+  D 
Sbjct  146  EPRKECGGILQAYDL  160



>ref|XP_004489034.1| PREDICTED: olee1-like protein-like [Cicer arietinum]
Length=166

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 83/136 (61%), Gaps = 1/136 (1%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E F+V GK+YCDPC  +FE+R+S+ +    V L+CR   +  VTY KE+ T+ +G Y + 
Sbjct  31   EIFSVVGKIYCDPCHFEFESRLSQPLEGVKVTLKCRKGDSNNVTYVKESRTDINGVYKIN  90

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            V+G+HEEE+C+V  + + +  C +  A  +  ++V +  +G+ S VR+ NPL FM + + 
Sbjct  91   VDGDHEEEVCEVNADATGKGACSQVMAN-KSDRIVLTKNMGVSSLVRFVNPLGFMTQAID  149

Query  176  KECAKVLKELDFVPLE  129
             +C  V  EL    L+
Sbjct  150  SQCGNVFSELGLDKLD  165



>ref|NP_001238723.1| uncharacterized protein LOC100499710 precursor [Glycine max]
 gb|ACU13342.1| unknown [Glycine max]
 gb|KHN09136.1| Pollen-specific protein C13 [Glycine soja]
Length=162

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 82/129 (64%), Gaps = 0/129 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F VKG+VYCDPCR  FET  +  IA A + L+C++  + EV YTK+  T++ G Y M V+
Sbjct  28   FCVKGRVYCDPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAYTMYVD  87

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H ++IC   +  SP   CKE   G ++A V+ +   G+ S+ R+AN + FM ++V+  
Sbjct  88   EDHADQICSAKLVSSPHPQCKEVTPGRDEAVVILTRYNGIASDDRFANAMGFMSQEVASG  147

Query  170  CAKVLKELD  144
            CA+VL++ +
Sbjct  148  CAEVLRQYE  156



>gb|ABK94215.1| unknown [Populus trichocarpa]
Length=159

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = -3

Query  551  SCHPGES-FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            +  PG + F+V+G VYCD C   FET  +  IA + V++ECR+  T+++ Y+KE TT++ 
Sbjct  19   AARPGRNPFSVQGIVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDST  78

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFF  195
            G Y++TV+ +H+++ICD  +  SPR+DC   +AG ++A+V+ +   G+ S  RYAN + F
Sbjct  79   GKYIITVDEDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLVSTTRYANSMGF  138

Query  194  MKEKVSKECAKVLKE  150
            M  +    C ++L+ 
Sbjct  139  MAAQPMSGCTELLRS  153



>gb|AFK47744.1| unknown [Lotus japonicus]
Length=162

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 78/129 (60%), Gaps = 0/129 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F VKG VYCDPCR  FET  +  IA A V L CR   + EV YTK   TN+ G Y ++V 
Sbjct  28   FIVKGCVYCDPCRAGFETSATTRIAGAEVMLLCRQKNSNEVVYTKRGWTNSKGEYTISVS  87

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H ++ICD  +  SP   CKEA  G ++A+V+ +   G+ S+ R+AN +  M E V+  
Sbjct  88   EDHGDQICDAKLISSPHPTCKEATPGRDQARVILTRYNGIASDDRFANAMGSMSENVAAG  147

Query  170  CAKVLKELD  144
            C ++LK+ +
Sbjct  148  CTQILKQYE  156



>ref|XP_008378536.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=218

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 82/129 (64%), Gaps = 0/129 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            FTV+GKVYCD CR  +ET+    IA A VRLECR+ T+  + YTKE TT++ G Y + V 
Sbjct  86   FTVEGKVYCDTCRAGYETKAITYIAGAKVRLECRDKTSMALLYTKEGTTDSAGCYKIPVA  145

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H ++ CD  +  SP++DC   + G E+A+V+ +   G+ S  R+AN + FM+ +    
Sbjct  146  EDHLDQFCDAVLVSSPQKDCATVSPGRERARVILTANNGIASYNRFANAMGFMRTEALSG  205

Query  170  CAKVLKELD  144
            C ++LKEL 
Sbjct  206  CTQILKELQ  214



>ref|NP_001057857.1| Os06g0556600 [Oryza sativa Japonica Group]
 dbj|BAD53560.1| putative pollen allergen Phl p 11 [Oryza sativa Japonica Group]
 dbj|BAD54134.1| putative pollen allergen Phl p 11 [Oryza sativa Japonica Group]
 dbj|BAF19771.1| Os06g0556600 [Oryza sativa Japonica Group]
 gb|EAZ01328.1| hypothetical protein OsI_23359 [Oryza sativa Indica Group]
 gb|EAZ37341.1| hypothetical protein OsJ_21682 [Oryza sativa Japonica Group]
 dbj|BAG93005.1| unnamed protein product [Oryza sativa Japonica Group]
Length=175

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 80/135 (59%), Gaps = 2/135 (1%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            PG  F V G+VYCDPCR  FET +S++I  A V +ECR+      +   E TT+  G Y 
Sbjct  35   PG-GFVVTGRVYCDPCRAGFETNVSKSIPGATVSVECRHYGAGRESLKAEATTDEKGWYK  93

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSN-VRYANPLFFMKE  186
            + ++ +H+EEIC+V ++KS    C E     ++++V  +   G+  N +RYANP+ F ++
Sbjct  94   VEIDQDHQEEICEVVLDKSSDPACSETEKTRDRSRVPLTSNNGLKQNGIRYANPIAFFRK  153

Query  185  KVSKECAKVLKELDF  141
            +   +C  +L++ D 
Sbjct  154  EPLADCGSILQKYDL  168



>ref|XP_003565925.1| PREDICTED: pollen allergen Phl p 11 [Brachypodium distachyon]
Length=170

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 77/135 (57%), Gaps = 2/135 (1%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            PG  F V G+VYCDPCR  FET +S+NI  A V ++CR     +     E TT+  G Y 
Sbjct  30   PG-GFVVTGRVYCDPCRAGFETNVSKNIGGATVAVDCRPFNGGDSKLKAEATTDQYGWYK  88

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKE  186
            + ++ +H+EEIC+V + +SP   C E     ++A+V  +   G+     RYANP+ F ++
Sbjct  89   IDIDQDHQEEICEVLLARSPDPACSEIEEFRDRARVPLTRNNGLKQQGTRYANPIAFFRK  148

Query  185  KVSKECAKVLKELDF  141
            +  K+C  +L+  D 
Sbjct  149  EPLKDCGGILQAYDL  163



>ref|XP_009386950.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=166

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 78/130 (60%), Gaps = 1/130 (1%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G+V+CD CR  FET +S  I  A VR+ECR+  T   T + E TT+  GTY + VE
Sbjct  33   FVVQGRVFCDTCRAGFETPVSTYIQGATVRVECRSEFTGAKTCSFEGTTDHTGTYNILVE  92

Query  350  GEHEE-EICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
            GEH++ EIC+  +  SP   CK A  G E+A V  S   G+ S+ R+AN L F+K+    
Sbjct  93   GEHDDHEICESLLVSSPESGCKTALQGRERAPVFLSHNNGIASDTRFANSLGFLKDTSLP  152

Query  173  ECAKVLKELD  144
             C ++LK  +
Sbjct  153  VCTELLKSYE  162



>gb|KHG12773.1| Olee1-like protein [Gossypium arboreum]
Length=187

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = -3

Query  533  SFTVKGKVYCDPCRLKFETRISENIADAVVRLECRN-MtteevtytkettTNADGTYMMT  357
            ++ V G VYCD CR++FET++SE I  AVV+LECRN    +    ++E  T+  G Y + 
Sbjct  30   TYIVVGHVYCDTCRVEFETKLSEPIGGAVVKLECRNRTDNQLTFQSQEIVTDEHGDYHIA  89

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            VEG++EE  CDV + +SP  DC + +     ++VV +   G+   +R+AN L F K+   
Sbjct  90   VEGDYEESDCDVALVRSPNPDCNDPSEIWRISRVVLTTLDGVSGELRFANNLGFKKKVAL  149

Query  176  KECAKVLKELDFVPL  132
             +C +VL+E+ +  L
Sbjct  150  PQCTQVLQEIGYYEL  164



>gb|KHN19737.1| Pollen-specific protein C13 [Glycine soja]
Length=162

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 81/127 (64%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F VKG+VYCDPCR  FET  +  IA A + L+C++  + EV YTK+  T++ G Y M V+
Sbjct  28   FCVKGRVYCDPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAYTMYVD  87

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H ++IC   +  SP   CKE   G ++A V+ +   G+ S+ R+AN + FM ++V+  
Sbjct  88   EDHADQICSAKLVSSPHPQCKEVTPGRDEAVVILTRYNGIASDDRFANAMGFMSQEVASG  147

Query  170  CAKVLKE  150
            CA++L++
Sbjct  148  CAEILRQ  154



>ref|XP_010269200.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=159

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 80/127 (63%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            FTV GKVYCD CR  FET  +  I  A VR+ECR+  T  + ++ +  T++ G+Y + V 
Sbjct  27   FTVFGKVYCDNCRAGFETSATTYIPGAKVRVECRDRDTLNLLFSVDGVTDSTGSYKIQVA  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +HE+++C+  +  SP+ DC     G E+A+V+ +   G+ S+ RYAN L F+K++    
Sbjct  87   EDHEDQLCESVLVSSPQNDCSAVEPGRERARVILTRGNGIASDNRYANSLGFIKDQPLPG  146

Query  170  CAKVLKE  150
            CA+++K+
Sbjct  147  CAEIMKQ  153



>ref|XP_002310579.1| hypothetical protein POPTR_0007s05750g [Populus trichocarpa]
 gb|EEE91029.1| hypothetical protein POPTR_0007s05750g [Populus trichocarpa]
Length=158

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 80/131 (61%), Gaps = 0/131 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G  F V+G+VYCD C+  FET+ +  + DA VR+ECR+ T  ++ Y+ E  T++ GTY +
Sbjct  23   GNPFYVRGRVYCDTCQCGFETKKTTYVPDARVRIECRDRTDLQLRYSVEGVTDSTGTYKI  82

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             VEG+  + +C V +  SP  DCK        A+V+ +   G  S++ YAN L F+K+K 
Sbjct  83   KVEGDQADRLCHVVLVDSPLADCKTVDTARNGAEVILTRSNGAISDLHYANSLGFVKDKA  142

Query  179  SKECAKVLKEL  147
               CA+++K+L
Sbjct  143  LPGCAELVKQL  153



>ref|XP_008450951.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=165

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 85/134 (63%), Gaps = 2/134 (1%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F V+GKVYCD CR++F T++S+ +  A V+LEC+ +    VT  KE  T+  G Y + 
Sbjct  25   DQFFVEGKVYCDTCRVQFFTKVSKFLKGATVKLECKEIEGGSVTLNKEAVTDKSGKYSIE  84

Query  356  VEGEHEEEICDVTVEKSPREDCKEAA--AGLEKAQVVCSDKVGMHSNVRYANPLFFMKEK  183
             +G+HEEE+C+V++ KS   DC E +       ++V  ++  G+ + VR ANPL F+K++
Sbjct  85   ADGDHEEEVCEVSLVKSVDPDCDEISKEGYGHTSRVTITNNSGITNPVRLANPLAFLKKE  144

Query  182  VSKECAKVLKELDF  141
               EC +VL+EL F
Sbjct  145  KLPECKEVLRELGF  158



>ref|XP_004144129.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004171680.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN66323.1| hypothetical protein Csa_1G597700 [Cucumis sativus]
Length=165

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 85/134 (63%), Gaps = 2/134 (1%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F V+GKVYCD CR++F T++S+ +  A V+LEC+ +    VT  KE  T+  G Y + 
Sbjct  25   DQFFVEGKVYCDTCRVQFFTKVSKFLEGATVKLECKEIEGGSVTLDKEAVTDKSGKYSIE  84

Query  356  VEGEHEEEICDVTVEKSPREDCKEAA--AGLEKAQVVCSDKVGMHSNVRYANPLFFMKEK  183
             +G+HEEE+C+V++ KS   DC E +       ++V  ++  G+ + VR ANPL F+K++
Sbjct  85   ADGDHEEEVCEVSLMKSVDPDCDEISKEGYGHTSRVTITNNSGITNPVRLANPLAFLKKE  144

Query  182  VSKECAKVLKELDF  141
               EC +VL+EL F
Sbjct  145  KLSECKEVLRELGF  158



>ref|XP_010529196.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=173

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 84/138 (61%), Gaps = 4/138 (3%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G VYCD CR++F TR+S+ +  A VRLEC+N     +T +KE  T+  G+++M 
Sbjct  32   DRFQIQGSVYCDTCRVQFITRLSKFLQGAKVRLECKNRVNGTLTVSKEAVTDESGSFLME  91

Query  356  VEGEHEEEICDVTVEKSPREDCKEAA--AGLEK-AQVVCSDKVGMHSN-VRYANPLFFMK  189
            V G+HEEE+C++ + +SP +DC E +  A L   A++  +   G+ SN  R  NPL FM 
Sbjct  92   VTGDHEEEVCEIVLVESPDKDCSEVSKEAFLRNAAKISLTANDGIVSNETRIVNPLGFMV  151

Query  188  EKVSKECAKVLKELDFVP  135
            +  S EC    KEL   P
Sbjct  152  KTPSTECPAAFKELGIKP  169



>ref|XP_009764546.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Nicotiana sylvestris]
Length=161

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 79/130 (61%), Gaps = 0/130 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G  F VKGK YCD CR  FET  ++ +A A VR+ECR+   E  TYT E  TN+ G Y +
Sbjct  24   GNPFLVKGKAYCDTCRCGFETPATKYLAGAKVRIECRHRVIEASTYTVEGVTNSKGEYNI  83

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             V  +  ++ CDV + KSP   C +  AG ++++V+ +   GM SN R+AN + F++++ 
Sbjct  84   LVNSDRGDDACDVILVKSPDRTCTKPNAGRDRSRVILTRNNGMISNTRFANAMGFLRDEP  143

Query  179  SKECAKVLKE  150
               C ++L++
Sbjct  144  LSSCTQILQQ  153



>ref|XP_002268073.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CBI33037.3| unnamed protein product [Vitis vinifera]
Length=159

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 82/127 (65%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F + G+VYCD CR  FET  +  IA A VR+EC++  + ++ Y+ E  T++ GTY  ++ 
Sbjct  27   FVLHGRVYCDTCRAGFETSATTYIAGARVRIECKDRNSLQLVYSVEGVTDSTGTYKFSIA  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H +++CD  + KSP+ DC +  AG +++++  +   G+ S+ R+AN + FMK++ +  
Sbjct  87   DDHGDQMCDAVLVKSPQPDCAKVDAGRDRSRLSLTRSNGLVSDTRFANAMGFMKDEPASG  146

Query  170  CAKVLKE  150
            C ++LK+
Sbjct  147  CTQLLKQ  153



>gb|AEW90948.1| pollen-specific protein F8-6 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 83/139 (60%), Gaps = 0/139 (0%)
 Frame = -3

Query  560  GSGSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTN  381
            G+   +    + V+G+VYCD CR  FET ++E I  A VRLEC+   TE+V  + +  T+
Sbjct  20   GTAVANDLPDYIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKRFGTEKVECSIDGVTD  79

Query  380  ADGTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPL  201
              GTY + ++  H E+IC++ + +SP  +C E     ++A++V S  VG+  N+R ANPL
Sbjct  80   ETGTYKIELKDSHPEDICEMVLVQSPLANCNEIQDLRDRAEIVLSRYVGISDNIRMANPL  139

Query  200  FFMKEKVSKECAKVLKELD  144
             ++K+K    C  +LK  +
Sbjct  140  GYLKDKPLPVCPDLLKTFN  158



>ref|XP_010538209.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=170

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = -3

Query  533  SFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTV  354
            +F +KG VYCD CR++F TR+S+ +  A V+LEC+N   + VT  +E  T+  G Y M V
Sbjct  30   TFHIKGSVYCDTCRVQFITRLSKFLEGAKVKLECKNRVNQTVTLVEEAVTDKSGNYEMVV  89

Query  353  EGEHEEEICDVTVEKSPREDCKEAAAG---LEKAQVVCSDKVGMHSN-VRYANPLFFMKE  186
             G+HEEE+C++ + +SP  +C+E          A++  +   G+ SN  R  NPL FM+ 
Sbjct  90   TGDHEEEVCEIVLVESPEAECREINNEEFLRNAARISLTANDGIVSNETRTVNPLGFMRN  149

Query  185  KVSKECAKVLKELDFVP  135
                +C K  KELD VP
Sbjct  150  TPLPDCPKAFKELDIVP  166



>ref|XP_003541705.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN08444.1| Olee1-like protein [Glycine soja]
Length=169

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 83/140 (59%), Gaps = 4/140 (3%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytke-ttTNA  378
            GS +  + F V+G VYCD CR++F T++SE +  A VR+ C  +   +     +   T+A
Sbjct  20   GSAYARDRFMVEGTVYCDTCRVQFLTKLSEFLEGATVRVVCSQVDNAKNVTFSKEAVTDA  79

Query  377  DGTYMMTVEGEHEEEICDVTVEKSPREDCKEA---AAGLEKAQVVCSDKVGMHSNVRYAN  207
             G+Y + V+G+HEE+ C+VT+ KSPR DC E    +   + A++  +   G+ S +R AN
Sbjct  80   SGSYKVEVDGDHEEDTCEVTLLKSPRADCSEVDQESHLQQAARISITKNNGIVSPIRQAN  139

Query  206  PLFFMKEKVSKECAKVLKEL  147
            PL F+K+     C  +LKEL
Sbjct  140  PLGFLKKDRLPGCLDLLKEL  159



>gb|EMS52933.1| hypothetical protein TRIUR3_31283 [Triticum urartu]
Length=169

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 76/126 (60%), Gaps = 0/126 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G+V+CD CR  FET  S  IA A VR+EC++ +T   T + E  T+  GTY + V 
Sbjct  35   FVVRGRVWCDTCRAGFETPASTFIAGAKVRVECKSRSTGAQTCSFEGHTDHTGTYNIPVA  94

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             EHE E+C+  +  SP   C +A AG E+A V  ++  G+ SNVR AN L F K+     
Sbjct  95   DEHEHELCESVLVSSPDTACAKAVAGRERAPVFLNNNNGVASNVRLANALGFEKDTPLAA  154

Query  170  CAKVLK  153
            CA++LK
Sbjct  155  CAQILK  160



>ref|XP_002392460.1| hypothetical protein MPER_07958 [Moniliophthora perniciosa FA553]
 gb|EEB93390.1| hypothetical protein MPER_07958 [Moniliophthora perniciosa FA553]
Length=160

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 87/131 (66%), Gaps = 1/131 (1%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
             TV GKVYCD CR  FET  S  IA A V++EC++ T+ ++ Y++E TT++ GTY + V 
Sbjct  28   LTVTGKVYCDTCRAGFETPASTYIAGAKVKVECKDRTSMKLLYSQEATTDSTGTYKLFVS  87

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H++++CD  +  SP+ +C++ AAG ++A+V+ +   G+ S+ RYAN + F  ++    
Sbjct  88   EDHQDQLCDAMLLSSPQPNCQKPAAGRDRARVILTRYNGIVSDTRYANNMGFEMDQPLAG  147

Query  170  CAKVLKEL-DF  141
            C +VL++  DF
Sbjct  148  CTQVLQQYQDF  158



>gb|AEW90940.1| group 11 grass pollen allergen F7-1 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 74/135 (55%), Gaps = 1/135 (1%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            P   F V G+VYCDPCR  FET +S+N+  A V ++CR     E     E TT+  G Y 
Sbjct  26   PEGGFLVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDKQGWYK  85

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKE  186
            + ++ +H++EIC+V + KSP   C E     ++A+V  +    M     RYANP+ F  +
Sbjct  86   IEIDQDHQDEICEVVLTKSPDPSCAEIEEFRDRARVPLTSNNDMKQQGTRYANPIAFFPK  145

Query  185  KVSKECAKVLKELDF  141
            +  KEC  +L+  D 
Sbjct  146  EPRKECGGILQAYDL  160



>ref|XP_010060161.1| PREDICTED: protein DOWNSTREAM OF FLC [Eucalyptus grandis]
 gb|KCW66732.1| hypothetical protein EUGRSUZ_F00490 [Eucalyptus grandis]
Length=160

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 87/131 (66%), Gaps = 1/131 (1%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
             TV GKVYCD CR  FET  S  IA A V++EC++ T+ ++ Y++E TT++ GTY + V 
Sbjct  28   LTVTGKVYCDTCRAGFETPASTYIAGAKVKVECKDRTSMKLLYSQEATTDSTGTYKLFVS  87

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H++++CD  +  SP+ +C++ AAG ++A+V+ +   G+ S+ RYAN + F  ++    
Sbjct  88   EDHQDQLCDAMLLSSPQLNCQKPAAGRDRARVILTRYNGIVSDTRYANNMGFEMDQPLAG  147

Query  170  CAKVLKEL-DF  141
            C +VL++  DF
Sbjct  148  CTQVLQQYQDF  158



>ref|XP_009366359.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Pyrus x bretschneideri]
Length=162

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 80/130 (62%), Gaps = 0/130 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G  F V+G+VYCD CR  FET  +  I+ A VR+EC++  T ++ Y+ E  T++ GTY +
Sbjct  25   GNPFHVQGRVYCDTCRCGFETTATNYISGARVRIECKDRNTLQLAYSVEGETDSTGTYNI  84

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             +E +HE++IC   +  SP  DCK A  G  +A VV +   G+  + RYAN + F K++ 
Sbjct  85   LIEEDHEDQICKSVLVSSPISDCKSADPGRSRANVVVTRYNGVVKDKRYANNMGFFKDEP  144

Query  179  SKECAKVLKE  150
              +C K+L++
Sbjct  145  LADCEKILEQ  154



>ref|NP_001146979.1| LOC100280588 precursor [Zea mays]
 gb|ACG24873.1| pollen-specific protein C13 precursor [Zea mays]
 gb|ACN27364.1| unknown [Zea mays]
 tpg|DAA46881.1| TPA: pollen-specific protein C13 [Zea mays]
Length=172

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = -3

Query  533  SFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTV  354
            SF V+G+V+CD CR  FET  S  IA A VR++C++ TT   T + E  T+  GTY + V
Sbjct  37   SFVVRGRVWCDNCRAGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILV  96

Query  353  EGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
              EHE E+C+  +  SP + C    AG E+A V  +   G+ SNVR AN L F K+    
Sbjct  97   IDEHEHELCESVLVSSPDKGCANVVAGRERAPVFLTSNNGVASNVRLANALGFQKDVALP  156

Query  173  ECAKVLK  153
             CA++LK
Sbjct  157  RCAQILK  163



>gb|ACG32277.1| pollen-specific protein C13 precursor [Zea mays]
Length=172

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = -3

Query  533  SFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTV  354
            SF V+G+V+CD CR  FET  S  IA A VR++C++ TT   T + E  T+  GTY + V
Sbjct  37   SFVVRGRVWCDNCRAGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILV  96

Query  353  EGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
              EHE E+C+  +  SP + C    AG E+A V  +   G+ SNVR AN L F K+    
Sbjct  97   IDEHEHELCESVLVSSPDKGCANVVAGRERAPVFLASNNGVASNVRLANALGFQKDVALP  156

Query  173  ECAKVLK  153
             CA++LK
Sbjct  157  RCAQILK  163



>ref|XP_008225283.1| PREDICTED: olee1-like protein [Prunus mume]
Length=168

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 88/143 (62%), Gaps = 3/143 (2%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            G  +  ++ +V G VYCD CR++F TRISE +  A V+LECR+     +T + ET T+  
Sbjct  21   GFAYCADNLSVDGLVYCDSCRIQFMTRISEALQGAKVKLECRDREGGTITLSSETETDEQ  80

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLE---KAQVVCSDKVGMHSNVRYANP  204
            G Y + VEG+HEEE+C+V + KSPR+DC E +        A++  ++  G+    R  NP
Sbjct  81   GRYQIPVEGDHEEEVCEVVLVKSPRDDCSEISTDSHAKLSARISLTNNNGIAGPHRIPNP  140

Query  203  LFFMKEKVSKECAKVLKELDFVP  135
            L F+K++   +CA+VLKEL   P
Sbjct  141  LGFLKKEPDAQCAEVLKELGLTP  163



>emb|CDY52214.1| BnaAnng11370D [Brassica napus]
Length=174

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 83/141 (59%), Gaps = 10/141 (7%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G VYCD CR++F TR+S+ +  A V+LECR+ T   +  TKE  T+  G+YMM 
Sbjct  33   DRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTLALTKEAVTDKTGSYMME  92

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSN-------VRYANPLF  198
            V G+HEEE+C++ + +SP   C + +   E+A +  + K+ + +N        R  NPL 
Sbjct  93   VTGDHEEEVCELVLVQSPDSGCSDVS---EEAYLRNAAKISLTANDGIVSHETRIVNPLG  149

Query  197  FMKEKVSKECAKVLKELDFVP  135
            FM +  S +C    KEL  VP
Sbjct  150  FMVKTPSADCPAAFKELGIVP  170



>ref|XP_009108374.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY34057.1| BnaC03g62750D [Brassica napus]
 emb|CDX76511.1| BnaA08g08890D [Brassica napus]
Length=171

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            +SF ++G VYCD CR++F TR+S+ +  A V+LECR+ T   V  TKE  T+  G+Y M 
Sbjct  30   DSFKIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTVALTKEAVTDKSGSYTME  89

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            V G+HEEE+C++ + +SP   C + +         K  +  +D +  H   R  NPL FM
Sbjct  90   VTGDHEEEVCELVLLQSPDSACSDVSQDAYLRNAAKVSLTANDGIVSH-ETRIVNPLGFM  148

Query  191  KEKVSKECAKVLKELDFVP  135
             +  S EC    KEL  VP
Sbjct  149  VKTPSAECPAAFKELGIVP  167



>ref|XP_009114385.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=174

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 83/141 (59%), Gaps = 10/141 (7%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G VYCD CR++F TR+S+ +  A V+LECR+ T   +  TKE  T+  G+YMM 
Sbjct  33   DRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTLALTKEAVTDKTGSYMME  92

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSN-------VRYANPLF  198
            V G+HEEE+C++ + +SP   C + +   E+A +  + K+ + +N        R  NPL 
Sbjct  93   VTGDHEEEVCELVLVQSPDSGCSDVS---EEAYLRNAAKISLTANDGIVSHETRIVNPLG  149

Query  197  FMKEKVSKECAKVLKELDFVP  135
            FM +  S +C    KEL  VP
Sbjct  150  FMVKTPSADCPAAFKELGIVP  170



>ref|XP_011075627.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=163

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 79/130 (61%), Gaps = 1/130 (1%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V GKVYC+ CR  F  R S+ +A A V+LEC+N  TE+VTYT E  TN  G Y +T E
Sbjct  28   FVVDGKVYCEVCRANFTNRYSKPMAGAKVKLECKNEVTEKVTYTLEGETNDKGVYTLTAE  87

Query  350  GEH-EEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
            G+H  E++C VT+ KS   DC E       A+V  +   G H   R+ANPL F +++   
Sbjct  88   GDHGSEDLCAVTLVKSSMADCAEIPDEKPAAEVTLTLNNGFHDEFRHANPLAFTRKEALP  147

Query  173  ECAKVLKELD  144
            ECA++ KEL+
Sbjct  148  ECAELFKELE  157



>emb|CDY65576.1| BnaC09g52000D [Brassica napus]
Length=174

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 82/141 (58%), Gaps = 10/141 (7%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G VYCD CR++F TR+S+ +  A V+LECR+ T   +  TKE  T+  G+YMM 
Sbjct  33   DRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTLALTKEAVTDKTGSYMME  92

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSN-------VRYANPLF  198
            V G+HEEE+C + + +SP   C + +   E+A +  + K+ + +N        R  NPL 
Sbjct  93   VTGDHEEEVCQLVLVQSPDSGCSDVS---EEAYLRNAAKISLTANDGIVSHETRIVNPLG  149

Query  197  FMKEKVSKECAKVLKELDFVP  135
            FM +  S +C    KEL  VP
Sbjct  150  FMVKTPSADCPAAFKELGIVP  170



>ref|XP_010527375.1| PREDICTED: major pollen allergen Lol p 11-like [Tarenaya hassleriana]
Length=165

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  545  HPGE---SFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            HP +   +  V+G+ YCDPCR  FET  S  I  A V+LEC++  T +V Y+ E  T+ D
Sbjct  23   HPKDNRNTMVVEGRTYCDPCRAGFETSASYFIPGATVKLECKDRKTMDVMYSDEAITDKD  82

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFF  195
            G Y   V  +H++E+CDV + KSP  +C   + G E++QV+ +   G+ S  RYAN + F
Sbjct  83   GCYKFFVHEDHKDEMCDVKLVKSPDTNCPRISPGREQSQVILNHFNGIASQTRYANNMGF  142

Query  194  MKEKVSKECAKVLKE  150
             KE+    CA+++K+
Sbjct  143  EKEEPDVFCAELMKQ  157



>ref|XP_007148052.1| hypothetical protein PHAVU_006G176500g [Phaseolus vulgaris]
 gb|ESW20046.1| hypothetical protein PHAVU_006G176500g [Phaseolus vulgaris]
Length=169

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 82/140 (59%), Gaps = 4/140 (3%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytke-ttTNA  378
            GS    + F V+G VYCD CR++F TR+SE +  A VR+ C  +   +     + T T+A
Sbjct  20   GSASARDRFFVEGTVYCDTCRVQFLTRMSEFLEGAAVRVMCSQVDNAKNVTFDKETVTDA  79

Query  377  DGTYMMTVEGEHEEEICDVTVEKSPREDCKEA---AAGLEKAQVVCSDKVGMHSNVRYAN  207
             G+Y M V+G+HEE+ C VT+ KSPR DC E    +   + A++  +   G+ S +R AN
Sbjct  80   LGSYKMEVDGDHEEDNCQVTLVKSPRPDCSEVDKESYLQQAARISITKNNGIVSPIRQAN  139

Query  206  PLFFMKEKVSKECAKVLKEL  147
            PL F+K+     C  +LKEL
Sbjct  140  PLGFLKKDRLPGCQDLLKEL  159



>ref|XP_011075462.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=163

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 78/130 (60%), Gaps = 1/130 (1%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V GKVYC+ CR  F  R SE +  A V+LEC+N  TE+VTYT E  TN  G Y +T E
Sbjct  28   FVVDGKVYCEVCRANFTNRYSEPMPGAKVKLECKNEVTEKVTYTLEGETNDKGVYTLTAE  87

Query  350  GEH-EEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
            G+H  E++C VT+ KS   DC E       A+V  +   G H   R+ANPL F +++   
Sbjct  88   GDHGSEDLCAVTLVKSSMADCAEIPDEKPAAEVTLTLNNGFHDEFRHANPLAFTRKEALP  147

Query  173  ECAKVLKELD  144
            ECA++ KEL+
Sbjct  148  ECAELFKELE  157



>emb|CAA78897.1| pollen specific gene [Oryza sativa Indica Group]
Length=164

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 82/130 (63%), Gaps = 1/130 (1%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            + V+G+VYCD CR +FET ++E I  A VRLEC++  T++V    +  T+  GTY + ++
Sbjct  30   YVVQGRVYCDTCRAEFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
              HEE+IC+V +  SP  +C E  A  ++A+V+ +  VG+  N+R ANPL ++K+     
Sbjct  90   DSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDYHCPS  149

Query  170  CAKVLKELDF  141
             A +LK+ D 
Sbjct  150  AA-LLKQFDL  158



>gb|EPS70684.1| hypothetical protein M569_04073 [Genlisea aurea]
Length=170

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 77/136 (57%), Gaps = 4/136 (3%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G+V+C+ CR  F  R+SE +  A VRLECR      +T+  E  T+A G Y +   
Sbjct  31   FFVQGQVFCEVCRTNFINRLSEPMEGATVRLECRGDNVGNITFGIEGVTDAGGNYKLKAT  90

Query  350  GEHEEEICDVTVEKSPREDCK----EAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEK  183
            G+HE+E C VT+ KS R DC+    E  A    +++  +   G H ++R+ANPL F K++
Sbjct  91   GDHEDEDCQVTLVKSSRLDCQETPSEGWAMQPSSKITITKNNGFHDDIRHANPLGFTKKE  150

Query  182  VSKECAKVLKELDFVP  135
                C ++ KEL   P
Sbjct  151  RDPACQELFKELQINP  166



>ref|XP_007136225.1| hypothetical protein PHAVU_009G028900g [Phaseolus vulgaris]
 gb|ESW08219.1| hypothetical protein PHAVU_009G028900g [Phaseolus vulgaris]
Length=162

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 80/127 (63%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F+VKG+VYCD CR  FET  +  IA A V  +C++ TT EV +T+   T++ GTY + V+
Sbjct  28   FSVKGRVYCDRCRAGFETSATTYIAGAEVMAQCKSRTTNEVVFTQNAITDSSGTYTLHVK  87

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H +EIC V +  SP  +C     G ++A V+ +   G+ S+ RYAN + FM  +V+  
Sbjct  88   KDHNDEICSVKILSSPHPECTVVTPGRDEALVILTRYNGIASDDRYANAMGFMSREVAAG  147

Query  170  CAKVLKE  150
            CA+VLK+
Sbjct  148  CAEVLKQ  154



>ref|XP_003634471.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CAN61642.1| hypothetical protein VITISV_029644 [Vitis vinifera]
 emb|CBI19132.3| unnamed protein product [Vitis vinifera]
Length=159

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 80/129 (62%), Gaps = 0/129 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G+VYCD CR  FET  +  IA A VR+EC++  + ++ Y+ E  T++ GTY + 
Sbjct  25   QPFVLQGRVYCDTCRAGFETSATTYIAGAKVRVECKDRNSMQLLYSIEGITDSTGTYKIM  84

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            V  + E+++CD  +  SP+ DC     G ++A V+ +   G+ S+ RYAN + F+K+   
Sbjct  85   VTEDREDQLCDAVLVSSPQSDCASVDPGRDRAAVILTRYNGIVSDNRYANSMGFLKDHPM  144

Query  176  KECAKVLKE  150
             EC ++L++
Sbjct  145  SECTQLLQQ  153



>ref|XP_007153183.1| hypothetical protein PHAVU_003G013900g [Phaseolus vulgaris]
 gb|ESW25177.1| hypothetical protein PHAVU_003G013900g [Phaseolus vulgaris]
Length=162

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 80/133 (60%), Gaps = 3/133 (2%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E F V+GK+YCDPC   FE+R+S  ++   V L+C       VTY K +T++A+G Y + 
Sbjct  27   EKFFVEGKIYCDPCHFAFESRLSFPLSGVNVSLQCIQEENNTVTYLKNSTSDANGMYNIP  86

Query  356  VEGEHEEEICDVTVEKSPRE-DCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
            V G+HE++IC V V  SP E  CKEA    +  +++ +D +G  S  RY NPL FM + +
Sbjct  87   VLGDHEDDIC-VVVADSPNEGQCKEAMPN-KSDRIILTDNMGAASLARYVNPLGFMTQTI  144

Query  179  SKECAKVLKELDF  141
              +C  V+ EL+ 
Sbjct  145  DSQCNAVVHELEL  157



>ref|XP_006464247.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Citrus sinensis]
Length=161

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 79/130 (61%), Gaps = 0/130 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G+ F ++G+VYCD CR  FET  +  I  A VR+EC++  +  + Y+ +  T++ GTY +
Sbjct  22   GDPFHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYNI  81

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             V+G+H+++IC   +  SP  DCK A  G   +QV+ +   G  SN+ +AN L F+K + 
Sbjct  82   HVDGDHQDQICYSKLISSPLADCKTADPGRACSQVILTRSNGAVSNLHFANALGFLKARP  141

Query  179  SKECAKVLKE  150
               C ++LK+
Sbjct  142  LAFCPELLKK  151



>ref|XP_006428158.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
 gb|ESR41398.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
Length=250

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 80/131 (61%), Gaps = 0/131 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G+ F ++G+VYCD CR  FET  +  I  A VR+EC++  +  + Y+ +  T++ GTY +
Sbjct  22   GDPFHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYNI  81

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             V+G+H+++IC   +  SP  DCK A  G   +QV+ +   G  SN+ +AN L F+K + 
Sbjct  82   HVDGDHQDQICYSKLISSPLADCKTADPGRACSQVILTRSNGAVSNLHFANALGFLKARP  141

Query  179  SKECAKVLKEL  147
               C ++LK+L
Sbjct  142  LAFCPELLKKL  152



>ref|XP_003638771.1| Pollen allergen Phl p [Medicago truncatula]
 gb|ACJ86158.1| unknown [Medicago truncatula]
 gb|AFK43522.1| unknown [Medicago truncatula]
 gb|KEH34886.1| pollen Ole e I family allergen [Medicago truncatula]
Length=162

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F +KG+V CDPCR  +ET    +IA A V L C+   T EV +TK   T+A G Y + V+
Sbjct  28   FCLKGRVVCDPCRAGYETSAITHIAGADVMLVCKQRITNEVVFTKPGKTDATGEYTIYVD  87

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +  +++CDV +  SP   C E A G ++A+V+ +   G+ SN R+AN + +M E+V+  
Sbjct  88   QDRADDVCDVQLINSPERSCSEKAPGRDQARVILTRYNGISSNDRFANAMLYMAEEVASG  147

Query  170  CAKVLKEL  147
            CA+VLK++
Sbjct  148  CAEVLKQM  155



>gb|AFK46977.1| unknown [Lotus japonicus]
Length=168

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 89/140 (64%), Gaps = 4/140 (3%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtt-eevtytkettTNA  378
            GS +  + F ++G VYCD CR +F TR+SE ++ A V + CR      +VT++KE  T+A
Sbjct  19   GSAYSQDRFFIEGTVYCDTCRTQFLTRVSEFMSGATVGVVCRERDAGAKVTFSKEAVTDA  78

Query  377  DGTYMMTVEGEHEEEICDVTVEKSPREDCKE--AAAGLEKA-QVVCSDKVGMHSNVRYAN  207
            +G Y + V+G+HE+E+C+V + KS R DC E    + LE+A ++  ++  G+ S VR AN
Sbjct  79   NGMYSVAVDGDHEDEVCEVKLLKSSRADCSEVDTESHLEQASRISITNNNGIVSPVRTAN  138

Query  206  PLFFMKEKVSKECAKVLKEL  147
            PL F+K +   EC  +L +L
Sbjct  139  PLGFLKTERLPECGHILLQL  158



>ref|XP_004289324.1| PREDICTED: pollen-specific protein C13-like [Fragaria vesca subsp. 
vesca]
Length=163

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 77/130 (59%), Gaps = 0/130 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G+ F V+G+VYCD CR  FET  +  IA A V ++C N  +  + Y+ E  T+  GTY +
Sbjct  26   GKPFHVQGRVYCDTCRCGFETSATIYIAGATVGIKCMNRNSMSLAYSVEGVTDETGTYNI  85

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             VE +HE++IC+  +  SP  DCK A  G  +A VV +   G+    R+AN + F K++ 
Sbjct  86   LVEDDHEDQICESVLVSSPISDCKSADPGRSRANVVLTRFNGVVKTKRFANNMGFFKDQA  145

Query  179  SKECAKVLKE  150
              EC ++LK+
Sbjct  146  LPECTELLKQ  155



>ref|XP_006284941.1| hypothetical protein CARUB_v10006240mg [Capsella rubella]
 gb|EOA17839.1| hypothetical protein CARUB_v10006240mg [Capsella rubella]
Length=172

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G VYCD CR++F TR+S+ +  A V+LECR+     VT T+E  T+  G+Y M 
Sbjct  31   DRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRVNGTVTLTEEAVTDKSGSYKME  90

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            V G+HEEE+C++ + +SP  DC + +         K  +  +D +  H   R  NPL FM
Sbjct  91   VAGDHEEEVCELVLLESPDSDCSDVSKEAYLHNAAKISLTANDGIVSHET-RIVNPLGFM  149

Query  191  KEKVSKECAKVLKELDFVP  135
             +  S EC    KEL  VP
Sbjct  150  VKTPSAECPAAFKELGIVP  168



>ref|XP_003543768.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Glycine max]
 gb|KHN26075.1| Pollen-specific protein C13 [Glycine soja]
Length=162

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F VKG+V+CDPCR  FET ++  IA A V L+C++  T    Y+K+  T++ G++ + V+
Sbjct  28   FYVKGRVFCDPCRAGFETPLTTYIAGAEVTLQCKDRITNNNVYSKQVKTDSTGSFTIFVD  87

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
                 + CD ++  SP  DCKE   G +  +V  +   G+ +N R+ N L FMKE V+  
Sbjct  88   ANQANQNCDASLVTSPLRDCKEPTPGRDHTRVNLNRFNGIATNDRFVNNLGFMKEIVASS  147

Query  170  CAKVLKE  150
            CAK+ K 
Sbjct  148  CAKIFKS  154



>gb|EYU31033.1| hypothetical protein MIMGU_mgv1a015328mg [Erythranthe guttata]
Length=161

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 80/134 (60%), Gaps = 0/134 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G+ F VKG VYCD CR  FET +++ +  A VR+ECR+  + ++TYT+E  T+  G Y  
Sbjct  26   GDPFLVKGCVYCDSCRCGFETDVTKYMPSAKVRIECRDRDSAKLTYTQEAVTDESGCYSA  85

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             V+ +  E+ CD  + KS  ++C    AG ++A+V+ +   GM  NVRYAN + F+K   
Sbjct  86   VVQSDRGEDFCDAVLVKSSDDECSVPNAGRDRARVILTRNNGMTDNVRYANNMGFLKNIP  145

Query  179  SKECAKVLKELDFV  138
               CA++L +   +
Sbjct  146  LSNCAQILHKYQII  159



>ref|XP_009409254.1| PREDICTED: major pollen allergen Lol p 11-like [Musa acuminata 
subsp. malaccensis]
Length=168

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 73/131 (56%), Gaps = 0/131 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F V+G+V+CD CR  FET +S     A VR+ECR+  T   T   E TT+  GTY + 
Sbjct  34   QGFVVQGRVFCDTCRAGFETPVSTYTKGAKVRIECRSKATGAKTCNFEGTTDHTGTYNIL  93

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            V  EHE EIC+  +  SP   CK    G E+A+V  S   G+ S+ RYAN L F  +   
Sbjct  94   VADEHEHEICESMLVSSPESRCKTPLQGRERARVFLSHNNGIASDTRYANSLGFQTDTPL  153

Query  176  KECAKVLKELD  144
              CA++LK  +
Sbjct  154  SVCAELLKTYE  164



>gb|AEW90945.1| group 11 grass pollen allergen R1-2, partial [Secale cereale 
x Triticum turgidum subsp. durum]
Length=161

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 74/135 (55%), Gaps = 1/135 (1%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            P   F V G+VYCDPCR  FET +S+N+  A V ++CR     E     E TT+  G Y 
Sbjct  26   PESGFIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYK  85

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKE  186
            + ++ +H++EI +V + KSP   C E     ++A+V  +   GM     R+ANP+ F  +
Sbjct  86   IEIDQDHQDEIREVVLTKSPDASCAEIEEFRDRARVPLTSNDGMKQQGTRFANPIAFFPK  145

Query  185  KVSKECAKVLKELDF  141
            +  KEC  +L+  D 
Sbjct  146  EPRKECGGILQAYDL  160



>ref|XP_010441660.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F ++G VYCD CR++F TR+S+ +  A V+LECRN T   VT TKE  T+  G+Y M V 
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRNRTNGTVTLTKEAVTDKSGSYKMEVT  94

Query  350  GEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFMKE  186
            G+HEEE+C++ + +SP   C + +         K  +  +D +  H   R  NPL FM +
Sbjct  95   GDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISLTANDGIVSHET-RIVNPLGFMVK  153

Query  185  KVSKECAKVLKELDFVP  135
              S +CA   KE+  VP
Sbjct  154  TPSADCAAAFKEIGIVP  170



>ref|XP_010518802.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=172

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 82/136 (60%), Gaps = 4/136 (3%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F ++G VYCD CR++F TR+S+ +  A VRLEC+N  T  +T +KE  T+  G+++M V 
Sbjct  33   FQIQGSVYCDTCRVQFITRLSKFLQGAKVRLECKNRVTGALTVSKEAVTDDTGSFLMQVT  92

Query  350  GEHEEEICDVTVEKSPREDCKEA---AAGLEKAQVVCSDKVGMHSN-VRYANPLFFMKEK  183
            G+HEEE+C++ + +SP ++C +    A     A+V  +   G+ SN  R  NPL FM + 
Sbjct  93   GDHEEEVCEIMLVESPDQECSDVSKDAYLRNAAKVSLTANDGIVSNETRIVNPLGFMVKT  152

Query  182  VSKECAKVLKELDFVP  135
             S +C    +EL   P
Sbjct  153  PSADCPAAFQELGITP  168



>ref|XP_009797814.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana sylvestris]
Length=161

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 82/135 (61%), Gaps = 0/135 (0%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
             S H  ++F V GKVYCD CR  FET  S+ +A + VR+EC+   T +V+YT E  TN+ 
Sbjct  19   ASAHFMDTFLVVGKVYCDTCRCGFETSASKYLAGSRVRIECKKRDTNDVSYTIEGVTNSK  78

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFF  195
            G Y + V  +  +E+CDV + +S    C   AAG ++A+VV +   GM SN R+AN + F
Sbjct  79   GEYKILVYSDRGDEVCDVVLIRSSDPMCATPAAGRDRARVVLTRNNGMISNTRFANSIGF  138

Query  194  MKEKVSKECAKVLKE  150
            + ++    C ++L++
Sbjct  139  LSDEPLASCNQILQQ  153



>ref|XP_007206364.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
 gb|EMJ07563.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
Length=160

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 78/130 (60%), Gaps = 0/130 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G  F ++G+VYCD CR  FET  +  I  A VR+EC+   T ++ Y+ E  T+A GTY +
Sbjct  23   GNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNTLQLAYSVEGETDATGTYNI  82

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             VE +HE++IC+  +  SP  DCK A  G ++A VV +   G+  +  YAN + F K++ 
Sbjct  83   LVEDDHEDQICESVLVSSPVNDCKSADPGRKRANVVVTRYNGVVKDKHYANNMGFFKDQP  142

Query  179  SKECAKVLKE  150
               C ++LK+
Sbjct  143  LAGCEELLKQ  152



>ref|XP_008348540.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=162

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 78/130 (60%), Gaps = 0/130 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G  F V+G+VYCD CR  FET  +  I  A VR+EC++  T ++ Y+ E  T++ GTY +
Sbjct  25   GNPFHVQGRVYCDTCRCGFETTATNYIPGARVRIECKDRNTLQLAYSVEGETDSTGTYNI  84

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             VE +HE++IC+  +  SP  DCK A  G  +A VV +   G+  + RYAN + F K + 
Sbjct  85   LVEEDHEDQICESVLVSSPISDCKSADPGRSRANVVVTRYNGVVKDKRYANNMGFFKNEP  144

Query  179  SKECAKVLKE  150
               C K+L++
Sbjct  145  LAGCEKILEQ  154



>ref|XP_010481521.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 80/139 (58%), Gaps = 6/139 (4%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G VYCD CR++F TR+S+ +  A V+LECRN T   VT TKE  T+  G+Y M 
Sbjct  33   DRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRNRTNGTVTLTKEAVTDKSGSYKME  92

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            V G+HEEE+C++ + +SP   C + +         K  +  +D +  H   R  NPL FM
Sbjct  93   VTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISLTANDGIVSHET-RIVNPLGFM  151

Query  191  KEKVSKECAKVLKELDFVP  135
             +  S +CA   KE+  VP
Sbjct  152  VKTPSADCAAAFKEIGIVP  170



>gb|AAM08621.1|AC107314_12 Putative Pollen specific protein C13 precursor [Oryza sativa 
Japonica Group]
 gb|AAN31783.1| Putataive pollen specific protein C13 precursor [Oryza sativa 
Japonica Group]
 gb|AAP53386.1| Pollen proteins Ole e I family protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAY78230.1| hypothetical protein OsI_33275 [Oryza sativa Indica Group]
 gb|EAZ15857.1| hypothetical protein OsJ_31276 [Oryza sativa Japonica Group]
Length=172

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G+V+CD C   FET  S  IA A V++ECR+ +T   T + E  T+  GTY + V 
Sbjct  38   FVVRGRVWCDTCLAGFETPASTYIAGAKVKVECRSKSTGAKTCSFEGQTDHTGTYNIPVN  97

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             EHE E+C+  +  SP   C +  AG E+A V  ++  G+ SNVR AN L F K+     
Sbjct  98   DEHEHELCESVLVSSPDAKCGKIVAGRERAPVFLTNNNGVTSNVRLANALGFQKDAPLAA  157

Query  170  CAKVLK  153
            CA++LK
Sbjct  158  CAQILK  163



>ref|NP_001237189.1| uncharacterized protein LOC100305566 precursor [Glycine max]
 gb|ACU13310.1| unknown [Glycine max]
Length=162

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 80/127 (63%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F VKG+VYC PCR  FET  +  IA A + L+C++  + EV YTK+  T++ G Y M V+
Sbjct  28   FCVKGRVYCGPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAYTMCVD  87

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H ++IC   +  SP   CKE   G ++A V+ +   G+ S+ R+AN + FM ++V+  
Sbjct  88   EDHADQICSAKLVSSPHPQCKEVTPGRDEAVVIPTRYNGIASDDRFANAMGFMSQEVASG  147

Query  170  CAKVLKE  150
            CA++L++
Sbjct  148  CAEILRQ  154



>ref|XP_006366520.1| PREDICTED: olee1-like protein-like [Solanum tuberosum]
Length=162

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 77/132 (58%), Gaps = 0/132 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            ++F V GKVYCD CR  FET  S  +  + VR+EC+N  T ++ YT E  TN+ G Y + 
Sbjct  26   DTFLVVGKVYCDTCRCGFETSASMYLPGSRVRIECKNRDTNDLAYTVEGFTNSKGEYKIL  85

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            V  +  +E CDV + +S    C E   G ++A+VV +   GM SN R+AN + F+  +  
Sbjct  86   VNSDRRDEFCDVVLIRSSDPMCAEPNTGRDRARVVLTSNNGMVSNTRFANSMGFLSNEPL  145

Query  176  KECAKVLKELDF  141
              C K+L++ +F
Sbjct  146  ASCTKILQQYEF  157



>ref|NP_001064462.2| Os10g0371000 [Oryza sativa Japonica Group]
 dbj|BAF26376.2| Os10g0371000, partial [Oryza sativa Japonica Group]
Length=196

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G+V+CD C   FET  S  IA A V++ECR+ +T   T + E  T+  GTY + V 
Sbjct  62   FVVRGRVWCDTCLAGFETPASTYIAGAKVKVECRSKSTGAKTCSFEGQTDHTGTYNIPVN  121

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             EHE E+C+  +  SP   C +  AG E+A V  ++  G+ SNVR AN L F K+     
Sbjct  122  DEHEHELCESVLVSSPDAKCGKIVAGRERAPVFLTNNNGVTSNVRLANALGFQKDAPLAA  181

Query  170  CAKVLK  153
            CA++LK
Sbjct  182  CAQILK  187



>ref|XP_009109686.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDX90169.1| BnaA08g18150D [Brassica napus]
Length=171

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 82/136 (60%), Gaps = 4/136 (3%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F +KG VYCD CR++F TR+S+ +  A V+LEC+    + VT TKE  T+ DG Y M V 
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKARENQTVTLTKEAVTDKDGKYEMVVM  91

Query  350  GEHEEEICDVTVEKSPREDCKEAAAG---LEKAQVVCSDKVGMHSN-VRYANPLFFMKEK  183
            G+HEEE+C++ + +SP  +C E          A++  +   G+ SN VR  NPL FM++ 
Sbjct  92   GDHEEEVCEIILVESPDAECGEVNNQEFLRNAARISLTANDGIVSNEVRTINPLGFMRKT  151

Query  182  VSKECAKVLKELDFVP  135
               +C +V KEL  VP
Sbjct  152  PLADCPQVFKELGIVP  167



>ref|XP_004971474.1| PREDICTED: pollen allergen Phl p 11-like [Setaria italica]
Length=168

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 75/134 (56%), Gaps = 1/134 (1%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G  F V G+VYCDPCR  FET +S+++  A V + CR     + T   E TT+  G Y +
Sbjct  28   GGGFVVTGRVYCDPCRAGFETNVSKSVPGATVEVVCRQFGASKETLKAEATTDEYGWYKL  87

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGM-HSNVRYANPLFFMKEK  183
             ++ +H++EIC+  + KS    C E     ++A+V  +   G+    VRYANP+ F ++ 
Sbjct  88   EIDQDHQDEICEAVLAKSSDPACAEVEEFRDRARVPLTSNNGIKQQGVRYANPIAFFRKD  147

Query  182  VSKECAKVLKELDF  141
              KEC ++L + D 
Sbjct  148  PLKECGQILSKYDL  161



>ref|XP_010321468.1| PREDICTED: LOW QUALITY PROTEIN: major pollen allergen Lol p 11-like 
[Solanum lycopersicum]
Length=162

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 77/132 (58%), Gaps = 0/132 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            ++F V GKVYCD CR  +ET  S+ +  + VR+EC+N  T ++ YT E  TN+ G Y + 
Sbjct  26   DTFLVIGKVYCDTCRCGYETSASKYLPGSRVRIECKNRDTNDLAYTVEGVTNSKGEYKIL  85

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            V  +  +E CDV + +S    C E   G ++ +VV +   GM SN R+AN L F+  +  
Sbjct  86   VNSDRRDEFCDVVLIRSSDPMCAEPNTGRDRTRVVLTSNNGMVSNTRFANSLGFLYNEPL  145

Query  176  KECAKVLKELDF  141
              C K+LK+ +F
Sbjct  146  ASCTKILKQYEF  157



>emb|CDX99789.1| BnaC05g22110D [Brassica napus]
Length=171

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 83/138 (60%), Gaps = 4/138 (3%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F + G VYCD CR++F TR+S+ +  A V+LEC++   + VT TKE  T+ DG Y M 
Sbjct  30   DRFNITGSVYCDTCRVQFVTRLSKFLEGAKVKLECKSRVNQTVTLTKEAVTDKDGKYQME  89

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAG---LEKAQVVCSDKVGMHSN-VRYANPLFFMK  189
            V G+HEEE+C++ + +SP  +C E          A++  +   G+ SN +R  NPL FM+
Sbjct  90   VMGDHEEELCEIILVQSPDAECGEVNNEEFLRNAARISLTANDGIVSNEIRTINPLGFMR  149

Query  188  EKVSKECAKVLKELDFVP  135
            +    +C +V KEL  VP
Sbjct  150  KTPLADCPQVFKELGIVP  167



>ref|XP_009600627.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana tomentosiformis]
Length=162

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
             S H  ++F V GKVYCD CR  FET  S+ +A + VR+EC+N  T +++YT E  TN+ 
Sbjct  19   ASAHFMDTFLVVGKVYCDTCRCGFETSASKYLAGSRVRIECKNRDTNDISYTIEGVTNSK  78

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFF  195
            G Y + V  +  +E+CDV + +S    C    AG ++A+VV +   GM SN R+AN + F
Sbjct  79   GEYKILVYSDRGDEVCDVVLIRSSDPMCAVPNAGRDRARVVLTRNNGMVSNTRFANSIGF  138

Query  194  MKEKVSKECAKVLKE  150
            +  +    C ++L++
Sbjct  139  LSNEPLASCNQILQQ  153



>emb|CDY01556.1| BnaC07g35460D [Brassica napus]
Length=172

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            +SF ++G VYCD CR++F TR+S+ +  A V+LECR+ T   VT TKE  T+  G+Y M 
Sbjct  31   DSFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSRTNGTVTLTKEAVTDKSGSYKME  90

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            V G+HEEE+C++ + +SP   C + +         K  +  +D +  H   R  NPL FM
Sbjct  91   VTGDHEEEVCELVLLQSPDSGCSDVSTEAYLRNAAKVSLTANDGIVSHET-RIVNPLGFM  149

Query  191  KEKVSKECAKVLKELDFVP  135
             +    +C    KEL  VP
Sbjct  150  VKTPLADCPAAFKELGIVP  168



>ref|XP_006281481.1| hypothetical protein CARUB_v10027565mg [Capsella rubella]
 gb|EOA14379.1| hypothetical protein CARUB_v10027565mg [Capsella rubella]
Length=174

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 78/137 (57%), Gaps = 6/137 (4%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F ++G VYCD CR++F TR+S+ +  A V+LECR+ T   VT TKE  T+  G+YMM V 
Sbjct  35   FQIQGSVYCDTCRVQFITRLSKFLEGAKVKLECRSRTNGTVTLTKEAVTDKTGSYMMEVT  94

Query  350  GEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFMKE  186
            G+HEEE+C++ + +SP   C + +         K  +  +D +  H   R  NPL FM  
Sbjct  95   GDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISLTANDGIVSHET-RIVNPLGFMVM  153

Query  185  KVSKECAKVLKELDFVP  135
              S +C    KEL  VP
Sbjct  154  TPSADCPAAFKELGIVP  170



>ref|XP_010911793.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=175

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 75/128 (59%), Gaps = 0/128 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F V+G+V+CD CR  FET  S  IA A VRLECR+ TT   T + +  T+  GTY + 
Sbjct  39   KGFVVQGRVFCDTCRAGFETPKSTYIAGAKVRLECRSRTTGAKTCSFDGVTDRSGTYNIL  98

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            V  EHE E C+  +  SP + C +   G E+A+V  ++  G+ S  R+AN L F ++   
Sbjct  99   VADEHEHETCEAVLVSSPVKGCAKTLEGRERARVFLTNNNGIASTKRFANSLGFQRDIAL  158

Query  176  KECAKVLK  153
              CA++LK
Sbjct  159  AGCAQLLK  166



>ref|XP_006442530.1| hypothetical protein CICLE_v10024378mg [Citrus clementina]
 gb|ESR55770.1| hypothetical protein CICLE_v10024378mg [Citrus clementina]
Length=163

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = -3

Query  527  TVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVEG  348
            TV+G VYCD CR+K++T +S+ IA A V LEC+     EV Y++E  ++  GTY + +EG
Sbjct  32   TVEGLVYCDSCRVKYKTELSDYIAGATVALECKESEGGEVVYSREVVSDQSGTYKIPIEG  91

Query  347  EHEEEICDVTVEKSPREDCKEAAA-GLEKAQVVCSDKVGMHSN-VRYANPLFFMKEKVSK  174
             H  ++C V + KSP+ +C E  A GL  A++  +  VG     +RYAN L FMK++   
Sbjct  92   CH-AKLCQVRLVKSPKPECSEIVADGLSSARIDLTPSVGSDPELIRYANDLGFMKKESLP  150

Query  173  ECAKVLKEL  147
            ECAKVL+E+
Sbjct  151  ECAKVLEEM  159



>ref|XP_010535648.1| PREDICTED: major pollen allergen Lol p 11-like [Tarenaya hassleriana]
Length=166

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = -3

Query  533  SFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTV  354
            +  V+G+ YCDPCR  FET  S  I  A V+LEC++  T EV YT E TT+ +G Y   V
Sbjct  31   TMVVEGRTYCDPCRAGFETSASYFIPGATVKLECKDRKTMEVMYTDEATTDNNGCYKFFV  90

Query  353  EGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
              +H++E+CDV + KSP  +C   + G E+++V+ +   G+ S  RYAN + F KE+   
Sbjct  91   HDDHKDEMCDVKLVKSPDTNCPRISPGREQSRVILNHYNGIASQTRYANNMGFEKEEPDV  150

Query  173  ECAKVLKE  150
             CA++LK+
Sbjct  151  FCAELLKQ  158



>gb|ACJ83911.1| unknown [Medicago truncatula]
 gb|ACJ86228.1| unknown [Medicago truncatula]
 gb|AFK43996.1| unknown [Medicago truncatula]
 gb|KEH36588.1| pollen Ole e I family allergen [Medicago truncatula]
Length=168

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 89/133 (67%), Gaps = 4/133 (3%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F V+G VYCD CR +F TR++E I  A VR+EC+      +T+ KE TT+  G Y + 
Sbjct  26   DRFFVEGVVYCDTCRTQFITRLTEFIEGATVRVECKE-DNGTLTFNKEATTDKSGKYSVE  84

Query  356  VEGEHEEEICDVTVEKSPREDCKE--AAAGLEK-AQVVCSDKVGMHSNVRYANPLFFMKE  186
            ++G+HE+E C+V + KSPR+DC E  + A L++ A++  ++  G+ S VR A+PL F+K+
Sbjct  85   IDGDHEDETCEVILCKSPRKDCSEVDSEAHLQQAARISVTNNNGIVSPVRAASPLGFLKK  144

Query  185  KVSKECAKVLKEL  147
            +   +C +VLKEL
Sbjct  145  ERLPKCGEVLKEL  157



>ref|NP_567562.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 sp|Q6NMJ2.1|OLE96_ARATH RecName: Full=Pollen-specific protein-like At4g18596; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAS47674.1| At4g18596 [Arabidopsis thaliana]
 dbj|BAD94719.1| pollen-specific protein - like [Arabidopsis thaliana]
 gb|AEE84066.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=172

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G VYCD CR++F TR+S+ +  A V+LECR+ T   VT TKE  T+  G+Y M 
Sbjct  31   DRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTVTLTKEAVTDKTGSYRME  90

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            V G+HEEE+C++ + +SP   C + +         K  +  +D +  H   R  NPL FM
Sbjct  91   VTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISLTANDGIVSHET-RIVNPLGFM  149

Query  191  KEKVSKECAKVLKELDFVP  135
             +  S EC    KEL  VP
Sbjct  150  VQTPSAECPAAFKELGIVP  168



>gb|AFK42345.1| unknown [Lotus japonicus]
Length=164

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 80/136 (59%), Gaps = 1/136 (1%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F V GK+YCDPC  +FE+R+S  +    + LEC+   T  VT+T E  T+ +G Y +T
Sbjct  29   DKFVVVGKIYCDPCHFEFESRLSHPLEGVKITLECKKADTNNVTFTTEAVTDKNGVYTLT  88

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
             +G+HEEE+C+V  + + + +C       +  ++V +  +G+ S  RY NPL FM + + 
Sbjct  89   CDGDHEEEVCEVNTDANTKGECTIPMVN-KFDRIVLTRNMGVSSLTRYVNPLGFMTKAIH  147

Query  176  KECAKVLKELDFVPLE  129
             +C  V++EL    L+
Sbjct  148  SQCGNVVQELGLDKLD  163



>emb|CDX99452.1| BnaC01g11000D [Brassica napus]
Length=172

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G VYCD CR++F TR+S+ +  A V+LECR+ T   VT TKE  T+  G+Y M 
Sbjct  31   DRFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSRTNGTVTLTKEAVTDKSGSYKME  90

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            V G+HEEE+C++ + +SP   C + +         K  +  +D +  H   R  NPL FM
Sbjct  91   VTGDHEEEVCELVLLQSPDSGCSDVSKEAYLRNAAKVSLTANDGIVSHET-RIVNPLGFM  149

Query  191  KEKVSKECAKVLKELDFVP  135
             +  S +C    KEL  VP
Sbjct  150  VKTPSADCPAAFKELGIVP  168



>ref|XP_002489221.1| hypothetical protein SORBIDRAFT_0012s014630 [Sorghum bicolor]
 gb|EES20226.1| hypothetical protein SORBIDRAFT_0012s014630 [Sorghum bicolor]
Length=171

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G+V+CD CR  FET  S  IA A VR++C++ TT   T + E  T+  GTY + V 
Sbjct  37   FVVRGRVWCDNCRTGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILVA  96

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             EHE E+C+  +  SP + C     G E+A V  +   G+ SN+R AN L F K+     
Sbjct  97   DEHEHELCESILVSSPDKGCSNVVVGRERAPVFLTSNNGVASNIRLANALGFEKDVALPR  156

Query  170  CAKVLK  153
            CA++LK
Sbjct  157  CAQILK  162



>ref|XP_006645671.1| PREDICTED: pollen allergen Phl p 11-like, partial [Oryza brachyantha]
Length=152

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 76/135 (56%), Gaps = 2/135 (1%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            PG  F V G+VYCDPCR  FET +S +I  + V +ECR+          E TT+  G Y 
Sbjct  12   PG-GFVVTGRVYCDPCRAGFETNVSSSIPGSTVSVECRHFGGGPERLKAEATTDERGWYK  70

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSN-VRYANPLFFMKE  186
            + ++ +H+EEIC+  + KS    C E     ++++V  +   G+  N VRYANP+ F ++
Sbjct  71   VEIDQDHQEEICEAVLVKSGDPKCSETEQFRDRSRVPLTSNNGLKQNGVRYANPIAFFRK  130

Query  185  KVSKECAKVLKELDF  141
            +   +C  +L++ D 
Sbjct  131  EPLADCGFILQKYDL  145



>ref|XP_008245042.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Prunus mume]
Length=162

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 76/130 (58%), Gaps = 0/130 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G  F ++G+VYCD CR  FET  +  I  A VR+EC+   T ++ Y+ E  T+  GTY +
Sbjct  25   GNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNTLQLAYSVEGETDTTGTYNI  84

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             VE +HE++IC+  +  SP  DCK A  G  +A VV +   G+  +  YAN + F K++ 
Sbjct  85   LVEDDHEDQICESVLVSSPVNDCKSADPGRNRANVVVTRYNGVVKDKHYANNMGFFKDQP  144

Query  179  SKECAKVLKE  150
               C ++LK+
Sbjct  145  LAGCEELLKQ  154



>ref|XP_010538956.1| PREDICTED: major pollen allergen Lol p 11 [Tarenaya hassleriana]
Length=159

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 81/127 (64%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G+VYCD CR  FET  S  I  AVV+LEC++  + E+ Y+ E  T++ G Y + V 
Sbjct  27   FVVRGRVYCDTCRAGFETPASTYIPGAVVKLECKDRRSMELVYSHEARTDSTGAYKIWVN  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +HE+++CD+ + KSP+  C + + G E+A+V  +   G+ S+ RY N + F +++    
Sbjct  87   EDHEDQLCDIMLVKSPQLGCSKVSHGRERARVTLTRYNGIASDDRYVNNMGFERDEALSG  146

Query  170  CAKVLKE  150
            C++++++
Sbjct  147  CSEIMRQ  153



>ref|XP_007149397.1| hypothetical protein PHAVU_005G066800g [Phaseolus vulgaris]
 gb|ESW21391.1| hypothetical protein PHAVU_005G066800g [Phaseolus vulgaris]
Length=162

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 77/130 (59%), Gaps = 1/130 (1%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E F V+GK+YCDPC+  FE+R+S  ++   V L+C     + V+Y K +TT+A+G Y + 
Sbjct  27   EKFFVEGKIYCDPCQFAFESRLSFALSGVNVTLKCIKEENDIVSYQKNSTTDANGMYSIP  86

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            V G+HEEEIC V  +      CKEA    +  +++ +  +G  S  RY NPL FM +   
Sbjct  87   VHGDHEEEICVVVADPPNEGQCKEAMPN-KSDRIILTKNMGAASMTRYVNPLGFMTQTTD  145

Query  176  KECAKVLKEL  147
             +C  V++EL
Sbjct  146  SQCFAVVQEL  155



>ref|XP_010261236.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=163

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 79/127 (62%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V G+VYCD CR  FET  +  I  A VR+ECR+     + ++ E  T+A GTY + V 
Sbjct  29   FNVVGRVYCDTCRAGFETPATTYIPGARVRVECRDRDNLNLLFSVEGVTDATGTYNIQVA  88

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H +++C+  + +S +EDC +  +G E+A VV +   G+ S+ R+AN + F+K++    
Sbjct  89   EDHGDQLCEAVLVRSSQEDCGKIESGRERANVVLTRNNGVLSDKRFANNMGFIKDQPLAG  148

Query  170  CAKVLKE  150
            CA++LK+
Sbjct  149  CAEILKQ  155



>ref|XP_008797140.1| PREDICTED: major pollen allergen Lol p 11-like [Phoenix dactylifera]
 ref|XP_008797142.1| PREDICTED: major pollen allergen Lol p 11-like [Phoenix dactylifera]
Length=174

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 78/132 (59%), Gaps = 0/132 (0%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            +   ++G VYCD CR  FET ++  I  A VRLEC    T+EVTY  E TT+  G Y + 
Sbjct  38   DGLVLEGHVYCDTCRAGFETDLTAYIPGAKVRLECTRYGTDEVTYAAEATTDLLGIYQIV  97

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            V G+H E+ C V + KS  ++C E   G ++A+VV +   G+ SNVR AN L F+  +  
Sbjct  98   VPGDHSEDQCSVVLMKSAVDNCTEIKPGRDRARVVLAQDGGLLSNVRRANALGFLIAEPL  157

Query  176  KECAKVLKELDF  141
             EC K+L++  F
Sbjct  158  AECGKLLQKYGF  169



>ref|XP_010494740.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F ++G VYCD CR++F TR+S+ +  A V+LECR+ T   VT TKE  T+  G+Y M V 
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTVTLTKEAVTDKSGSYKMEVT  94

Query  350  GEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFMKE  186
            G+HEEE+C++ + +SP   C + +         K  +  +D +  H   R  NPL FM +
Sbjct  95   GDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISLTANDGIVSHET-RIVNPLGFMVK  153

Query  185  KVSKECAKVLKELDFVP  135
              S +CA   KE+  VP
Sbjct  154  TPSADCAAAFKEIGIVP  170



>ref|XP_009136942.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY53995.1| BnaA03g58200D [Brassica napus]
Length=171

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 78/139 (56%), Gaps = 6/139 (4%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            +SF ++G VYCD CR++F TR+S+ +  A V+LECR+ T   VT TKE  T+  G+Y M 
Sbjct  30   DSFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSRTNGTVTLTKEAVTDKSGSYKME  89

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            V G+HEEE+C++ +  SP   C + +         K  +  +D +  H   R  NPL FM
Sbjct  90   VTGDHEEEVCELVLLHSPDSGCSDVSTEAYLRNAAKVSLTANDGIVSHET-RIVNPLGFM  148

Query  191  KEKVSKECAKVLKELDFVP  135
             +    +C    KEL  VP
Sbjct  149  VKTPLADCPAAFKELGIVP  167



>ref|XP_010434511.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G VYCD CR++F TR+S+ +  A V+LECR+     VT TKE  T+  G+Y M 
Sbjct  31   DRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRVNGTVTLTKEAVTDKSGSYKME  90

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            V G+HEEE+C++ + +SP  +C + +         K  +  +D +  H   R  NPL FM
Sbjct  91   VTGDHEEEVCELVLVESPNSECSDVSKEAYLRNAAKISLTANDGIVSHET-RIVNPLGFM  149

Query  191  KEKVSKECAKVLKELDFVP  135
             +  S EC    KE+  VP
Sbjct  150  VKTPSAECPAAFKEIGIVP  168



>ref|XP_007018845.1| Pollen-specific protein C13, putative [Theobroma cacao]
 gb|EOY16070.1| Pollen-specific protein C13, putative [Theobroma cacao]
Length=159

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 80/126 (63%), Gaps = 0/126 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
              V+G+VYCD CR  FET  + N+A A V++EC +  T +V Y KE  T++ G Y + V 
Sbjct  27   LVVQGQVYCDRCRAGFETPKTRNMAGAKVKVECSDRKTGQVVYKKEGYTDSTGHYKVVVS  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H +EICD  + KS + DC + + G E+A+V+ ++  G+ SN R+AN + FM ++    
Sbjct  87   EDHLDEICDAILVKSSQPDCAKMSPGRERARVILTNFNGIASNTRFANAMGFMADEADAG  146

Query  170  CAKVLK  153
            CA+++K
Sbjct  147  CAEIMK  152



>ref|XP_003581152.1| PREDICTED: pollen-specific protein C13-like [Brachypodium distachyon]
Length=171

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 78/128 (61%), Gaps = 0/128 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            + V+G+VYCD CR  FET ++  I  A VRLEC+   TE+V    +  T+  GTY + ++
Sbjct  31   YIVQGRVYCDTCRAGFETNVTTYIKGAKVRLECKRFGTEKVERALDGVTDETGTYKIELK  90

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
              H E+IC+V + +SP  DC +  A  ++A+V  +  +G+  N+R AN L ++K+     
Sbjct  91   DSHPEDICEVVLIQSPLADCNKIQALRDRARVELTRNIGISDNLRLANSLGYLKDVPLPV  150

Query  170  CAKVLKEL  147
            CA++LK+ 
Sbjct  151  CAQLLKQF  158



>emb|CDY43319.1| BnaC03g58910D [Brassica napus]
Length=171

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 82/136 (60%), Gaps = 4/136 (3%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F +KG VYCD CR++F TR+S+ +  A V+LEC+    + VT TKE  T+ +G Y M V 
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAVTDKEGKYEMVVM  91

Query  350  GEHEEEICDVTVEKSPREDCKEAAAG---LEKAQVVCSDKVGMHSN-VRYANPLFFMKEK  183
            G+HEEE+C++ + +SP  +C E          A++  +   G+ SN VR  NPL FM++ 
Sbjct  92   GDHEEEVCEIILVESPDAECGEVNNQEFLRNAARISLTANDGIVSNEVRTINPLGFMRKT  151

Query  182  VSKECAKVLKELDFVP  135
               +C +V KEL  VP
Sbjct  152  PLADCPQVFKELGIVP  167



>ref|XP_007153182.1| hypothetical protein PHAVU_003G013800g [Phaseolus vulgaris]
 gb|ESW25176.1| hypothetical protein PHAVU_003G013800g [Phaseolus vulgaris]
Length=163

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 82/134 (61%), Gaps = 4/134 (3%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLEC-RNMtteevtytkettTNADGTYMM  360
            E F+V+GK+YCDPC   FE+R+S  ++   V L+C +      +TY K +T++A+G Y +
Sbjct  27   EKFSVQGKIYCDPCHFAFESRLSFPLSGVSVSLQCIKEENNTIITYLKNSTSDANGMYNI  86

Query  359  TVEGEHEEEICDVTVEKSPRE-DCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEK  183
             V G+HE++IC V V  SP E  CKEA    +  +++ ++ +G  S  RY NPL FM + 
Sbjct  87   PVLGDHEDDIC-VVVADSPNEGQCKEAMPN-KSDRIIITNNMGAASLTRYVNPLGFMTQT  144

Query  182  VSKECAKVLKELDF  141
            +  +C  V+ EL+ 
Sbjct  145  IDSQCNVVVHELEL  158



>ref|XP_009132011.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDX78874.1| BnaA01g09410D [Brassica napus]
Length=172

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G VYCD CR++F TR+S+ +  A V+LECR+ T   VT TKE  T+  G+Y M 
Sbjct  31   DRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTVTLTKEAVTDKSGSYKME  90

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            V G+HEEE+C++ + +SP   C + +         K  +  +D +  H   R  NPL FM
Sbjct  91   VTGDHEEEVCELVLLQSPDSGCSDVSKEAYLRNAAKVSLTANDGIVSHET-RIVNPLGFM  149

Query  191  KEKVSKECAKVLKELDFVP  135
             +  S +C    KEL  VP
Sbjct  150  VKTPSADCPAAFKELGIVP  168



>gb|EYU24008.1| hypothetical protein MIMGU_mgv1a015363mg [Erythranthe guttata]
Length=160

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 79/130 (61%), Gaps = 0/130 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G+S  ++G  YCD CR  +ET  S+ +A AVV LECR+ TT E+TY+ ET T++ G Y  
Sbjct  25   GDSLLLQGSTYCDACRCGYETSASKPVAGAVVGLECRSRTTSELTYSDETVTDSAGKYKF  84

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             V+ +  ++ CDV + KS   +C E   G ++A+V+ +   GM SN R+AN + F+    
Sbjct  85   LVQSDRGDDFCDVFLSKSSDPECSEPNVGRDRARVILTRNNGMDSNTRFANAMGFLANTP  144

Query  179  SKECAKVLKE  150
               C ++LK+
Sbjct  145  LASCQEILKQ  154



>ref|XP_009115274.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=171

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 82/138 (59%), Gaps = 4/138 (3%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F + G VYCD CR++F TR+S+ +  A V+LEC++   + VT TKE  T+ DG Y M 
Sbjct  30   DRFNITGSVYCDTCRVQFVTRLSKFLEGAKVKLECKSRVNQTVTLTKEAVTDKDGKYQME  89

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAG---LEKAQVVCSDKVGMHSN-VRYANPLFFMK  189
            V G+HEEE+C+  + +SP  +C E          A++  +   G+ SN +R  NPL FM+
Sbjct  90   VMGDHEEELCEFILVQSPDAECGEVNNEEFLRNAARISLTANDGIVSNEIRTINPLGFMR  149

Query  188  EKVSKECAKVLKELDFVP  135
            +    +C +V KEL  VP
Sbjct  150  KTPLADCPQVFKELGIVP  167



>ref|XP_007149396.1| hypothetical protein PHAVU_005G066700g [Phaseolus vulgaris]
 gb|ESW21390.1| hypothetical protein PHAVU_005G066700g [Phaseolus vulgaris]
Length=162

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 76/130 (58%), Gaps = 1/130 (1%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            E F V+GK+YCDPC+  FE+R+S  ++   V L+C     + V+Y K +TT+A+G Y + 
Sbjct  27   EKFFVEGKIYCDPCQFAFESRLSFALSGVNVTLKCIKEENDIVSYLKNSTTDANGMYNIP  86

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVS  177
            V G+HEEEIC V  +      CKEA    +  +++ +  +G  S  RY NPL FM +   
Sbjct  87   VRGDHEEEICMVVADPPNEGQCKEAMPN-KSDRIILTKNMGAASMTRYVNPLGFMTQTTD  145

Query  176  KECAKVLKEL  147
             +C  V+ EL
Sbjct  146  SQCFSVVHEL  155



>ref|XP_010496255.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 78/137 (57%), Gaps = 6/137 (4%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F ++G VYCD CR++F TR+S+ +  A V+LECR+     VT TKE  T+  G+Y M V 
Sbjct  33   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRVNGTVTLTKEAVTDKSGSYKMEVT  92

Query  350  GEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFMKE  186
            G+HEEE+C++ + +SP  +C + +         K  +  +D +  H   R  NPL FM +
Sbjct  93   GDHEEEVCELVLVESPDSECSDVSKEAYLRNAAKISLTANDGIVSHET-RIVNPLGFMVK  151

Query  185  KVSKECAKVLKELDFVP  135
              S EC    KE+  VP
Sbjct  152  TPSAECPAAFKEIGIVP  168



>ref|NP_174209.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAF88123.1|AC021043_16 Similar to major allergen OLE5c [Arabidopsis thaliana]
 gb|AEE31049.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=171

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 81/138 (59%), Gaps = 4/138 (3%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F +KG VYCD CR++F TRIS+ +  A V+LEC+    + VT TKE  T+  G Y M 
Sbjct  30   DKFHIKGSVYCDTCRVQFITRISKFLEGAKVKLECKGRENQTVTLTKEAVTDNAGNYQME  89

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAG---LEKAQVVCSDKVGMHSN-VRYANPLFFMK  189
            V G+HEEE+C++ + +SP  +C +          A++  +   G+ SN  R  NPL FM+
Sbjct  90   VMGDHEEEVCEIVLLQSPDPECGDVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMR  149

Query  188  EKVSKECAKVLKELDFVP  135
            +    EC +V KEL  VP
Sbjct  150  KTPLAECPQVFKELGIVP  167



>ref|XP_002870034.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH46293.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=173

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G VYCD CR++F TR+S+ +  A V+LECR+ T   VT TKE  T+  G+Y M 
Sbjct  32   DRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTVTLTKEAVTDKTGSYRME  91

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            V G+HEEE+C++ + +SP   C + +         K  +  +D +  H   R  NPL FM
Sbjct  92   VTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISLTANDGIVSHET-RIVNPLGFM  150

Query  191  KEKVSKECAKVLKELDFVP  135
             +  S EC    KEL  VP
Sbjct  151  VKTPSPECPAAFKELGIVP  169



>ref|XP_011030966.1| PREDICTED: protein DOWNSTREAM OF FLC [Populus euphratica]
Length=157

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 79/131 (60%), Gaps = 0/131 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G  F V+G+VYCD C+  FET+ +  I  A VR+EC++ T  ++ Y+ E  T++ G Y +
Sbjct  22   GNPFHVRGRVYCDTCQCGFETKKTTYIPGATVRIECKDRTDLQLRYSLEGVTDSTGAYKI  81

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             V G+  + IC V +  SP  DCK     L +A+V+ +   G  S++ YAN L F+K++ 
Sbjct  82   KVVGDQADRICHVVLVDSPLADCKTVHPVLNRAEVILTRSNGAISDLHYANSLGFVKDEA  141

Query  179  SKECAKVLKEL  147
               CA+++K+L
Sbjct  142  LPGCAELVKKL  152



>ref|XP_010521200.1| PREDICTED: major pollen allergen Lol p 11 [Tarenaya hassleriana]
Length=164

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 81/130 (62%), Gaps = 0/130 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G +  V+G+ YCDPC   FET  S  I  A V+LEC++  T +V +T+ETTT+  G+Y  
Sbjct  27   GNTMVVEGRTYCDPCLAGFETSASYFIPGATVKLECKDRKTMKVMHTEETTTDNGGSYKF  86

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             V  +H++++CDV + KSP  +C   + G E+++V+ +   G+ S  RYAN + F KE  
Sbjct  87   FVHEDHKDQMCDVKLVKSPDTNCPRISPGREQSRVILNHNNGIASQNRYANNMGFEKEAP  146

Query  179  SKECAKVLKE  150
               CA++LK+
Sbjct  147  DAFCAELLKQ  156



>ref|XP_010439832.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G VYCD CR++F TR+S+ +  A V+LECR+     VT TKE  T+  G+Y M 
Sbjct  31   DRFQIQGSVYCDTCRVQFITRLSKFLEGAKVKLECRSRVNGTVTLTKEAVTDKSGSYKME  90

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            V G+HEEE+C++ + +SP  +C + +         K  +  +D +  H   R  NPL FM
Sbjct  91   VTGDHEEEVCELVLVESPDSECSDVSKEAYLRNAAKISLTANDGIVSHET-RIVNPLGFM  149

Query  191  KEKVSKECAKVLKELDFVP  135
             +  S EC    KE+  VP
Sbjct  150  VKTPSAECPAAFKEIGIVP  168



>ref|XP_006414083.1| hypothetical protein EUTSA_v10026398mg [Eutrema salsugineum]
 gb|ESQ55536.1| hypothetical protein EUTSA_v10026398mg [Eutrema salsugineum]
Length=172

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 78/139 (56%), Gaps = 6/139 (4%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F ++G VYCD CR++F TR+S+ +  A V+LECR+     VT TKE  T+  G+Y M 
Sbjct  31   DRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRANGTVTLTKEAVTDKSGSYRME  90

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFM  192
            V G+HEEE+C++ + +SP   C + +         K  +  +D +  H   R  NPL FM
Sbjct  91   VTGDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKISLTANDGIVSHET-RIVNPLGFM  149

Query  191  KEKVSKECAKVLKELDFVP  135
             +    +CA   KEL  VP
Sbjct  150  VKTPLADCAAAFKELGIVP  168



>ref|XP_010540511.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=170

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 80/136 (59%), Gaps = 4/136 (3%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F +KG VYCD CR++F TR+S+ +  A V+LEC+N+  + VT TKE  T+  G Y M V 
Sbjct  31   FHIKGSVYCDTCRVQFFTRLSKFLEGAKVKLECKNIDNQTVTLTKEAVTDKSGNYEMVVM  90

Query  350  GEHEEEICDVTVEKSPREDCKEAAA---GLEKAQVVCSDKVGMHSN-VRYANPLFFMKEK  183
            G+HE+E+C++ + +SP  +C +          A++  +   G+ SN  R  NPL FM+  
Sbjct  91   GDHEDEVCEIVLAESPDTECSDINNEEFTRNAARISLTANDGIVSNETRTVNPLGFMRRT  150

Query  182  VSKECAKVLKELDFVP  135
               +C K  +EL  VP
Sbjct  151  PLSDCPKAFEELGIVP  166



>gb|AAM65838.1| Ole e I (main olive allergen)-like protein [Arabidopsis thaliana]
Length=174

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 77/137 (56%), Gaps = 6/137 (4%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F ++G VYCD CR++F TR+S+ +  A V+LECR+ T   +T TKE  T+  G+Y M V 
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTITLTKEAVTDKTGSYKMEVT  94

Query  350  GEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFMKE  186
            G+HEEE+C++ + +SP   C + +         K  +  +D +  H   R  NPL FM +
Sbjct  95   GDHEEEVCELVLVQSPDSGCSDVSTEAYLRNAAKISLTANDGIVSHET-RIVNPLGFMVQ  153

Query  185  KVSKECAKVLKELDFVP  135
                +C    KEL  VP
Sbjct  154  TXLADCPAAFKELGIVP  170



>ref|XP_006661725.1| PREDICTED: pollen-specific protein C13-like [Oryza brachyantha]
Length=175

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 76/127 (60%), Gaps = 1/127 (1%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G+V+CD C   FET  S  IA A V++ECR+ +T   T + E  T+  GTY + V+
Sbjct  40   FVVRGRVWCDTCLAGFETPASTYIAGAKVKVECRSKSTGAKTCSFEGETDHTGTYNIAVD  99

Query  350  GEHEEEICDVTVEKSP-REDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSK  174
             EHE E+C+  +  SP    C +A AG E+A V  ++  G+ SNVR AN L F K+    
Sbjct  100  DEHEHELCESVLVSSPDAARCGKAVAGRERAPVFLTNNNGVTSNVRLANALGFQKDAPLA  159

Query  173  ECAKVLK  153
             CA+++K
Sbjct  160  ACAQIMK  166



>ref|XP_006398273.1| hypothetical protein EUTSA_v10001051mg [Eutrema salsugineum]
 gb|ESQ39726.1| hypothetical protein EUTSA_v10001051mg [Eutrema salsugineum]
Length=174

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F ++G VYCD CR++F TR+S+ +  A V+LECR+ T   +T TKE  T+  G+Y M V 
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTLTLTKEAVTDKSGSYKMEVT  94

Query  350  GEHEEEICDVTVEKSPREDC----KEAAA-GLEKAQVVCSDKVGMHSNVRYANPLFFMKE  186
            G+HEEE+C++ + +SP   C    KEA      K  +  +D +  H   R  NPL FM +
Sbjct  95   GDHEEEVCELVLVQSPDSGCSNVSKEAYLRNAAKISLTANDGIVSHET-RIVNPLGFMVK  153

Query  185  KVSKECAKVLKELDFVP  135
                +CA   KEL  VP
Sbjct  154  TPLADCAAAFKELGIVP  170



>ref|XP_008234688.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Prunus mume]
Length=162

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 76/130 (58%), Gaps = 0/130 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G  F ++G+VYCD CR  FET  +  I  A VR+EC+   T ++ Y+ E  T+A GTY +
Sbjct  25   GNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNTLQLAYSVEGETDATGTYNI  84

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             VE +HE++IC+  +  SP  DCK A     +A VV +   G+  +  YAN + F K++ 
Sbjct  85   LVEDDHEDQICESVLVSSPVNDCKSADPRRNRANVVVTRYNGIVKDKHYANNMGFFKDQP  144

Query  179  SKECAKVLKE  150
               C ++LK+
Sbjct  145  LAGCEELLKQ  154



>gb|KFK44745.1| hypothetical protein AALP_AA1G297400 [Arabis alpina]
Length=171

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 83/138 (60%), Gaps = 8/138 (6%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F +KG VYCD CR++F TR+S+ +  A V+LEC+    + VT TKE  T+  G Y M V 
Sbjct  32   FHIKGSVYCDTCRVQFVTRVSKFLEGAKVKLECKGRENQTVTLTKEAVTDNAGNYQMEVM  91

Query  350  GEHEEEICDVTVEKSPREDC-----KEAAAGLEKAQVVCSDKVGMHSN-VRYANPLFFMK  189
            G+HEEE+C++ + +SP  +C     +E      +  +  +D  G+ SN  R  NPL FM+
Sbjct  92   GDHEEEVCEIVLVQSPDPECGDINNQEFLRNAARISLTAND--GIVSNETRTINPLGFMR  149

Query  188  EKVSKECAKVLKELDFVP  135
            +   ++C++V KEL  VP
Sbjct  150  KNPLEDCSQVFKELGIVP  167



>gb|EPS62385.1| hypothetical protein M569_12405, partial [Genlisea aurea]
Length=150

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 78/130 (60%), Gaps = 0/130 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G+   VKG VYCD CR  FE   ++ +A A VR+ECR   T ++TY ++  TN+ G Y +
Sbjct  16   GQPLVVKGSVYCDTCRCGFENEATKYMAGAAVRIECREAHTSQITYVEDGVTNSAGHYEI  75

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             V G+  +++CD  + KS   +C    AG ++A+VV +   G+ S+ R+AN + F++   
Sbjct  76   RVHGDRGDDVCDAVLLKSSDPECSTPDAGRDRARVVLTRNNGIASDHRFANSMGFLRNAP  135

Query  179  SKECAKVLKE  150
               CA+VL++
Sbjct  136  LAACAQVLQK  145



>ref|XP_009134109.1| PREDICTED: pollen-specific protein C13 [Brassica rapa]
Length=159

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G+VYCD C   FET  S  I  AVVRLEC++  T E+TY  E  T++ G+Y + V 
Sbjct  27   FVVRGRVYCDTCLAGFETSASTFIPGAVVRLECKDRRTMELTYRHEARTDSTGSYRILVS  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +HE++ CD  +  S +  C   + G ++A+V  +   G+ S+ R+AN L F+++  S  
Sbjct  87   EDHEDQFCDTMLVSSSQLRCSNVSPGHDRARVTLTRFNGIASDERFANNLGFLRDAASPG  146

Query  170  CAKVLKE  150
            CA+++K+
Sbjct  147  CAEIMKQ  153



>ref|XP_010942360.1| PREDICTED: pollen allergen Phl p 11-like [Elaeis guineensis]
Length=174

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 80/138 (58%), Gaps = 0/138 (0%)
 Frame = -3

Query  554  GSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNAD  375
            G     + FT++G+VYCD CR  FET ++  +  A VRLEC    T+E+TY  E TT+  
Sbjct  32   GEASKTKDFTLEGRVYCDTCRTGFETDLTTYMPGAKVRLECMRYGTDELTYKAEATTDFL  91

Query  374  GTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFF  195
            G Y MTV  +H  + C V + KS  ++C E   G ++ ++  +   G+ SN+R AN L +
Sbjct  92   GIYQMTVPDDHSNDQCSVVLVKSSLDNCTEIEPGRDRVRITLAQDGGLLSNIRQANALGY  151

Query  194  MKEKVSKECAKVLKELDF  141
            + +K   EC K+L++  F
Sbjct  152  LIDKPLLECGKLLQKYGF  169



>ref|XP_010549400.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=171

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 81/138 (59%), Gaps = 4/138 (3%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F +KG VYCD CR++F TR+S+ +  A V+LEC+N   + VT TKE  T+  G Y M 
Sbjct  30   DRFHIKGSVYCDTCRVQFITRLSKFLEGAKVKLECKNRVNQTVTLTKEAVTDKSGNYEME  89

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAA---GLEKAQVVCSDKVGMHSN-VRYANPLFFMK  189
            V G+HEEE+C++ + +SP  +C E          A++  +   G+ SN  R  NPL FM+
Sbjct  90   VMGDHEEEVCEIVLGESPDAECSEINNEEFTRNAARISLTANDGIVSNETRSVNPLGFMR  149

Query  188  EKVSKECAKVLKELDFVP  135
            +    +C +  KEL  VP
Sbjct  150  KTPLGDCPEAFKELGIVP  167



>dbj|BAB09316.1| Ole e I (main olive allergen)-like protein [Arabidopsis thaliana]
Length=168

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 77/137 (56%), Gaps = 6/137 (4%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F ++G VYCD CR++F TR+S+ +  A V+LECR+ T   +T TKE  T+  G+Y M V 
Sbjct  29   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTITLTKEAVTDKTGSYKMEVT  88

Query  350  GEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFMKE  186
            G+HEEE+C++ + +SP   C + +         K  +  +D +  H   R  NPL FM +
Sbjct  89   GDHEEEVCELVLVQSPDSGCSDVSTEAYLRNAAKISLTANDGIVSHET-RIVNPLGFMVQ  147

Query  185  KVSKECAKVLKELDFVP  135
                +C    KEL  VP
Sbjct  148  TPLADCPAAFKELGIVP  164



>ref|XP_002533139.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
 gb|EEF29251.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
Length=161

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 76/131 (58%), Gaps = 0/131 (0%)
 Frame = -3

Query  539  GESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMM  360
            G  F +KG+VYCD CR  FET+ +  I  A VR+EC + TT  + Y+ E  T+  GTY +
Sbjct  26   GRPFHIKGRVYCDTCRCGFETKKTTYIPGARVRIECEDRTTLRLKYSVEGETDETGTYNI  85

Query  359  TVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKV  180
             VE +H+++IC   +  SP   C  A  G  +A VV +   G  S++ +AN + F++ + 
Sbjct  86   LVEDDHQDQICYAALVSSPWPSCNTADPGRSRAHVVVTRNNGAISDLHFANSMGFLRNQA  145

Query  179  SKECAKVLKEL  147
               C +++K+L
Sbjct  146  MSGCTELVKQL  156



>pir||S43243 allergen-like protein Syr v I isoform 2 - Syringa vulgaris
Length=145

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 82/142 (58%), Gaps = 6/142 (4%)
 Frame = -3

Query  542  PGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYM  363
            P   F ++G+VYCD CR +F T +SE I  A +RL+C++    ++T+T+   T A+G Y 
Sbjct  7    PVPQFHIQGQVYCDTCRARFITELSEFIPGAGIRLQCKDGEHGKITFTEIGYTRAEGLYS  66

Query  362  MTVEGEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHS---NVRYANPLFFM  192
            M VEG+H+ E C++T+  S R+DC+E      +  V  S K  +++     R  NPL F 
Sbjct  67   MLVEGDHKNEFCEITLLSSSRKDCEEIPI---EGWVKPSLKFILNTVNGTTRTINPLGFF  123

Query  191  KEKVSKECAKVLKELDFVPLEM  126
            K++V  +C +V  +L   P  M
Sbjct  124  KKEVLPKCPQVFNKLGMYPPNM  145



>ref|NP_568650.1| pollen_Ole_e_I-domain containing protein [Arabidopsis thaliana]
 dbj|BAD43611.1| Ole e I (main olive allergen)-like protein [Arabidopsis thaliana]
 gb|ABR46194.1| At5g45880 [Arabidopsis thaliana]
 gb|AED95311.1| pollen_Ole_e_I-domain containing protein [Arabidopsis thaliana]
Length=174

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 77/137 (56%), Gaps = 6/137 (4%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F ++G VYCD CR++F TR+S+ +  A V+LECR+ T   +T TKE  T+  G+Y M V 
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTITLTKEAVTDKTGSYKMEVT  94

Query  350  GEHEEEICDVTVEKSPREDCKEAAA-----GLEKAQVVCSDKVGMHSNVRYANPLFFMKE  186
            G+HEEE+C++ + +SP   C + +         K  +  +D +  H   R  NPL FM +
Sbjct  95   GDHEEEVCELVLVQSPDSGCSDVSTEAYLRNAAKISLTANDGIVSHET-RIVNPLGFMVQ  153

Query  185  KVSKECAKVLKELDFVP  135
                +C    KEL  VP
Sbjct  154  TPLADCPAAFKELGIVP  170



>emb|CDY12288.1| BnaA09g24880D [Brassica napus]
 emb|CDX90693.1| BnaA03g23730D [Brassica napus]
Length=159

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F V+G+VYCD C   FET  S  I  AVVRLEC++  T E+TY  E  T++ G+Y + V 
Sbjct  27   FVVRGRVYCDTCLAGFETSASTFIPGAVVRLECKDRRTMELTYRHEARTDSTGSYKILVS  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +HE++ CD  +  S +  C   + G ++A+V  +   G+ S+ R+AN L F+++  S  
Sbjct  87   EDHEDQFCDTMLVSSSQLRCSNVSPGHDRARVTLTRFNGIASDERFANNLGFLRDAASPG  146

Query  170  CAKVLKE  150
            CA+++K+
Sbjct  147  CAEIMKQ  153



>ref|XP_010941451.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=165

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (58%), Gaps = 1/137 (1%)
 Frame = -3

Query  560  GSGSCHPGESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTN  381
            G     P  SF+V G+VYCD CR  F    +E +  A VRLECR+  + +V+++ E  T+
Sbjct  17   GVADAVPTPSFSVTGRVYCDTCRAGFVHEFTEYLGGAKVRLECRDYVSGQVSHSGEALTD  76

Query  380  ADGTYMMTVEGEHEEEICDVTVEKSPREDCKEAAAG-LEKAQVVCSDKVGMHSNVRYANP  204
              G Y +T+  +H+EEIC+V +  SPR DCKE  A   ++A+V  +   GM S  R  N 
Sbjct  77   KYGYYTITMSDDHQEEICEVVLLDSPRYDCKEIPADHRDRARVALTRNNGMSSEQRNVNA  136

Query  203  LFFMKEKVSKECAKVLK  153
            + ++K+    +C  +L+
Sbjct  137  IGYLKDVPLPKCGPMLQ  153



>emb|CDY69202.1| BnaCnng62360D [Brassica napus]
Length=171

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 80/136 (59%), Gaps = 4/136 (3%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F +KG VYCD CR++F TR+S+ +  A V+LEC+    + VT TKE  T+ DG Y M V 
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAMTDKDGNYEMEVM  91

Query  350  GEHEEEICDVTVEKSPREDCKEAAAG---LEKAQVVCSDKVGMHSN-VRYANPLFFMKEK  183
            G+HEEE+C++ + +SP  +C +          A++  +   G+ SN  R  NPL FM++ 
Sbjct  92   GDHEEEVCEIILVQSPDAECGDVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  182  VSKECAKVLKELDFVP  135
               +C +  KEL  VP
Sbjct  152  PLADCPQAFKELGIVP  167



>ref|XP_006304746.1| hypothetical protein CARUB_v10012122mg [Capsella rubella]
 gb|EOA37644.1| hypothetical protein CARUB_v10012122mg [Capsella rubella]
Length=171

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 80/138 (58%), Gaps = 4/138 (3%)
 Frame = -3

Query  536  ESFTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMT  357
            + F +KG VYCD CR++F TR+S+ +  A V+LEC+    + VT TKE  T+  G Y M 
Sbjct  30   DRFHIKGSVYCDTCRVQFITRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDKAGNYQME  89

Query  356  VEGEHEEEICDVTVEKSPREDCKEAAAG---LEKAQVVCSDKVGMHSN-VRYANPLFFMK  189
            V G+HEEE+C++ + +SP  +C E          A++  +   G+ SN  R  NPL FM+
Sbjct  90   VMGDHEEEVCEIVLLQSPDAECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMR  149

Query  188  EKVSKECAKVLKELDFVP  135
            +    EC +  KEL  VP
Sbjct  150  KTPLAECPQAFKELGIVP  167



>ref|XP_010460686.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 80/136 (59%), Gaps = 4/136 (3%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F +KG VYCD CR++F TR+S+ +  A V+LEC+    + VT TKE  T++ G Y M V 
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDSAGNYQMEVM  91

Query  350  GEHEEEICDVTVEKSPREDCKEAAAG---LEKAQVVCSDKVGMHSN-VRYANPLFFMKEK  183
            G+HEEE+C++ + +SP  +C E          A++  +   G+ SN  R  NPL FM++ 
Sbjct  92   GDHEEELCEIVLVQSPDPECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  182  VSKECAKVLKELDFVP  135
               +C +  KEL  VP
Sbjct  152  PLADCPQAFKELGIVP  167



>gb|KHG30321.1| Anther-specific LAT52 [Gossypium arboreum]
Length=161

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
              V+G VYCD CR  FET  +  +ADA+V+L C +  T  V + KE  T+  G Y + V 
Sbjct  27   LVVEGYVYCDTCRAGFETPKTRRLADAMVKLVCSDRKTGGVVFEKEGYTDKTGKYQIRVS  86

Query  350  GEHEEEICDVTVEKSPREDCKEAAAGLEKAQVVCSDKVGMHSNVRYANPLFFMKEKVSKE  171
             +H ++ICD  + KSP+  C   + G E+A+V+ ++  G+ S  RYAN + FM +K    
Sbjct  87   EDHLDQICDAVLVKSPQLGCATMSPGRERARVILTNSNGISSTTRYANSMGFMVDKAEAG  146

Query  170  CAKVLK  153
            CA+++K
Sbjct  147  CAEMMK  152



>ref|XP_010499433.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 80/136 (59%), Gaps = 4/136 (3%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F +KG VYCD CR++F TR+S+ +  A V+LEC+    + VT TKE  T++ G Y M V 
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDSAGNYQMEVM  91

Query  350  GEHEEEICDVTVEKSPREDCKEAAAG---LEKAQVVCSDKVGMHSN-VRYANPLFFMKEK  183
            G+HEEE+C++ + +SP  +C E          A++  +   G+ SN  R  NPL FM++ 
Sbjct  92   GDHEEELCEIVLVQSPDPECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  182  VSKECAKVLKELDFVP  135
               +C +  KEL  VP
Sbjct  152  PLADCPQAFKELGIVP  167



>ref|XP_009102877.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY15649.1| BnaA07g08200D [Brassica napus]
Length=171

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 80/136 (59%), Gaps = 4/136 (3%)
 Frame = -3

Query  530  FTVKGKVYCDPCRLKFETRISENIADAVVRLECRNMtteevtytkettTNADGTYMMTVE  351
            F +KG VYCD CR++F TR+S+ +  A V+LEC+    + VT TKE  T+ DG Y M V 
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAMTDKDGNYEMEVM  91

Query  350  GEHEEEICDVTVEKSPREDCKEAAAG---LEKAQVVCSDKVGMHSN-VRYANPLFFMKEK  183
            G+HEEE+C++ + +SP  +C +          A++  +   G+ SN  R  NPL FM++ 
Sbjct  92   GDHEEEVCEIILVQSPDAECGDVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  182  VSKECAKVLKELDFVP  135
               +C +  KEL  VP
Sbjct  152  PLADCPQAFKELGIVP  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 959982664718