BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84125_g1_i1 len=1399 path=[1377:0-1398]

Length=1399
                                                                      Score     E

ref|XP_009792812.1|  PREDICTED: uncharacterized protein LOC104239795    293   8e-91   
ref|XP_009795461.1|  PREDICTED: uncharacterized protein LOC104242159    291   7e-90   
ref|XP_009625035.1|  PREDICTED: uncharacterized protein LOC104115988    289   5e-89   
ref|XP_006345991.1|  PREDICTED: uncharacterized protein LOC102591105    282   9e-87   
ref|XP_009591729.1|  PREDICTED: uncharacterized protein LOC104088710    282   2e-86   
gb|EYU39518.1|  hypothetical protein MIMGU_mgv1a007478mg                278   7e-85   
ref|XP_004239688.1|  PREDICTED: putative uncharacterized protein ...    274   5e-83   
emb|CDP04279.1|  unnamed protein product                                267   3e-81   
ref|XP_011069440.1|  PREDICTED: uncharacterized protein LOC105155266    262   9e-79   
ref|XP_004242771.1|  PREDICTED: formin-J                                252   3e-75   
ref|XP_006358324.1|  PREDICTED: uncharacterized protein LOC102592049    251   6e-75   
ref|XP_011077131.1|  PREDICTED: uncharacterized protein LOC105161211    218   5e-62   
gb|EYU39778.1|  hypothetical protein MIMGU_mgv1a009123mg                216   9e-62   
ref|XP_003535375.1|  PREDICTED: uncharacterized protein LOC100795448    203   1e-56   
ref|XP_007205372.1|  hypothetical protein PRUPE_ppa007276mg             202   2e-56   
emb|CDP04278.1|  unnamed protein product                                198   9e-55   
ref|XP_008218351.1|  PREDICTED: uncharacterized protein LOC103318712    199   1e-54   
ref|XP_011077059.1|  PREDICTED: uncharacterized protein LOC105161156    198   1e-54   
ref|XP_004494967.1|  PREDICTED: uncharacterized protein LOC101508328    197   2e-54   
ref|XP_008441789.1|  PREDICTED: uncharacterized protein LOC103485843    191   2e-52   
ref|XP_008370760.1|  PREDICTED: uncharacterized protein LOC103434221    192   2e-52   
ref|XP_004152866.1|  PREDICTED: uncharacterized protein LOC101218582    191   3e-52   
ref|XP_008366882.1|  PREDICTED: uncharacterized protein LOC103430513    192   3e-52   
ref|XP_004495587.1|  PREDICTED: uncharacterized protein LOC101488962    191   3e-52   
ref|XP_004155136.1|  PREDICTED: uncharacterized protein LOC101227028    191   5e-52   
ref|XP_009379739.1|  PREDICTED: uncharacterized protein LOC103968123    191   5e-52   
ref|XP_008388740.1|  PREDICTED: uncharacterized protein LOC103451084    190   2e-51   
ref|XP_009343786.1|  PREDICTED: uncharacterized protein LOC103935702    190   3e-51   
gb|KDP23730.1|  hypothetical protein JCGZ_23563                         189   4e-51   
gb|KDO53064.1|  hypothetical protein CISIN_1g035970mg                   187   2e-50   
ref|XP_004304780.1|  PREDICTED: uncharacterized protein LOC101296310    188   3e-50   
ref|XP_003590980.1|  hypothetical protein MTR_1g080360                  186   5e-50   
ref|XP_006437469.1|  hypothetical protein CICLE_v10033675mg             186   7e-50   
ref|XP_002521996.1|  conserved hypothetical protein                     184   1e-49   Ricinus communis
ref|XP_007132355.1|  hypothetical protein PHAVU_011G087700g             182   2e-48   
ref|XP_007132356.1|  hypothetical protein PHAVU_011G087800g             182   2e-48   
ref|XP_006577748.1|  PREDICTED: uncharacterized protein LOC102667983    180   5e-48   
gb|KHN31488.1|  hypothetical protein glysoja_035595                     175   1e-47   
gb|KEH24577.1|  calcium-dependent lipid-binding (CaLB domain) fam...    179   1e-47   
ref|XP_007147205.1|  hypothetical protein PHAVU_006G104400g             178   3e-47   
ref|XP_004234051.1|  PREDICTED: uncharacterized protein LOC101265801    180   6e-47   
ref|XP_002325345.1|  hypothetical protein POPTR_0019s03780g             176   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_011036375.1|  PREDICTED: uncharacterized protein LOC105133911    176   2e-46   
gb|KCW57324.1|  hypothetical protein EUGRSUZ_H00123                     174   3e-45   
ref|XP_011073723.1|  PREDICTED: uncharacterized protein LOC105158612    174   1e-44   
ref|XP_007035276.1|  Calcium-dependent lipid-binding family prote...    173   1e-44   
ref|XP_006356117.1|  PREDICTED: uncharacterized protein LOC102592369    173   2e-44   
ref|XP_008224037.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    172   6e-44   
gb|KCW85316.1|  hypothetical protein EUGRSUZ_B02156                     168   8e-44   
ref|XP_010043310.1|  PREDICTED: uncharacterized protein LOC104432551    168   9e-44   
ref|XP_010025827.1|  PREDICTED: uncharacterized protein LOC104416087    171   1e-43   
ref|XP_004173200.1|  PREDICTED: uncharacterized LOC101215059            171   2e-43   
ref|XP_009795412.1|  PREDICTED: uncharacterized protein LOC104242110    171   2e-43   
ref|XP_008460692.1|  PREDICTED: uncharacterized protein LOC103499460    171   2e-43   
ref|XP_004147189.1|  PREDICTED: uncharacterized protein LOC101215059    171   3e-43   
ref|XP_009604695.1|  PREDICTED: uncharacterized protein LOC104099416    170   3e-43   
ref|XP_011038591.1|  PREDICTED: uncharacterized protein LOC105135426    166   4e-43   
ref|XP_002319115.2|  hypothetical protein POPTR_0013s04590g             167   5e-43   Populus trichocarpa [western balsam poplar]
ref|XP_011091348.1|  PREDICTED: uncharacterized protein LOC105171810    170   5e-43   
ref|XP_007226487.1|  hypothetical protein PRUPE_ppa026634mg             169   5e-43   
ref|XP_008340669.1|  PREDICTED: uncharacterized protein LOC103403599    169   6e-43   
ref|XP_006489752.1|  PREDICTED: uncharacterized protein DDB_G0271...    169   6e-43   
gb|KDO41882.1|  hypothetical protein CISIN_1g041258mg                   169   7e-43   
ref|XP_009804994.1|  PREDICTED: uncharacterized protein DDB_G0292...    169   9e-43   
gb|EYU43768.1|  hypothetical protein MIMGU_mgv1a006114mg                167   1e-42   
ref|XP_010667096.1|  PREDICTED: uncharacterized protein LOC104884184    167   2e-42   
ref|XP_006420366.1|  hypothetical protein CICLE_v10006849mg             167   3e-42   
ref|XP_004253020.1|  PREDICTED: uncharacterized protein LOC101244358    167   4e-42   
ref|XP_002528347.1|  hypothetical protein RCOM_1217340                  166   5e-42   Ricinus communis
ref|XP_006418119.1|  hypothetical protein EUTSA_v10007144mg             167   5e-42   
ref|XP_004297932.1|  PREDICTED: uncharacterized protein LOC101311957    166   6e-42   
ref|XP_009118638.1|  PREDICTED: uncharacterized protein LOC103843645    167   9e-42   
emb|CDY53195.1|  BnaAnng12200D                                          167   1e-41   
ref|XP_009119477.1|  PREDICTED: uncharacterized protein LOC103844449    166   1e-41   
ref|XP_002311697.2|  C2 domain-containing family protein                165   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006342681.1|  PREDICTED: uncharacterized protein LOC102596842    166   1e-41   
ref|XP_011029742.1|  PREDICTED: uncharacterized protein LOC105129399    165   1e-41   
ref|XP_004247791.2|  PREDICTED: uncharacterized protein LOC101245204    165   2e-41   
ref|XP_002282144.1|  PREDICTED: uncharacterized protein LOC100256206    164   2e-41   Vitis vinifera
ref|XP_009767920.1|  PREDICTED: uncharacterized protein LOC104218993    164   3e-41   
gb|KFK42792.1|  hypothetical protein AALP_AA1G039700                    165   3e-41   
emb|CAN83108.1|  hypothetical protein VITISV_026570                     164   3e-41   Vitis vinifera
emb|CDY59181.1|  BnaC08g50140D                                          165   3e-41   
gb|EPS62035.1|  hypothetical protein M569_12761                         155   3e-41   
ref|XP_010264865.1|  PREDICTED: uncharacterized protein LOC104602763    162   3e-41   
ref|XP_009590587.1|  PREDICTED: ankyrin repeat-containing protein...    164   4e-41   
ref|XP_010025828.1|  PREDICTED: uncharacterized protein LOC104416088    155   4e-41   
emb|CDY18242.1|  BnaC05g02650D                                          162   5e-41   
ref|XP_002881275.1|  C2 domain-containing protein                       164   7e-41   
ref|XP_009621969.1|  PREDICTED: uncharacterized protein LOC104113496    163   1e-40   
gb|KFK31057.1|  hypothetical protein AALP_AA6G062700                    160   1e-40   
ref|XP_006303752.1|  hypothetical protein CARUB_v10011922mg             164   1e-40   
ref|XP_002314508.1|  C2 domain-containing family protein                162   1e-40   Populus trichocarpa [western balsam poplar]
emb|CBI23723.3|  unnamed protein product                                161   2e-40   
ref|XP_010483923.1|  PREDICTED: uncharacterized protein LOC104762347    163   2e-40   
ref|NP_180890.1|  calcium-dependent lipid-binding domain-containi...    163   2e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDO99320.1|  unnamed protein product                                162   2e-40   
ref|XP_009357966.1|  PREDICTED: uncharacterized protein LOC103948651    162   2e-40   
ref|XP_007144140.1|  hypothetical protein PHAVU_007G132000g             164   2e-40   
gb|KDP33324.1|  hypothetical protein JCGZ_12873                         160   3e-40   
ref|XP_003590735.1|  RNA-binding protein 12B                            162   3e-40   
ref|XP_010475114.1|  PREDICTED: uncharacterized protein LOC104754591    162   4e-40   
ref|XP_006410470.1|  hypothetical protein EUTSA_v10016412mg             162   4e-40   
ref|XP_007030351.1|  Calcium-dependent lipid-binding (CaLB domain...    158   4e-40   
ref|XP_011041447.1|  PREDICTED: uncharacterized protein LOC105137420    160   5e-40   
ref|XP_010457504.1|  PREDICTED: uncharacterized protein LOC104738975    162   5e-40   
ref|XP_006293875.1|  hypothetical protein CARUB_v10022860mg             161   6e-40   
ref|XP_002889512.1|  hypothetical protein ARALYDRAFT_470434             161   6e-40   
ref|XP_010105208.1|  hypothetical protein L484_011265                   161   6e-40   
ref|NP_171948.1|  calcium-dependent lipid-binding domain-containi...    161   7e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39933.1|  hypothetical protein AALP_AA3G308600                    158   7e-40   
ref|XP_009141305.1|  PREDICTED: uncharacterized protein LOC103865261    161   8e-40   
gb|AAB80639.1|  Contains similarity to Glycine SRC2 (gb|AB000130)       161   8e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDY37732.1|  BnaA04g19360D                                          161   8e-40   
ref|XP_003555498.1|  PREDICTED: uncharacterized protein LOC100812185    161   9e-40   
ref|NP_178968.1|  C2 domain-containing protein                          158   9e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003535258.1|  PREDICTED: uncharacterized protein LOC100787698    161   9e-40   
ref|XP_010556931.1|  PREDICTED: uncharacterized protein LOC104826097    160   1e-39   
emb|CDY23753.1|  BnaC04g43690D                                          160   1e-39   
ref|XP_004495257.1|  PREDICTED: proteoglycan 4-like                     161   1e-39   
ref|XP_010522448.1|  PREDICTED: uncharacterized protein LOC104801063    159   4e-39   
ref|XP_002885870.1|  hypothetical protein ARALYDRAFT_480303             156   4e-39   
ref|XP_009143873.1|  PREDICTED: uncharacterized protein LOC103867544    159   5e-39   
ref|XP_010102203.1|  hypothetical protein L484_024484                   155   5e-39   
ref|XP_010413889.1|  PREDICTED: uncharacterized protein LOC104700118    158   6e-39   
ref|XP_010469493.1|  PREDICTED: uncharacterized protein LOC104749540    158   7e-39   
ref|XP_010509905.1|  PREDICTED: serine/arginine repetitive matrix...    158   7e-39   
emb|CDY37206.1|  BnaA09g08270D                                          154   3e-38   
ref|XP_010467176.1|  PREDICTED: uncharacterized protein LOC104747266    153   7e-38   
ref|XP_010518533.1|  PREDICTED: uncharacterized protein LOC104793798    153   8e-38   
ref|XP_006300066.1|  hypothetical protein CARUB_v10016294mg             152   1e-37   
ref|XP_004497792.1|  PREDICTED: uncharacterized protein LOC101505544    152   2e-37   
ref|XP_003556915.1|  PREDICTED: uncharacterized protein LOC100779058    152   2e-37   
emb|CDX81442.1|  BnaC09g08530D                                          151   3e-37   
ref|XP_006409691.1|  hypothetical protein EUTSA_v10022712mg             151   3e-37   
emb|CDY37207.1|  BnaA09g08280D                                          150   5e-37   
ref|XP_009112245.1|  PREDICTED: uncharacterized protein LOC103837642    150   6e-37   
ref|XP_010674263.1|  PREDICTED: uncharacterized protein LOC104890461    149   9e-37   
ref|XP_010488836.1|  PREDICTED: uncharacterized protein LOC104766620    149   1e-36   
ref|XP_007145354.1|  hypothetical protein PHAVU_007G232100g             149   2e-36   
emb|CDX89815.1|  BnaA10g02670D                                          149   3e-36   
gb|KCW57325.1|  hypothetical protein EUGRSUZ_H00124                     140   8e-36   
gb|KCW60206.1|  hypothetical protein EUGRSUZ_H02915                     145   9e-35   
ref|XP_010026783.1|  PREDICTED: protein bunched, class 2/F/G isof...    144   1e-34   
ref|XP_003590193.1|  hypothetical protein MTR_1g045780                  144   2e-34   
gb|AFK13837.1|  C2 domain-containing protein SRC2                       140   4e-34   
emb|CDX89605.1|  BnaC03g45190D                                          142   5e-34   
ref|XP_009136211.1|  PREDICTED: uncharacterized protein LOC103860372    142   6e-34   
emb|CDY49343.1|  BnaA05g33050D                                          140   1e-33   
ref|XP_009123999.1|  PREDICTED: uncharacterized protein LOC103848923    140   2e-33   
ref|XP_010485810.1|  PREDICTED: putative lysozyme-like protein          140   2e-33   
ref|XP_009625033.1|  PREDICTED: uncharacterized protein LOC104115986    139   6e-33   
gb|KFK37859.1|  hypothetical protein AALP_AA3G038400                    138   7e-33   
emb|CDY42921.1|  BnaC05g47300D                                          138   9e-33   
gb|AAF26778.1|AC016829_2  hypothetical protein                          137   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28543.1|  unknown                                                 137   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463915.1|  PREDICTED: uncharacterized protein LOC104744544    138   1e-32   
ref|XP_006297897.1|  hypothetical protein CARUB_v10013938mg             137   1e-32   
ref|XP_002884443.1|  hypothetical protein ARALYDRAFT_477695             137   2e-32   
emb|CDX74193.1|  BnaA03g28540D                                          137   2e-32   
ref|XP_010533203.1|  PREDICTED: uncharacterized protein LOC104809...    137   2e-32   
ref|NP_566225.4|  calcium-dependent lipid-binding family protein        137   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67146.1|  unknown                                                 136   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010558947.1|  PREDICTED: uncharacterized protein LOC104827473    136   4e-32   
ref|XP_006408192.1|  hypothetical protein EUTSA_v10020890mg             136   4e-32   
emb|CDX92066.1|  BnaC03g33680D                                          132   8e-31   
ref|XP_009134757.1|  PREDICTED: uncharacterized protein LOC103859027    131   2e-30   
ref|XP_010557577.1|  PREDICTED: uncharacterized protein LOC104826528    132   2e-30   
ref|XP_006842598.1|  hypothetical protein AMTR_s00077p00167680          130   3e-30   
ref|XP_009406969.1|  PREDICTED: uncharacterized protein LOC103989745    128   5e-30   
ref|XP_006842901.1|  hypothetical protein AMTR_s00075p00073210          130   5e-30   
ref|XP_009377282.1|  PREDICTED: BON1-associated protein 2               125   8e-30   
ref|XP_010262513.1|  PREDICTED: uncharacterized protein LOC104601031    128   1e-29   
ref|XP_007051663.1|  Calcium-dependent lipid-binding family prote...    125   3e-29   
ref|XP_010549648.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    127   4e-29   
ref|XP_007147256.1|  hypothetical protein PHAVU_006G109100g             124   5e-29   
gb|KDP28538.1|  hypothetical protein JCGZ_14309                         124   7e-29   
gb|EYU32591.1|  hypothetical protein MIMGU_mgv1a006056mg                127   1e-28   
ref|XP_009111426.1|  PREDICTED: uncharacterized protein LOC103836878    123   1e-28   
ref|XP_010456220.1|  PREDICTED: BON1-associated protein 2-like          123   1e-28   
ref|XP_009385178.1|  PREDICTED: uncharacterized protein LOC103972545    124   2e-28   
ref|XP_008362824.1|  PREDICTED: uncharacterized protein LOC103426513    123   2e-28   
ref|XP_010544424.1|  PREDICTED: uncharacterized protein LOC104817045    122   3e-28   
ref|XP_009401202.1|  PREDICTED: uncharacterized protein LOC103985274    122   3e-28   
ref|XP_002511946.1|  conserved hypothetical protein                     122   4e-28   Ricinus communis
ref|XP_003553776.1|  PREDICTED: uncharacterized protein LOC100793541    121   5e-28   
ref|XP_009420756.1|  PREDICTED: uncharacterized protein LOC104000435    121   7e-28   
ref|XP_006577334.1|  PREDICTED: BON1-associated protein 2-like          119   1e-27   
ref|XP_010669605.1|  PREDICTED: uncharacterized protein LOC104886787    120   1e-27   
ref|XP_010092894.1|  hypothetical protein L484_022489                   120   2e-27   
ref|XP_010427687.1|  PREDICTED: BON1-associated protein 2-like          119   2e-27   
gb|EYU38921.1|  hypothetical protein MIMGU_mgv1a022778mg                119   3e-27   
ref|XP_004308328.1|  PREDICTED: uncharacterized protein LOC101301728    120   3e-27   
ref|XP_010422779.1|  PREDICTED: BON1-associated protein 2-like          119   4e-27   
ref|XP_002301388.2|  hypothetical protein POPTR_0002s16800g             118   4e-27   Populus trichocarpa [western balsam poplar]
ref|XP_006396291.1|  hypothetical protein EUTSA_v10028892mg             118   9e-27   
ref|XP_002872904.1|  C2 domain-containing protein                       118   9e-27   
ref|NP_192029.1|  calcium-dependent lipid-binding domain-containi...    117   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004494776.1|  PREDICTED: uncharacterized protein LOC101496947    117   1e-26   
ref|XP_004133823.1|  PREDICTED: uncharacterized protein LOC101212280    118   1e-26   
ref|XP_011023248.1|  PREDICTED: uncharacterized protein LOC105124808    117   2e-26   
ref|XP_006289671.1|  hypothetical protein CARUB_v10003230mg             116   3e-26   
gb|KDO86360.1|  hypothetical protein CISIN_1g047341mg                   115   5e-26   
ref|XP_006444911.1|  hypothetical protein CICLE_v10021815mg             115   5e-26   
ref|XP_010936043.1|  PREDICTED: uncharacterized protein LOC105055767    115   8e-26   
emb|CDY48509.1|  BnaA09g00140D                                          121   8e-26   
emb|CDY07180.1|  BnaCnng01950D                                          121   8e-26   
ref|XP_002276427.1|  PREDICTED: uncharacterized protein LOC100258448    115   1e-25   Vitis vinifera
gb|EPS68074.1|  hypothetical protein M569_06693                         114   1e-25   
gb|AES82742.2|  calcium-dependent lipid-binding (CaLB domain) fam...    114   2e-25   
ref|XP_009350266.1|  PREDICTED: uncharacterized protein LOC103941795    114   2e-25   
ref|XP_007218843.1|  hypothetical protein PRUPE_ppa010336mg             114   3e-25   
ref|XP_003626524.1|  hypothetical protein MTR_7g116840                  114   4e-25   
ref|XP_009347863.1|  PREDICTED: uncharacterized protein LOC103939495    113   4e-25   
ref|XP_010055064.1|  PREDICTED: uncharacterized protein LOC104443389    113   5e-25   
ref|XP_010251574.1|  PREDICTED: uncharacterized protein LOC104593437    113   6e-25   
gb|KDP30266.1|  hypothetical protein JCGZ_17048                         110   1e-24   
ref|XP_008801291.1|  PREDICTED: uncharacterized protein LOC103715451    113   1e-24   
ref|XP_008796382.1|  PREDICTED: uncharacterized protein LOC103711856    112   2e-24   
ref|XP_008233233.1|  PREDICTED: uncharacterized protein LOC103332288    112   2e-24   
ref|XP_011093241.1|  PREDICTED: uncharacterized protein LOC105173247    111   2e-24   
emb|CDP08734.1|  unnamed protein product                                111   3e-24   
ref|XP_004229965.1|  PREDICTED: BON1-associated protein 2               110   7e-24   
ref|XP_006339653.1|  PREDICTED: uncharacterized protein LOC102592387    110   7e-24   
ref|XP_009764572.1|  PREDICTED: uncharacterized protein LOC104216252    109   9e-24   
ref|XP_011093070.1|  PREDICTED: uncharacterized protein LOC105173112    109   1e-23   
ref|XP_010920373.1|  PREDICTED: CASP-like protein 4A1                   111   3e-23   
ref|XP_008437926.1|  PREDICTED: uncharacterized protein LOC103483209    108   4e-23   
emb|CDP17419.1|  unnamed protein product                                108   5e-23   
emb|CAN79006.1|  hypothetical protein VITISV_040896                     109   6e-23   Vitis vinifera
ref|XP_009591358.1|  PREDICTED: uncharacterized protein LOC104088405    105   3e-22   
gb|ABK23345.1|  unknown                                                 100   3e-21   Picea sitchensis
ref|XP_008679175.1|  PREDICTED: uncharacterized protein LOC103654122    100   1e-20   
gb|AEW08214.1|  hypothetical protein 2_3193_01                        97.4    2e-20   
ref|XP_003572941.1|  PREDICTED: uncharacterized protein LOC100843074    100   3e-20   
ref|XP_008791481.1|  PREDICTED: uncharacterized protein LOC103708363  99.4    3e-20   
ref|XP_008798687.1|  PREDICTED: uncharacterized protein LOC103713510  99.4    3e-20   
gb|AFG52315.1|  hypothetical protein 2_3193_01                        95.5    1e-19   
ref|XP_010914657.1|  PREDICTED: uncharacterized protein LOC105039993  96.7    3e-19   
gb|EAY87999.1|  hypothetical protein OsI_09421                        96.3    6e-19   Oryza sativa Indica Group [Indian rice]
gb|AFG52320.1|  hypothetical protein 2_3193_01                        93.2    6e-19   
ref|XP_007031704.1|  Calcium-dependent lipid-binding (CaLB domain...  95.9    1e-18   
ref|XP_010914471.1|  PREDICTED: uncharacterized protein LOC105039856  94.7    2e-18   
gb|ABK22654.1|  unknown                                               92.4    4e-18   Picea sitchensis
ref|XP_009400560.1|  PREDICTED: uncharacterized protein LOC103984726  92.8    8e-18   
ref|XP_006605265.1|  PREDICTED: uncharacterized protein LOC102668124  88.6    6e-17   
gb|EPS60622.1|  hypothetical protein M569_14180                       89.0    2e-16   
dbj|BAK03653.1|  predicted protein                                    88.2    4e-16   
ref|XP_010245272.1|  PREDICTED: uncharacterized protein LOC104588843  85.1    2e-15   
ref|XP_002989504.1|  hypothetical protein SELMODRAFT_428112           84.3    2e-15   
ref|XP_008365038.1|  PREDICTED: uncharacterized protein LOC103428692  85.5    3e-15   
ref|XP_002964639.1|  hypothetical protein SELMODRAFT_406042           83.6    3e-15   
ref|XP_002976843.1|  hypothetical protein SELMODRAFT_443351           83.6    2e-14   
ref|NP_001043768.1|  Os01g0659800                                     83.2    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453028.1|  hypothetical protein SORBIDRAFT_04g037000        82.0    4e-14   Sorghum bicolor [broomcorn]
ref|NP_001048499.1|  Os02g0815100                                     82.0    5e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002992362.1|  hypothetical protein SELMODRAFT_430579           80.9    1e-13   
ref|XP_002970540.1|  hypothetical protein SELMODRAFT_441151           80.9    1e-13   
ref|XP_002967740.1|  hypothetical protein SELMODRAFT_408999           80.1    2e-13   
gb|ABK24127.1|  unknown                                               78.6    2e-13   Picea sitchensis
ref|XP_004955273.1|  PREDICTED: uncharacterized protein LOC101765467  79.7    3e-13   
ref|XP_004985379.1|  PREDICTED: uncharacterized protein LOC101774...  79.7    3e-13   
ref|XP_004985378.1|  PREDICTED: uncharacterized protein LOC101774...  79.7    4e-13   
ref|NP_001170657.1|  hypothetical protein                             79.0    5e-13   Zea mays [maize]
ref|XP_002978619.1|  hypothetical protein SELMODRAFT_443918           80.5    5e-13   
ref|XP_003569491.1|  PREDICTED: uncharacterized protein LOC100842238  79.0    7e-13   
emb|CDM83573.1|  unnamed protein product                              78.6    1e-12   
ref|XP_001782642.1|  predicted protein                                77.8    1e-12   
ref|XP_010922806.1|  PREDICTED: WW domain-binding protein 11          77.0    3e-12   
ref|XP_010936622.1|  PREDICTED: uncharacterized protein LOC105056210  75.1    5e-12   
gb|ABU98655.1|  SRC2 protein                                          76.3    6e-12   Taiwania cryptomerioides
gb|ABR18223.1|  unknown                                               76.3    6e-12   Picea sitchensis
ref|XP_002272904.1|  PREDICTED: cytokinesis protein sepA-like         75.5    8e-12   Vitis vinifera
ref|XP_006855523.1|  hypothetical protein AMTR_s00057p00209740        75.5    9e-12   
ref|XP_010670031.1|  PREDICTED: probable inactive serine/threonin...  76.3    9e-12   
ref|XP_001761054.1|  predicted protein                                74.3    9e-12   
ref|XP_002968005.1|  hypothetical protein SELMODRAFT_440190           73.9    1e-11   
gb|ABR17336.1|  unknown                                               75.1    1e-11   Picea sitchensis
emb|CDP14057.1|  unnamed protein product                              75.1    1e-11   
ref|XP_004247617.1|  PREDICTED: formin-like protein 14                74.7    2e-11   
ref|XP_011084443.1|  PREDICTED: uncharacterized protein LOC105166693  73.9    2e-11   
gb|ACN40336.1|  unknown                                               74.3    2e-11   
ref|XP_010319948.1|  PREDICTED: uncharacterized protein LOC104647076  74.3    3e-11   
ref|XP_011090948.1|  PREDICTED: protein diaphanous homolog 1-like     73.9    4e-11   
gb|AFW83462.1|  C2 domain containing protein                          73.2    4e-11   
ref|XP_011041338.1|  PREDICTED: leucine-rich repeat extensin-like...  73.6    4e-11   
gb|KDP44823.1|  hypothetical protein JCGZ_01323                       73.6    4e-11   
ref|XP_001778275.1|  predicted protein                                72.4    5e-11   
ref|XP_002266989.1|  PREDICTED: formin-A                              73.6    6e-11   
gb|EYU43935.1|  hypothetical protein MIMGU_mgv1a013059mg              71.6    7e-11   
ref|XP_009791711.1|  PREDICTED: uncharacterized protein LOC104238906  72.8    1e-10   
ref|NP_001152648.1|  C2 domain containing protein                     72.0    1e-10   
ref|XP_001772125.1|  predicted protein                                73.6    1e-10   
ref|XP_009588589.1|  PREDICTED: pollen-specific leucine-rich repe...  72.0    1e-10   
ref|XP_009410493.1|  PREDICTED: uncharacterized protein LOC103992499  72.0    1e-10   
ref|XP_009774894.1|  PREDICTED: uncharacterized protein LOC104224872  71.2    2e-10   
gb|ABK23901.1|  unknown                                               72.0    2e-10   
ref|XP_002279465.1|  PREDICTED: formin-1                              70.9    2e-10   
ref|XP_002520901.1|  conserved hypothetical protein                   72.0    2e-10   
ref|XP_004240724.1|  PREDICTED: uncharacterized protein LOC101263030  70.1    3e-10   
ref|XP_011076131.1|  PREDICTED: WW domain-containing protein C11B...  70.5    3e-10   
ref|XP_009779320.1|  PREDICTED: pollen-specific leucine-rich repe...  71.2    3e-10   
ref|XP_007218347.1|  hypothetical protein PRUPE_ppa008681mg           70.9    3e-10   
emb|CDY17163.1|  BnaA05g10250D                                        66.6    4e-10   
ref|XP_002299003.1|  hypothetical protein POPTR_0001s46230g           68.6    4e-10   
ref|XP_002456081.1|  hypothetical protein SORBIDRAFT_03g030080        70.5    4e-10   
gb|KDP46959.1|  hypothetical protein JCGZ_07976                       70.1    4e-10   
ref|XP_010275059.1|  PREDICTED: uncharacterized protein LOC104610232  68.9    4e-10   
ref|XP_008803020.1|  PREDICTED: WAS/WASL-interacting protein fami...  70.5    4e-10   
ref|XP_004289725.1|  PREDICTED: uncharacterized protein LOC101315189  69.7    5e-10   
ref|XP_011076733.1|  PREDICTED: pollen-specific leucine-rich repe...  70.5    5e-10   
ref|XP_009600682.1|  PREDICTED: uncharacterized protein LOC104096081  70.5    6e-10   
ref|XP_006363329.1|  PREDICTED: uncharacterized protein LOC102600321  69.7    6e-10   
ref|XP_009627866.1|  PREDICTED: uncharacterized protein LOC104118341  69.3    7e-10   
gb|ACV71018.1|  UPA18                                                 70.5    7e-10   
ref|XP_010417623.1|  PREDICTED: uncharacterized protein LOC104703311  70.1    8e-10   
ref|XP_009792811.1|  PREDICTED: uncharacterized protein LOC104239794  69.7    8e-10   
gb|KDP21440.1|  hypothetical protein JCGZ_21911                       66.6    1e-09   
ref|XP_008343828.1|  PREDICTED: formin-like protein 20                69.3    1e-09   
ref|XP_010269468.1|  PREDICTED: abl interactor homolog                68.6    1e-09   
ref|XP_007218318.1|  hypothetical protein PRUPE_ppa008392mg           69.3    2e-09   
ref|XP_006371351.1|  hypothetical protein POPTR_0019s09350g           68.9    2e-09   
ref|XP_008234153.1|  PREDICTED: verprolin                             68.9    2e-09   
ref|NP_197783.2|  calcium-dependent lipid-binding domain-containi...  67.4    2e-09   
ref|XP_008225460.1|  PREDICTED: uncharacterized protein LOC103325105  67.0    2e-09   
ref|XP_007009086.1|  Calcium-dependent lipid-binding family protein   68.6    2e-09   
ref|XP_010671655.1|  PREDICTED: uncharacterized protein LOC104888395  67.8    2e-09   
ref|XP_004307752.1|  PREDICTED: uncharacterized protein LOC101311043  68.9    2e-09   
gb|KCW90833.1|  hypothetical protein EUGRSUZ_A02890                   67.0    2e-09   
ref|XP_010671657.1|  PREDICTED: uncharacterized protein LOC104888396  67.8    3e-09   
ref|XP_002526856.1|  protein with unknown function                    68.2    3e-09   
ref|XP_011071658.1|  PREDICTED: neural Wiskott-Aldrich syndrome p...  67.8    3e-09   
ref|XP_002512414.1|  conserved hypothetical protein                   67.8    3e-09   
gb|KDP21615.1|  hypothetical protein JCGZ_03286                       68.2    3e-09   
dbj|BAB10068.1|  unnamed protein product                              67.0    3e-09   
gb|ABK92946.1|  unknown                                               68.2    3e-09   
ref|XP_002311204.1|  hypothetical protein POPTR_0008s06510g           68.2    3e-09   
gb|KDP25484.1|  hypothetical protein JCGZ_20640                       66.2    4e-09   
ref|XP_010256631.1|  PREDICTED: leucine-rich repeat extensin-like...  67.8    4e-09   
ref|XP_002280187.1|  PREDICTED: formin-like protein 14                67.8    4e-09   
ref|XP_010999508.1|  PREDICTED: formin-G                              67.8    4e-09   
ref|XP_010109170.1|  hypothetical protein L484_017111                 67.8    5e-09   
ref|XP_004140766.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.9    5e-09   
ref|XP_011087410.1|  PREDICTED: uncharacterized protein LOC105168911  67.8    5e-09   
ref|XP_010098296.1|  hypothetical protein L484_023544                 67.0    6e-09   
ref|XP_004157192.1|  PREDICTED: uncharacterized protein LOC101224685  66.6    7e-09   
ref|XP_002315561.1|  shock protein SRC2                               66.6    7e-09   
gb|EYU25119.1|  hypothetical protein MIMGU_mgv1a021760mg              66.6    9e-09   
ref|XP_010101600.1|  hypothetical protein L484_001120                 64.7    1e-08   
gb|EEE55117.1|  hypothetical protein OsJ_02891                        66.2    1e-08   
gb|KEH35505.1|  calcium-dependent lipid-binding (CaLB domain) fam...  66.6    1e-08   
ref|XP_010097658.1|  hypothetical protein L484_023798                 64.7    1e-08   
ref|XP_002965668.1|  hypothetical protein SELMODRAFT_407234           66.6    1e-08   
gb|EPS59428.1|  hypothetical protein M569_15381                       65.9    1e-08   
gb|KCW65820.1|  hypothetical protein EUGRSUZ_G031711                  65.5    1e-08   
ref|XP_010666732.1|  PREDICTED: uncharacterized protein LOC104883866  65.1    1e-08   
gb|EYU19982.1|  hypothetical protein MIMGU_mgv1a024988mg              65.9    1e-08   
gb|KDP37957.1|  hypothetical protein JCGZ_04600                       64.3    1e-08   
ref|XP_010096455.1|  hypothetical protein L484_001160                 64.7    2e-08   
ref|XP_002971671.1|  hypothetical protein SELMODRAFT_412188           66.2    2e-08   
gb|KDO67597.1|  hypothetical protein CISIN_1g020960mg                 65.9    2e-08   
ref|XP_009350922.1|  PREDICTED: formin-like protein 20                66.2    2e-08   
ref|XP_009800792.1|  PREDICTED: WW domain-containing protein C11B...  65.5    2e-08   
ref|XP_010068940.1|  PREDICTED: uncharacterized protein LOC104455934  65.5    2e-08   
ref|XP_007138900.1|  hypothetical protein PHAVU_009G247100g           65.5    2e-08   
ref|XP_010035164.1|  PREDICTED: uncharacterized protein DDB_G0290...  66.6    2e-08   
ref|XP_004235211.1|  PREDICTED: uncharacterized protein LOC101249714  65.5    2e-08   
ref|XP_010035163.1|  PREDICTED: uncharacterized protein DDB_G0290...  66.6    2e-08   
ref|XP_009612128.1|  PREDICTED: cyclin-dependent kinase inhibitor...  65.5    2e-08   
ref|XP_006358166.1|  PREDICTED: uncharacterized protein LOC102591162  65.5    3e-08   
ref|XP_009363765.1|  PREDICTED: wiskott-Aldrich syndrome protein-...  65.5    3e-08   
ref|XP_007011415.1|  Calcium-dependent lipid-binding family protein   65.5    3e-08   
ref|XP_010096867.1|  hypothetical protein L484_003038                 64.7    3e-08   
ref|XP_006435975.1|  hypothetical protein CICLE_v10033529mg           65.1    3e-08   
ref|XP_008392919.1|  PREDICTED: histone-lysine N-methyltransferas...  65.5    3e-08   
emb|CDP21817.1|  unnamed protein product                              64.3    3e-08   
ref|XP_008347213.1|  PREDICTED: uncharacterized protein LOC103410258  65.1    4e-08   
ref|XP_009362765.1|  PREDICTED: wiskott-Aldrich syndrome protein ...  65.1    4e-08   
ref|XP_011044520.1|  PREDICTED: actin cytoskeleton-regulatory com...  64.3    4e-08   
gb|AAB61031.1|  A_IG002N01.24 gene product                            66.2    4e-08   
ref|XP_008375255.1|  PREDICTED: uncharacterized protein LOC103438493  65.1    4e-08   
ref|XP_003565019.1|  PREDICTED: basic salivary proline-rich prote...  64.7    5e-08   
ref|XP_002509742.1|  conserved hypothetical protein                   63.2    5e-08   
gb|KDP32089.1|  hypothetical protein JCGZ_12550                       65.5    5e-08   
gb|KEH34781.1|  C2 domain protein                                     64.3    5e-08   
ref|XP_006342789.1|  PREDICTED: formin-A-like isoform X1              63.9    6e-08   
ref|XP_008379961.1|  PREDICTED: WW domain-containing protein C11B...  63.9    7e-08   
ref|XP_009779515.1|  PREDICTED: formin-like protein 18                63.9    7e-08   
ref|XP_010244593.1|  PREDICTED: uncharacterized protein LOC104588...  63.9    7e-08   
ref|XP_010244594.1|  PREDICTED: uncharacterized protein LOC104588...  63.9    7e-08   
gb|KDP27783.1|  hypothetical protein JCGZ_18863                       63.9    8e-08   
ref|XP_011076565.1|  PREDICTED: cleavage and polyadenylation spec...  63.9    8e-08   
ref|XP_010938433.1|  PREDICTED: neural Wiskott-Aldrich syndrome p...  63.5    8e-08   
ref|XP_006646653.1|  PREDICTED: C2 domain-containing protein At1g...  62.8    8e-08   
ref|XP_010248679.1|  PREDICTED: uncharacterized protein LOC104591520  62.4    8e-08   
ref|XP_004229314.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  63.5    1e-07   
ref|XP_010934387.1|  PREDICTED: large proline-rich protein bag6-like  63.2    1e-07   
ref|XP_010025284.1|  PREDICTED: uncharacterized protein LOC104415652  61.6    1e-07   
gb|KDO56853.1|  hypothetical protein CISIN_1g023810mg                 62.8    1e-07   
gb|EPS57822.1|  hypothetical protein M569_16995                       60.8    1e-07   
ref|XP_006394656.1|  hypothetical protein EUTSA_v10004867mg           62.0    1e-07   
ref|XP_006422081.1|  hypothetical protein CICLE_v10005598mg           62.4    1e-07   
ref|XP_009401591.1|  PREDICTED: uncharacterized protein LOC103985575  62.8    2e-07   
ref|XP_006486118.1|  PREDICTED: probable inactive serine/threonin...  63.2    2e-07   
ref|XP_004159813.1|  PREDICTED: uncharacterized protein LOC101229597  63.2    2e-07   
ref|XP_009592495.1|  PREDICTED: cytokinesis protein sepA              62.8    2e-07   
ref|XP_003602455.1|  hypothetical protein MTR_3g093550                60.1    2e-07   
ref|XP_003529574.1|  PREDICTED: toll-interacting protein-like         62.4    2e-07   
ref|XP_008439269.1|  PREDICTED: zinc finger matrin-type protein C...  62.4    2e-07   
ref|XP_002314120.1|  C2 domain-containing family protein              62.4    2e-07   
ref|NP_188272.1|  Calcium-dependent lipid-binding domain-containi...  62.8    2e-07   
gb|KFK27692.1|  hypothetical protein AALP_AA8G416000                  62.0    2e-07   
dbj|BAJ97521.1|  predicted protein                                    62.8    2e-07   
ref|XP_011030162.1|  PREDICTED: uncharacterized protein LOC105129684  62.0    3e-07   
ref|XP_003600860.1|  BAHD acyltransferase DCR                         63.5    3e-07   
ref|XP_002318206.1|  hypothetical protein POPTR_0012s12880g           60.8    3e-07   
ref|XP_010921798.1|  PREDICTED: ingression protein fic1-like          62.4    3e-07   
ref|XP_002459044.1|  hypothetical protein SORBIDRAFT_03g045000        62.4    3e-07   
ref|XP_002513669.1|  conserved hypothetical protein                   61.2    4e-07   
ref|XP_006827556.1|  hypothetical protein AMTR_s00009p00221230        61.2    4e-07   
ref|XP_004134204.1|  PREDICTED: uncharacterized protein LOC101222610  62.0    4e-07   
ref|XP_006406829.1|  hypothetical protein EUTSA_v10021044mg           61.6    5e-07   
ref|XP_006296032.1|  hypothetical protein CARUB_v10025177mg           61.6    5e-07   
ref|NP_001238642.1|  cold-regulated protein                           61.2    5e-07   
emb|CDX87149.1|  BnaC09g04640D                                        59.7    5e-07   
ref|XP_006353889.1|  PREDICTED: RNA-binding protein EWS-like isof...  61.2    6e-07   
gb|AFW84033.1|  src2-like protein                                     61.6    6e-07   
ref|XP_008800861.1|  PREDICTED: formin-like protein 18                61.2    6e-07   
gb|KHN26566.1|  hypothetical protein glysoja_019805                   60.5    6e-07   
ref|XP_006353888.1|  PREDICTED: RNA-binding protein EWS-like isof...  61.2    6e-07   
ref|NP_001149536.1|  src2-like protein                                61.2    6e-07   
gb|KHG21324.1|  BON1-associated 2 -like protein                       60.5    7e-07   
ref|XP_010031258.1|  PREDICTED: formin-like protein 20                61.2    7e-07   
tpg|DAA55958.1|  TPA: hypothetical protein ZEAMMB73_567157            60.8    7e-07   
ref|XP_010550541.1|  PREDICTED: uncharacterized protein LOC104821382  60.5    7e-07   
ref|XP_002283998.1|  PREDICTED: uncharacterized protein LOC100245905  60.5    8e-07   
ref|XP_008439354.1|  PREDICTED: BON1-associated protein 2-like        58.9    8e-07   
ref|XP_009384169.1|  PREDICTED: basic proline-rich protein-like       60.8    8e-07   
ref|XP_007154268.1|  hypothetical protein PHAVU_003G104400g           60.1    8e-07   
ref|XP_010454681.1|  PREDICTED: uncharacterized protein LOC104736407  60.1    8e-07   
ref|XP_006425035.1|  hypothetical protein CICLE_v10028899mg           60.5    8e-07   
ref|XP_011032146.1|  PREDICTED: basic salivary proline-rich prote...  60.5    9e-07   
gb|AGW45467.1|  cold-regulated protein                                59.7    9e-07   
ref|XP_008438876.1|  PREDICTED: protein diaphanous homolog 1          60.8    9e-07   
ref|XP_008789935.1|  PREDICTED: small nuclear ribonucleoprotein-a...  60.5    9e-07   
ref|XP_004971180.1|  PREDICTED: calcium-binding protein P-like        60.8    1e-06   
emb|CAN64035.1|  hypothetical protein VITISV_020002                   59.7    1e-06   
ref|XP_002885144.1|  hypothetical protein ARALYDRAFT_479112           60.8    1e-06   
ref|XP_007163517.1|  hypothetical protein PHAVU_001G240600g           60.5    1e-06   
ref|XP_008234191.1|  PREDICTED: WW domain-containing protein C11B...  60.1    1e-06   
ref|XP_010111003.1|  BON1-associated protein 2                        58.9    1e-06   
dbj|BAK04679.1|  predicted protein                                    59.7    1e-06   
ref|XP_004490527.1|  PREDICTED: uncharacterized protein LOC101506482  60.1    1e-06   
ref|XP_007218770.1|  hypothetical protein PRUPE_ppa009523mg           59.7    1e-06   
gb|EMT21195.1|  hypothetical protein F775_15531                       59.3    1e-06   
ref|XP_007035560.1|  Soybean gene regulated by cold-2, putative       59.7    2e-06   
ref|XP_006601957.1|  PREDICTED: uncharacterized protein LOC102666...  60.1    2e-06   
ref|XP_008785412.1|  PREDICTED: extensin-like                         60.1    2e-06   
ref|XP_007141338.1|  hypothetical protein PHAVU_008G187400g           59.7    2e-06   
ref|XP_006827562.1|  hypothetical protein AMTR_s00009p00222310        59.3    2e-06   
ref|XP_004296826.1|  PREDICTED: uncharacterized protein LOC101304564  59.7    2e-06   
ref|XP_010940561.1|  PREDICTED: transcription elongation factor SPT5  59.3    2e-06   
ref|XP_008779256.1|  PREDICTED: uncharacterized protein LOC103698987  59.3    2e-06   
ref|XP_001758706.1|  predicted protein                                58.9    2e-06   
ref|XP_008376957.1|  PREDICTED: protein transport protein Sec24-l...  59.7    2e-06   
ref|XP_002872084.1|  hypothetical protein ARALYDRAFT_910412           58.5    2e-06   
ref|XP_002963356.1|  hypothetical protein SELMODRAFT_438513           60.1    2e-06   
ref|XP_007038773.1|  Calcium-dependent lipid-binding family protein   58.9    3e-06   
ref|XP_009368751.1|  PREDICTED: WW domain-containing protein C11B...  58.9    3e-06   
ref|XP_002275480.1|  PREDICTED: uncharacterized protein LOC100242355  58.5    3e-06   
emb|CAN78886.1|  hypothetical protein VITISV_002549                   58.5    3e-06   
ref|XP_010259736.1|  PREDICTED: uncharacterized protein LOC104599071  57.8    3e-06   
ref|XP_003634095.1|  PREDICTED: uncharacterized protein LOC100852496  58.5    3e-06   
ref|XP_010690030.1|  PREDICTED: uncharacterized protein LOC104903656  58.5    3e-06   
ref|XP_004234422.1|  PREDICTED: probable calcium-binding protein ...  59.3    3e-06   
ref|XP_010548935.1|  PREDICTED: extensin isoform X1                   59.3    3e-06   
ref|XP_002519702.1|  conserved hypothetical protein                   57.4    3e-06   
emb|CAN69351.1|  hypothetical protein VITISV_017753                   58.2    3e-06   
gb|EYU45555.1|  hypothetical protein MIMGU_mgv1a018032mg              58.9    4e-06   
ref|XP_001758594.1|  predicted protein                                57.4    4e-06   
ref|XP_010269469.1|  PREDICTED: uncharacterized protein LOC104606112  57.0    4e-06   
ref|XP_006288435.1|  hypothetical protein CARUB_v10001693mg           58.2    4e-06   
ref|XP_010421203.1|  PREDICTED: actin cytoskeleton-regulatory com...  58.2    4e-06   
ref|XP_001779834.1|  predicted protein                                58.2    4e-06   
ref|XP_001759306.1|  predicted protein                                59.3    5e-06   
gb|EMS45677.1|  hypothetical protein TRIUR3_15996                     58.9    5e-06   
ref|XP_010255304.1|  PREDICTED: uncharacterized protein LOC104596023  58.2    5e-06   
emb|CDM84751.1|  unnamed protein product                              58.2    5e-06   
ref|XP_010090794.1|  16 kDa phloem protein 2                          57.8    6e-06   
gb|ABK26354.1|  unknown                                               58.2    6e-06   
ref|XP_007209531.1|  hypothetical protein PRUPE_ppa010653mg           57.4    6e-06   
ref|XP_010103360.1|  hypothetical protein L484_002544                 57.0    6e-06   
ref|XP_010067355.1|  PREDICTED: uncharacterized protein LOC104454253  57.0    6e-06   
ref|XP_004250568.1|  PREDICTED: uncharacterized protein LOC101255161  55.8    6e-06   
ref|XP_010662792.1|  PREDICTED: uncharacterized protein LOC104882216  56.2    7e-06   
ref|XP_001775930.1|  predicted protein                                58.2    7e-06   
ref|XP_009148165.1|  PREDICTED: spidroin-2-like isoform X2            57.8    7e-06   
dbj|BAD73346.1|  proline-rich family protein-like                     57.8    8e-06   
gb|ABO82522.1|  unknown                                               56.2    8e-06   
ref|XP_010554734.1|  PREDICTED: uncharacterized protein LOC104824373  57.8    8e-06   



>ref|XP_009792812.1| PREDICTED: uncharacterized protein LOC104239795 [Nicotiana sylvestris]
Length=404

 Score =   293 bits (751),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 181/350 (52%), Positives = 224/350 (64%), Gaps = 36/350 (10%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
             HILEITLISAQDL PV KSLRTYAL W NPNRKRTT +D  G++NPTWNDKFSF+VDDEF
Sbjct  40    HILEITLISAQDLSPVCKSLRTYALTWVNPNRKRTTRVDNQGHSNPTWNDKFSFRVDDEF  99

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L SE S V VEIYTVSWFRD+LVGTV V ++NLI+P ++  + VALQIRRPSG+PQG+LN
Sbjct  100   LNSESSAVHVEIYTVSWFRDILVGTVKVLLNNLINPFDRSKKFVALQIRRPSGNPQGILN  159

Query  851   MSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNS-------EDEERERLH  693
             +   L +   + RSMPL + ++  S   +D+   K N +   +        EDEE+ +++
Sbjct  160   LGVALIDK--SKRSMPLFNQITPLSLDHRDILDRKINDINAQDQMINENFPEDEEKLQIN  217

Query  692   AKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEVCSDVGP  513
              KI  W+        SDVN  EFP + GSICNGSMVN GS+VN       GSE+CSD+GP
Sbjct  218   NKIQLWQSQNL--GYSDVNTGEFPNQAGSICNGSMVN-GSIVN-------GSELCSDIGP  267

Query  512   SASVVAAEIAQSWQASAAPR-------KEIMERGV-GDSMVLPANLTPeeakrrreaaed  357
             SAS+VAAEIA+  Q    PR       KE    G  G+S +L   LT EEA  +  A   
Sbjct  268   SASIVAAEIAKKLQPLPPPRVPSKELNKEYSGEGEDGESSIL-EELTAEEAYAKGLALST  326

Query  356   deneeemeMIPK------NAGRRKPDNGMYSCF--VYGFQFTIVCGANNN  231
             +  ++E     K         RR  D G+YSCF   Y F+FTIVCGA+NN
Sbjct  327   EGRKKEAAAPEKCQRGSGGHPRRNTDGGLYSCFGNAYCFEFTIVCGASNN  376



>ref|XP_009795461.1| PREDICTED: uncharacterized protein LOC104242159 [Nicotiana sylvestris]
Length=395

 Score =   291 bits (744),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 178/336 (53%), Positives = 229/336 (68%), Gaps = 21/336 (6%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
             HILEI+LISAQDL PVSKSLRTYAL W NPN+KR+T ID  G+ NPTWNDKFSFKV+DEF
Sbjct  36    HILEISLISAQDLAPVSKSLRTYALAWINPNKKRSTRIDNEGHNNPTWNDKFSFKVNDEF  95

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP---SEKGTREVALQIRRPSGSPQG  861
             L SE S V VEIYTVSWFRDVLVGTV V ++NLI+P   +  G R VALQIRRPSG+PQG
Sbjct  96    LYSETSAVHVEIYTVSWFRDVLVGTVHVLLNNLINPFINNSNGKRFVALQIRRPSGNPQG  155

Query  860   LLNMSATLQENTGTSRSMPL--SDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHAK  687
             +LNM  +L     + RSMPL  +++M+ +S   +D+  +K N  E +  +DE++ +++ K
Sbjct  156   ILNMGVSLIH--SSMRSMPLICNEIMNPSSLDYRDILDKKMN--ENYQEDDEKQRQINDK  211

Query  686   ILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEVCSDVGPSA  507
             I  W RS++    S+VN E+FP K GS+CNGSMVN GSM N GS+VN GSE+CSD+GPSA
Sbjct  212   IQLW-RSLSLG-YSEVNNEDFPNKAGSVCNGSMVN-GSMCN-GSIVN-GSELCSDIGPSA  266

Query  506   SVVAAEI-AQSWQ--ASAAPRKEIMERGVGDSMVLPANLTPeeakrrreaaeddeneeem  336
             S+VAAEI A+ +Q        K+  E   G+S +L      E   +   ++ +   +E  
Sbjct  267   SIVAAEIAAKRYQPPPQKVQIKQPKEMEDGESSILEDLTAEEAYAKGLASSMEKGRKETA  326

Query  335   eMIPKNAG--RRKPDNGMYSCF--VYGFQFTIVCGA  240
              +   N G  RR  D G++SCF   YG +F IVCGA
Sbjct  327   ALAVVNGGHSRRNSDGGLFSCFGNAYGIEFRIVCGA  362



>ref|XP_009625035.1| PREDICTED: uncharacterized protein LOC104115988 [Nicotiana tomentosiformis]
Length=406

 Score =   289 bits (739),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 178/347 (51%), Positives = 221/347 (64%), Gaps = 36/347 (10%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
             HILEITLISAQDL PV KSLRTYAL W NPNRKRTT +D  G++NPTWNDKFSF+VDDEF
Sbjct  42    HILEITLISAQDLSPVCKSLRTYALTWVNPNRKRTTRVDNQGHSNPTWNDKFSFRVDDEF  101

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L SE S V VEIYTVSWFRD+LVGTV V ++NLI+P ++  + VALQIRRPSG+PQG+LN
Sbjct  102   LNSESSAVHVEIYTVSWFRDILVGTVKVLLNNLINPYDRSKKFVALQIRRPSGNPQGILN  161

Query  851   MSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNS-------EDEERERLH  693
             +   L +   + RSMPL D ++  S   +D+   K N +   +        EDEE+ +++
Sbjct  162   LGVALIDK--SKRSMPLFDEITPLSLDHRDILDRKINDINAQDQMINENFPEDEEKLQIN  219

Query  692   AKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEVCSDVGP  513
              KI  W+        SDVN  EFP + GSICNGSM N GS+VN       GSE+CSD+GP
Sbjct  220   NKIQLWQSQSL--GYSDVNNGEFPNQAGSICNGSMAN-GSVVN-------GSELCSDIGP  269

Query  512   SASVVAAEIAQSWQASAAPR---KEIM-----ERGVGDSMVLPANLTPeeakrrreaaed  357
             SAS+VAAEIA+  Q    PR   KE+      E   G+S +L   LT EEA  +  A   
Sbjct  270   SASIVAAEIAKKLQPLPPPRVPSKELSKEYSGEGDDGESSIL-EELTAEEAYAKGLALST  328

Query  356   deneeemeMIPK------NAGRRKPDNGMYSCF--VYGFQFTIVCGA  240
             +  ++E     K         RR  + G+YSCF   Y F+FTIVCGA
Sbjct  329   EARKKEAAAPEKCQRGSGGHPRRNTNGGLYSCFGNAYCFEFTIVCGA  375



>ref|XP_006345991.1| PREDICTED: uncharacterized protein LOC102591105, partial [Solanum 
tuberosum]
Length=373

 Score =   282 bits (721),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 188/382 (49%), Positives = 237/382 (62%), Gaps = 51/382 (13%)
 Frame = -3

Query  1277  TAANSVITVSDVSCLSRPPV----GYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKR  1110
             T  N VI     S LS  P       HILEITLISAQDL PVSKSLRTYAL W NPNRKR
Sbjct  5     TTTNLVIPTPQSSSLSYQPSPNNNNSHILEITLISAQDLAPVSKSLRTYALTWINPNRKR  64

Query  1109  TTCIDQNGNANPTWNDKFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI  930
             +T +D +G+ NPTWNDKFSFKV++EFL SE S V VEIYTVSWFRDVLVGT++V ++NLI
Sbjct  65    STKVDNDGHNNPTWNDKFSFKVNEEFLYSENSAVHVEIYTVSWFRDVLVGTINVQLNNLI  124

Query  929   SP------SEKGTREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL--SDLMSTASG  774
             +P      S  G R VALQIRRPSG+PQG+LNM   + E   + RSMPL   +++  +S 
Sbjct  125   NPCVNFQNSLNGKRFVALQIRRPSGNPQGILNMGVAIIE--SSMRSMPLICKEIIDPSSL  182

Query  773   YKKDLELEKRNILEYHNSEDEERER-LHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICN  597
               +D+ L+K+    Y    D++++R L+ K+  W RSM+    S+VN +EFP K GSICN
Sbjct  183   DYRDI-LDKKMSENYQEVIDDDKQRELNEKVQLW-RSMSLG-YSEVNNDEFPIKGGSICN  239

Query  596   GSMVNGGSMVNGGSMVNYGSEVCSDVGPSASVVAAEI-AQSWQ-----ASAAPRKEI---  444
             GSMVN             GSE+CSDVGPSAS+VAAEI A+ +Q         PR+E+   
Sbjct  240   GSMVN-------------GSELCSDVGPSASIVAAEIAAKRYQQLLSTVQPEPRQEVETK  286

Query  443   --MERGVGDSMVLPANLTPeea------krrreaaeddeneeemeMIPKNAGRRKPD-NG  291
                E   G+S ++  +LT EEA         RE    +    +M+ I     RR  D  G
Sbjct  287   KSKEMEDGESSLILEDLTAEEAYAKGLLSSNREKLRKETIATQMQAINGGHARRNSDGGG  346

Query  290   MYSCF--VYGFQFTIVCGANNN  231
             ++SCF   YG +F IVCGAN+N
Sbjct  347   LFSCFGNAYGIEFRIVCGANSN  368



>ref|XP_009591729.1| PREDICTED: uncharacterized protein LOC104088710 [Nicotiana tomentosiformis]
Length=399

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 175/343 (51%), Positives = 229/343 (67%), Gaps = 33/343 (10%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
             HI+EI+LISAQDL PVSKSLRTYAL W NPN+KR+T ID  G+ NP+WNDKFSFKV+DEF
Sbjct  38    HIIEISLISAQDLAPVSKSLRTYALTWINPNKKRSTRIDNEGHNNPSWNDKFSFKVNDEF  97

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP--SEKGTREVALQIRRPSGSPQGL  858
             L SE S V VEIYTVSWFRDVLVGTV V ++NLI+P  +  G R VALQIRRPSG+PQG+
Sbjct  98    LYSETSAVHVEIYTVSWFRDVLVGTVHVLLNNLINPFVNSNGKRFVALQIRRPSGNPQGI  157

Query  857   LNMSATLQENTGTSRSMPL--SDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHAKI  684
             LNM  +L     + +SMPL  S++M+ +S   +D+ L+K+ I E +  +DE++ +++ K+
Sbjct  158   LNMGVSLI--NSSMKSMPLICSEIMNPSSLNYRDI-LDKK-INENYQVDDEKQRQINDKV  213

Query  683   LQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEVCSDVGPSAS  504
               W RS++    S+VN E+FP K GS+CNGSMVN GS+VN       GSE+CSD+GPSAS
Sbjct  214   QLW-RSLSLG-YSEVNNEDFPNKAGSVCNGSMVN-GSIVN-------GSELCSDIGPSAS  263

Query  503   VVAAEI-AQSWQ-----ASAAPRKEIM-----ERGVGDSMVLPANLTPeeakrrreaaed  357
             +VAAEI A+ +Q     A   P KE+      E   G+S +L      E   +   ++ +
Sbjct  264   IVAAEIAAKRYQPPRQPARPEPPKEMHIKQPKEMEDGESSILEDLTAEEAYAKGLTSSIE  323

Query  356   deneeemeMIPKNAG--RRKPDNGMYSCF--VYGFQFTIVCGA  240
                +E       N G  RR  D G++SCF   YG +F IVCGA
Sbjct  324   KGRKEMAVQAVVNGGHSRRNSDGGLFSCFGNAYGIEFRIVCGA  366



>gb|EYU39518.1| hypothetical protein MIMGU_mgv1a007478mg [Erythranthe guttata]
Length=406

 Score =   278 bits (711),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 171/365 (47%), Positives = 229/365 (63%), Gaps = 39/365 (11%)
 Frame = -3

Query  1226  PPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFK  1047
             P    H+LEI+LISAQDL P++KS+RTYA+ W NPNRK TT  DQ+GN +PTWNDK +F+
Sbjct  25    PHTPLHLLEISLISAQDLTPITKSMRTYAIAWVNPNRKLTTRTDQHGNTHPTWNDKLTFR  84

Query  1046  VDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSE--------KGTREVALQ  891
             VD +FLAS+ + +TVEIYTVSWFRDVLVGTV V +S+L+SP          K  R VALQ
Sbjct  85    VDSQFLASDDAAITVEIYTVSWFRDVLVGTVRVLISDLMSPPSGVPLQSLPKNMRFVALQ  144

Query  890   IRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNIL---EYHNS  720
             +RRPSG+PQG+LNM  +L +   + +SMPL         +++++ L+K N L   E +N+
Sbjct  145   VRRPSGAPQGILNMGVSLLDT--SMQSMPLQRGQPHEE-FREEI-LKKVNALSLEEQNNN  200

Query  719   EDEERERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYG  540
             ED+E++ L  +I  W RS++     + + +EFP K GS+ NGSMVN GSM N GSMVN G
Sbjct  201   EDDEKKELEKRIHLW-RSLSVGSGVNNDDDEFPQKGGSVYNGSMVN-GSMCN-GSMVN-G  256

Query  539   SEVCSDVGPSASVVAAEIAQSWQASAAP-----RKEIMERGVGDSMVLPANLTPeeakrr  375
             SE+CSD+GPSAS+VAAE+A   Q  + P     R        G S++    +    AK  
Sbjct  257   SELCSDIGPSASIVAAEMAMKPQMHSQPPPRPVRNAQAADDTGSSILEEMTMEEARAKGY  316

Query  374   reaaedde---------------neeemeMIPKNAGRRKPDNGMYSCFVYGFQFTIVCGA  240
             R     +                NE E+ ++     RR  D G++SCF YG +FTIVCGA
Sbjct  317   RIRTSRERWRKPSSGKSSSIDSCNESELSLMSNRHSRRNSDGGLFSCFAYGIEFTIVCGA  376

Query  239   NNNPP  225
             +NNPP
Sbjct  377   SNNPP  381



>ref|XP_004239688.1| PREDICTED: putative uncharacterized protein DDB_G0267840 [Solanum 
lycopersicum]
Length=415

 Score =   274 bits (700),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 175/352 (50%), Positives = 221/352 (63%), Gaps = 41/352 (12%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
             HILEITLISAQDL P+SKSLRTYAL W NPNRKR+T ID  G+ NPTWNDKFSFKV++EF
Sbjct  32    HILEITLISAQDLAPISKSLRTYALTWINPNRKRSTKIDNEGHNNPTWNDKFSFKVNEEF  91

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------SEKGTREVALQIRRPSGS  870
             L SE S V VEIYTVSWFRDVLVGT++V ++NLI+P      S  G R VALQIRRPSG+
Sbjct  92    LYSENSAVHVEIYTVSWFRDVLVGTINVQLNNLINPYVNFQNSSNGKRFVALQIRRPSGN  151

Query  869   PQGLLNMSATLQENTGTSRSMPL--SDLMSTASGYKKDLELEKRNILEYHN-SEDEERER  699
             PQG+LNM   + E   + RSMPL  +++M   S   +D+ L+K+    Y    ED+++  
Sbjct  152   PQGILNMGVAIIE--SSMRSMPLLCNEIMDPTSLDYRDI-LDKKMSENYQEVVEDDKQRE  208

Query  698   LHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEVCSDV  519
             ++ KI  W RSM+    S++N +E   K  SICNGSM N GSMVN       GSE+CSDV
Sbjct  209   INEKIQLW-RSMSLG-YSEINNDELLIKGSSICNGSMAN-GSMVN-------GSELCSDV  258

Query  518   GPSASVVAAEIAQ----------SWQASAAPRKEIMERGVGDSMVLPANLTPeea-----  384
             GPSAS+VAAEIA            +++  A  K+  E   G+  ++  +LT EEA     
Sbjct  259   GPSASIVAAEIAAKRYQQLLPTIQFESREAAIKQSKEMEDGERSLILEDLTAEEAYAKGL  318

Query  383   -krrreaaeddeneeemeMIPKNAGRRKPD-NGMYSCF--VYGFQFTIVCGA  240
                 RE    +    + + I     RR  D  G++SCF   YG +F IVCGA
Sbjct  319   ISSNREKLRKETTATQTQTINGGHARRNSDGGGLFSCFGNTYGIEFRIVCGA  370



>emb|CDP04279.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 159/355 (45%), Positives = 221/355 (62%), Gaps = 52/355 (15%)
 Frame = -3

Query  1271  ANSVITVSDVSCLSRPPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQ  1092
             A+S IT SD+S    PP  +++L I+LISAQDL P+SKS+RTYA+ W +P+RK TT +DQ
Sbjct  10    ASSTITDSDISL--HPP-DFYVLNISLISAQDLAPISKSMRTYAVTWIHPSRKLTTSVDQ  66

Query  1091  NGNANPTWNDKFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKG  912
               + NP WN++F+F+VD EFL+S+++ +TVEIYTVSWFRD+LVGTV V +S+LI+P  + 
Sbjct  67    QRHTNPLWNERFAFRVDSEFLSSDQAAITVEIYTVSWFRDLLVGTVRVLISDLITPCARN  126

Query  911   -TREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNIL  735
              TR +ALQIRRPSG+PQG+LNM   L +    +RSMPL   M+ +    +D  ++K N +
Sbjct  127   HTRYLALQIRRPSGNPQGMLNMGVALMD--AANRSMPLRREMNPSVRDYQDALVKKLNSM  184

Query  734   EYHNSE-----DEERERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSM  570
                  +     +E  ++++ KI  WR   +  + S+ N EEFP K GSICNG+       
Sbjct  185   SAQQKDGEIVTEENNDQMNEKIHLWR---SYSLGSEFN-EEFPLKAGSICNGN-------  233

Query  569   VNGGSMVNYGSEVCSDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGDSMVLPANLTPe  390
                      GSE+CSDVGPSAS+VAAEIA+    S  P   + ER +G+S+V    +   
Sbjct  234   ---------GSELCSDVGPSASIVAAEIARK---SLPP---MAERKIGNSIVEEMTVEEA  278

Query  389   eakrrreaaeddeneeemeMIPKNAGRRKPDNGMYSCF--VYGFQFTIVCGANNN  231
              AK                   +  GRR  D G++SCF   YGF+FTIVCGA+N+
Sbjct  279   TAKGLNSDG-------------RRHGRRHSDGGLFSCFGNAYGFEFTIVCGASNH  320



>ref|XP_011069440.1| PREDICTED: uncharacterized protein LOC105155266 [Sesamum indicum]
Length=404

 Score =   262 bits (670),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 163/357 (46%), Positives = 225/357 (63%), Gaps = 42/357 (12%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             +++LEI+LISAQDL P+SKS++TYA+ W NPN+K TT  DQ GN NP WNDKF F++ +E
Sbjct  32    FYLLEISLISAQDLAPISKSMQTYAMAWINPNKKHTTRTDQQGNKNPMWNDKFVFRLTNE  91

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP-------SEKGTREVALQIRRPS  876
              L SE +TVTVEIYTVSWFRDVLVG V V +S+LI+P       + K TR VALQ+RRPS
Sbjct  92    LLHSETATVTVEIYTVSWFRDVLVGMVRVLISDLITPLIRTLQTNTKNTRFVALQVRRPS  151

Query  875   GSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRN------ILEYHNSED  714
             G+PQG+LNM  +L ++  T RSMPL +  +         + +++N       L+      
Sbjct  152   GTPQGILNMGISLLDS--TMRSMPLKNYAARKHAKNNVQDSDEKNTNPDDDTLQKDEQLS  209

Query  713   EERERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSE  534
             +E+  L+AKI  WR   +    S+VN E+FP K GSI NGSMVN GS+ NG   + YGSE
Sbjct  210   DEKRELNAKIQLWR---SLSAGSEVN-EDFPVKAGSIYNGSMVN-GSLCNGS--IEYGSE  262

Query  533   VCSDVGPSASVVAAEIAQSWQ--------ASAAPRKEIME---RGVGDSMVLPANLTPee  387
             +CSD+GPSAS+VAAE+A+  Q        A++ P++  ++   +  G S++    +   +
Sbjct  263   LCSDIGPSASIVAAEVAKKLQPPPDLTYPAASNPKEAKLQGDHQETGSSILEELTIEEAK  322

Query  386   akrrreaaedden------eeemeMIPKNAGRRKP-DNGMYSCF--VYGFQFTIVCG  243
             AK  R A+++         E EM ++     RR P D G++SCF   YG +FTIVCG
Sbjct  323   AKGYRVASKERSRRDRDGNESEMSIVTSGRSRRNPADAGLFSCFGNAYGIEFTIVCG  379



>ref|XP_004242771.1| PREDICTED: formin-J [Solanum lycopersicum]
Length=370

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 159/340 (47%), Positives = 200/340 (59%), Gaps = 52/340 (15%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
             HILEITLISAQDL PV KSLRTYAL W NPNRKRTT ID +G+ NP WNDKFSF+VDDEF
Sbjct  34    HILEITLISAQDLSPVCKSLRTYALTWVNPNRKRTTRIDNHGHNNPNWNDKFSFRVDDEF  93

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGT----REVALQIRRPSGSPQ  864
             L S+ S + VEIYTVSWFRD+LVGTV V ++NL++P E  +    + VALQIRRPSG+PQ
Sbjct  94    LISDSSAIHVEIYTVSWFRDILVGTVKVILNNLVNPFENTSNSSKKFVALQIRRPSGNPQ  153

Query  863   GLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRN--------ILEYHNSEDEE  708
             G+LNM  +L +   + RSMPL   ++  S   +D+   K N        I   HN  D E
Sbjct  154   GILNMGVSLIDK--SKRSMPLFSEITPLSMDHRDILDRKINDINAQDEMINNNHNDTD-E  210

Query  707   RERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEVC  528
             + ++  K+  W+        S++N  EFP + GSI N                  GSE+C
Sbjct  211   KLKITNKVQIWQSHNL--AYSEINNGEFPNQAGSIVN------------------GSELC  250

Query  527   SDVGPSASVVAAEIAQSWQASAAPRKEIMERG--VGDSMVLPANLTPeeakrrreaaedd  354
             SD+GPSAS+VAAE A+  Q    P++    RG   G+S +L   LT EEA  +       
Sbjct  251   SDIGPSASIVAAETAKKLQP-MLPQRVASNRGNEDGESSIL-GELTAEEAYAKGLEETK-  307

Query  353   eneeemeMIPKNAGRRKPDNGMYSCF--VYGFQFTIVCGA  240
                       +  G    D G+YSCF   Y F+FTIVCGA
Sbjct  308   ----------RGRGGHTRDGGLYSCFGNAYCFEFTIVCGA  337



>ref|XP_006358324.1| PREDICTED: uncharacterized protein LOC102592049 [Solanum tuberosum]
Length=353

 Score =   251 bits (640),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 157/342 (46%), Positives = 196/342 (57%), Gaps = 59/342 (17%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
             HILEITLISAQDL PV KSLRTYAL W NPNRKRTT +D +G+ NP WNDKFSF+VDDEF
Sbjct  36    HILEITLISAQDLSPVCKSLRTYALTWVNPNRKRTTRVDNHGHNNPNWNDKFSFRVDDEF  95

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP-----SEKGTREVALQIRRPSGSP  867
             L+S+ S + VEIYTVSWFRD+LVGTV V ++NL++P     S +  + VALQIRRPSG+P
Sbjct  96    LSSDSSAIHVEIYTVSWFRDILVGTVKVILNNLVNPFENTSSNQSKKFVALQIRRPSGNP  155

Query  866   QGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRN--------ILEYHNSEDE  711
             QG+LNM   + +   + RSMPL   ++  S   +D+   K N        I   HN  DE
Sbjct  156   QGILNMGVAVIDK--SKRSMPLFSEITPLSLDHRDILDRKINDINAQDEMINNNHNHTDE  213

Query  710   ERERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEV  531
             +      +I  W++S       +V   EFP + GSI N                  GSE+
Sbjct  214   K-----LQIQMWQQS------DNVAYSEFPNQAGSIIN------------------GSEL  244

Query  530   CSDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGDSMVLPANLTPeeakrrreaaedde  351
             CSD+GPSAS+VAAE A+  Q  +    E      G+S  +   LT EEA  +        
Sbjct  245   CSDIGPSASIVAAETAKKLQVPSNRENE-----DGESSSILEELTAEEAYGKGLEETKRA  299

Query  350   neeemeMIPKNAGRRKPDNGMYSCF--VYGFQFTIVCGANNN  231
                          RR  D G+YSCF   Y F+FTIVCGA NN
Sbjct  300   KGGHT--------RRNTDGGLYSCFGNAYCFEFTIVCGAGNN  333



>ref|XP_011077131.1| PREDICTED: uncharacterized protein LOC105161211 [Sesamum indicum]
Length=377

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 132/344 (38%), Positives = 195/344 (57%), Gaps = 45/344 (13%)
 Frame = -3

Query  1202  EITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEFLAS  1023
             +++LISAQDL PV KS+RTYA+ W NPNRK TT  DQ G+ +PTWN+KFSF+VD + L S
Sbjct  35    DVSLISAQDLSPVCKSMRTYAVAWINPNRKLTTRTDQQGHTHPTWNEKFSFRVDTKSLIS  94

Query  1022  EKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSE--------KGTREVALQIRRPSGSP  867
             E S +TVEIYTVSWFRDVLVGTV V +S+L++P          + TR +ALQ+RRPSG+P
Sbjct  95    ENSAMTVEIYTVSWFRDVLVGTVRVLISDLLAPPSGIPLQNLPRSTRFIALQVRRPSGAP  154

Query  866   QGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELE------KRNILEYHNSEDEER  705
             QG+LNM  +L +   T RSMPL+ +   A  +  +++ +      ++ + +Y    ++E+
Sbjct  155   QGILNMGVSLLDT--TMRSMPLNPI---ADNFHDEIQKKAGAVSLQQELPQYDEDGEDEK  209

Query  704   ERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGG----SMVNGGSMVNYGS  537
             + L  KI  WR   +  + S++N ++F  KPGS+ +GS++NG       V   + +    
Sbjct  210   KELERKIQLWR---SLSVGSEMNTDDFALKPGSVIDGSIINGSLPPPLPVKPATQIRL--  264

Query  536   EVCSDVGPSA-SVVAAEIAQSWQASAAPRKEIMERGVGDSMVLPANLTPeeakrrreaae  360
             E+  D   S    +  E A++        +E   R V D                     
Sbjct  265   EINDDTSSSILEELTIEEAKAKGYRTRTSRERWRREVSDGHT----------------DL  308

Query  359   ddeneeemeMIPKNAGRRKPDNGMYSCFVYGFQFTIVCGANNNP  228
             +  +++      K   RR  D G++SC VYG +FTIVCGA+ +P
Sbjct  309   ESCDDDSELSTNKRHSRRNSDGGLFSCLVYGIEFTIVCGASKHP  352



>gb|EYU39778.1| hypothetical protein MIMGU_mgv1a009123mg [Erythranthe guttata]
Length=352

 Score =   216 bits (550),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 152/360 (42%), Positives = 182/360 (51%), Gaps = 90/360 (25%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              +LEI+LISAQDL PVSKS+ TY +VW  PN+K TT  D +G  NP WNDK  F +D+  
Sbjct  27    QLLEISLISAQDLAPVSKSMHTYGVVWIRPNKKHTTRTDNHGQRNPKWNDKCVFSLDNP-  85

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP----SEKGTREVALQIRRPSGSPQ  864
               +  +TVTVEIYTVSWFRDV+VG V V V++LI+P      K TR VALQIRRPSGSPQ
Sbjct  86    PENNDATVTVEIYTVSWFRDVIVGMVRVRVADLITPLTRTRNKNTRFVALQIRRPSGSPQ  145

Query  863   GLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHAKI  684
             G+LNM   L + T   RSMPLS                 +N  + H   D+  +     I
Sbjct  146   GILNMGVALSD-TAAMRSMPLS----------------SKNRFDEHKQNDDVTD---LNI  185

Query  683   LQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEVCSDVGPSAS  504
             + WR     D  +D     FP KPGSICNGS V+             GS++CSDVGPSAS
Sbjct  186   VLWRSLSAGDGKAD--DLSFPDKPGSICNGSTVDN------------GSDLCSDVGPSAS  231

Query  503   VVAAEI------------------AQSWQA----SAAPRKEIMER----GVGDSMVLPAN  402
             VVAAEI                  A+  +A    S A  KE+  R    G GD   L  N
Sbjct  232   VVAAEINTTAADQETGSSILEELTAEEAKAKGYKSVATSKEMWRRAMVEGGGDESELLRN  291

Query  401   LTPeeakrrreaaeddeneeemeMIPKNAGRRKPDNGMYSCF--VYGFQFTIVCGANNNP  228
                    RR                         D G +SCF   YG +FTIVCGA  NP
Sbjct  292   GGGRRRSRRSS-----------------------DEGRFSCFGNAYGIEFTIVCGAGKNP  328



>ref|XP_003535375.1| PREDICTED: uncharacterized protein LOC100795448 [Glycine max]
Length=373

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 137/366 (37%), Positives = 195/366 (53%), Gaps = 54/366 (15%)
 Frame = -3

Query  1244  VSCLSRPPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWN  1065
             +S L+ P   + +LE+ +ISAQDL PVSKS++ YA+ W NP RK TT ID NG  NPTWN
Sbjct  1     MSMLASP---FQLLELNIISAQDLAPVSKSIKAYAVAWLNPERKLTTQIDPNGQNNPTWN  57

Query  1064  DKFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNL----ISPSEKGTREVA  897
             +KF F+VDD+FL S++S + +EIY  +W RD+L+GTV+V  SNL    I+  +   R VA
Sbjct  58    EKFVFRVDDDFLTSDESLIIIEIYASAWLRDILIGTVTVLASNLLPRSINTRKSKIRFVA  117

Query  896   LQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNS  720
             LQ+RRPSG PQG+LN+   L ++  T RSMP+ S+L ++A GY   ++ +K  + +   +
Sbjct  118   LQVRRPSGRPQGILNIGVNLVDS--TMRSMPMYSELSASAVGYWDVMDPKKPKLQQNETN  175

Query  719   EDEERERLHAKILQWRRSMTPDMMSDVNG-------EEFPGKPGSICNGSMVNGGSMVNG  561
              ++       K+L  +RS +    S +N        E    + G  C GS V G  M   
Sbjct  176   NNDS----SCKLLTLQRSQSEKNDSTINDYAYNCSKENGYDEGGDDCQGSEV-GMPMAKK  230

Query  560   GSMVNYGSEVCSDVGPSASVVAAEIAQSWQ---ASAAPRKEIMERGVGDSMVLPANLT--  396
             G ++N    +CSDVGPS SVVAA IA+         APRK             P NL   
Sbjct  231   GVIMNMNGSLCSDVGPSPSVVAAAIAKGLYPLPMMTAPRK-------------PGNLVFQ  277

Query  395   --------PeeakrrreaaeddeneeemeMIPKNAGRRK----PDNGMYSCF--VYGFQF  258
                                 +++    +  IPK  G++      D G++SCF    G +F
Sbjct  278   DWPEERGGLTAVYDHLGKNNENKKVRHVHSIPKGKGQKHRKGSSDGGLFSCFGTAMGCEF  337

Query  257   TIVCGA  240
             +I CG 
Sbjct  338   SITCGG  343



>ref|XP_007205372.1| hypothetical protein PRUPE_ppa007276mg [Prunus persica]
 gb|EMJ06571.1| hypothetical protein PRUPE_ppa007276mg [Prunus persica]
Length=375

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 165/256 (64%), Gaps = 29/256 (11%)
 Frame = -3

Query  1235  LSRPPVG--YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWND  1062
             + RPP+   + +LEI LISAQDL P SKS+RT+A+ W NP RK TT +DQNG+ NPTWN+
Sbjct  1     MPRPPLASSFQLLEINLISAQDLYPASKSMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNE  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRR  882
             KF F+VDDEFL  + S + +EIY  +W RDVL+GT +V V+NL + S+   R +A+Q+RR
Sbjct  61    KFVFRVDDEFLKDDTSKIMIEIYASAWLRDVLIGTAAVVVNNLQNKSK--MRFMAIQLRR  118

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYH-NSEDEE  708
             PSG PQG+LN+   L +N  T RSMPL S+L S+A GY   +E +  N   +  N +D++
Sbjct  119   PSGRPQGILNIGLGLLDN--TMRSMPLYSELSSSAVGYWDLMEGKGANQKNHDPNYKDQD  176

Query  707   RERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEVC  528
                   K + ++RS      SD  G ++    GSI NGS ++  S   GG     G  +C
Sbjct  177   ------KFIIFQRS-----QSDRTGSDY----GSIVNGSELS--SAQKGGK----GGSIC  215

Query  527   SDVGPSASVVAAEIAQ  480
             SDVGPS SVVAA IA+
Sbjct  216   SDVGPSPSVVAAAIAK  231



>emb|CDP04278.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   198 bits (504),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 142/364 (39%), Positives = 197/364 (54%), Gaps = 55/364 (15%)
 Frame = -3

Query  1223  PVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKV  1044
             P+ + +LE+ +ISAQDL PVS++LRTYA+ W NP RK  T +DQ G  NPTWNDKF F+V
Sbjct  3     PLPFQLLELNVISAQDLAPVSQNLRTYAVAWMNPERKLRTRVDQQGKTNPTWNDKFVFRV  62

Query  1043  DDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGT-----REVALQIRRP  879
             D++FL SE S+V +E+Y + W RD  VG+V V +SNLI  + + T     R VALQIRRP
Sbjct  63    DEKFLDSETSSVMIEVYAIGWLRDTPVGSVRVLISNLIPQNVRKTNNSQRRFVALQIRRP  122

Query  878   SGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERE  702
             SG PQG+LNM  TL +N    +SMPL S+L ++A                 + + D++ E
Sbjct  123   SGRPQGILNMGVTLLDN--NMKSMPLYSELSASAK--------------NGNGNSDQKEE  166

Query  701   RLHAKILQWRRSMTPDMMSDVNGEEFPGK-PGSICNGSMVN----GGSMVNG----GSMV  549
             +     ++ RR+ +        G ++ G   GS+ N S+VN    GGS +NG    GS +
Sbjct  167   K-----IKLRRTQSDCTEVKEKGNKWKGNGEGSVYNSSVVNGPTRGGSSLNGPNLNGSEI  221

Query  548   NY---GSEVCSDVGPSASVVAAEIAQSWQASAAPR-----KEIMERGVGDSMVLPANLTP  393
                  GS   SDVGPS SVVAA +A+    +  P+       I+     D   +    + 
Sbjct  222   GVAKNGSMCNSDVGPSPSVVAAAVARGLYPTPLPKPHDPGSSILGDWTADDASVEGLKSK  281

Query  392   eeakrrreaaeddeneeemeMIPKNAG------RRKPDN---GMYSCF--VYGFQFTIVC  246
              +  +     + D+     + IPK         RRK  N   G +SCF    G +FTIVC
Sbjct  282   IDRWKMELPGKCDKTPNSYQKIPKEKERKQHWRRRKSANEGSGRFSCFGAACGCEFTIVC  341

Query  245   GANN  234
             GANN
Sbjct  342   GANN  345



>ref|XP_008218351.1| PREDICTED: uncharacterized protein LOC103318712 [Prunus mume]
Length=417

 Score =   199 bits (506),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 124/286 (43%), Positives = 167/286 (58%), Gaps = 45/286 (16%)
 Frame = -3

Query  1235  LSRPPVG--YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWND  1062
             + RPP+   + +LEI LISAQDL P SKS+RT+A+ W NP RK TT +DQNG+ NPTWN+
Sbjct  1     MPRPPLASSFQLLEINLISAQDLYPASKSMRTFAVAWVNPKRKLTTRVDQNGHTNPTWNE  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRR  882
             KF F+VDDEFL  + S + +EIY  +W RDVL+GT +V V+NL + S+   R +A+Q+RR
Sbjct  61    KFVFRVDDEFLKDDTSKIMIEIYASAWLRDVLIGTAAVVVNNLQNKSK--MRFMAIQLRR  118

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYH-NSEDEE  708
             PSG PQG+LN+   L +N  T RSMPL S+L S+A GY   +E +  N   +  N +D++
Sbjct  119   PSGRPQGILNIGLGLLDN--TMRSMPLYSELSSSAVGYWDLMEGKGANQKNHDPNYKDQD  176

Query  707   RERLHAKILQWRRSMTPDMMSD-----------------------------VNGEEFPGK  615
                   K + ++RS +    SD                               G     K
Sbjct  177   ------KFIIFQRSQSDRTGSDYGFSKSRPASSVCDGLSKSKASSSICNAATGGFSKTTK  230

Query  614   P-GSICNGSMVNGGSMVNGGSMVNYGSEVCSDVGPSASVVAAEIAQ  480
             P GS CN S+VN GS ++       G  +CSDVGPS SVVAA IA+
Sbjct  231   PQGSFCNSSIVN-GSELSSAQKGGKGGSICSDVGPSPSVVAAAIAK  275



>ref|XP_011077059.1| PREDICTED: uncharacterized protein LOC105161156 [Sesamum indicum]
Length=397

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 159/405 (39%), Positives = 210/405 (52%), Gaps = 89/405 (22%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKF  1056
             +SR P  Y +LE+ +ISAQDL  VS++LRTYA  W NPNRK  T +D  G  NPTWNDKF
Sbjct  1     MSRVP--YQLLELAIISAQDLASVSRNLRTYATTWINPNRKLKTRVDNQGLNNPTWNDKF  58

Query  1055  SFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPS--EKGT--REVALQI  888
              F+VDD+FL S  S+V +EIY   W RD  VG+VSV +SNLI PS  ++G+  R VALQI
Sbjct  59    IFRVDDKFLNSATSSVMIEIYAQGWLRDTPVGSVSVLISNLIPPSVRQEGSSRRFVALQI  118

Query  887   RRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDE  711
             RRPSG PQG+LNM  +L +N  T +SMPL +DL ++A G  +DL  EK       N E++
Sbjct  119   RRPSGRPQGILNMGVSLLDN--TMKSMPLYADLNASAVGV-RDLMDEKLCKNNKRNKEND  175

Query  710   ERERLH----------AKILQWRRSMTPDMMSDVNGEEFPGKP---GSICNGSMVNGGSM  570
              + ++H           K +Q  R+++    +D+  ++  G+     S+CN    N G M
Sbjct  176   NQRKVHRQDGGKESSGEKKIQLLRTLSD--QTDLTRKQGGGRKRRGSSVCNVPYYNQGFM  233

Query  569   VN---------------GGSMVNYGSEVCSDVGPSASVVAAEIA----------------  483
             +N               GGS VN GS+  SD+GPS SVVAA +A                
Sbjct  234   LNIGGSSVVGGGSVVHAGGSYVN-GSQCNSDLGPSPSVVAAAVACGLYPTQLGPPPKPGS  292

Query  482   ---QSW---QASAAPRKEIMERGVGDSMVLPANLTPeeakrrreaaeddeneeemeMIPK  321
                + W   +AS    K  +ER     M LP N                  E   +   K
Sbjct  293   SVLEDWTVEEASMEGLKSKIERW---RMELPQN------------QRYQRLEASNKRREK  337

Query  320   NAG--RRKPDNGM-------YSCF--VYGFQFTIVCGANNNPPKT  219
               G  RRK  NG        +SCF   YG +FTIVCG+ N   K+
Sbjct  338   KPGHRRRKTANGADDDEAGRFSCFGNAYGCEFTIVCGSKNGGRKS  382



>ref|XP_004494967.1| PREDICTED: uncharacterized protein LOC101508328 [Cicer arietinum]
Length=373

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 138/349 (40%), Positives = 198/349 (57%), Gaps = 25/349 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             Y +LEI++ISAQDLPPV+KS++ YA+ W +P RK  T IDQ G+ NPTWN+KF F+VDDE
Sbjct  10    YQLLEISIISAQDLPPVAKSIKAYAVAWLHPERKLATQIDQVGHTNPTWNEKFVFRVDDE  69

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK-GTRE-----VALQIRRPSG  873
             FL SE S + ++IY  +W RDVL+GTV V V NL+ P  + G R+     VALQIR+PSG
Sbjct  70    FLNSENSVIMIDIYNSTWIRDVLIGTVGVLVGNLLPPGTRTGNRKPKLRFVALQIRKPSG  129

Query  872   SPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERERL  696
              PQG+LN+  T+ ++  T RSMPL S+L ++A GY   ++  K+ I   +++ ++     
Sbjct  130   RPQGILNIGVTVLDS--TMRSMPLYSELSTSAVGYSDLMDSNKKKI--SNDNNNDNYSTT  185

Query  695   HAKILQWRRSMTPDMMSDVNGEEF--PGKPGSICNGSMVNGGSMVNGGSMVNYGSEVCSD  522
              +K+L  +R  +    S +N   +   GK G +   S V+      GG   N    +CSD
Sbjct  186   DSKLLTLQRCQSEKNDSTINDYVYHGAGKNGYVYEESEVSVPLPRKGG---NNEESLCSD  242

Query  521   VGPSASVVAAEIAQSWQASAAPRKEIMERGVGD-SMVLPANLTPeeakrrreaaeddene  345
             +GPS SVVAA IA+      AP + +    V D S    +     + +R R       N+
Sbjct  243   IGPSPSVVAAAIAKGLYPIPAPPRTMESSTVDDWSESNCSEGMNTKIQRWRHELTPAYNK  302

Query  344   eemeMIPKNAGRRKP------DNGMYSCF--VYGFQFTIVCGANNNPPK  222
             EE + I K  G + P         ++SCF   +G +F+I CG  N   K
Sbjct  303   EEYDEIEKRVGGKTPGRPVSRKGKLFSCFGTAFGCEFSISCGGGNQKKK  351



>ref|XP_008441789.1| PREDICTED: uncharacterized protein LOC103485843 [Cucumis melo]
Length=361

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 137/360 (38%), Positives = 193/360 (54%), Gaps = 39/360 (11%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKF  1056
             + RPP  + +LE++L+SA DL  VSK++RT+A+ W NP+RK TT +DQ G  NPTWN+KF
Sbjct  1     MVRPP--FQVLELSLLSANDLASVSKTMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEKF  58

Query  1055  SFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI--SPSEKGTREVALQIRR  882
              FKVDD+ L    STVT+EIY+ +  RD+LVGTV+  VSNLI  S  +   R + LQ+RR
Sbjct  59    VFKVDDDLLEDPTSTVTIEIYSSALLRDILVGTVTEVVSNLIPQSSPKSNMRFLTLQVRR  118

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDL-ELEKRNILEYHNSEDEE  708
             PSG P+G + +  TL ++    RSMPL SDL S+A  Y  DL E++ +      N     
Sbjct  119   PSGRPKGTVKVGVTLLDS--AKRSMPLESDLGSSAVDYDWDLREIKAQKQNFQKNGYTIV  176

Query  707   RERLHAKILQWRRSMTPDMMSDVNGEEFPGKP-GSICNGSMVNGG--------SMVNGGS  555
              +R H+          PD ++        GKP GS+CN S V GG         +     
Sbjct  177   MKRSHSA------RYDPDALN--------GKPGGSVCNASSVMGGRDSVRSRSELGTTKK  222

Query  554   MVNYGSEVCSDVGPSASVVAAEIAQS-WQASAAPRKEIMERGVGDSMV--LPANLTPeea  384
             +VN    +CSDVGPS SVVAA IA+  + A       I+E       +  L   +     
Sbjct  223   IVNANGSLCSDVGPSPSVVAAAIAKGLYPAPDDVGSSILEDWTEKDSIEGLKTKIERWRT  282

Query  383   krrreaaeddeneeemeMIPKNA---GRRKPDNGMYSCF--VYGFQFTIVCGANNNPPKT  219
             +      +++  +       K +    RRK  +G++SCF   YG +F+I CG  N   K+
Sbjct  283   ELHPIMYDNEIKKLPSRSYRKKSVKKQRRKKGSGLFSCFGTAYGCEFSITCGGPNQKKKS  342



>ref|XP_008370760.1| PREDICTED: uncharacterized protein LOC103434221 [Malus domestica]
 ref|XP_008370902.1| PREDICTED: uncharacterized protein LOC103434347 [Malus domestica]
Length=402

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 160/278 (58%), Gaps = 40/278 (14%)
 Frame = -3

Query  1223  PVG--YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSF  1050
             P G  + +LEI LISAQDL P SK++RT+A+ W NP RK TT  DQ G+ NPTWN+KF F
Sbjct  4     PFGSSFQLLEINLISAQDLTPASKAMRTFAVAWVNPKRKLTTRFDQTGHTNPTWNEKFVF  63

Query  1049  KVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGS  870
             +VDD+FL  + S + +EIY  +W RDVL+GT +V V+NL + S+   R +A+Q+RRPSG 
Sbjct  64    RVDDDFLRHDTSKIMIEIYASAWLRDVLIGTAAVVVNNLQNKSK--MRFMAIQLRRPSGR  121

Query  869   PQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYH-NSEDEERERL  696
             PQG+LN+   L ++  T RSMPL S+L S+A GY   +E +  N      NS+D++    
Sbjct  122   PQGILNIGLGLLDS--TMRSMPLYSELSSSAVGYWDLMEGKTGNQKSSGLNSKDQD----  175

Query  695   HAKILQWRRSMTPDMMSD-------------------------VNGEEF-PGKPGSICNG  594
               K + ++RS +    SD                          N   + P    S CN 
Sbjct  176   --KFVIFQRSQSDRTGSDSGFSKSRPASSICDGVTKIRPSNSTCNAAAYKPKTQASFCNS  233

Query  593   SMVNGGSMVNGGSMVNYGSEVCSDVGPSASVVAAEIAQ  480
             S+VNG  +  G    N    +CSDVGPS SVVAA IA+
Sbjct  234   SIVNGSELSTGQKKGNVNGSLCSDVGPSPSVVAAAIAK  271



>ref|XP_004152866.1| PREDICTED: uncharacterized protein LOC101218582 [Cucumis sativus]
 gb|KGN61292.1| hypothetical protein Csa_2G076000 [Cucumis sativus]
Length=360

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 134/353 (38%), Positives = 184/353 (52%), Gaps = 38/353 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE++L+SA DL  VSK++RT+A+ W NP+RK TT +DQ G  NPTWN+KF FKVDD+
Sbjct  6     FQVLELSLLSANDLASVSKTMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEKFVFKVDDD  65

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI--SPSEKGTREVALQIRRPSGSPQG  861
              L    STVT+EIY+ +  RD+LVGTV+  VSNLI  S S+   R + LQ+RRPSG P+G
Sbjct  66    LLEDPTSTVTIEIYSSALLRDILVGTVTEVVSNLIPQSSSKSNMRFLTLQVRRPSGRPKG  125

Query  860   LLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHAKI  684
              + +  TL ++    RSMPL SDL S+A  Y  DL   K     +  +            
Sbjct  126   TVKVGVTLLDS--AKRSMPLESDLGSSAVDYDWDLSEIKAQKQNFQKN------------  171

Query  683   LQWRRSMTPDMMSDVNGEEFPGKP-GSICNGSMVNGG--------SMVNGGSMVNYGSEV  531
               +R  M        + + F GKP GS+CN + V GG         +     +VN    +
Sbjct  172   -GYRIVMKRSHSERYDPDAFNGKPSGSVCNTNSVIGGRESVRSKSELGTTKKIVNANGSL  230

Query  530   CSDVGPSASVVAAEIAQS-WQASAAPRKEIMERGV------GDSMVLPANLTPeeakrrr  372
             CSDVGPS SVVAA IA+  + A       I+E         G    +    T        
Sbjct  231   CSDVGPSPSVVAAAIAKGLYPAPDDVGSSILEDWTEKDSIEGLKTKIERWRTELHPMYES  290

Query  371   eaaeddeneeemeMIPKNAGRRKPDNGMYSCF--VYGFQFTIVCGANNNPPKT  219
             E  +        + + K   RRK  +G++SCF   YG +F+I CG  N   K+
Sbjct  291   EIKKLPSRSYRKKSVKKQ--RRKKGSGLFSCFGTAYGCEFSITCGGPNQKKKS  341



>ref|XP_008366882.1| PREDICTED: uncharacterized protein LOC103430513 [Malus domestica]
Length=395

 Score =   192 bits (488),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 113/272 (42%), Positives = 156/272 (57%), Gaps = 35/272 (13%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI LISAQDL P SK++RT+A+ W NP RK TT +DQNG+ NPTWN+KF F+VD++
Sbjct  9     FQLLEINLISAQDLTPASKAMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDED  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLL  855
             FL  + S + +EIY  +W RDVL+GT +V V+NL + S+   R +A+Q+RRPSG PQG+L
Sbjct  69    FLRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNLQNKSK--MRFMAIQLRRPSGRPQGIL  126

Query  854   NMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHAKILQ  678
             N+   L ++  T RSMPL S+L S+A GY   +E +  N    H   +    +   K + 
Sbjct  127   NIGLGLLDS--TMRSMPLYSELSSSAVGYWDLMEGKTGN----HQKSNGSNSKDQDKFII  180

Query  677   WRRSMTPDMMSD-------------------------VNGEEF-PGKPGSICNGSMVNGG  576
             ++RS +    SD                          N   + P    S CN S+VNG 
Sbjct  181   FQRSQSDRTGSDYGFSKSRPASSICDGVTKSRPPSSICNAAAYKPKHQASFCNSSIVNGS  240

Query  575   SMVNGGSMVNYGSEVCSDVGPSASVVAAEIAQ  480
              +       N    +CSDVGPS SVVAA IA+
Sbjct  241   EVSTVQKKGNVNGSLCSDVGPSPSVVAAAIAK  272



>ref|XP_004495587.1| PREDICTED: uncharacterized protein LOC101488962 [Cicer arietinum]
Length=363

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 127/351 (36%), Positives = 190/351 (54%), Gaps = 41/351 (12%)
 Frame = -3

Query  1226  PPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFK  1047
             PP  +H+LEI +ISAQDL PVSKS++ YA+ W +P RK TT ID + + NPTWN+KF F+
Sbjct  6     PP--FHLLEINIISAQDLSPVSKSIKAYAVAWLDPQRKLTTQIDPHAHNNPTWNEKFVFR  63

Query  1046  VDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP---SEKGTREVALQIRRPS  876
             VDD+FL SE S + +EIY+ +W RD+L+GTV+VN++NL+      +   R VALQ+RRPS
Sbjct  64    VDDDFLQSEDSAIVIEIYSSAWLRDILIGTVAVNLNNLLPRLYNRKSKIRFVALQVRRPS  123

Query  875   GSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNSEDEERERL  696
             G PQG+LN+   L +   T RSMP+   +S+++    DL   K+  ++ H +E+   +  
Sbjct  124   GRPQGILNIGVNLVD--ATMRSMPMYSELSSSAVEYHDLMNPKK--IQNHENENNACD--  177

Query  695   HAKILQWRRSMTPDMMSDVNGEEF--PGKPGSICNGSMVNGGSMV-----NGGSMVNYGS  537
              +K++  +RS +    S +N   +   GK G    G + N  S +       G ++N   
Sbjct  178   -SKLMTLQRSQSEKNDSTINDYTYNPNGKNGY---GGVENSESEIGVPTGKKGVIMNANG  233

Query  536   EVCSDVGPSASVVAAEIAQSW--------QASAAPRKEIMERGVGDSMVLPANLTPeeak  381
              +CSDVGPS SVVAA IA+          + +A P  + M+R    +M LP         
Sbjct  234   SLCSDVGPSPSVVAAAIAKGLYPLPLPVPRKAANPMFDKMDR--WRTMELPVVYDHLGKN  291

Query  380   rrreaaeddeneeemeMIPKNAGRRKPDNGMYSCF--VYGFQFTIVCGANN  234
                      +             ++    G++SCF    G + +I CG  N
Sbjct  292   NCNGEKMGMKQTG-------EGNKKGSRQGLFSCFGTALGCEISITCGGGN  335



>ref|XP_004155136.1| PREDICTED: uncharacterized protein LOC101227028 [Cucumis sativus]
Length=360

 Score =   191 bits (484),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 133/353 (38%), Positives = 184/353 (52%), Gaps = 38/353 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE++L+SA DL  VSK++RT+A+ W NP+RK TT +DQ G  NPTWN+KF FKVDD+
Sbjct  6     FQVLELSLLSANDLASVSKTMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEKFVFKVDDD  65

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI--SPSEKGTREVALQIRRPSGSPQG  861
              L    STVT+EIY+ +  RD+L+GTV+  VSNLI  S S+   R + LQ+RRPSG P+G
Sbjct  66    LLEDPTSTVTIEIYSSALLRDILIGTVTEVVSNLIPQSSSKSNMRFLTLQVRRPSGRPKG  125

Query  860   LLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHAKI  684
              + +  TL ++    RSMPL SDL S+A  Y  DL   K     +  +            
Sbjct  126   TVKVGVTLLDS--AKRSMPLESDLGSSAVDYDWDLSEIKAQKQNFQKN------------  171

Query  683   LQWRRSMTPDMMSDVNGEEFPGKP-GSICNGSMVNGG--------SMVNGGSMVNYGSEV  531
               +R  M        + + F GKP GS+CN + V GG         +     +VN    +
Sbjct  172   -GYRIVMKRSHSERYDPDAFNGKPSGSVCNTNSVIGGRESVRSKSELGTTKKIVNANGSL  230

Query  530   CSDVGPSASVVAAEIAQS-WQASAAPRKEIMERGV------GDSMVLPANLTPeeakrrr  372
             CSDVGPS SVVAA IA+  + A       I+E         G    +    T        
Sbjct  231   CSDVGPSPSVVAAAIAKGLYPAPDDVGSSILEDWTEKDSIEGLKTKIERWRTELHPMYES  290

Query  371   eaaeddeneeemeMIPKNAGRRKPDNGMYSCF--VYGFQFTIVCGANNNPPKT  219
             E  +        + + K   RRK  +G++SCF   YG +F+I CG  N   K+
Sbjct  291   EIKKLPSRSYRKKSVKKQ--RRKKGSGLFSCFGTAYGCEFSITCGGPNQKKKS  341



>ref|XP_009379739.1| PREDICTED: uncharacterized protein LOC103968123 [Pyrus x bretschneideri]
Length=395

 Score =   191 bits (486),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 113/272 (42%), Positives = 156/272 (57%), Gaps = 35/272 (13%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI LISAQ+L P SK++RT+A+ W NP RK TT +DQNG+ NPTWN+KF F+VDD+
Sbjct  9     FQLLEINLISAQELTPASKAMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDDD  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLL  855
             FL  + S + +EIY  +W RDVL+GT +V V+NL + S+   R +A+Q+RRPSG PQG+L
Sbjct  69    FLRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNLQNKSK--MRFMAIQLRRPSGRPQGIL  126

Query  854   NMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHAKILQ  678
             N+   L ++  T RSMPL S+L S+A GY   +E +  N    H   +    +   K + 
Sbjct  127   NIGLGLLDS--TMRSMPLYSELSSSAVGYWDLMEGKTGN----HQKSNGPNSKDQDKFII  180

Query  677   WRRSMTPDMMSD-------------------------VNGEEF-PGKPGSICNGSMVNGG  576
             ++RS +    SD                          N   + P    S CN S+VNG 
Sbjct  181   FQRSQSDRTGSDYGFSKSKPASSICDGVTKSRPPSSICNAAAYKPKHQASFCNSSIVNGS  240

Query  575   SMVNGGSMVNYGSEVCSDVGPSASVVAAEIAQ  480
              +       N    +CSDVGPS SVVAA IA+
Sbjct  241   EVSTVQKKGNVNGSLCSDVGPSPSVVAAAIAK  272



>ref|XP_008388740.1| PREDICTED: uncharacterized protein LOC103451084 [Malus domestica]
Length=395

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/272 (41%), Positives = 155/272 (57%), Gaps = 35/272 (13%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI LISAQDL P SK++RT+A+ W NP RK TT +DQNG+ NPTWN+KF F+VD++
Sbjct  9     FQLLEINLISAQDLTPASKAMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDED  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLL  855
             FL  + S + +EIY  +W RDVL+GT +V V+NL + S+   R +A+Q+RRPSG P G+L
Sbjct  69    FLRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNLQNKSK--MRFMAIQLRRPSGRPXGIL  126

Query  854   NMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHAKILQ  678
             N+   L ++  T RSMPL S+L S+A GY   +E +  N    H   +    +   K + 
Sbjct  127   NIGLGLLDS--TMRSMPLYSELSSSAVGYWDLMEGKTGN----HQKSNGSNSKDQDKFII  180

Query  677   WRRSMTPDMMSD-------------------------VNGEEF-PGKPGSICNGSMVNGG  576
             ++RS +    SD                          N   + P    S CN S+VNG 
Sbjct  181   FQRSQSDRTGSDYGFSKSRPASSICDGVTKSRPPSSICNAAAYKPKHQASFCNSSIVNGS  240

Query  575   SMVNGGSMVNYGSEVCSDVGPSASVVAAEIAQ  480
              +       N    +CSDVGPS SVVAA IA+
Sbjct  241   EVSTVQKKGNVNGSLCSDVGPSPSVVAAAIAK  272



>ref|XP_009343786.1| PREDICTED: uncharacterized protein LOC103935702 [Pyrus x bretschneideri]
Length=402

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 159/278 (57%), Gaps = 40/278 (14%)
 Frame = -3

Query  1223  PVG--YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSF  1050
             P G  + +LEI LISAQDL P SK++RT+A+ W NP RK TT  DQ G+ NPTWN+KF F
Sbjct  4     PFGSTFQLLEINLISAQDLTPASKAMRTFAVAWVNPKRKLTTRFDQTGHTNPTWNEKFVF  63

Query  1049  KVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGS  870
             +VDD+FL  + S + +EIY  +W RDVL+GT +V V+NL + S+   R +A+Q+RRPSG 
Sbjct  64    RVDDDFLRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNLQNKSK--MRFMAIQLRRPSGR  121

Query  869   PQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYH-NSEDEERERL  696
             PQG+LN+   L ++  T RSMPL S+L S+A GY   +E +  N      NS+D++    
Sbjct  122   PQGILNIGLGLLDS--TMRSMPLYSELSSSAVGYWDLMEGKAGNQKSSGLNSKDQD----  175

Query  695   HAKILQWRRSMTPDMMSD-------------------------VNGEEF-PGKPGSICNG  594
               K + ++RS +    SD                          N   + P    S CN 
Sbjct  176   --KFVIFQRSQSDRTGSDSGFSKSRPASSICDGVTKIRPSNSTCNAAAYKPKTQASFCNS  233

Query  593   SMVNGGSMVNGGSMVNYGSEVCSDVGPSASVVAAEIAQ  480
             S+VNG  +       N    +CSDVGPS SVVAA IA+
Sbjct  234   SIVNGSELSTEQKKGNVNGSLCSDVGPSPSVVAAAIAK  271



>gb|KDP23730.1| hypothetical protein JCGZ_23563 [Jatropha curcas]
Length=375

 Score =   189 bits (479),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 114/256 (45%), Positives = 151/256 (59%), Gaps = 37/256 (14%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +ISAQDL  VSKS+RTYA+VW +P RK TT IDQNG+ NP WN+KF F+VDD 
Sbjct  8     FQLLEINVISAQDLATVSKSMRTYAVVWVHPERKLTTRIDQNGHTNPQWNEKFVFRVDDA  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGT--REVALQIRRPSGSPQG  861
             FL SE S + +EIY  +W RDV +G+V V VSNL   +   +  R VALQIRRPSG PQG
Sbjct  68    FLDSETSAIMIEIYAAAWLRDVQIGSVRVLVSNLFPSNNNNSKMRFVALQIRRPSGRPQG  127

Query  860   LLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHAKI  684
             +LNM   L +N  T RSMPL ++L ++A G+  DL   K N           ++ +  K 
Sbjct  128   ILNMGVQLLDN--TMRSMPLYTELSASAVGF-NDLIDAKTNT----------KQTIEEKT  174

Query  683   LQWRRSMTPDMMSDVNGEEFPGK-----PGSICNGSMVNGGSMVN--------------G  561
              + RR+ +       N +EF  K       S+ NGS+VN  ++++               
Sbjct  175   SKLRRTQSDHTDFTTNADEFGVKGSHTAKSSVINGSLVNSSAVIHTNNKDKDASTGSHGN  234

Query  560   GSMVNYGSEVCSDVGP  513
             GSMVN    +CSDVGP
Sbjct  235   GSMVN--GSLCSDVGP  248



>gb|KDO53064.1| hypothetical protein CISIN_1g035970mg, partial [Citrus sinensis]
Length=377

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 143/385 (37%), Positives = 204/385 (53%), Gaps = 67/385 (17%)
 Frame = -3

Query  1226  PPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFK  1047
             PP    +LEI+++S  DL  VSKS++TY++ W +P RK TT +DQNG  NP+WN+KF F+
Sbjct  4     PP---RVLEISIVSGHDLALVSKSMKTYSVAWVDPERKLTTRVDQNGLNNPSWNEKFVFR  60

Query  1046  VDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP----SEKGTREVALQIRRP  879
             VDD FL  E S + +EIY  +W +D L+G+V V +S+L       S   TR VALQ+RRP
Sbjct  61    VDDRFLTDETSAIMIEIYAAAWLKDALIGSVRVLISHLFGTLTHNSSSSTRYVALQVRRP  120

Query  878   SGSPQGLLNMSATLQENTGTSRSMPL--------SDLMSTASGYKKDLELEKRNILEYHN  723
             SG PQG+LN+  TL +N  T RSMPL        ++    +SG    ++ E         
Sbjct  121   SGRPQGILNLGITLLDN--TMRSMPLFAELCGAGANFSEVSSGANDVMKPETTTAQNSKQ  178

Query  722   S-EDEERERL---------HAKILQWRRSMTPDMMSDVNGEEF----------PGKPGSI  603
             S +D+E ER+          AK+   RRS +    +D+  E++          P   GS+
Sbjct  179   SKDDQELERVLKPKDNSLSKAKL---RRSQSDK--TDLTSEDYSKNSSHQAQQPTGTGSV  233

Query  602   CNGSMVNGGSMVNG-GSMVNYGSEVCSDVGPSASVVAAEIAQSWQASAAPRKEIMERGVG  426
               GS+ NGGS+V G GSMVN GS+  SDVGPSASVVAA IA+    +  P K       G
Sbjct  234   VTGSICNGGSVVKGNGSMVN-GSQCSSDVGPSASVVAAAIAKGLYKAPTPPK------TG  286

Query  425   DSMVLPANLTPeeakrrreaaeddeneeemeMIP------------KNAG--RRKPDN-G  291
                ++    T    +  ++     + E     +P            K+ G  RR+ D+ G
Sbjct  287   AGGLVTEEWTAAAKESDQQEVMKSKVERWRTELPPIYDNSKMSANSKHGGRPRRRTDSGG  346

Query  290   MYSCF--VYGFQFTIVCGANNNPPK  222
             ++SCF   +G + +I CG  N+  K
Sbjct  347   LFSCFGNAFGCEISITCGGGNSSKK  371



>ref|XP_004304780.1| PREDICTED: uncharacterized protein LOC101296310 [Fragaria vesca 
subsp. vesca]
Length=457

 Score =   188 bits (478),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 141/415 (34%), Positives = 200/415 (48%), Gaps = 82/415 (20%)
 Frame = -3

Query  1241  SCLSRPP--VGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTW  1068
             + + +PP    + +LEI LISAQDL   SKS+RT+A+ W NP RK TT +DQNG+ NPTW
Sbjct  28    TAMPKPPHMSSFQLLEINLISAQDLTAASKSMRTFAVAWVNPKRKLTTRVDQNGHTNPTW  87

Query  1067  NDKFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQI  888
             N+KF F+V ++FL  + S + +EIY  +W RDVLVGT ++ VSNL + S+   R VA+Q+
Sbjct  88    NEKFVFRVGEDFLKDDTSKIMIEIYASAWLRDVLVGTAAIVVSNLQNNSK--MRFVAIQL  145

Query  887   RRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDE  711
             RRPSG PQG+LN+   L +N  T RSMPL S+L ++A GY+  ++ +       +N    
Sbjct  146   RRPSGRPQGILNVGLGLLDN--TMRSMPLYSELSTSAVGYRDIMDAKSNKKSSNNNGSKM  203

Query  710   ERERLHAKILQWRRSMTPDM----------MSDVNGEEFPGK-PGSICNG-SMVNG----  579
             + ++LHA         T D           + +     +  K PGSIC G S+VNG    
Sbjct  204   D-DKLHALYRSQSERTTSDYGFSKSKPASSICNAGNNNYNKKAPGSICIGSSIVNGSEIS  262

Query  578   ---------------------------------------GSMVNGGSMVNYGSEVCSDVG  516
                                                    GSMVNG S+VN    +CSDVG
Sbjct  263   YATKDDTPKRDGTPKKGGTPKKGGTPKNGTKTINPPNGNGSMVNGSSIVN--GSLCSDVG  320

Query  515   PSASVVAAEIAQSW-----------QASAAPRKEIMERGVGDSMVLP-----ANLTPeea  384
             PS SVVAA IA+             Q+ ++   E  +    + +          L P   
Sbjct  321   PSPSVVAAAIAKGIYPLPHGASNTDQSGSSLMDEWADEDSVEGLKTKIERWRTELPPVYD  380

Query  383   krrreaaeddeneeemeMI-PKNAGRRKPDNGMYSCFVYGFQFTIVCGANNNPPK  222
              +            +  +I PK   R +    ++SCF  G + +I CG    P K
Sbjct  381   TKSSGQNLKLMPSSQRSIIRPKPKRRSRNRASLFSCFALGCEISISCGGKGKPKK  435



>ref|XP_003590980.1| hypothetical protein MTR_1g080360 [Medicago truncatula]
 gb|AES61231.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=375

 Score =   186 bits (471),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 114/253 (45%), Positives = 158/253 (62%), Gaps = 13/253 (5%)
 Frame = -3

Query  1226  PPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFK  1047
             PP  + +LEI +ISAQDL PVSKS++ YA+ W NP RK TT  D +G+ NPTWN+KF F+
Sbjct  6     PP--FQLLEINVISAQDLAPVSKSIKAYAVAWLNPERKLTTQADPHGHNNPTWNEKFVFR  63

Query  1046  VDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKG-TREVALQIRRPSGS  870
             VDD+FL SE+S + +EIY  +W RDVL+GTV+V+++NL+  + K   R VALQ+RRPSG 
Sbjct  64    VDDDFLLSEESVIMIEIYASAWLRDVLIGTVAVHLNNLLPRNRKSKIRFVALQVRRPSGR  123

Query  869   PQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERERLH  693
             PQG+LN+   + +   T RSMP+ S+L S+A  Y    +  K+N    +NS  + +   H
Sbjct  124   PQGILNIGVNVVD--ATMRSMPMYSELSSSAVEYYDITKPNKQNQNYDNNSNCDAK---H  178

Query  692   AKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNG--GSMVNYGSEVCSDV  519
                LQ  RS +    S +N   +     +   G   +  S+  G  G +VN    +CSDV
Sbjct  179   MMTLQ--RSQSEKNDSTINDYVYNPNGKNGYGGECESEISVPTGKKGVIVNANGSLCSDV  236

Query  518   GPSASVVAAEIAQ  480
             GPS SVVAA IA+
Sbjct  237   GPSPSVVAAAIAK  249



>ref|XP_006437469.1| hypothetical protein CICLE_v10033675mg [Citrus clementina]
 ref|XP_006484674.1| PREDICTED: haze protective factor 1-like [Citrus sinensis]
 gb|ESR50709.1| hypothetical protein CICLE_v10033675mg [Citrus clementina]
Length=393

 Score =   186 bits (471),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 142/385 (37%), Positives = 205/385 (53%), Gaps = 67/385 (17%)
 Frame = -3

Query  1226  PPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFK  1047
             PP    +LEI+++S  DL  VSKS++TY++ W +P RK TT +DQNG  NP+WN+KF F+
Sbjct  4     PP---RVLEISIVSGHDLALVSKSMKTYSVAWVDPERKLTTRVDQNGLNNPSWNEKFVFR  60

Query  1046  VDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP----SEKGTREVALQIRRP  879
             VDD FL  E S + +EIY  +W +D L+G+V V +S+L       S   TR VALQ+RRP
Sbjct  61    VDDRFLTDETSAIMIEIYAAAWLKDALIGSVRVLISHLFGTLTHNSSSSTRYVALQVRRP  120

Query  878   SGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILE-----YHNS--  720
             SG PQG+LN+  TL +N  T RSMPL   +  A     ++     ++++       NS  
Sbjct  121   SGRPQGILNLGITLLDN--TMRSMPLFAELCGAGANFSEVSSGANDVMKPETTTAQNSKQ  178

Query  719   --EDEERERL---------HAKILQWRRSMTPDMMSDVNGEEF----------PGKPGSI  603
               +D+E ER+          AK+   RRS +    +D+  E++          P   GS+
Sbjct  179   PKDDQELERVLKPKDNSLSKAKL---RRSQSDK--TDLTSEDYSKNSSHQAQQPTGTGSV  233

Query  602   CNGSMVNGGSMVNG-GSMVNYGSEVCSDVGPSASVVAAEIAQSWQASAAPRKEIMERGVG  426
               GS+ NGGS+V G GSMVN GS+  SDVGPSASVVAA IA+    +  P K       G
Sbjct  234   VTGSICNGGSVVKGSGSMVN-GSQCSSDVGPSASVVAAAIAKGLYKAPTPPK------TG  286

Query  425   DSMVLPANLTPeeakrrreaaeddeneeemeMIP------------KNAG--RRKPDN-G  291
                ++    T    +  ++     + E     +P            K+ G  RR+ D+ G
Sbjct  287   AGGLVTEEWTAAAKESDQQEVMKSKVERWRTELPPIYDNSKMSANSKHGGRPRRRTDSGG  346

Query  290   MYSCF--VYGFQFTIVCGANNNPPK  222
             ++SCF   +G + +I CG  N+  K
Sbjct  347   LFSCFGNAFGCEISITCGGGNSSKK  371



>ref|XP_002521996.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40400.1| conserved hypothetical protein [Ricinus communis]
Length=380

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 117/266 (44%), Positives = 156/266 (59%), Gaps = 51/266 (19%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +ISAQDL PVSKS+RTYA+VW +P RK TT +DQNG+ NP WN+KF F+VDD 
Sbjct  8     FQLLEINVISAQDLAPVSKSMRTYAVVWVHPERKLTTRVDQNGHTNPQWNEKFVFRVDDT  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGT--REVALQIRRPSGSPQ  864
             FL SE S++ +EIY  +W RDV +G+V V +SNL  SP+   +  R VALQIRRPSG PQ
Sbjct  68    FLNSETSSIMIEIYAAAWLRDVQIGSVRVLISNLFPSPTNNNSKMRFVALQIRRPSGRPQ  127

Query  863   GLLNMSATLQENTGTSRSMPL-SDLMSTASGYKK--DLELEKRNILEYHNSEDEERERLH  693
             G+LNM   L +N  T RSMPL ++L ++A G+    D +  K+ +       DE++ RL 
Sbjct  128   GILNMGVQLLDN--TMRSMPLYTELSASAVGFNDLIDAKTSKQTM-------DEKKGRL-  177

Query  692   AKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNG----------------  561
                   RR+ + D       +EF  K  +    S+VNGGS+VN                 
Sbjct  178   ------RRTQS-DHTDLTLTDEFGVKGSAPPRSSVVNGGSLVNSSLVRPRTSTGNEKDKN  230

Query  560   ----------GSMVNYGSEVCSDVGP  513
                       GSM+N    +CSDVGP
Sbjct  231   KDPCTADNGHGSMIN--GSLCSDVGP  254



>ref|XP_007132355.1| hypothetical protein PHAVU_011G087700g [Phaseolus vulgaris]
 gb|ESW04349.1| hypothetical protein PHAVU_011G087700g [Phaseolus vulgaris]
Length=385

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 122/353 (35%), Positives = 182/353 (52%), Gaps = 30/353 (8%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVSKS++ YA+ W +P RK TT I  +G+ NPTWN+KF F++D++
Sbjct  8     FQLLEVNIISAQDLAPVSKSIKAYAVAWLDPERKLTTQIHPDGHNNPTWNEKFVFRIDED  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGT---REVALQIRRPSGSPQ  864
             FL ++ S V +EIY  +W RD+LVGTV V +SNL+  S   T   R +ALQ+RRPSG PQ
Sbjct  68    FLYADDSVVMIEIYASTWLRDILVGTVGVLLSNLLPRSINRTSKIRFIALQVRRPSGHPQ  127

Query  863   GLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHAKI  684
             G+LN+   L +   T RSMP+   + +++    D + +K+  +  + +   E      K+
Sbjct  128   GILNIGVNLVDP--TRRSMPMYSELGSSTVGDWDADPKKQKPMP-NQTPSNEFNSAKCKL  184

Query  683   LQWRRSMTPDMMSDVNGEEFPGKPGSI-----CNGSMVNGGSMVNGGSMVNYGSEVCSDV  519
             L  +RS +    S +N   +   P        C GS + G      G ++N    +CSDV
Sbjct  185   LTLQRSASEKNDSTINDYTYKNYPKGYEDNEDCQGSEL-GMPTTKKGMIMNLNGSLCSDV  243

Query  518   GPSASVVAAEIAQSWQ--ASAAPRK--EIMERGVGDSMVLPANLTPeeak--------rr  375
             GPS SVVA  IA+        AP+K   ++  G       P  L  +  +          
Sbjct  244   GPSPSVVATAIAKGLYPFPMMAPQKTGNLVFEGWPGKEKGPEELNTKIDQWRSMERGGVA  303

Query  374   reaaeddeneeemeMIPKNAG----RRKPDNGMYSCF--VYGFQFTIVCGANN  234
                      +     +PK  G    R   + G++SCF    G +F+I CG  N
Sbjct  304   VYDHLGQNEKTGKHNVPKGKGQNQRRSGANGGLFSCFGTAMGCEFSITCGGGN  356



>ref|XP_007132356.1| hypothetical protein PHAVU_011G087800g [Phaseolus vulgaris]
 gb|ESW04350.1| hypothetical protein PHAVU_011G087800g [Phaseolus vulgaris]
Length=385

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 125/357 (35%), Positives = 185/357 (52%), Gaps = 30/357 (8%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVSKS++ YA+ W +P RK TT ID +G+ NPTWN+KF F++D++
Sbjct  8     FQLLEVNIISAQDLAPVSKSIKAYAVAWLDPERKLTTQIDPDGHNNPTWNEKFVFRIDED  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGT---REVALQIRRPSGSPQ  864
             FL ++ S V +EIY  +W RD+LVGTV V +SNL+  S   T   R +ALQ+RRPSG PQ
Sbjct  68    FLYADDSVVMIEIYASTWLRDILVGTVGVLLSNLLPRSINRTSKIRFIALQVRRPSGHPQ  127

Query  863   GLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHAKI  684
             G+LN+   L +   T RSMP+   + +++    D + +K+  +  + +   E    + K+
Sbjct  128   GILNIGVNLVDP--TRRSMPMYSELGSSTVGDWDADPKKQKPMS-NQTPSNEFNSANCKL  184

Query  683   LQWRRSMTPDMMSDVNGEEFPGKPGSI-----CNGSMVNGGSMVNGGSMVNYGSEVCSDV  519
             L  +RS +    S +N   +   P        C GS + G      G ++N    +CSDV
Sbjct  185   LTLQRSASEKNDSTINDYTYNNYPKGYEDNEDCQGSEL-GMPTTKKGMVMNLNGSLCSDV  243

Query  518   GPSASVVAAEIAQSWQ--ASAAPRK--EIMERGVGDSMVLPANLTPeeakrrreaaedde  351
             GPS SVVA  IA+        APRK   ++  G       P  L  +  + R        
Sbjct  244   GPSPSVVATAIAKGLYPFPMMAPRKTGNLVFEGWPGKEKGPEELNTKIDRWRSMERGGVA  303

Query  350   neeemeMIPK------------NAGRRKPDNGMYSCF--VYGFQFTIVCGANNNPPK  222
               + +    K            N  R   + G++SCF    G +F+I CG  N   K
Sbjct  304   VYDHLGQNEKTGKHNVLKGKGQNQRRGGANGGLFSCFGTAMGCEFSITCGGGNRSRK  360



>ref|XP_006577748.1| PREDICTED: uncharacterized protein LOC102667983 [Glycine max]
Length=373

 Score =   180 bits (457),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 131/348 (38%), Positives = 183/348 (53%), Gaps = 31/348 (9%)
 Frame = -3

Query  1226  PPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFK  1047
             PP  Y +LEI +ISAQDL  VSKS+R YA+ W +P RK  T +DQ G+ NPTWN+KF F+
Sbjct  6     PP--YQLLEINVISAQDLAQVSKSVRGYAVAWLHPERKLATQVDQEGHTNPTWNEKFVFR  63

Query  1046  VDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK-GTREVALQIRRPSGS  870
             VDD FL S+ S + +EIY+ +W R VL+GTV+V ++NL+ P+ K   R VALQIRRPSG 
Sbjct  64    VDDSFLNSDNSVIMIEIYSHAWLRHVLIGTVAVQLTNLLPPNRKPKLRFVALQIRRPSGR  123

Query  869   PQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERER--  699
             PQG+LN+   L ++  T RSMPL S+L S+  GY   +E  K+      + ++       
Sbjct  124   PQGILNIGVNLLDS--TMRSMPLYSELSSSTVGYWDIMESSKKKKKSEEDDDNTHHHHSP  181

Query  698   LHAKILQWRRSMTPDMMSDVNGEEFPGKPGSI-CNGSMVNGGSMVNGGSMVNYGSEVCSD  522
             L + +L  +R  +    S VN   + G       +G   + G  +  G++ N GS + SD
Sbjct  182   LDSSLLTLQRCQSEKNDSTVNDYAYHGNAKHYGYDGQDSDVG--MRKGAVFNEGS-LISD  238

Query  521   VGPSASVVAAEIAQSWQASAAPRKEIMERGVGDSMVLPA--------------NLTPeea  384
             VGPS SVVAA IA+       P    +E    D     +               LTP   
Sbjct  239   VGPSPSVVAAAIAKGLYPMPPPAPRTVESSTMDGWSENSGTEGMKTKIERWRNELTPAYE  298

Query  383   krrreaaeddeneeemeMIPKNAGRRKPDNGMYSCF--VYGFQFTIVC  246
                 E     +  + +   P+   RR    G  SCF  V+G + +I C
Sbjct  299   DYVDERKVLRQTSKRVGRTPR---RRGQGGGPCSCFGSVFGVEISITC  343



>gb|KHN31488.1| hypothetical protein glysoja_035595, partial [Glycine soja]
Length=241

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 151/246 (61%), Gaps = 10/246 (4%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEFL  1029
             +LEI +ISAQDL  VSKS+R YA+ W +P RK  T +DQ G+ NPTWN+KF F+VDD FL
Sbjct  1     LLEINVISAQDLAQVSKSVRGYAVAWLHPERKLATQVDQEGHTNPTWNEKFVFRVDDSFL  60

Query  1028  ASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK-GTREVALQIRRPSGSPQGLLN  852
              S+ S + +EIY+ +W R VL+GTV+V ++NL+ P+ K   R VALQIRRPSG PQG+LN
Sbjct  61    NSDNSVIMIEIYSHAWLRHVLIGTVAVQLTNLLPPNRKPKLRFVALQIRRPSGRPQGILN  120

Query  851   MSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERER--LHAKIL  681
             +   L ++  T RSMPL S+L S+  GY   +E  K+      + ++       L + +L
Sbjct  121   IGVNLLDS--TMRSMPLYSELSSSTVGYWDIMESSKKKKKSEEDDDNTHHHHSPLDSSLL  178

Query  680   QWRRSMTPDMMSDVNGEEFPGKPGSI-CNGSMVNGGSMVNGGSMVNYGSEVCSDVGPSAS  504
               +R  +    S VN   + G       +G   + G  +  G++ N GS + SDVGPS S
Sbjct  179   TLQRCQSEKNDSTVNDYAYHGNAKHYGYDGQDSDVG--MRKGAVFNEGS-LISDVGPSPS  235

Query  503   VVAAEI  486
             VVAA I
Sbjct  236   VVAAAI  241



>gb|KEH24577.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=389

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 135/361 (37%), Positives = 192/361 (53%), Gaps = 33/361 (9%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             Y +LEI +ISAQDL  V+KS++ YA+ W +P RK  T IDQ G+ NPTWN+KF F+VD+E
Sbjct  10    YQLLEINIISAQDLSGVAKSVKAYAVAWLHPERKLATQIDQVGHTNPTWNEKFVFRVDNE  69

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGTRE-----VALQIRRPSG  873
             FL SE S + +EIY  +W RD+L+GTV V V+NL+ + +  G R+     V LQIRRPSG
Sbjct  70    FLNSESSVIMIEIYNSAWLRDILIGTVVVLVNNLLPTVTLSGNRKPKLRFVGLQIRRPSG  129

Query  872   SPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGY--KKDLELEKRNILEYHNSEDEERE  702
              PQG+LN+  TL ++  T RSMPL S+L ++A GY    D    KR +   +N  +    
Sbjct  130   RPQGILNIGVTLLDS--TMRSMPLYSELSTSAVGYWDMMDSNSNKRKVNNNYNDNNSIVT  187

Query  701   RLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEVCSD  522
                  +L  +R  +    S +N   + G   +  NG   +  SM       N  S +CSD
Sbjct  188   DDSKMMLTLQRCQSEKNDSTINDYTYHGAGKNNYNGYEESEASMPLPRKRGNEES-LCSD  246

Query  521   VGPSASVVAAEIAQSWQASAAPRKEIMERGVG-----------DSMV--LPANLTPeeak  381
             VGPS SVVAA IA+       P +++    VG           D+ +      LTP   +
Sbjct  247   VGPSPSVVAAAIAKGLYLMPPPSRKVKSSAVGGWSESNYTEGMDTKIERWRNELTPAYDE  306

Query  380   rrreaaed-deneeemeMIPKNAGRR--KP---DNGMYSCF--VYGFQFTIVCGANNNPP  225
                E  E+  +     +  PK +G+   +P      + SCF  ++G +F+I CG   N  
Sbjct  307   EFEELDEEIKKRMVVAKKTPKRSGKTPGRPMSKKGKLCSCFGTMFGCEFSITCGGGGNNK  366

Query  224   K  222
             K
Sbjct  367   K  367



>ref|XP_007147205.1| hypothetical protein PHAVU_006G104400g [Phaseolus vulgaris]
 gb|ESW19199.1| hypothetical protein PHAVU_006G104400g [Phaseolus vulgaris]
Length=371

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 111/267 (42%), Positives = 155/267 (58%), Gaps = 26/267 (10%)
 Frame = -3

Query  1217  GYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
             GY +LEI ++SAQDLP VSK +R YA+ W +P+RK TT +DQ G+ NPTWN+KF F+VDD
Sbjct  6     GYQLLEINVMSAQDLPRVSKPVRAYAVGWLHPDRKLTTQVDQEGHTNPTWNEKFVFRVDD  65

Query  1037  EFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK-GTREVALQIRRPSGSPQG  861
             +FL S+ + +T+EIYT +W   VL+GTV + VS+L+  + K   R VA+QIRRPSG  QG
Sbjct  66    QFLDSDDAVITIEIYTQAWLSPVLIGTVGILVSDLLPTNRKPKLRFVAVQIRRPSGRTQG  125

Query  860   LLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHA--  690
             +LN+  TL ++  T RSMPL SDL S+  GY    E  K      H   +E+RE  H+  
Sbjct  126   ILNIGVTLLDS--TMRSMPLYSDLSSSDGGYYDPTESRKNK----HAVTEEDREE-HSPS  178

Query  689   ---KILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSM-----VNGGSMVNGGSMVNYGSE  534
                 +L  +R  +    S ++   + G               V  G + NG S++     
Sbjct  179   DTTSLLTLQRYQSEKNDSTIDDYAYHGNAKRYFYDEQDSEVGVRKGGVFNGDSLI-----  233

Query  533   VCSDVGPSASVVAAEIAQSWQASAAPR  453
               SDVGPS S+VA+ I++       PR
Sbjct  234   --SDVGPSPSMVASAISKGLYPMPPPR  258



>ref|XP_004234051.1| PREDICTED: uncharacterized protein LOC101265801 [Solanum lycopersicum]
Length=485

 Score =   180 bits (456),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 116/173 (67%), Gaps = 10/173 (6%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +ISAQDL P+SK L+TYA  W +P RK  T +D NG  NPTWNDKF F+VD+E
Sbjct  15    FQLLEINIISAQDLEPMSKKLKTYAAAWVHPTRKLATGVDVNGGHNPTWNDKFVFRVDEE  74

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP-------SEKGTREVALQIRRPS  876
             FL  E S V +EIY+V WFRD LVGTV V V NLI P          G R VALQIRRPS
Sbjct  75    FLRHENSAVHIEIYSVHWFRDSLVGTVRVLVGNLIPPIRTHLRTHHHGMRFVALQIRRPS  134

Query  875   GSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNSE  717
             G PQG+LN+  +L ++  + RSMPL   MST++   +DL +E RN    HN+E
Sbjct  135   GRPQGILNIGVSLLDS--SMRSMPLYRQMSTSAVAYRDL-MEDRNTPHTHNNE  184



>ref|XP_002325345.1| hypothetical protein POPTR_0019s03780g [Populus trichocarpa]
 gb|EEE99726.1| hypothetical protein POPTR_0019s03780g [Populus trichocarpa]
Length=364

 Score =   176 bits (447),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 134/355 (38%), Positives = 192/355 (54%), Gaps = 40/355 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +IS QDL PVSKS+RTYA+ W +P RK +T +DQNG+ NP WN+KF F+VDD 
Sbjct  8     FQLLEINVISGQDLAPVSKSMRTYAVAWVHPGRKLSTKVDQNGHINPQWNEKFVFRVDDT  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGT---REVALQIRRPSGSPQ  864
             F+ +E S++ +EIY  +W RDV +G+V V +SNL  PS       R VALQ+RRPSG PQ
Sbjct  68    FINAENSSIMIEIYAAAWLRDVQIGSVRVLISNLF-PSNNNNNKMRFVALQVRRPSGRPQ  126

Query  863   GLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHAK  687
             G+LNM   + ++  T RSMPL ++L ++A G+         N L    +  ++ E   AK
Sbjct  127   GILNMGVQVLDS--TMRSMPLYTELSASAVGF---------NDLINAKTNGKDLEEKGAK  175

Query  686   ILQWRRSMTPDMMSDVNGEEFPGKP---GSICNGSMVNGGSMVNG---GSMVNYGSEVCS  525
             + + +   T    +D +G +  G     GS+ N S+       NG   GSMVN    +CS
Sbjct  176   LRRTQSDRTDHTTTDESGLKEGGVRSLGGSLINSSVAKPSVKDNGNGNGSMVN--GSLCS  233

Query  524   DVGPSASVVAAEIAQSWQASAAPRKEIMERGVGDSMV-----------LPANLTPeeakr  378
             DVGPSASVVAA IA+    + A   +    G G S++           L   L     + 
Sbjct  234   DVGPSASVVAAAIAKGLIKTPANAGQQDTDGAGSSILEDWTENDSAEGLRTKLERWRTEL  293

Query  377   rreaaeddeneeemeMIPKNAGRRKPDNG-MYSCF--VYGFQFTIVCGANNNPPK  222
                   D    +      K+  RR+ + G ++SCF   +G + +I CG  NN  +
Sbjct  294   PPVYDNDLRKMQSRSRNKKH--RRRSEGGRLFSCFGNAFGCEISITCGGRNNKKR  346



>ref|XP_011036375.1| PREDICTED: uncharacterized protein LOC105133911 [Populus euphratica]
Length=382

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 136/363 (37%), Positives = 195/363 (54%), Gaps = 40/363 (11%)
 Frame = -3

Query  1238  CLSRPPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDK  1059
             CL++      +LEI +IS QDL PVSKS+RTYA+ W +P RK +T +DQNG+ NP WN+K
Sbjct  18    CLTQVVARLPLLEINVISGQDLAPVSKSMRTYAVAWVHPGRKLSTKVDQNGHINPQWNEK  77

Query  1058  FSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGT---REVALQI  888
             F F+VDD F+ +E S++ +EIY  +W RDV +G+V V +SNL  PS       R VALQ+
Sbjct  78    FVFRVDDTFINAENSSIMIEIYAAAWLRDVQIGSVRVLISNLF-PSNNNNNKMRFVALQV  136

Query  887   RRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDE  711
             RRPSG PQG+LNM   + ++  T RSMPL ++L ++A G+         N L    +  +
Sbjct  137   RRPSGRPQGILNMGVQVLDS--TMRSMPLYTELSASAVGF---------NDLINAKTNGK  185

Query  710   ERERLHAKILQWRRSMTPDMMSDVNGEEFPG---KPGSICNGSMVNGGSMVNG---GSMV  549
             + E   AK+ + +   T    +D +G +  G     GS+ N S+       NG   GSMV
Sbjct  186   DLEEKGAKLRRTQSDRTDLTTTDESGLKEGGVRSLGGSLINSSVAKPSVKDNGNGNGSMV  245

Query  548   NYGSEVCSDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGDSMV-----------LPAN  402
             N    +CSDVGPSASVVAA IA+    + A   +    G G S++           L   
Sbjct  246   N--GSLCSDVGPSASVVAAAIAKGLIKTPANAGQHDTDGAGSSILEDWTENDSAEGLRTK  303

Query  401   LTPeeakrrreaaeddeneeemeMIPKNAGRRKPDNG-MYSCF--VYGFQFTIVCGANNN  231
             L     +       D    +      K+  RR+ + G ++SCF   +G + +I CG  NN
Sbjct  304   LERWRTELPPVYDNDLRKMQSRSRNKKH--RRRSEGGRLFSCFGNAFGCEISITCGGRNN  361

Query  230   PPK  222
               +
Sbjct  362   KKR  364



>gb|KCW57324.1| hypothetical protein EUGRSUZ_H00123 [Eucalyptus grandis]
Length=462

 Score =   174 bits (442),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 107/269 (40%), Positives = 153/269 (57%), Gaps = 37/269 (14%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL  VS+S+R+YA+VW +P+RK +T +D  G  NPTWNDKF F+VD+E
Sbjct  9     FQLLEVNIISAQDLRSVSRSMRSYAVVWVHPDRKLSTRVDTRGRRNPTWNDKFVFRVDEE  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK--------GTREVALQIRRP  879
             FL  + S V +EIY V WFRDVLVGT+ + VSNL+ P  +        G R VALQ+RRP
Sbjct  69    FLRCDTSAVMIEIYAVHWFRDVLVGTIRLLVSNLLPPPSRPFRHQRHIGMRFVALQVRRP  128

Query  878   SGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDE---  711
             SG PQG+LN+   L ++  + RSMPL + L ++A G+ +DL L+++  +  HN++ +   
Sbjct  129   SGRPQGILNVGVALLDS--SMRSMPLYTQLSASAVGF-QDL-LQRQEYVSEHNTQIQNPP  184

Query  710   ------------------ERERLHAKILQWRRSMTPDMMSDVNGE-EFPGKPGSICNGSM  588
                               E+  L            P     +N +  F  KP SI N SM
Sbjct  185   PQHQKQKQQQQMQMSTFVEKPELRRTKSDTSSMQGPRQARTLNRKVSFREKPNSIINASM  244

Query  587   VNGGSMVNGGSMVNYGSEVCSDVGPSASV  501
             VNG ++  G S+    S   S V   ++V
Sbjct  245   VNGSAL--GHSIFKGKSSKASSVANGSAV  271



>ref|XP_011073723.1| PREDICTED: uncharacterized protein LOC105158612 [Sesamum indicum]
Length=505

 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 120/189 (63%), Gaps = 12/189 (6%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +IS QDL PV++ +RTYA  W +PNRK ++C+D+ GN NPTWNDKF F+V++E
Sbjct  8     FQLLEINIISGQDLEPVARKMRTYAKAWVHPNRKLSSCVDKEGNNNPTWNDKFVFRVEEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------GTREVALQIRR  882
             FL  + S V +EIY+  W RDVLVGTV V V NLI P  +         G R VALQ+RR
Sbjct  68    FLREDSSAVMIEIYSAHWLRDVLVGTVRVLVGNLIPPPVRTHQNNSHYMGMRFVALQVRR  127

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEER  705
             PSG PQG+LN+   L +  G+ RSMPL   L S+A GY+  ++    ++    N     +
Sbjct  128   PSGRPQGILNIGVALLD--GSLRSMPLYRQLSSSAVGYRDLMQHPPVHLQVQENDTKNNK  185

Query  704   ERLHAKILQ  678
             E+  A  L+
Sbjct  186   EQQQAPALK  194



>ref|XP_007035276.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
 gb|EOY06202.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
Length=480

 Score =   173 bits (439),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 110/246 (45%), Positives = 148/246 (60%), Gaps = 22/246 (9%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSK-SLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
             + +LE+ +ISAQDL PVS+  +RTYA+ W +P RK +T ID  G+ NPTWNDKF F+VDD
Sbjct  10    FQLLELNVISAQDLEPVSRRKMRTYAVAWVHPQRKLSTRIDNLGHTNPTWNDKFVFRVDD  69

Query  1037  EFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPS----------EKGTREVALQI  888
             EFL  + S V +E+Y V WFRD+ VGTV V V NLISP           + G R VALQ+
Sbjct  70    EFLHGDTSAVMIELYAVHWFRDIHVGTVRVIVGNLISPPTSRPRHRHEVQIGMRFVALQV  129

Query  887   RRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH-----  726
              RPSG PQG+LN+   L ++  + RSMPL   M S+A GY+  +  E ++    +     
Sbjct  130   WRPSGRPQGILNIGVALLDS--SMRSMPLYMQMGSSAVGYRHLMGEEIQSSNNNNNNNPS  187

Query  725   -NSEDEERERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMV  549
               S+    + L   +++     T    S +   +   K  SI  GS+VNGGSMVNGGS+V
Sbjct  188   ITSKSNNPQLLLNGLIKPMLRRTKSDSSSMFSSDLKSKR-SIKGGSVVNGGSMVNGGSIV  246

Query  548   NYGSEV  531
             N GSE+
Sbjct  247   N-GSEI  251



>ref|XP_006356117.1| PREDICTED: uncharacterized protein LOC102592369 [Solanum tuberosum]
Length=482

 Score =   173 bits (438),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 115/173 (66%), Gaps = 10/173 (6%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +ISAQDL P+SK ++TYA  W +P RK  T +D  G  NPTWNDKF F+VDDE
Sbjct  15    FQLLEINIISAQDLEPMSKKMKTYAAAWVHPTRKLATGVDVEGGHNPTWNDKFVFRVDDE  74

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP-------SEKGTREVALQIRRPS  876
             FL  + S V +EIY+V WFRD LVGTV V V NLI P          G R +ALQ+RRPS
Sbjct  75    FLRHDNSAVHIEIYSVHWFRDTLVGTVRVLVGNLIPPIRTHLRTHHHGMRFIALQVRRPS  134

Query  875   GSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNSE  717
             G PQG+LN+  +L ++  + RSMPL   MST++   +DL +E RN    H++E
Sbjct  135   GRPQGILNIGVSLLDS--SMRSMPLYRQMSTSAVAYRDL-MEDRNSHPPHSNE  184



>ref|XP_008224037.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103323799 
[Prunus mume]
Length=516

 Score =   172 bits (436),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 137/226 (61%), Gaps = 17/226 (8%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL P+S+S+RTYA+ W +P+RK +T +D  G++NPTWNDKF F+VD++
Sbjct  9     FQLLELNVISAQDLAPISRSMRTYAIAWVHPDRKLSTRVDTQGHSNPTWNDKFVFRVDED  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK--------GTREVALQIRRP  879
             FL  + S V +EIY + WF+DV VGTV V V NLI    K        G R VALQ+RRP
Sbjct  69    FLHEDTSAVMIEIYALHWFKDVHVGTVRVLVGNLIPTPAKPHHHNPQLGMRFVALQVRRP  128

Query  878   SGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERE  702
             SG PQG+LN+   L  +  + RSMPL S L ++A GYK  +  E  +    ++    +  
Sbjct  129   SGRPQGILNIGVALLHS--SMRSMPLYSQLSTSAVGYKTLMGEEDPHRSSQNHHAGSQMT  186

Query  701   RLHAKILQWRRSMTPDMM-SDVNGEEFP-----GKPGSICNGSMVN  582
                   L+  +S +  M  SD+   EF      GK GS+ NGS V+
Sbjct  187   TYSKPELRRSKSDSSSMFGSDLRATEFKNKGKNGKAGSMLNGSEVS  232



>gb|KCW85316.1| hypothetical protein EUGRSUZ_B02156 [Eucalyptus grandis]
Length=352

 Score =   168 bits (426),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 188/351 (54%), Gaps = 45/351 (13%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              +LE+ LISAQDL PVSKS+RTYA+ W +P+RK TT +D+ G+ANP WN+KF F+V+D  
Sbjct  9     RLLELNLISAQDLAPVSKSMRTYAVAWVHPDRKLTTRVDEKGHANPNWNEKFVFRVNDVS  68

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKG------TREVALQIRRPSGS  870
             L ++   +T+EIY ++W R VLVGTV   +S+LI PS +        R + LQ+ RPSG 
Sbjct  69    LETDTCVITIEIYALTWLRVVLVGTVRALLSSLIPPSTRTRTKNTPMRFMTLQVLRPSGR  128

Query  869   PQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKR-NILEYHNSEDEERERLH  693
             PQG +N   +L  +  + RSMPL+  +S +  +    E +++ N  E  N  ++  ++  
Sbjct  129   PQGAINFGVSLINS--SMRSMPLNSELSASLAFDSGEEADQKDNKKEPGNDGNKNSQKDA  186

Query  692   AKILQWRRSMTPDMMSDVNGEEFPGKPGS-ICNGSMVNGGSMVNGGSMVNYGSEVCSDVG  516
              KI  WR              ++   PGS +CN SMV G     GGS++  GS V SDVG
Sbjct  187   TKIRLWRSQSE-------RTNDYSYNPGSTVCNDSMV-GFKQTKGGSLL--GSMV-SDVG  235

Query  515   PSASVVAAEIAQSWQASAAPRKEIMERGVGDSMVLPANLTPeeakrrreaaedd------  354
             PSAS+VAA IA   +    P K   E   G+S +L  N T  ++        +       
Sbjct  236   PSASIVAAAIA---KGLLPPNKNYREE--GESSILLDNWTENDSSEGLRTKIERWRTELP  290

Query  353   ------eneeemeMIPKNAGRRKP-----DNGMYSCF--VYGFQFTIVCGA  240
                    N ++      N GR +P       G++SCF   YG +F+I CG 
Sbjct  291   PIHNRGGNGKKNAKTGANQGRDRPRRHSDGGGLFSCFGNAYGCEFSISCGG  341



>ref|XP_010043310.1| PREDICTED: uncharacterized protein LOC104432551 [Eucalyptus grandis]
Length=355

 Score =   168 bits (425),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 188/351 (54%), Gaps = 45/351 (13%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              +LE+ LISAQDL PVSKS+RTYA+ W +P+RK TT +D+ G+ANP WN+KF F+V+D  
Sbjct  9     RLLELNLISAQDLAPVSKSMRTYAVAWVHPDRKLTTRVDEKGHANPNWNEKFVFRVNDVS  68

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKG------TREVALQIRRPSGS  870
             L ++   +T+EIY ++W R VLVGTV   +S+LI PS +        R + LQ+ RPSG 
Sbjct  69    LETDTCVITIEIYALTWLRVVLVGTVRALLSSLIPPSTRTRTKNTPMRFMTLQVLRPSGR  128

Query  869   PQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKR-NILEYHNSEDEERERLH  693
             PQG +N   +L  +  + RSMPL+  +S +  +    E +++ N  E  N  ++  ++  
Sbjct  129   PQGAINFGVSLINS--SMRSMPLNSELSASLAFDSGEEADQKDNKKEPGNDGNKNSQKDA  186

Query  692   AKILQWRRSMTPDMMSDVNGEEFPGKPGS-ICNGSMVNGGSMVNGGSMVNYGSEVCSDVG  516
              KI  WR              ++   PGS +CN SMV G     GGS++  GS V SDVG
Sbjct  187   TKIRLWRSQSE-------RTNDYSYNPGSTVCNDSMV-GFKQTKGGSLL--GSMV-SDVG  235

Query  515   PSASVVAAEIAQSWQASAAPRKEIMERGVGDSMVLPANLTPeeakrrreaaedd------  354
             PSAS+VAA IA   +    P K   E   G+S +L  N T  ++        +       
Sbjct  236   PSASIVAAAIA---KGLLPPNKNYREE--GESSILLDNWTENDSSEGLRTKIERWRTELP  290

Query  353   ------eneeemeMIPKNAGRRKP-----DNGMYSCF--VYGFQFTIVCGA  240
                    N ++      N GR +P       G++SCF   YG +F+I CG 
Sbjct  291   PIHNRGGNGKKNAKTGANQGRDRPRRHSDGGGLFSCFGNAYGCEFSISCGG  341



>ref|XP_010025827.1| PREDICTED: uncharacterized protein LOC104416087 [Eucalyptus grandis]
Length=481

 Score =   171 bits (432),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 123/175 (70%), Gaps = 13/175 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL  VS+S+R+YA+VW +P+RK +T +D  G  NPTWNDKF F+VD+E
Sbjct  9     FQLLEVNIISAQDLRSVSRSMRSYAVVWVHPDRKLSTRVDTRGRRNPTWNDKFVFRVDEE  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK--------GTREVALQIRRP  879
             FL  + S V +EIY V WFRDVLVGT+ + VSNL+ P  +        G R VALQ+RRP
Sbjct  69    FLRCDTSAVMIEIYAVHWFRDVLVGTIRLLVSNLLPPPSRPFRHQRHIGMRFVALQVRRP  128

Query  878   SGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSE  717
             SG PQG+LN+   L ++  + RSMPL + L ++A G+ +DL L+++  +  HN++
Sbjct  129   SGRPQGILNVGVALLDS--SMRSMPLYTQLSASAVGF-QDL-LQRQEYVSEHNTQ  179



>ref|XP_004173200.1| PREDICTED: uncharacterized LOC101215059 [Cucumis sativus]
Length=533

 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 141/228 (62%), Gaps = 19/228 (8%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+S+RTYA+ W +P+RK +T +D +G+ NPTWNDKF F+VDDE
Sbjct  7     FQLLELNVISAQDLAPVSRSMRTYAVAWVHPDRKLSTRVDTHGHNNPTWNDKFVFRVDDE  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI----------SPSEKGTREVALQIR  885
             FL S+ S V +EIY + WF+D+ VGTV + V NLI             + G R VALQ+R
Sbjct  67    FLHSDTSAVMIEIYALHWFKDIHVGTVRILVGNLIPTPPRLHQFSQQPQVGMRFVALQVR  126

Query  884   RPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEE  708
             RPSG PQG+LN+   L  +  + RSMPL S L ++A GY ++L  E+     +H++ + +
Sbjct  127   RPSGRPQGILNIGVALLHS--SMRSMPLYSQLSTSAIGY-RNLMGEEDPFANHHSNTNNQ  183

Query  707   RER----LHAKILQWRRSMTPDMM-SDVNGEEFPGKPGSICNGSMVNG  579
                    L    ++  +S T  M+ S++ G E  GK       SMVNG
Sbjct  184   SHGTPTVLTRPEMRRSKSDTSSMIGSELRGSEMMGKGMKSKASSMVNG  231



>ref|XP_009795412.1| PREDICTED: uncharacterized protein LOC104242110 [Nicotiana sylvestris]
Length=545

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 122/190 (64%), Gaps = 16/190 (8%)
 Frame = -3

Query  1226  PPVG-----YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWND  1062
             PP G     + +LE+ +ISAQDL PVSK ++TYA  W +P RK TT +D  G  NPTWND
Sbjct  2     PPKGGVLKPFQLLEVNIISAQDLEPVSKRMKTYATAWVHPTRKLTTGVDTEGGNNPTWND  61

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK-------GTRE  903
             KF F+VD+EFL  + S V ++IY+V WFRD LVG+V V V NLI P  +       G R 
Sbjct  62    KFVFRVDEEFLRQDTSAVQIDIYSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQHHIGMRF  121

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLMS-TASGYKKDLELEKRNILEYH  726
             VALQIRRPSG PQG+LN+  TL    GT RSMPL   +S +A GY +DL  E  ++  Y+
Sbjct  122   VALQIRRPSGRPQGILNIGVTLL--GGTMRSMPLYRQLSMSAVGY-RDLMEEDAHLPNYN  178

Query  725   NSEDEERERL  696
                + + +++
Sbjct  179   EKIETQNDKV  188



>ref|XP_008460692.1| PREDICTED: uncharacterized protein LOC103499460 [Cucumis melo]
Length=561

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 140/229 (61%), Gaps = 21/229 (9%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+S+RTYA+ W +P+RK +T +D +G+ NPTWNDKF F+VDDE
Sbjct  7     FQLLELNVISAQDLAPVSRSMRTYAVAWVHPDRKLSTRVDTHGHNNPTWNDKFVFRVDDE  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI----------SPSEKGTREVALQIR  885
             FL S+ S V +EIY + WF+D+ VGTV + V NLI             + G R VALQ+R
Sbjct  67    FLHSDTSAVMIEIYALHWFKDIHVGTVRILVGNLIPTPPRLHQFSQQPQVGMRFVALQVR  126

Query  884   RPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEE  708
             RPSG PQG+LN+   L  +  + RSMPL S L ++A GY+  +  E  +    H+S +  
Sbjct  127   RPSGRPQGILNIGVALLHS--SMRSMPLYSQLSTSAIGYRNLMGEE--DPFATHHSTNNN  182

Query  707   RERLHAKIL---QWRRSM--TPDMM-SDVNGEEFPGKPGSICNGSMVNG  579
             +      +L   + RRS   T  M+ S++ G E  GK       SMVNG
Sbjct  183   QSHGTPTVLTRPEMRRSKSDTSSMIGSELRGSEMMGKGLKSKASSMVNG  231



>ref|XP_004147189.1| PREDICTED: uncharacterized protein LOC101215059 [Cucumis sativus]
 gb|KGN61560.1| hypothetical protein Csa_2G171820 [Cucumis sativus]
Length=561

 Score =   171 bits (432),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 141/228 (62%), Gaps = 19/228 (8%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+S+RTYA+ W +P+RK +T +D +G+ NPTWNDKF F+VDDE
Sbjct  7     FQLLELNVISAQDLAPVSRSMRTYAVAWVHPDRKLSTRVDTHGHNNPTWNDKFVFRVDDE  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI----------SPSEKGTREVALQIR  885
             FL S+ S V +EIY + WF+D+ VGTV + V NLI             + G R VALQ+R
Sbjct  67    FLHSDTSAVMIEIYALHWFKDIHVGTVRILVGNLIPTPPRLHQFSQQPQVGMRFVALQVR  126

Query  884   RPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEE  708
             RPSG PQG+LN+   L  +  + RSMPL S L ++A GY ++L  E+     +H++ + +
Sbjct  127   RPSGRPQGILNIGVALLHS--SMRSMPLYSQLSTSAIGY-RNLMGEEDPFANHHSNTNNQ  183

Query  707   RER----LHAKILQWRRSMTPDMM-SDVNGEEFPGKPGSICNGSMVNG  579
                    L    ++  +S T  M+ S++ G E  GK       SMVNG
Sbjct  184   SHGTPTVLTRPEMRRSKSDTSSMIGSELRGSEMMGKGMKSKASSMVNG  231



>ref|XP_009604695.1| PREDICTED: uncharacterized protein LOC104099416 [Nicotiana tomentosiformis]
Length=545

 Score =   170 bits (431),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 114/171 (67%), Gaps = 11/171 (6%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVSK ++TYA  W +P RK TT +D  G  NPTWNDKF F+VD+E
Sbjct  11    FQLLEVNIISAQDLEPVSKKMKTYATAWVHPTRKLTTGVDTEGGNNPTWNDKFVFRVDEE  70

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK-------GTREVALQIRRPS  876
             FL  + S V ++IY+V WFRD LVG+V V V NLI P  +       G R VALQIRRPS
Sbjct  71    FLRQDTSAVQIDIYSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQHHIGMRFVALQIRRPS  130

Query  875   GSPQGLLNMSATLQENTGTSRSMPLSDLMS-TASGYKKDLELEKRNILEYH  726
             G PQG+LN+  TL    GT RSMPL   +S +A GY +DL  E  ++  Y+
Sbjct  131   GRPQGILNIGVTLL--GGTMRSMPLYRQLSMSAVGY-RDLMEEDAHLPNYN  178



>ref|XP_011038591.1| PREDICTED: uncharacterized protein LOC105135426 [Populus euphratica]
Length=367

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 102/255 (40%), Positives = 150/255 (59%), Gaps = 41/255 (16%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +IS QDL PVSKS+RTYA+VW +P RK +T +DQNG+ NP WN+KF F+VD+ 
Sbjct  8     FQLLEINVISGQDLAPVSKSMRTYAIVWVHPGRKLSTKVDQNGHTNPQWNEKFVFRVDEI  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTRE---VALQIRRPSGSPQ  864
             F+ +E S++ +E+Y  +W RDV +G+V+V +SNL  PS     +   VALQ+RRPSG PQ
Sbjct  68    FINAENSSIMIEVYAAAWLRDVQIGSVNVLISNLF-PSHNNNNKMHFVALQVRRPSGRPQ  126

Query  863   GLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHAK  687
             G+LN+   L +   T RSMPL ++L  +A+G+  D  ++ + I        +  E   AK
Sbjct  127   GILNLGVQLLDT--TMRSMPLYTELSVSAAGF--DDLIDAKTI-------GQSLEEKSAK  175

Query  686   ILQWRRSMTPDMMSDVNGEEFPGKP---GSICNGSMVN--------------GGSMVNGG  558
             + + +   T   +SD +G +  G     GS+ N S+V                GS++NG 
Sbjct  176   LRRTQSDQTDQTISDKSGVKESGVRSLGGSLINSSVVKRDNGNGNGNGNGNGNGSLING-  234

Query  557   SMVNYGSEVCSDVGP  513
                     +CSDVGP
Sbjct  235   -------SLCSDVGP  242



>ref|XP_002319115.2| hypothetical protein POPTR_0013s04590g, partial [Populus trichocarpa]
 gb|EEE95038.2| hypothetical protein POPTR_0013s04590g, partial [Populus trichocarpa]
Length=383

 Score =   167 bits (422),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 99/238 (42%), Positives = 142/238 (60%), Gaps = 37/238 (16%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +IS QDL PVSKS+RTYA+VW +P RK +T +DQNG+ NP WN+KF F+VDD 
Sbjct  8     FQLLEINVISGQDLAPVSKSMRTYAIVWVHPGRKLSTKVDQNGHTNPQWNEKFVFRVDDT  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGT---REVALQIRRPSGSPQ  864
             F+ +E S++ +E+Y  +W RDV +G+V+V +SNL  PS       R VALQ+RRPSG PQ
Sbjct  68    FINAENSSIMIEVYAAAWLRDVQIGSVNVLISNLF-PSHNNNNKMRFVALQVRRPSGRPQ  126

Query  863   GLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHAK  687
             G+LN+   L +   T RSMPL ++L  +A G+  D  ++ + I        +  E   AK
Sbjct  127   GILNLGVQLLDT--TMRSMPLYTELSVSAVGF--DDLIDAKTI-------GQSLEEKSAK  175

Query  686   ILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEVCSDVGP  513
             + + +   T   +SD +G +              +G SM+NG         +CSDVGP
Sbjct  176   LRRTQSDQTDQTISDKSGIK-------------ESGVSMINGS--------LCSDVGP  212



>ref|XP_011091348.1| PREDICTED: uncharacterized protein LOC105171810 [Sesamum indicum]
Length=545

 Score =   170 bits (430),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 125/198 (63%), Gaps = 14/198 (7%)
 Frame = -3

Query  1262  VITVSDVSCLSR---PPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQ  1092
             V+ V  VSC  +   P   + +LEI +ISAQDL PVSK +RTYA  W +PNRK ++C+D 
Sbjct  22    VVLVLCVSCPLKKMAPEKPFQLLEINIISAQDLEPVSKKMRTYATAWLHPNRKLSSCVDA  81

Query  1091  NGNANPTWNDKFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK-  915
              GN +PTWNDKF FKV++EFL  + S V +EIY   W RD LVGTV V V NLI  S + 
Sbjct  82    EGNNSPTWNDKFVFKVEEEFLRRDTSAVMIEIYAKQWLRDTLVGTVRVLVGNLIPSSTRT  141

Query  914   ------GTREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLE  756
                   G R VALQ+RRPSG PQG+LN+   L ++  + RSMPL   L ++A GY +DL 
Sbjct  142   LGHHHFGMRFVALQVRRPSGRPQGILNIGVALLDS--SMRSMPLYRQLSASAVGY-RDLM  198

Query  755   LEKRNILEYHNSEDEERE  702
              +   + + H +E +  +
Sbjct  199   DDPPALQQPHKNERQNHD  216



>ref|XP_007226487.1| hypothetical protein PRUPE_ppa026634mg [Prunus persica]
 gb|EMJ27686.1| hypothetical protein PRUPE_ppa026634mg [Prunus persica]
Length=492

 Score =   169 bits (428),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 135/222 (61%), Gaps = 12/222 (5%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL P+S+S+RTYA+ W +P+RK +T +D  G+ NPTWNDKF F+VD++
Sbjct  9     FQLLELNVISAQDLAPISRSMRTYAIAWVHPDRKLSTRVDTQGHNNPTWNDKFVFRVDED  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK--------GTREVALQIRRP  879
             FL  + S V +EIY + WF+DV VGTV V V NLI    K        G R VALQ+RRP
Sbjct  69    FLHEDTSAVMIEIYALHWFKDVHVGTVRVLVGNLIPTPAKPHHHNPHLGMRFVALQVRRP  128

Query  878   SGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDL-ELEKRNILEYHNSEDEER  705
             SG PQG+LN+   L  +  + RSMPL S L ++A GYK  + E +     + H++  +  
Sbjct  129   SGRPQGILNIGVALLHS--SMRSMPLYSQLSTSAVGYKTLMGEEDPHRSSQTHHAGSQAT  186

Query  704   ERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNG  579
                  ++ + +   +    S++   EF  K  +   GSMVNG
Sbjct  187   TYSKPELRRSKSDSSSMFGSELRATEFKNKGKNGKAGSMVNG  228



>ref|XP_008340669.1| PREDICTED: uncharacterized protein LOC103403599 [Malus domestica]
Length=533

 Score =   169 bits (429),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 161/285 (56%), Gaps = 13/285 (5%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL P+S+S+RTYA+ W +P+RK +T +D +G+ NPTWNDKF F+VD++
Sbjct  9     FQLLELNVISAQDLAPISRSMRTYAIAWVHPDRKLSTRVDTSGHNNPTWNDKFVFRVDED  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK--------GTREVALQIRRP  879
             FL  + S V +EIY + WF+DV VGTV V V NLI  S +        G R VALQ+RRP
Sbjct  69    FLHDDTSAVMIEIYVLHWFKDVHVGTVRVLVGNLIQTSTRPYHHHPQVGMRFVALQVRRP  128

Query  878   SGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDL-ELEKRNILEYHNSEDEER  705
             SG PQG+LN+   L  +  + RSMPL S L ++A GYK  + E +     + H++  +  
Sbjct  129   SGRPQGILNIGVALLHS--SMRSMPLYSQLSTSAVGYKTLMGEDDATRSTKTHHTRSQMT  186

Query  704   ERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEVCS  525
                  ++ + +   +  + S++  +EF  K       SMVN   +         GS+  S
Sbjct  187   TNSKPQLRRTKSDSSSMLGSELRDKEFKHKGKKGKASSMVNSSDISTRKKKKGRGSKASS  246

Query  524   DVGPSASVVAAEIAQSWQASAAPRKEIMER-GVGDSMVLPANLTP  393
              VG ++ ++  +  +   +S     ++  R G   SM+   N+ P
Sbjct  247   LVGGASDIIYRKGKKGKASSIVSASDVSYRKGKASSMLSATNVGP  291



>ref|XP_006489752.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
Length=510

 Score =   169 bits (428),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 111/158 (70%), Gaps = 11/158 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+S+RTYA+ W +PNRK +T +D +G  NPTWNDKF F+VD++
Sbjct  9     FQLLELNIISAQDLAPVSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDED  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------GTREVALQIRR  882
             FL ++ S V +EI+ + WFRD+ VGTV V V NLI P  +         G R VALQ+RR
Sbjct  69    FLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVRR  128

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYK  768
             PSG PQG+LN+   L ++  + RSMPL   +S+A GY+
Sbjct  129   PSGRPQGILNIGVALLDS--SMRSMPLYTQLSSALGYR  164



>gb|KDO41882.1| hypothetical protein CISIN_1g041258mg [Citrus sinensis]
Length=510

 Score =   169 bits (427),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 111/158 (70%), Gaps = 11/158 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+S+RTYA+ W +PNRK +T +D +G  NPTWNDKF F+VD++
Sbjct  9     FQLLELNIISAQDLAPVSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDED  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------GTREVALQIRR  882
             FL ++ S V +EI+ + WFRD+ VGTV V V NLI P  +         G R VALQ+RR
Sbjct  69    FLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVRR  128

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYK  768
             PSG PQG+LN+   L ++  + RSMPL   +S+A GY+
Sbjct  129   PSGRPQGILNIGVALLDS--SMRSMPLYTQLSSALGYR  164



>ref|XP_009804994.1| PREDICTED: uncharacterized protein DDB_G0292186-like [Nicotiana 
sylvestris]
Length=526

 Score =   169 bits (427),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 107/162 (66%), Gaps = 11/162 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +ISAQDL P SK ++TYA  W +P RK TT +D  G  NPTWNDKF F+VD+E
Sbjct  13    FQLLEINIISAQDLEPTSKKMKTYATAWVHPTRKLTTGVDVEGGNNPTWNDKFVFRVDEE  72

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP--------SEKGTREVALQIRRP  879
             FL  + S V +EI++V WFRD LVGTV V V NLI P           G R VALQIRRP
Sbjct  73    FLRQDTSAVHIEIFSVHWFRDSLVGTVRVLVRNLIPPIRAHGHHNHHLGMRFVALQIRRP  132

Query  878   SGSPQGLLNMSATLQENTGTSRSMPLSDLMST-ASGYKKDLE  756
             SG PQG+LN+   L +  G+ RSMPL   MST A GY+  +E
Sbjct  133   SGRPQGILNIGVALLD--GSMRSMPLYRQMSTSAVGYRDLME  172



>gb|EYU43768.1| hypothetical protein MIMGU_mgv1a006114mg [Erythranthe guttata]
Length=456

 Score =   167 bits (423),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 108/166 (65%), Gaps = 12/166 (7%)
 Frame = -3

Query  1226  PPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFK  1047
             P   + +LEI +ISAQDL PVS+ +RTYA  W + +RK ++C+D  G  NPTWNDKF F+
Sbjct  3     PSKPFQLLEINIISAQDLEPVSRKMRTYATAWMHQSRKLSSCVDNEGKTNPTWNDKFVFR  62

Query  1046  VDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------GTREVA  897
             VDDEFL  + S + +EIY   WFRDVLVGTV V V NLI P  +          G R VA
Sbjct  63    VDDEFLRQDTSAIMIEIYATHWFRDVLVGTVRVLVGNLIPPPTRTHQQTNHYTGGMRFVA  122

Query  896   LQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDL  759
             LQ+RRPSG PQG+LN+   L ++  + RSMPL   +S ++   +DL
Sbjct  123   LQVRRPSGRPQGILNIGVALLDS--SMRSMPLYRQLSMSAVGFRDL  166



>ref|XP_010667096.1| PREDICTED: uncharacterized protein LOC104884184 [Beta vulgaris 
subsp. vulgaris]
Length=464

 Score =   167 bits (423),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 109/157 (69%), Gaps = 10/157 (6%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +IS QD+  VS+S++TYA+ W +P+RK TT +D NG  NPTWNDKF F+VD+ 
Sbjct  4     FQLLEINIISGQDIHKVSRSMKTYAVAWVHPDRKLTTRVDSNGGTNPTWNDKFVFRVDNR  63

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK-------GTREVALQIRRPS  876
             FL S+ S + +EIY + WFRDV VGTV V V NLI P  +       G R VALQ+RRPS
Sbjct  64    FLQSDTSAIMIEIYALHWFRDVHVGTVRVLVGNLIPPQTRSFNQNHIGMRFVALQVRRPS  123

Query  875   GSPQGLLNMSATLQENTGTSRSMPLSDLMST-ASGYK  768
             G PQG+LN+  T+ ++  T RSMPL   +ST A GY+
Sbjct  124   GRPQGILNVGVTVLDS--TMRSMPLYRQLSTSAVGYQ  158



>ref|XP_006420366.1| hypothetical protein CICLE_v10006849mg [Citrus clementina]
 gb|ESR33606.1| hypothetical protein CICLE_v10006849mg [Citrus clementina]
Length=497

 Score =   167 bits (423),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 110/158 (70%), Gaps = 11/158 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+S+R YA+ W +PNRK +T +D +G  NPTWNDKF F+VD++
Sbjct  9     FQLLELNIISAQDLAPVSRSMRAYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDED  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------GTREVALQIRR  882
             FL ++ S V +EI+ + WFRD+ VGTV V V NLI P  +         G R VALQ+RR
Sbjct  69    FLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVRR  128

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYK  768
             PSG PQG+LN+   L ++  + RSMPL   +S+A GY+
Sbjct  129   PSGRPQGILNIGVALLDS--SMRSMPLYTALSSALGYR  164



>ref|XP_004253020.1| PREDICTED: uncharacterized protein LOC101244358 [Solanum lycopersicum]
Length=534

 Score =   167 bits (423),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 113/171 (66%), Gaps = 12/171 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL P+SK ++TYA  W +P RK TT +D +G  NPTWNDKF F+VDDE
Sbjct  11    FQLLEVNIISAQDLEPISKKMKTYASAWVHPTRKLTTGVDNDGGNNPTWNDKFVFRVDDE  70

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK--------GTREVALQIRRP  879
             FL  + S V ++I++V WFRD LVG+V V V NLI P  +        G R VALQIRRP
Sbjct  71    FLQQDTSAVQIDIFSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQQHHIGMRFVALQIRRP  130

Query  878   SGSPQGLLNMSATLQENTGTSRSMPLSDLMS-TASGYKKDLELEKRNILEY  729
             SG PQG+LN+  TL    GT RSM L   +S +A GY +DL  E  ++  Y
Sbjct  131   SGRPQGILNIGVTLL--GGTMRSMQLYRQLSMSAVGY-RDLMDEDAHLPNY  178



>ref|XP_002528347.1| hypothetical protein RCOM_1217340 [Ricinus communis]
 gb|EEF34019.1| hypothetical protein RCOM_1217340 [Ricinus communis]
Length=472

 Score =   166 bits (420),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 104/274 (38%), Positives = 152/274 (55%), Gaps = 34/274 (12%)
 Frame = -3

Query  1235  LSRPPVG--YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWND  1062
             +SRP     + +LE+ +IS QDL  VS+ +RTYA+ W +P+RK +T +D  G+ NPTWND
Sbjct  1     MSRPVYSPPFQLLELNVISGQDLAQVSRKMRTYAVAWVHPDRKLSTRVDAQGHNNPTWND  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPS-----------EK  915
             KF F+VDDEFL  E S + +EIY + WFRDV VGTV V V NLI P+           + 
Sbjct  61    KFVFRVDDEFLYGETSAIMIEIYALHWFRDVHVGTVRVIVGNLIPPAQLYRQHQQHHVQL  120

Query  914   GTREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNI  738
             G R VALQ+RR SG PQG+LN+   L +   + RSMPL S + ++A GY+  +  +  + 
Sbjct  121   GMRFVALQVRRHSGRPQGILNIGVALLDT--SMRSMPLYSQISASAVGYRHLMGEKGTHT  178

Query  737   LEYHNS---EDEERERLHAKILQW------RRSMTPDMMSDVNGEEFPGKPGSICNGSMV  585
               +H S   +D   +  +  +L W      RR  T    S + G +  GK  +I   +  
Sbjct  179   HTHHKSKADDDRSSDNQNQFLLPWIPKPELRR--TKSESSSMFGSDMVGK--NIKKKTQE  234

Query  584   NGGSMVNGGSMV-----NYGSEVCSDVGPSASVV  498
               GSMV+G  ++     NY   +      ++S++
Sbjct  235   KAGSMVSGLEIIKKDNKNYHHNIKKQSSKASSMI  268



>ref|XP_006418119.1| hypothetical protein EUTSA_v10007144mg [Eutrema salsugineum]
 gb|ESQ36472.1| hypothetical protein EUTSA_v10007144mg [Eutrema salsugineum]
Length=595

 Score =   167 bits (424),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 116/180 (64%), Gaps = 19/180 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+ ++TYA+ W +  RK TT +D NG ANPTWNDKF F+V++E
Sbjct  8     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------------GTRE  903
             FL ++ S V +EIY + WFRDV VGTV V +SNLI P+ +                G R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF  127

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH  726
             VALQ+RR SG PQG+LN+   L +  G+ RSMPL   M S+A GY+  L  E R++   H
Sbjct  128   VALQVRRTSGRPQGILNIGVGLLD--GSMRSMPLYTHMDSSAVGYRDLLGEEDRHLQHLH  185



>ref|XP_004297932.1| PREDICTED: uncharacterized protein LOC101311957 [Fragaria vesca 
subsp. vesca]
Length=519

 Score =   166 bits (421),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 111/159 (70%), Gaps = 11/159 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+S+RTYA+ W +P+RK +T +D +G+ NPTWNDKF F+VD++
Sbjct  7     FQLLELNVISAQDLAPVSRSMRTYAIAWVHPDRKLSTRVDTHGHNNPTWNDKFVFRVDED  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK--------GTREVALQIRRP  879
             FL  + S V +EIY + WF+DV VGT+ V V NLI    K        G R VALQ+RRP
Sbjct  67    FLHEDTSAVMIEIYALHWFKDVHVGTIRVLVGNLIQTPAKPHHHHPQLGMRFVALQVRRP  126

Query  878   SGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKK  765
             SG PQG+LN+   L  +  + RSMPL S L S+A GYK+
Sbjct  127   SGRPQGILNIGVALLHS--SMRSMPLYSQLNSSAVGYKQ  163



>ref|XP_009118638.1| PREDICTED: uncharacterized protein LOC103843645 [Brassica rapa]
Length=593

 Score =   167 bits (422),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 116/180 (64%), Gaps = 19/180 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PV++ ++TYA+ W +  RK TT +D NG ANPTWNDKF F+V++E
Sbjct  8     FQLLELNIISAQDLAPVARKMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------------GTRE  903
             FL ++ S V +EIY + WFRDV VGTV V +SNLI PS +                G R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPPGMRF  127

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH  726
             VALQ+RR SG PQG+LN+   + +  G+ RSMPL   M S+A GY+  L  E R++   H
Sbjct  128   VALQVRRTSGRPQGILNIGVGVLD--GSMRSMPLYTHMDSSAVGYRDLLGEEDRHLQHLH  185



>emb|CDY53195.1| BnaAnng12200D [Brassica napus]
Length=593

 Score =   167 bits (422),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 116/180 (64%), Gaps = 19/180 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PV++ ++TYA+ W +  RK TT +D NG ANPTWNDKF F+V++E
Sbjct  8     FQLLELNIISAQDLAPVARKMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------------GTRE  903
             FL ++ S V +EIY + WFRDV VGTV V +SNLI PS +                G R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPPGMRF  127

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH  726
             VALQ+RR SG PQG+LN+   + +  G+ RSMPL   M S+A GY+  L  E R++   H
Sbjct  128   VALQVRRTSGRPQGILNIGVGVLD--GSMRSMPLYTHMDSSAVGYRDLLGEEDRHLQHLH  185



>ref|XP_009119477.1| PREDICTED: uncharacterized protein LOC103844449 [Brassica rapa]
Length=561

 Score =   166 bits (421),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 114/180 (63%), Gaps = 19/180 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+ ++TYA+ W +  RK TT +D N   NPTWNDKF F+VD+E
Sbjct  8     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNAGTNPTWNDKFVFRVDEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------------GTRE  903
             FL ++ S V +EIY + WFRDV VGTV V +SNLI PS +                G R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYHRTPPQGMRF  127

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH  726
             VALQ+RR SG PQG+LN+   + +  G+ RSMPL   M S+A GY+  L  E R++   H
Sbjct  128   VALQVRRASGRPQGILNIGVGVLD--GSMRSMPLYTHMDSSAVGYRDLLGEEDRHLQHLH  185



>ref|XP_002311697.2| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE89064.2| C2 domain-containing family protein [Populus trichocarpa]
Length=492

 Score =   165 bits (418),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 107/158 (68%), Gaps = 10/158 (6%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL  VS+ ++TYA+ W +P+RK +T ID  G  NPTWNDKF F+VDD 
Sbjct  9     FQLLELNVISAQDLAKVSRKMKTYAVAWIHPDRKLSTRIDSEGRNNPTWNDKFVFRVDDR  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK--------GTREVALQIRRP  879
             FL  + S V +EIY + WFRD+ VGTV V V NLI P +         G R VALQ+RRP
Sbjct  69    FLHGDTSAVMIEIYALHWFRDIHVGTVRVIVGNLIPPPDPHHHNQFQIGMRFVALQVRRP  128

Query  878   SGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKK  765
             SG PQG+LN+   L ++  + RSMPL   +S+A GY++
Sbjct  129   SGRPQGILNIGVALLDS--SMRSMPLYSQLSSAVGYRQ  164



>ref|XP_006342681.1| PREDICTED: uncharacterized protein LOC102596842 [Solanum tuberosum]
Length=528

 Score =   166 bits (419),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 112/171 (65%), Gaps = 12/171 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL P+SK ++TYA  W +P RK TT +D  G  NPTWNDKF F+VDDE
Sbjct  11    FQLLEVNIISAQDLEPISKKMKTYASAWVHPTRKLTTGVDTEGGNNPTWNDKFVFRVDDE  70

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK--------GTREVALQIRRP  879
             FL  + S + ++I++V WFRD LVG+V V V NLI P  +        G R VALQIRRP
Sbjct  71    FLQQDTSAIQIDIFSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQQHHIGMRFVALQIRRP  130

Query  878   SGSPQGLLNMSATLQENTGTSRSMPLSDLMS-TASGYKKDLELEKRNILEY  729
             SG PQG+LN+  TL    GT RSM L   +S +A GY +DL  E  ++  Y
Sbjct  131   SGRPQGILNIGVTLL--GGTMRSMQLYRQLSMSAVGY-RDLMDEDAHLPNY  178



>ref|XP_011029742.1| PREDICTED: uncharacterized protein LOC105129399 [Populus euphratica]
Length=492

 Score =   165 bits (418),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/256 (40%), Positives = 146/256 (57%), Gaps = 34/256 (13%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL  VS+ ++TYA+ W +P+RK +T ID  G  NPTWNDKF F+VDD 
Sbjct  9     FQLLELNVISAQDLAKVSRKMKTYAVAWIHPDRKLSTRIDSEGRNNPTWNDKFVFRVDDR  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK--------GTREVALQIRRP  879
             FL  + S V +EIY + WFRD+ VGTV V V NLI P +         G R VALQ+RRP
Sbjct  69    FLHGDTSAVMIEIYALHWFRDIHVGTVRVIVGNLIPPPDPHHHNQFQIGMRFVALQVRRP  128

Query  878   SGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNSEDEERE-  702
             SG P+G+LN+   L ++  + RSMPL   +S+A GY++ +  E    +++H    +    
Sbjct  129   SGRPKGILNIGVALLDS--SMRSMPLYSQLSSAVGYRQLMGEED---MDHHKDVSDVSSS  183

Query  701   --RLHAKILQW------RR------SMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVN  564
               R +  +L W      RR      S+   M+ +       GK  S+ +GS      M+N
Sbjct  184   GIRSNPLLLPWPPKSELRRTKSDSSSLFGSMVMEKKRMVMKGKGASMISGSESEDTMMMN  243

Query  563   GG-----SMVNYGSEV  531
             GG     SMV+ GSE+
Sbjct  244   GGRTKASSMVS-GSEL  258



>ref|XP_004247791.2| PREDICTED: uncharacterized protein LOC101245204 [Solanum lycopersicum]
Length=521

 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 115/177 (65%), Gaps = 14/177 (8%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +ISAQDL PVSK ++TYA VW +P RK TT +D  G  NPTWNDKF F+VD+E
Sbjct  7     FQLLEINIISAQDLEPVSKKMKTYATVWVHPTRKLTTAVDIEGGNNPTWNDKFVFRVDEE  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI----------SPSEKGTREVALQIR  885
             FL  + S V +EI+   WF+D LVG+V V V NLI           P   G R VALQ+R
Sbjct  67    FLRQDTSAVQIEIHCGHWFKDSLVGSVRVLVGNLIPSPSRTHHNHHPHNLGMRFVALQVR  126

Query  884   RPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSE  717
             RPSG PQG+LN+   L ++  T RSMPL ++L  +A GY +DL  E++    +HN +
Sbjct  127   RPSGRPQGILNIGVALLDS--TMRSMPLYTELNKSAVGY-RDLMEEEQLPHHHHNQK  180



>ref|XP_002282144.1| PREDICTED: uncharacterized protein LOC100256206 [Vitis vinifera]
Length=494

 Score =   164 bits (416),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 138/219 (63%), Gaps = 15/219 (7%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              +LEI LISAQDL PV +S+RTYA+ W +P+RK +T ID  G+ +PTWNDKF F+VDDEF
Sbjct  8     QLLEINLISAQDLAPVGRSMRTYAIAWVHPDRKLSTRIDSTGHNSPTWNDKFVFRVDDEF  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPS-------EKGTREVALQIRRPSG  873
             L ++ S V ++IY+  WFRD  VGTV + V NLI PS       + G R +ALQ+RR SG
Sbjct  68    LRADTSAVMIDIYSQHWFRDYHVGTVRILVGNLIPPSVRPGHRTQMGMRFMALQVRRSSG  127

Query  872   SPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERERL  696
              PQGLLN+   L ++  + RSMPL S L ++A G+   +  +    +  +N+++   E++
Sbjct  128   RPQGLLNIGVALLDS--SMRSMPLYSQLSASAVGFHDLVGEDDPKKINNNNNQNPPLEKI  185

Query  695   HAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNG  579
                +L+  +S   D +  V+  EF   P S  NGS V+G
Sbjct  186   ---VLRRCKSERSDRL--VSEAEFSDFPASSVNGSEVSG  219



>ref|XP_009767920.1| PREDICTED: uncharacterized protein LOC104218993 [Nicotiana sylvestris]
Length=520

 Score =   164 bits (416),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 112/166 (67%), Gaps = 12/166 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +ISAQDL P+SK ++TYA VW +P RK TT +D  G  NPTWNDKF F+VD+E
Sbjct  7     FQLLEINIISAQDLQPISKKMKTYATVWVHPTRKLTTAVDVEGGNNPTWNDKFVFRVDEE  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------GTREVALQIRR  882
             FL  + S V +EI+ V WF+D LVG+V V V NLI P  +         G R VALQ+RR
Sbjct  67    FLRQDTSAVQIEIHCVHWFKDSLVGSVRVLVGNLIPPPPRPHHNHHHHFGMRFVALQVRR  126

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEK  747
             PSG PQG+LN+   L ++  T RSMPL ++L  +A GY+  +E E+
Sbjct  127   PSGRPQGILNIGVALLDS--TMRSMPLYTELNKSAVGYRDLMEEEQ  170



>gb|KFK42792.1| hypothetical protein AALP_AA1G039700 [Arabis alpina]
Length=572

 Score =   165 bits (418),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 114/180 (63%), Gaps = 19/180 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+ ++TYA+ W +  RK TT +D NG  NPTWNDKF F+V++E
Sbjct  7     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNGGPNPTWNDKFVFRVNEE  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------------GTRE  903
             FL ++ S V +EIY + WFRDV VGTV V +SNLI P  +                G R 
Sbjct  67    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPDRRPGYRTSNNEYRRTPPQGMRF  126

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH  726
             VALQ+RR SG PQG+LN+   L +  G+ RSMPL   M S+A GY+  L  E R++   H
Sbjct  127   VALQVRRTSGRPQGILNIGVGLLD--GSMRSMPLYTHMDSSAVGYRDLLGEEDRHLQHLH  184



>emb|CAN83108.1| hypothetical protein VITISV_026570 [Vitis vinifera]
Length=494

 Score =   164 bits (415),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 138/219 (63%), Gaps = 15/219 (7%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              +LEI LISAQDL PV +S+RTYA+ W +P+RK +T ID  G+ +PTWNDKF F+VDDEF
Sbjct  8     QLLEINLISAQDLAPVGRSMRTYAIAWVHPDRKLSTRIDSTGHNSPTWNDKFVFRVDDEF  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPS-------EKGTREVALQIRRPSG  873
             L ++ S V ++IY+  WFRD  VGTV + V NLI PS       + G R +ALQ+RR SG
Sbjct  68    LRADTSAVMIDIYSQHWFRDYHVGTVRILVGNLIPPSVRPGHRTQMGMRFMALQVRRSSG  127

Query  872   SPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERERL  696
              PQGLLN+   L ++  + RSMPL S L ++A G+   +  +    +  +N+++   E++
Sbjct  128   RPQGLLNIGVALLDS--SMRSMPLYSQLSASAVGFHDLVGEDDPKKINNNNNQNPPFEKI  185

Query  695   HAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNG  579
                +L+  +S   D +  V+  EF   P S  NGS V+G
Sbjct  186   ---VLRRCKSERSDRL--VSEAEFSDFPASSVNGSEVSG  219



>emb|CDY59181.1| BnaC08g50140D [Brassica napus]
Length=593

 Score =   165 bits (418),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 116/180 (64%), Gaps = 19/180 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PV++ ++TYA+ W +  RK TT +D NG ANPTWNDKF F+V++E
Sbjct  8     FQLLELNIISAQDLAPVARKMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------------GTRE  903
             FL ++ S V +EIY + WFRDV VGTV V +SNLI P+ +                G R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF  127

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH  726
             VALQ+RR SG PQG+LN+   + +  G+ RSMPL   M S+A GY+  L  E R++   H
Sbjct  128   VALQVRRTSGRPQGILNIGVGVLD--GSMRSMPLYTHMDSSAVGYRDLLGEEDRHLQHLH  185



>gb|EPS62035.1| hypothetical protein M569_12761, partial [Genlisea aurea]
Length=167

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 107/159 (67%), Gaps = 12/159 (8%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             +H+LEI +ISAQ+L PV K ++TYA  W +P RK +T +D +GN +PTWNDKF FKVD++
Sbjct  8     FHLLEINVISAQELEPVRKKMQTYATAWVHPQRKLSTSVDNDGNTSPTWNDKFVFKVDED  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP---------SEKGTREVALQIRR  882
             FL ++ S V++EI    WF D++VG+V + + NLI P            G + +ALQ+RR
Sbjct  68    FLRNDTSAVSIEILAEHWFTDIVVGSVRIIIGNLIPPHVWTDRRHHHRIGMQFIALQVRR  127

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYK  768
             PSG PQG+LN+   +    GT RSMPL + L ++A GY+
Sbjct  128   PSGRPQGILNIGVAVLN--GTMRSMPLYTQLSASAFGYR  164



>ref|XP_010264865.1| PREDICTED: uncharacterized protein LOC104602763 [Nelumbo nucifera]
Length=418

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 119/182 (65%), Gaps = 9/182 (5%)
 Frame = -3

Query  1220  VGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             V + +LEI +ISAQDL PV++S+ TYA+ W +P RK +TC+D +G+ +PTWNDKF F+VD
Sbjct  7     VPFQLLEINVISAQDLAPVTRSMHTYAVAWVDPERKLSTCVDTHGHVDPTWNDKFVFRVD  66

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI------SPSEKGTREVALQIRRP  879
             DEFL S+ S V ++I+ +  FRDV VGTV V V NL       S    G R VALQ+RRP
Sbjct  67    DEFLHSDTSAVMIKIFALRPFRDVHVGTVRVLVGNLFPLSSLRSHQRSGMRFVALQVRRP  126

Query  878   SGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERE  702
             SG PQG+LN+ A L +   + RSMPL S   S+A GY+  +  + R+   ++ S  + + 
Sbjct  127   SGRPQGILNIGAALLDK--SMRSMPLYSQPNSSALGYRHLMGEDIRSPYRHYLSRQKFQH  184

Query  701   RL  696
              L
Sbjct  185   SL  186



>ref|XP_009590587.1| PREDICTED: ankyrin repeat-containing protein kinase A-like [Nicotiana 
tomentosiformis]
Length=535

 Score =   164 bits (416),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 116/176 (66%), Gaps = 15/176 (9%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +ISAQDL P+SK ++TYA VW +P RK TT +D  G  NPTWNDKF F+VD+E
Sbjct  7     FQLLEINIISAQDLQPISKKMKTYATVWVHPTRKLTTAVDVEGGNNPTWNDKFVFRVDEE  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------GTREVALQIRR  882
             FL  + S V +EI+ V WF+D +VG+V V V NLI P  +         G R VALQ+RR
Sbjct  67    FLRQDTSAVQIEIHCVHWFKDSVVGSVRVLVGNLIPPPPRPHHNHHHHFGMRFVALQVRR  126

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSE  717
             PSG PQG+LN+   L ++  T RSMPL ++L  +A GY+  +E E+   L  HN +
Sbjct  127   PSGRPQGILNIGVALLDS--TMRSMPLYTELNKSAVGYRDLMEEEQ---LSQHNQK  177



>ref|XP_010025828.1| PREDICTED: uncharacterized protein LOC104416088 [Eucalyptus grandis]
 gb|KCW57326.1| hypothetical protein EUGRSUZ_H00125 [Eucalyptus grandis]
Length=155

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 96/142 (68%), Gaps = 8/142 (6%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEFL  1029
             +L+I +ISAQDL  VS S+RTYA+ W +P+RK +T +D  G  NPTWNDKF F VD EFL
Sbjct  11    LLKIDIISAQDLASVSHSMRTYAVAWVHPDRKFSTRVDTRGQCNPTWNDKFVFCVDQEFL  70

Query  1028  ASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK--------GTREVALQIRRPSG  873
               E S V VEIY V WFRDVL+GTV V VSN   PS          G R VALQ+RRPSG
Sbjct  71    RRETSAVMVEIYAVHWFRDVLIGTVRVLVSNFAPPSSWPFRRKQLIGMRVVALQVRRPSG  130

Query  872   SPQGLLNMSATLQENTGTSRSM  807
              PQG+LN+  TL +++  S+ +
Sbjct  131   RPQGILNVGGTLLDSSMGSKPL  152



>emb|CDY18242.1| BnaC05g02650D [Brassica napus]
Length=410

 Score =   162 bits (409),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 104/146 (71%), Gaps = 3/146 (2%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+ ++TYA+ W +  RK TT +D N   NPTWNDKF F+VD+E
Sbjct  8     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNAGTNPTWNDKFVFRVDEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLL  855
             FL ++ S V +EIY + WFRDV VGTV V +SNLI PS +  R VALQ+RR SG PQG+L
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRR-MRFVALQVRRASGRPQGIL  126

Query  854   NMSATLQENTGTSRSMPLSDLMSTAS  777
             N+   + +  G+ RSMPL   M +++
Sbjct  127   NIGVGVLD--GSMRSMPLYTHMDSSA  150



>ref|XP_002881275.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57534.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=595

 Score =   164 bits (415),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 116/179 (65%), Gaps = 18/179 (10%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+ ++TYA+ W +  RK TT +D  G ANPTWNDKF F+V ++
Sbjct  7     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSED  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------------GTREV  900
             FL ++ S V VEIY + WFRDV VGT+ V +SNLI P+ +               G R V
Sbjct  67    FLYADTSAVVVEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFV  126

Query  899   ALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYH  726
             ALQ+RRPSG PQG+LN+   + +  G+ RSMPL +++ S+A GY+  L  E  N+   H
Sbjct  127   ALQVRRPSGRPQGILNIGVGILD--GSMRSMPLYTNMDSSAVGYRDLLGEEDPNLQNLH  183



>ref|XP_009621969.1| PREDICTED: uncharacterized protein LOC104113496 [Nicotiana tomentosiformis]
Length=523

 Score =   163 bits (412),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 105/162 (65%), Gaps = 11/162 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +IS QDL P SK ++TY   W +P +K TT +D  G  NPTWNDKF F+VD+E
Sbjct  13    FQLLEINIISVQDLEPTSKKMKTYVTAWIHPTQKLTTGVDVEGGNNPTWNDKFVFRVDEE  72

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP--------SEKGTREVALQIRRP  879
             FL  + S V +EI++V WFRD L+GTV V V NLI P           G R VALQIRRP
Sbjct  73    FLRQDTSAVHIEIFSVHWFRDSLIGTVRVLVGNLIPPIRAYGHHNHHLGMRFVALQIRRP  132

Query  878   SGSPQGLLNMSATLQENTGTSRSMPLSDLMST-ASGYKKDLE  756
             SG PQG+LN+   L +  G+ RSMPL   MST A GY+  +E
Sbjct  133   SGRPQGILNIGVALLD--GSMRSMPLYRQMSTSAVGYRDLME  172



>gb|KFK31057.1| hypothetical protein AALP_AA6G062700 [Arabis alpina]
Length=367

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 112/166 (67%), Gaps = 18/166 (11%)
 Frame = -3

Query  1217  GYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
              + +LE+ +ISAQDL PVS+ ++TYA+ W +  RK TT +D +G ANPTWNDKF F+V +
Sbjct  6     SFQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYSGGANPTWNDKFVFRVSE  65

Query  1037  EFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------------GTRE  903
             +FL ++ S V +EIY + WFRDV VGT+ V +SNLI P+ +               G R 
Sbjct  66    DFLYADTSAVVIEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRF  125

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYK  768
             VALQ+RRPSG PQG+LN+   + +  G+ RSMPL +++ S+A GY+
Sbjct  126   VALQVRRPSGRPQGILNIGVGMLD--GSMRSMPLYTNMDSSAVGYR  169



>ref|XP_006303752.1| hypothetical protein CARUB_v10011922mg [Capsella rubella]
 gb|EOA36650.1| hypothetical protein CARUB_v10011922mg [Capsella rubella]
Length=600

 Score =   164 bits (414),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 114/180 (63%), Gaps = 19/180 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PV++  +TYA+ W +P RK TT +D NG  NPTWNDKF F+V+++
Sbjct  8     FQLLELNIISAQDLAPVARKTKTYAVAWVHPERKLTTRVDYNGGTNPTWNDKFVFRVNED  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------------GTRE  903
             FL ++ S V +EIY + WFRDV VGTV V +SNLI P+ +                G R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF  127

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH  726
             VALQ+RR SG PQG+LN+   L +  G+ RSMPL   M S+A GY+  L  E  ++   H
Sbjct  128   VALQVRRSSGRPQGILNIGVGLLD--GSMRSMPLYTHMDSSAVGYRDLLGEEDHHLQHLH  185



>ref|XP_002314508.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF00679.1| C2 domain-containing family protein [Populus trichocarpa]
Length=460

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/259 (39%), Positives = 146/259 (56%), Gaps = 33/259 (13%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL  VS+ ++TYA+ W +P+R+ +T +D  G  NPTWNDKF F+VDD 
Sbjct  9     FQLLELNVISAQDLVKVSRKMKTYAVAWVHPDRRLSTRVDSEGCNNPTWNDKFVFRVDDR  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPS--------EKGTREVALQIRRP  879
             FL  + S V +EIY + WFRD+ +GTV V V NLI P         + G R VALQ+RRP
Sbjct  69    FLHGDTSAVMIEIYALHWFRDIHIGTVRVIVGNLIPPPRPHHHNQFQLGMRFVALQVRRP  128

Query  878   SGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSE-DEER  705
             SG PQG+LN+   L ++  + RSMPL S +  +A GY+   +L     L +H  + D++ 
Sbjct  129   SGRPQGILNIGVALLDS--SMRSMPLYSQISVSAVGYR---QLMGEGELNHHKDDSDDKS  183

Query  704   ERLHAK--ILQW------RR------SMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMV  567
               +H+   +L W      RR      SM   ++         GK  S+ +GS V    M+
Sbjct  184   SGIHSNSFLLPWLPKPELRRTKSDSSSMFGSIVMAKRKMIMKGKGSSMISGSEVEERKML  243

Query  566   NGG----SMVNYGSEVCSD  522
             N G    S +  GSE+  +
Sbjct  244   NKGRSKASSLTGGSEIVKE  262



>emb|CBI23723.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 107/158 (68%), Gaps = 12/158 (8%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              +LEI LISAQDL PV +S+RTYA+ W +P+RK +T ID  G+ +PTWNDKF F+VDDEF
Sbjct  8     QLLEINLISAQDLAPVGRSMRTYAIAWVHPDRKLSTRIDSTGHNSPTWNDKFVFRVDDEF  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPS-------EKGTREVALQIRRPSG  873
             L ++ S V ++IY+  WFRD  VGTV + V NLI PS       + G R +ALQ+RR SG
Sbjct  68    LRADTSAVMIDIYSQHWFRDYHVGTVRILVGNLIPPSVRPGHRTQMGMRFMALQVRRSSG  127

Query  872   SPQGLLNMSATLQENTGTSRSMPLS---DLMSTASGYK  768
              PQGLLN+   L ++  + RSMPL    DL+   SG K
Sbjct  128   RPQGLLNIGVALLDS--SMRSMPLYKFVDLLKKKSGAK  163



>ref|XP_010483923.1| PREDICTED: uncharacterized protein LOC104762347 [Camelina sativa]
Length=601

 Score =   163 bits (413),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 113/180 (63%), Gaps = 19/180 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PV++  +TYA+ W +  RK TT +D NG  NPTWNDKF F+V++E
Sbjct  8     FQLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------------GTRE  903
             FL ++ S V +EIY + WFRDV VGTV V +SNLI PS +                G R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPPGMRF  127

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH  726
             VALQ+RR SG PQG+LN+   L +  G+ RSMPL   M S+A GY+  L  E  ++   H
Sbjct  128   VALQVRRTSGRPQGILNIGVGLLD--GSMRSMPLYTHMDSSAVGYRDLLGEEDHHLQHLH  185



>ref|NP_180890.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAB80650.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08815.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=602

 Score =   163 bits (412),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 115/179 (64%), Gaps = 18/179 (10%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+ ++TYA+ W +  RK TT +D  G  NPTWNDKF F+V ++
Sbjct  7     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGGNPTWNDKFVFRVSED  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------------GTREV  900
             FL ++ S V VEIY + WFRDV VGTV V +SNLI P+ +               G R V
Sbjct  67    FLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRSNEEYRRTPPPGMRFV  126

Query  899   ALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYH  726
             ALQ+RRPSG PQG+LN+   + +  G+ RSMPL +++ S+A GY+  L  E  N+   H
Sbjct  127   ALQVRRPSGRPQGILNIGVGILD--GSMRSMPLYTNMDSSAVGYRDLLGEEDPNLQNLH  183



>emb|CDO99320.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 120/176 (68%), Gaps = 11/176 (6%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +ISAQDL PVS+ ++TYA  W N +RK ++ +D  G+ NPTWNDKF F+VD++
Sbjct  8     FQLLEINVISAQDLEPVSRKMKTYATAWVNSSRKLSSRVDSGGHVNPTWNDKFVFRVDED  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP-------SEKGTREVALQIRRPS  876
             FL  + S V +EI+ V WF+D LVGTV V V NLI P       +  G R VALQ+RRPS
Sbjct  68    FLRQDTSAVQIEIHAVHWFKDTLVGTVRVLVGNLIPPLLRSRHHNHIGMRFVALQVRRPS  127

Query  875   GSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDE  711
             G PQG+LN+  TL ++  + RSMPL + L ++A GY +DL  E  + L+ ++++ E
Sbjct  128   GRPQGILNIGVTLLDS--SMRSMPLYTQLSASAVGY-RDLMGEDDSHLQNNHTKIE  180



>ref|XP_009357966.1| PREDICTED: uncharacterized protein LOC103948651 [Pyrus x bretschneideri]
Length=533

 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 109/158 (69%), Gaps = 11/158 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL P+S+S+RTYA+ W +P+RK +T +D  G+ NPTWNDKF F+VD++
Sbjct  9     FQLLELNVISAQDLAPISRSMRTYAVAWVHPDRKLSTRVDTLGHNNPTWNDKFVFRVDED  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK--------GTREVALQIRRP  879
             FL  + S V +EIY + WF+DV VGTV V V NLI    +        G R VALQ+RRP
Sbjct  69    FLHDDTSAVMIEIYVLHWFKDVHVGTVRVLVGNLIQTPMRPHHHHPQVGMRFVALQVRRP  128

Query  878   SGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYK  768
             SG PQG+LN+   L  +  + RSMPL S L ++A GYK
Sbjct  129   SGRPQGILNIGVALLHS--SMRSMPLYSQLSTSAVGYK  164



>ref|XP_007144140.1| hypothetical protein PHAVU_007G132000g [Phaseolus vulgaris]
 gb|ESW16134.1| hypothetical protein PHAVU_007G132000g [Phaseolus vulgaris]
Length=736

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 110/158 (70%), Gaps = 11/158 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+++RTYA+ W +P+RK +T +D  G+ +PTWNDKF F+VDDE
Sbjct  8     FQLLELNVISAQDLAPVSRNMRTYAVSWVHPDRKLSTRVDTQGHTHPTWNDKFVFRVDDE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------GTREVALQIRR  882
             FL S+ S++ +EIY + WF+D+ VGTV V + NL  P  +         GTR  A+Q+RR
Sbjct  68    FLCSDTSSIMIEIYALHWFKDIHVGTVRVLIGNLAPPPSRPFHSNRTPLGTRFAAVQVRR  127

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYK  768
             PSG PQG+LN+  T+ +  G+  SMPL    ++A GY+
Sbjct  128   PSGRPQGILNIGFTVLD--GSMHSMPLYTHNASAVGYR  163



>gb|KDP33324.1| hypothetical protein JCGZ_12873 [Jatropha curcas]
Length=446

 Score =   160 bits (406),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/233 (41%), Positives = 132/233 (57%), Gaps = 25/233 (11%)
 Frame = -3

Query  1223  PVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKV  1044
             P  + +LE+ +IS QDL  VS+ +RTYA+ W +P RK +T +D   + NPTWNDKF F+V
Sbjct  6     PQPFQLLELNVISGQDLAQVSRKMRTYAVAWVHPERKLSTRLDIYSHNNPTWNDKFVFRV  65

Query  1043  DDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------GTREVAL  894
             DDEFL  E S + VEIY VSWFRD+ VGTV V V NLI P+E           G R VAL
Sbjct  66    DDEFLYRETSAIMVEIYAVSWFRDIHVGTVRVIVGNLIPPAEHKKHQKHGVQLGMRFVAL  125

Query  893   QIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEK---RNILEYHN  723
             Q+RR SG PQG+LN+     +   + +SMPL    ++A GY+  +   K    N  +  N
Sbjct  126   QVRRRSGRPQGILNIGVAFLD--ASRKSMPLYTQTASAVGYRHMMGENKDSHANKDKNSN  183

Query  722   SEDEERERLHAKIL-------QWRRS---MTPDMMSDVNGEEFPGKPGSICNG  594
              +D+       + L       Q RR+   ++  + S+V   +  GK GS+ NG
Sbjct  184   KDDKSSNGSQNQFLLPWMPKPQLRRTKSDISSMVGSNVIVSKTKGKSGSMVNG  236



>ref|XP_003590735.1| RNA-binding protein 12B [Medicago truncatula]
 gb|AES60986.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=682

 Score =   162 bits (411),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 110/158 (70%), Gaps = 11/158 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL  + +++RTYA+ W +P+RK +T +D  G+ NPTWNDKF F+VD+E
Sbjct  8     FQLLELNVISAQDLASLGRNMRTYAVAWVHPDRKLSTRVDTQGHTNPTWNDKFVFRVDEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------GTREVALQIRR  882
             FL S+ S + VE+Y + WF+D+ VGTV V V NLI P  +         G R VALQ+RR
Sbjct  68    FLYSDTSAIMVEVYALHWFKDIHVGTVRVLVGNLIPPPTRPFHNDRAPMGMRFVALQVRR  127

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYK  768
             PSG PQG+LN+  T+ ++  + RSMPL  L ++A GY+
Sbjct  128   PSGRPQGILNIGVTVLDS--SMRSMPLYTLNASAVGYR  163



>ref|XP_010475114.1| PREDICTED: uncharacterized protein LOC104754591 [Camelina sativa]
Length=600

 Score =   162 bits (410),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 114/180 (63%), Gaps = 19/180 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PV++  +TYA+ W +  RK TT +D NG  NPTWNDKF F+V++E
Sbjct  8     FQLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------------GTRE  903
             FL ++ S V +EIY + WFRDV VGTV V +SNLI P+ +                G R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNNNEYRRTPPPGMRF  127

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH  726
             VALQ+RR SG PQG+LN+   L +  G+ RSMPL   M S+A GY+  L  E +++   H
Sbjct  128   VALQVRRTSGRPQGILNIGVGLLD--GSMRSMPLYTHMDSSAVGYRDLLGEEDQHLQHLH  185



>ref|XP_006410470.1| hypothetical protein EUTSA_v10016412mg [Eutrema salsugineum]
 gb|ESQ51923.1| hypothetical protein EUTSA_v10016412mg [Eutrema salsugineum]
Length=597

 Score =   162 bits (410),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 116/179 (65%), Gaps = 18/179 (10%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+ ++TYA+ W +  RK TT +D  G ANPTWNDKF F+V ++
Sbjct  7     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSED  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------------GTREV  900
             FL ++ S V VEIY + WFRDV VGT+ V +SNLI P+ +               G R V
Sbjct  67    FLYADTSAVVVEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFV  126

Query  899   ALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYH  726
             ALQ+RRPSG PQG+LN+   + +  G+ RSMPL +++ S+A GY+  L  E  ++   H
Sbjct  127   ALQVRRPSGRPQGILNIGVGILD--GSMRSMPLYTNMDSSAVGYRDLLGEEDPHLESLH  183



>ref|XP_007030351.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
 gb|EOY10853.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
Length=370

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 143/250 (57%), Gaps = 22/250 (9%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKF  1056
             ++ PP    ILEI LISA+DL PVSK+++TYA+ W  P+ K  T IDQ G  +P+WN+KF
Sbjct  1     MAPPPTHSRILEINLISAEDLAPVSKNMKTYAVAWVQPDHKLATGIDQTGRTDPSWNEKF  60

Query  1055  SFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI--------SPSEKGTREV  900
              F++DD+FL SE + + VEIY  +W +DVL+G V+V + ++           +   TR V
Sbjct  61    MFRLDDKFLNSEDAAIVVEIYAAAWVKDVLIGYVNVLIKDIFHLRSIADAKINYSATRTV  120

Query  899   ALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNS  720
              LQIRRPSG PQG+LNM   L ++  T+ S+P        +  K +   E  N LE H S
Sbjct  121   TLQIRRPSGRPQGILNMEVILLDS--TTPSVPELGDPKPKTTSKNEESFENNNELESHKS  178

Query  719   EDEERERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNG-GSMVNY  543
                     +AKI + +  +T   M D N E+ P + GSI N      GS   G GSMVN 
Sbjct  179   SP------NAKISRSQSDVTDSTMED-NLEKRP-QMGSIVND---GSGSEAKGYGSMVNG  227

Query  542   GSEVCSDVGP  513
             GS   SDVGP
Sbjct  228   GSICSSDVGP  237



>ref|XP_011041447.1| PREDICTED: uncharacterized protein LOC105137420 [Populus euphratica]
Length=459

 Score =   160 bits (405),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 146/258 (57%), Gaps = 31/258 (12%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL  VS+ ++TYA+ W +P+R+ +T +   G  NPTWNDKF F+VDD 
Sbjct  9     FQLLELNVISAQDLVKVSRKMKTYAVAWVHPDRRLSTRVTSEGCNNPTWNDKFVFRVDDR  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPS--------EKGTREVALQIRRP  879
             FL  + S V +EIY + WFRD+ +GTV V V NLI P         + G R VALQ+RRP
Sbjct  69    FLHGDTSAVMIEIYALHWFRDIHIGTVRVIVGNLIPPPRPHHHNQFQLGMRFVALQVRRP  128

Query  878   SGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERE  702
             SG PQG+LN+   L ++  + RSMPL S +  +A GY++ +  E+ N   + +  D++  
Sbjct  129   SGRPQGILNIGVALLDS--SMRSMPLYSQISVSAVGYRQLMGEEELN--HHKDDSDDKSS  184

Query  701   RLHAK--ILQW------RR------SMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVN  564
              +H+   +L W      RR      SM   ++         GK  S+ +GS V   +M+N
Sbjct  185   GIHSNSFLLPWLPKPELRRTKSDSSSMFGSIVMAKRKMIMKGKGSSMISGSEVEERNMLN  244

Query  563   GG----SMVNYGSEVCSD  522
              G    S +  GSE   +
Sbjct  245   KGRSKASSLTSGSEFVKE  262



>ref|XP_010457504.1| PREDICTED: uncharacterized protein LOC104738975 [Camelina sativa]
Length=600

 Score =   162 bits (409),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 113/180 (63%), Gaps = 19/180 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PV++  +TYA+ W +  RK TT +D NG  NPTWNDKF F+V++E
Sbjct  8     FQLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------------GTRE  903
             FL ++ S V +EIY + WFRDV VGTV V +SNLI P+ +                G R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF  127

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH  726
             VALQ+RR SG PQG+LN+   L +  G+ RSMPL   M S+A GY+  L  E  ++   H
Sbjct  128   VALQVRRTSGRPQGILNIGVGLLD--GSMRSMPLYTHMDSSAVGYRDLLGEEDHHLQHLH  185



>ref|XP_006293875.1| hypothetical protein CARUB_v10022860mg [Capsella rubella]
 gb|EOA26773.1| hypothetical protein CARUB_v10022860mg [Capsella rubella]
Length=597

 Score =   161 bits (408),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 116/179 (65%), Gaps = 18/179 (10%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+ ++TYA+ W +  RK TT +D  G ANPTWNDKF F+V ++
Sbjct  7     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSED  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------------GTREV  900
             FL ++ S V VEIY + WFRDV VGTV V +SNLI P+ +               G R V
Sbjct  67    FLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFV  126

Query  899   ALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYH  726
             ALQ+RRPSG PQG+LN+   + +  G+ RSMPL +++ S+A GY+  L  +  ++   H
Sbjct  127   ALQVRRPSGRPQGILNIGVGILD--GSMRSMPLYTNMDSSAVGYRDLLGEDDPHLQNLH  183



>ref|XP_002889512.1| hypothetical protein ARALYDRAFT_470434 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65771.1| hypothetical protein ARALYDRAFT_470434 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   161 bits (408),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 113/180 (63%), Gaps = 19/180 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PV++  +TYA+ W +  RK TT +D NG  NPTWNDKF F+V++E
Sbjct  8     FQLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------------GTRE  903
             FL ++ S V +EIY + WFRDV VGTV V +SNLI P+ +                G R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF  127

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH  726
             VALQ+RR SG PQG+LN+   L +  G+ RSMPL   M S+A GY+  L  E  ++   H
Sbjct  128   VALQVRRTSGRPQGILNIGVGLID--GSMRSMPLYTHMDSSAVGYRDLLGEEDHHLQHLH  185



>ref|XP_010105208.1| hypothetical protein L484_011265 [Morus notabilis]
 gb|EXC04073.1| hypothetical protein L484_011265 [Morus notabilis]
Length=589

 Score =   161 bits (408),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 111/167 (66%), Gaps = 19/167 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+S+RTYA+ W +P+RK +T +D  G+ NPTWNDKF F+VD++
Sbjct  7     FQLLELNVISAQDLAPVSRSMRTYAVAWVHPDRKLSTRVDTYGHTNPTWNDKFVFRVDED  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGT----------------RE  903
             FL ++ S + +EIY + WF+DV VGTV + V NLI P   G+                R 
Sbjct  67    FLHTDTSAIMIEIYALHWFKDVHVGTVRILVGNLIPPPRAGSSFGHGHSHNNYNQLGMRF  126

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKK  765
             VALQ+RRPSG PQG+LN+   +  +    RSMPL S L ++A GY++
Sbjct  127   VALQVRRPSGRPQGILNIGVAILHS--AMRSMPLYSHLSNSAVGYRE  171



>ref|NP_171948.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE27711.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=601

 Score =   161 bits (408),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 113/180 (63%), Gaps = 19/180 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PV++  +TYA+ W +  RK TT +D NG  NPTWNDKF F+V++E
Sbjct  8     FQLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------------GTRE  903
             FL ++ S V +EIY + WFRDV VGTV V +SNLI P+ +                G R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF  127

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH  726
             VALQ+RR SG PQG+LN+   L +  G+ RSMPL   M S+A GY+  L  E  ++   H
Sbjct  128   VALQVRRTSGRPQGILNIGVGLID--GSMRSMPLYTHMDSSAVGYRDLLGEEDHHLQHLH  185



>gb|KFK39933.1| hypothetical protein AALP_AA3G308600 [Arabis alpina]
Length=401

 Score =   158 bits (400),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 187/396 (47%), Gaps = 84/396 (21%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQ+L PV++ ++TYA+ W +P RK TT +D  G  +PTWNDKF F++++E 
Sbjct  8     QILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLEEEA  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L  E+S V +EIY + WF+D+ VGTV   +S+L++PS    R V L++ R SG P GLLN
Sbjct  68    LYDERSIVVIEIYALHWFKDIHVGTVQALISDLVTPSS-AMRFVTLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNI------LEYHNSEDEERERLHA  690
             ++  L +N+G  +SMPL         +++DL   K+NI      L    S+         
Sbjct  127   IAVGLIDNSG--QSMPLL--------FEEDLMFHKKNISSKPVGLRRSKSDTSSMVDSPR  176

Query  689   KILQWRRSMTPDMMSDVNGEEFPGKPGSIC--------NGSMVNGGSMVNGGSM------  552
             K+ Q R S T +  S    +EF      I         N  +     +V G  M      
Sbjct  177   KVTQTRMSSTTN--SGFEKDEFSSDSQMIVYEPQSKTPNIMLRQTKHIVYGTPMRPRNTT  234

Query  551   --------VNYGSEVC--------SDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGDS  420
                     V YG+ +         SD+GPSASVVAA+IA+  +A      E     VG+ 
Sbjct  235   AYTPKRNSVEYGTPMRSRPIVITESDLGPSASVVAAQIAKE-KAFTGKDAESTVISVGER  293

Query  419   MV-------------LPANL------TPeeakrrreaaeddeneeemeMIPKN-------  318
              V             LP  L       P    +         + +  E +P+N       
Sbjct  294   SVEGLRSKLERWQANLPVVLDVGSSYQPSSDYKTSTNFNPKSSYKPNETLPRNNQMIVAP  353

Query  317   ----AGRRKP--DNGMYSCF--VYGFQFTIVCGANN  234
                  GR K   D G++SCF  + G + +IVCG ++
Sbjct  354   LQKQVGRTKKGGDGGLFSCFGNICGIECSIVCGGSS  389



>ref|XP_009141305.1| PREDICTED: uncharacterized protein LOC103865261 [Brassica rapa]
Length=611

 Score =   161 bits (407),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 116/179 (65%), Gaps = 18/179 (10%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ LISAQDL PVS+ ++TYA+ W +  RK TT +D  G ANPTWNDKF F+V ++
Sbjct  7     FQLLELNLISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSED  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------------GTREV  900
             FL ++ S V VEIY + WFRDV VGTV V +SNLI P+ +               G R V
Sbjct  67    FLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRFV  126

Query  899   ALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYH  726
             ALQ+RRPSG PQG+LN+   + +  G+ RS+PL +++ S+A GY+  L  +  ++   H
Sbjct  127   ALQVRRPSGRPQGILNIGVGILD--GSMRSLPLYTNMDSSAVGYRDLLGEDDPHLQNLH  183



>gb|AAB80639.1| Contains similarity to Glycine SRC2 (gb|AB000130) [Arabidopsis 
thaliana]
Length=578

 Score =   161 bits (407),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 113/180 (63%), Gaps = 19/180 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PV++  +TYA+ W +  RK TT +D NG  NPTWNDKF F+V++E
Sbjct  5     FQLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEE  64

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------------GTRE  903
             FL ++ S V +EIY + WFRDV VGTV V +SNLI P+ +                G R 
Sbjct  65    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF  124

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH  726
             VALQ+RR SG PQG+LN+   L +  G+ RSMPL   M S+A GY+  L  E  ++   H
Sbjct  125   VALQVRRTSGRPQGILNIGVGLID--GSMRSMPLYTHMDSSAVGYRDLLGEEDHHLQHLH  182



>emb|CDY37732.1| BnaA04g19360D [Brassica napus]
Length=611

 Score =   161 bits (407),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 116/179 (65%), Gaps = 18/179 (10%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ LISAQDL PVS+ ++TYA+ W +  RK TT +D  G ANPTWNDKF F+V ++
Sbjct  7     FQLLELNLISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSED  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------------GTREV  900
             FL ++ S V VEIY + WFRDV VGTV V +SNLI P+ +               G R V
Sbjct  67    FLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRFV  126

Query  899   ALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYH  726
             ALQ+RRPSG PQG+LN+   + +  G+ RS+PL +++ S+A GY+  L  +  ++   H
Sbjct  127   ALQVRRPSGRPQGILNIGVGILD--GSMRSLPLYTNMDSSAVGYRDLLGEDDPHLQNLH  183



>ref|XP_003555498.1| PREDICTED: uncharacterized protein LOC100812185 [Glycine max]
Length=642

 Score =   161 bits (407),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 109/158 (69%), Gaps = 11/158 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL P+ +++RTYA+ W +P+RK +T +D  G+ NPTWNDKF F+VD+E
Sbjct  8     FQLLELNVISAQDLAPLGRNMRTYAVSWVHPDRKLSTRVDSEGHTNPTWNDKFVFRVDEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------GTREVALQIRR  882
             FL S+ S + +EIY + WF+D+ VGTV V V NL  P  K         G R +ALQ+RR
Sbjct  68    FLYSDTSAIMIEIYALHWFKDIHVGTVRVLVGNLAPPPSKPFHNNRTPLGMRFIALQVRR  127

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYK  768
             PSG PQG+LN+  T+ ++  + RSMPL    ++A GY+
Sbjct  128   PSGRPQGILNIGFTVLDS--SMRSMPLYTHNASAVGYR  163



>ref|NP_178968.1| C2 domain-containing protein [Arabidopsis thaliana]
 gb|AAD28670.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM15260.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAC43170.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63412.1| At2g13350 [Arabidopsis thaliana]
 gb|AEC06226.1| C2 domain-containing protein [Arabidopsis thaliana]
Length=401

 Score =   158 bits (400),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 188/396 (47%), Gaps = 84/396 (21%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQ+L PV++ ++TYA+ W +P RK TT +D  G  +PTWNDKF F++D+E 
Sbjct  8     QILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L    S V +EIY + WF+D+ VGTV   +S+L+SPS    R V L++ R SG P GLLN
Sbjct  68    LYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSS-AMRFVTLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNI------LEYHNSEDEERERLHA  690
             ++  L +N+G  +SMPL         +++DL   K+NI      L    S+         
Sbjct  127   IAVGLIDNSG--QSMPLL--------FEEDLLFHKKNISSKPVGLRRSKSDTSSMVDSPR  176

Query  689   KILQWRRSMTPDMMSDVNGEEFPGKPGSIC--------NGSMVNGGSMVNGGSM------  552
             K+ Q R S T +  S  + +EF      +         N        +V G  M      
Sbjct  177   KVTQSRVSSTTN--SGFDKDEFSSDSQMVVYEPQRKTPNTMRQTKQQLVYGTPMRPRKTT  234

Query  551   --------VNYGSEVC--------SDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGDS  420
                     + YG+ +         SD+GPSASVVAA+IA+  +A      E     VG+ 
Sbjct  235   AYTPKRNTIEYGTPMRSRPIVITESDLGPSASVVAAQIAKE-KALTGKDAESTVISVGER  293

Query  419   MV-------------LPANL------TPeeakrrreaaeddeneeemeMIPKN-------  318
              V             LP  L       P    +         + +  E++P+N       
Sbjct  294   SVEGLRSKLERWQANLPVVLDVGSSYQPSSDYKTNSNFNPKSSYKPNEIVPRNPQMIGAP  353

Query  317   ----AGRRKP--DNGMYSCF--VYGFQFTIVCGANN  234
                 +GR K   DNG++SCF  + G + +IVCG ++
Sbjct  354   IQKPSGRNKKSGDNGLFSCFGNICGIECSIVCGGSS  389



>ref|XP_003535258.1| PREDICTED: uncharacterized protein LOC100787698 [Glycine max]
Length=657

 Score =   161 bits (407),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 109/158 (69%), Gaps = 11/158 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+++RTYA+ W +P RK +T +D  G+ +PTWNDKF F+VD+E
Sbjct  8     FQLLELNVISAQDLAPVSRNMRTYAVSWVHPERKLSTRVDTEGHTHPTWNDKFVFRVDEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------GTREVALQIRR  882
             FL S+ S + +EIY + WF+D+ VGTV V V NL  P  K         G R VALQ+RR
Sbjct  68    FLYSDTSAIMIEIYALHWFKDIHVGTVRVLVGNLAPPPSKPFHNNRTPLGMRFVALQMRR  127

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYK  768
             PSG PQG+LN+  T+ ++  + RSMPL    ++A GY+
Sbjct  128   PSGRPQGILNIGFTVLDS--SMRSMPLYTHNASAVGYR  163



>ref|XP_010556931.1| PREDICTED: uncharacterized protein LOC104826097 [Tarenaya hassleriana]
Length=585

 Score =   160 bits (406),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 114/181 (63%), Gaps = 20/181 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+ ++TYA+ W N  R+  T +D +G +NPTWNDKF F+V++E
Sbjct  7     FQLLELNIISAQDLAPVSRKMKTYAIAWVNSERRLATRVDYSGGSNPTWNDKFVFRVNEE  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK-----------------GTR  906
             FL ++ S V +EIY + WFRDV VGTV V +SNLI PS +                 G R
Sbjct  67    FLYADTSAVMIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTGNNEYRRSTPPPGMR  126

Query  905   EVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEY  729
              VALQ+RR SG PQG+LN+   L +  G+ RSMPL   M S+A GY+  L  E  ++   
Sbjct  127   FVALQVRRTSGRPQGILNIGVGLLD--GSMRSMPLYTHMDSSAVGYRDLLGEEDPHLQHL  184

Query  728   H  726
             H
Sbjct  185   H  185



>emb|CDY23753.1| BnaC04g43690D [Brassica napus]
Length=610

 Score =   160 bits (406),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 116/179 (65%), Gaps = 18/179 (10%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ LISAQDL PVS+ ++TYA+ W +  RK TT +D  G ANPTWNDKF F+V ++
Sbjct  7     FQLLELNLISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGEANPTWNDKFVFRVSED  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------------GTREV  900
             FL ++ S V VEIY + WFRDV VGTV V +SNLI P+ +               G R +
Sbjct  67    FLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRFI  126

Query  899   ALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYH  726
             ALQ+RRPSG PQG+LN+   + +  G+ RS+PL +++ S+A GY+  L  +  ++   H
Sbjct  127   ALQVRRPSGRPQGILNIGVGILD--GSMRSLPLYTNMDSSAVGYRDLLGEDDPHLQNLH  183



>ref|XP_004495257.1| PREDICTED: proteoglycan 4-like [Cicer arietinum]
Length=713

 Score =   161 bits (407),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 108/158 (68%), Gaps = 11/158 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL  V +++RTYA+ W +P+RK +T +D  G+ NPTWNDKF F+VDDE
Sbjct  8     FQLLELNVISAQDLASVGRNMRTYAVAWVHPDRKLSTRVDTQGHTNPTWNDKFVFRVDDE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------GTREVALQIRR  882
             FL ++ S   +EIY + WF+D+ VGTV V V NLI+P  +         G R VALQ+RR
Sbjct  68    FLYNDTSAFMIEIYALHWFKDIHVGTVRVLVGNLITPPSRPFHKDNAPIGMRFVALQVRR  127

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYK  768
             PSG PQG+LN+  T+ +   + RSMPL    ++A GY+
Sbjct  128   PSGRPQGILNIGVTVLD--SSMRSMPLYTHNASAVGYR  163



>ref|XP_010522448.1| PREDICTED: uncharacterized protein LOC104801063 [Tarenaya hassleriana]
Length=580

 Score =   159 bits (401),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 117/182 (64%), Gaps = 21/182 (12%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL  VS+ ++TYA+ W +  RK TT +D +G +NPTWNDKF F+V+DE
Sbjct  7     FQLLELNIISAQDLAHVSRKMKTYAIAWVHSERKLTTRVDYSGGSNPTWNDKFVFRVNDE  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK-----------------GTR  906
             FL ++ S V +EIY + WFRDV VGTV V +SNLI PS +                 G R
Sbjct  67    FLYADTSAVMIEIYALHWFRDVHVGTVRVLISNLIPPSHRPGFRTGNNEYRRSTLPPGMR  126

Query  905   EVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEY  729
              VALQ+RR SG PQG+LN+   L +  G+ RSMPL   M S+A GY +DL  E+   L++
Sbjct  127   FVALQVRRTSGRPQGILNIGVGLLD--GSMRSMPLYTHMDSSAVGY-RDLLGEEDPHLQH  183

Query  728   HN  723
              N
Sbjct  184   LN  185



>ref|XP_002885870.1| hypothetical protein ARALYDRAFT_480303 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62129.1| hypothetical protein ARALYDRAFT_480303 [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   156 bits (395),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 126/397 (32%), Positives = 193/397 (49%), Gaps = 85/397 (21%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQ+L PV++ ++TYA+ W +P RK TT +D  G  +PTWNDKF F++D+E 
Sbjct  8     QILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L    S V +EIY + WF+D+ VGTV   +S+L+SPS    R V L++ R SG P GLLN
Sbjct  68    LYDATSIVVIEIYALHWFKDIHVGTVQTLISDLVSPSS-AMRFVTLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNI----LEYHNSEDEERERLHA--  690
             ++  L +N+G  +SMPL         +++DL   K+NI    + +  S+ +    + +  
Sbjct  127   IAVGLIDNSG--QSMPLL--------FEEDLLFHKKNISSKPVGFRRSKSDTSSMVDSPR  176

Query  689   KILQWRRSMTPDMMSDVNGEEFPG--------------------KPGSICNGSMV---NG  579
             K+ Q R S T +  S    +EF                      K   I  G+ +   N 
Sbjct  177   KVTQSRVSSTTN--SGFEKDEFSSDSQMVVYEPQRKTPNTLLRQKKQQIVYGTPMRPRNT  234

Query  578   GSMVNGGSMVNYGSEVC--------SDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGD  423
              +     + + YG+ +         SD+GPSASVVAA+IA+  +A      E     VG+
Sbjct  235   TAYTPKRNNIEYGTPMRSRPIVITESDLGPSASVVAAQIAKE-KALTGKDAESTVISVGE  293

Query  422   SMV-------------LPANL------TPeeakrrreaaeddeneeemeMIPKN------  318
               V             LP  L       P    +         + +  E++P+N      
Sbjct  294   RSVEGLRSKLERWQANLPVVLDVGSSYQPSSDYKTNSNFNPKSSYKPNEIVPRNPQMIGA  353

Query  317   -----AGRRKP--DNGMYSCF--VYGFQFTIVCGANN  234
                  +GR K   DNG++SCF  + G + +IVCG ++
Sbjct  354   PIQKQSGRNKKGGDNGLFSCFGNICGIECSIVCGGSS  390



>ref|XP_009143873.1| PREDICTED: uncharacterized protein LOC103867544 [Brassica rapa]
Length=561

 Score =   159 bits (401),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 113/176 (64%), Gaps = 17/176 (10%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQ+L PVS+ ++TYA+ W +  RK TT +D  G ANPTWNDKF F+V ++
Sbjct  7     FQLLELNIISAQELAPVSRKMKTYAVAWVHSQRKLTTRVDYTGAANPTWNDKFVFRVSED  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------------GTREV  900
             FL ++ S V VEIYT+ WFRDV VGT+ V +SNLI P+ +               G R V
Sbjct  67    FLYADTSAVVVEIYTLHWFRDVHVGTIRVLISNLIPPNRRPGYRSNEEYRHTPPLGMRFV  126

Query  899   ALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILE  732
             ALQ+RRPSG PQG+LN+   + +  G+ RS+PL   M +++   KDL  E+   L 
Sbjct  127   ALQVRRPSGRPQGILNIGVGILD--GSMRSLPLYTHMDSSAVGPKDLLGEEEPYLH  180



>ref|XP_010102203.1| hypothetical protein L484_024484 [Morus notabilis]
 gb|EXB93146.1| hypothetical protein L484_024484 [Morus notabilis]
Length=377

 Score =   155 bits (393),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 123/367 (34%), Positives = 184/367 (50%), Gaps = 60/367 (16%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              +LE+ L+SA+DL  VSKS++T+A+ W + +RK  T  DQ G  NP WN+KF+F+VDD+F
Sbjct  10    RLLELNLLSARDLATVSKSMKTFAVAWIDQDRKLETRNDQTGQNNPAWNEKFAFRVDDDF  69

Query  1031  LASEKSTVTVEIYTVSWFRD-VLVGTVSVNVSNLISPSEKG--------TREVALQIRRP  879
             L SE ST+T+EI  ++   + VLVGTVSV V++L   S            R + LQIRRP
Sbjct  70    LVSESSTITIEIRALTRRGNVVLVGTVSVLVASLFPRSSTSFQKRSFSKMRFLTLQIRRP  129

Query  878   SGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNSEDEERER  699
              G PQG+L++   L +  GT RSMPLS  +S ASGY     ++ R+        D+ER+R
Sbjct  130   CGRPQGVLDVGVALLD--GTRRSMPLSSDVS-ASGYGTTDMMDTRS--------DKERKR  178

Query  698   LHA-KILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEVCSD  522
                  +++ RRS +   +S    E    KP    NGS+++   +  G         +CSD
Sbjct  179   KSLPNMIKLRRSKSDRSIS----ESCLLKP---TNGSLISCSDLGKG------KESLCSD  225

Query  521   VGPSASVVAAEIAQSWQASAAPRKEIMERGVGDSMVLP--------------------AN  402
             VGPS SVVAA IA     + A         + +S +L                     + 
Sbjct  226   VGPSPSVVAAAIAMGRYPAKAKDSGGAANEMAESSILEEWTEEDDSAEGLKTKIERWRSE  285

Query  401   LTPeeakrrreaaeddeneeemeMIPKNAGRRKP----DNGMYSCF--VYGFQFTIVCGA  240
             + P    + ++               +N   +K      +G++SCF   YG +F+I CG 
Sbjct  286   IHPLYQSQYKKNMSYHRENYNRSTHRRNEPAKKELRRGGSGLFSCFGNAYGCEFSITCGG  345

Query  239   NNNPPKT  219
              ++  K+
Sbjct  346   GSSRRKS  352



>ref|XP_010413889.1| PREDICTED: uncharacterized protein LOC104700118 [Camelina sativa]
Length=596

 Score =   158 bits (400),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 117/179 (65%), Gaps = 18/179 (10%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL P+S+ ++TYA+ W +  RK TT +D +G  NPTWNDKF F+V+++
Sbjct  7     FQLLELNIISAQDLAPLSRKMKTYAVAWVHSERKLTTRVDYSGGVNPTWNDKFVFRVNED  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------------GTREV  900
             FL ++ S V VEIY + WFRDV VGTV V +SNLI P+ +               G R V
Sbjct  67    FLYADTSAVVVEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFV  126

Query  899   ALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYH  726
             ALQ+RRPSG PQG+LN+   + +  G+ RSMPL +++ S+A GY+  L  +  ++   H
Sbjct  127   ALQVRRPSGRPQGILNIGVGILD--GSMRSMPLYTNMDSSAVGYRDLLGEDDPHLQNLH  183



>ref|XP_010469493.1| PREDICTED: uncharacterized protein LOC104749540 [Camelina sativa]
Length=596

 Score =   158 bits (400),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 116/179 (65%), Gaps = 18/179 (10%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL P+S+ ++TYA+ W +  RK TT +D  G  NPTWNDKF F+V+++
Sbjct  7     FQLLELNIISAQDLAPLSRKMKTYAVAWVHSERKLTTRVDYTGGVNPTWNDKFVFRVNED  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------------GTREV  900
             FL ++ S V VEIY + WFRDV VGTV V +SNLI P+ +               G R V
Sbjct  67    FLYADTSAVVVEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFV  126

Query  899   ALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYH  726
             ALQ+RRPSG PQG+LN+   + +  G+ RSMPL +++ S+A GY+  L  +  ++   H
Sbjct  127   ALQVRRPSGRPQGILNIGVGILD--GSMRSMPLYTNMDSSAVGYRDLLGEDDPHLQNLH  183



>ref|XP_010509905.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Camelina 
sativa]
Length=596

 Score =   158 bits (400),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 116/179 (65%), Gaps = 18/179 (10%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL P+S+ ++TYA+ W +  RK TT +D  G  NPTWNDKF F+V+++
Sbjct  7     FQLLELNIISAQDLAPLSRKMKTYAVAWVHSERKLTTRVDYTGGVNPTWNDKFVFRVNED  66

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------------GTREV  900
             FL ++ S V VEIY + WFRDV VGTV V +SNLI P+ +               G R V
Sbjct  67    FLYADTSAVVVEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFV  126

Query  899   ALQIRRPSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYH  726
             ALQ+RRPSG PQG+LN+   + +  G+ RSMPL +++ S+A GY+  L  +  ++   H
Sbjct  127   ALQVRRPSGRPQGILNIGVGILD--GSMRSMPLYTNMDSSAVGYRDLLGEDDPHLQNLH  183



>emb|CDY37206.1| BnaA09g08270D [Brassica napus]
Length=407

 Score =   154 bits (389),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 125/392 (32%), Positives = 188/392 (48%), Gaps = 70/392 (18%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQ+L PV++ ++TYA+ W +P RK TT +D  G  +PTWNDKF F++D+E 
Sbjct  8     QILEMNIISAQELAPVARCMKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L    S V +EIY + WF+D+ VGTV   +S+L++PS  G R V L++ R SG P GLLN
Sbjct  68    LYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS-GMRFVTLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPL---SDLM-------STASGYKKD-------LELEKRNILEYHN  723
             ++  L +N+G  +SMPL    DLM       S   G ++        +E  ++ + +   
Sbjct  127   IAVGLIDNSG--QSMPLLFEEDLMFHKTNITSKPVGLRRSKSDTSSMVESPRKKVTQQQT  184

Query  722   S----------EDEERERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMV--NG  579
             +          E +E       ++   +  TP+ MS        G P    N +      
Sbjct  185   TRVSSTTNSGFEKDEFSSDSQMVVYEPQRKTPNTMSRQTKHIVHGTPMRPRNTNAFTPKR  244

Query  578   GSMVNGGSMVNYGSEVC---SDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGDSMV--  414
              S+  G  M +    V    SD+GPSASVVAA+IA+  +A      E     VG+  V  
Sbjct  245   NSIEYGTPMRSRSRPVVITESDLGPSASVVAAQIAKE-KALTGRDAESTVISVGERSVEG  303

Query  413   -----------LPANL------TPeeakrrreaaeddeneeemeMIPKN-----------  318
                        LP  L       P    +     +   + +  E +P+N           
Sbjct  304   LRSKLERWQANLPVVLDVGSSYQPSSDYKTSSNFKPKSSYKPNETVPRNQQMIVAPLPKQ  363

Query  317   AGRRKP--DNGMYSCF--VYGFQFTIVCGANN  234
              GR K   DNG++SCF  + G + +IVCG ++
Sbjct  364   GGRNKKGGDNGLFSCFGNICGIECSIVCGGSS  395



>ref|XP_010467176.1| PREDICTED: uncharacterized protein LOC104747266 [Camelina sativa]
Length=404

 Score =   153 bits (386),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 123/395 (31%), Positives = 186/395 (47%), Gaps = 86/395 (22%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQ+L PV++ ++TYA+ W +P RK TT +D  G  +PTWNDKF F++D+E 
Sbjct  8     QILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L    S V +EIY + WF+D+ VGTV   +S+L+SPS    R V L++ R SG P GLLN
Sbjct  68    LYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSS-AMRFVTLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNI------LEYHNSEDEERERLHA  690
             ++  L +N+G  +SMPL         +++DL   K+NI      L    S+         
Sbjct  127   IAVGLIDNSG--QSMPLL--------FEEDLLFHKKNISSKPVGLRRSKSDTSSMVDSPR  176

Query  689   KILQWRRSMTPDMMSDVNGEEFPG--------------------KPGSICNGSMV---NG  579
             K+ Q R S T +  S    +EF                      K   I  G+ +   N 
Sbjct  177   KVTQSRVSSTTN--SGFEKDEFSSDSQMVVYEPQRKTPNTLLRQKKQQIVYGTPMRPRNK  234

Query  578   GSMVNGGSMVNYGSEVC--------SDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGD  423
              +     + + YG+ +         SD+GPSASVVAA+IA+  +A      E     VG+
Sbjct  235   TAYTPKRNNIEYGTPMRSRPIIITESDLGPSASVVAAQIAKE-KALTGKDAESTVISVGE  293

Query  422   SMV-------------LP------ANLTPeeakrrreaaeddeneeemeMIPKNA-----  315
               V             LP      ++  P    +         + +  E++P+N      
Sbjct  294   RSVEGLRSKLERWQANLPVVVDVGSSYQPSSDYKTNSNFNPKSSYKPNEIVPRNTQMVGA  353

Query  314   ---------GRRKPDNGMYSCF--VYGFQFTIVCG  243
                       ++  DNG++SCF  + G + +IVCG
Sbjct  354   PLAKQGGRNNKKGGDNGLFSCFGNICGIECSIVCG  388



>ref|XP_010518533.1| PREDICTED: uncharacterized protein LOC104793798 [Camelina sativa]
Length=404

 Score =   153 bits (386),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 123/395 (31%), Positives = 186/395 (47%), Gaps = 86/395 (22%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQ+L PV++ ++TYA+ W +P RK TT +D  G  +PTWNDKF F++D+E 
Sbjct  8     QILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L    S V +EIY + WF+D+ VGTV   +S+L+SPS    R V L++ R SG P GLLN
Sbjct  68    LYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSS-AMRFVTLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNI------LEYHNSEDEERERLHA  690
             ++  L +N+G  +SMPL         +++DL   K+NI      L    S+         
Sbjct  127   IAVGLIDNSG--QSMPLL--------FEEDLLFHKKNISSKPVGLRRSKSDTSSMVDSPR  176

Query  689   KILQWRRSMTPDMMSDVNGEEFPG--------------------KPGSICNGSMV---NG  579
             K+ Q R S T +  S    +EF                      K   I  G+ +   N 
Sbjct  177   KVTQSRVSSTTN--SGFEKDEFSSDSQMVVYEPQRKTPNTLLRQKKQQIVYGTPMRPRNK  234

Query  578   GSMVNGGSMVNYGSEVC--------SDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGD  423
              +     + + YG+ +         SD+GPSASVVAA+IA+  +A      E     VG+
Sbjct  235   TAYTPKRNNIEYGTPMRSRPIVITESDLGPSASVVAAQIAKE-KALTGKDAESTVISVGE  293

Query  422   SMV-------------LP------ANLTPeeakrrreaaeddeneeemeMIPKNA-----  315
               V             LP      ++  P    +         + +  E++P+N      
Sbjct  294   RSVEGLRSKLERWQANLPVVVDVGSSYQPSSDYKTNSNFNPKSSYKPNEIVPRNTQMVGA  353

Query  314   ---------GRRKPDNGMYSCF--VYGFQFTIVCG  243
                       ++  DNG++SCF  + G + +IVCG
Sbjct  354   PLAKQGGRNNKKGGDNGLFSCFGNICGIECSIVCG  388



>ref|XP_006300066.1| hypothetical protein CARUB_v10016294mg [Capsella rubella]
 gb|EOA32964.1| hypothetical protein CARUB_v10016294mg [Capsella rubella]
Length=404

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 122/395 (31%), Positives = 182/395 (46%), Gaps = 84/395 (21%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQ+L PV++ ++TYA+ W +P RK  T +D  G   PTWNDKF F++D+E 
Sbjct  8     QILELNIISAQELAPVARCMKTYAIAWIDPERKLMTRVDNTGGTTPTWNDKFVFRLDEET  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
                + + V +EIY + WF+D+ VGTV   +S+L+SPS    R V L++ R SG P GLLN
Sbjct  68    TYDDTTIVVIEIYALHWFKDIHVGTVQALISDLVSPSS-AMRFVTLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNI------LEYHNSEDEERERLHA  690
             ++  L +N+G   SMPL         Y++DL   K+NI      L    S+         
Sbjct  127   IAVGLIDNSG--HSMPLL--------YEEDLLFHKKNISTKPVGLRRSKSDTSSMVDSPR  176

Query  689   KILQWRRSMTPDMMSDVNGEEFPG--------------------KPGSICNGSMV---NG  579
             K+ Q   S T +  S    +EF                      K   I  G+ +   N 
Sbjct  177   KVTQSHMSYTTN--SGFEKDEFSSDSQMVVYESQSKTPNTLLRQKKQQIVYGTPMRPRNT  234

Query  578   GSMVNGGSMVNYGSEVC--------SDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGD  423
              +     + + YG+ +         SD+GPSASVVAA+IA+    +     E     VG+
Sbjct  235   TAYTPKRNRIEYGTPMRSRPIVITESDLGPSASVVAAQIAKEKALTGKLDAESTVISVGE  294

Query  422   SMV-------------LP------ANLTPeeakrrreaaeddeneeemeMIPKN------  318
               V             LP      ++  P    +         + +  E++P+N      
Sbjct  295   RSVEGLRSKLERWQANLPVVVDVGSSYQPSSDYKTNSFNVPKSSYKPNEIVPRNTQMIVP  354

Query  317   -----AGRRKP--DNGMYSCF--VYGFQFTIVCGA  240
                   GR K   DNG++SCF  + G + +IVCG 
Sbjct  355   LPKQQGGRNKKGGDNGLFSCFGNICGIECSIVCGG  389



>ref|XP_004497792.1| PREDICTED: uncharacterized protein LOC101505544 [Cicer arietinum]
Length=451

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 106/161 (66%), Gaps = 12/161 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             Y +LE+ +ISAQDL PV +S+RTYA+ W +P+RK +T +D +G  NP WNDKF F+VDD+
Sbjct  8     YQLLELNVISAQDLAPVGRSMRTYAVAWVDPDRKLSTRVDSHGGINPAWNDKFVFRVDDD  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSE---------KGTREVALQIRR  882
             FL  E S +T++IY + WF+D+ VGT  V   ++I PS           G R V LQ+RR
Sbjct  68    FLNDENSIITIDIYALHWFKDIHVGTALVLADDIIPPSRPSHNKNYKPPGMRFVGLQVRR  127

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPLSDLMST-ASGYKKD  762
             PSG P+G+LN+   + ++  + RSMPL    +T A GY +D
Sbjct  128   PSGRPKGILNVGVVVIDS--SMRSMPLYTHDNTPAVGYHQD  166



>ref|XP_003556915.1| PREDICTED: uncharacterized protein LOC100779058 [Glycine max]
Length=449

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 105/160 (66%), Gaps = 11/160 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             Y +LE+ +ISAQDL PV +S+RTYA+ W +P+RK +T +D  G  NPTWNDKF F+VD++
Sbjct  8     YQLLELNVISAQDLAPVGRSMRTYAIAWIDPDRKLSTRVDSQGGTNPTWNDKFVFRVDED  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------GTREVALQIRR  882
             FL  E+S +T++IY + WFRD+ VG+  V   +L  P  +         G + + LQ++R
Sbjct  68    FLYDEESVITIDIYALHWFRDIHVGSAQVLSGDLFPPPTQPQKNTYKSTGMQFMGLQVQR  127

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKD  762
             PSG P+G+LN+ A + ++  + RSMPL    S A GY  D
Sbjct  128   PSGRPKGILNIGAAIIDS--SMRSMPLYTQNSPAVGYSHD  165



>emb|CDX81442.1| BnaC09g08530D [Brassica napus]
Length=408

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 122/393 (31%), Positives = 186/393 (47%), Gaps = 71/393 (18%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQ+L PV++ ++TYA+ W +P RK TT +D  G  +PTWNDKF F++D+E 
Sbjct  8     QILEMNIISAQELAPVARCMKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L    S V +EIY + WF+D+ VGTV   +S+L++PS  G R V L++ R SG P GLLN
Sbjct  68    LYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS-GMRFVTLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPL---SDLM-------STASGYKKD-------LELEKRNILEYHN  723
             ++  L +N+G  +SMPL    DLM       S   G ++        +E  ++ + +   
Sbjct  127   IAVGLIDNSG--QSMPLLFEEDLMFHKTNITSKPVGLRRSKSDTSSMVESPRKKVTQQQT  184

Query  722   S-----------EDEERERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSI--CNGSMVN  582
             +           +DE        + +  +  TP+ MS        G P      N     
Sbjct  185   TRVSSTTNSGFEKDEFSSDSQMVVYEPAQRKTPNTMSRQTKHIVHGTPMRPRNTNAYTPK  244

Query  581   GGSMVNGGSMVNYGSEVC---SDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGDSMV-  414
               S+  G  M +    V    SD+GPSASVVAA+IA+  +A      E     VG+  V 
Sbjct  245   RNSIEYGTPMRSRSRPVVITESDLGPSASVVAAQIAKE-KALTGKDAESTVISVGERSVE  303

Query  413   ------------LPANL------TPeeakrrreaaeddeneeemeMIPKN----------  318
                         LP  L       P    +     +   + +  E +P+N          
Sbjct  304   GLRSKLERWQANLPVVLDVGSSYQPSSDYKTSSNFKPKSSYKPNETVPRNQQMIVAPVPK  363

Query  317   ---AGRRKPDNGMYSCF--VYGFQFTIVCGANN  234
                  ++  DNG++SCF  + G + +IVCG ++
Sbjct  364   QGGRKKKGGDNGLFSCFGNICGIECSIVCGGSS  396



>ref|XP_006409691.1| hypothetical protein EUTSA_v10022712mg [Eutrema salsugineum]
 gb|ESQ51144.1| hypothetical protein EUTSA_v10022712mg [Eutrema salsugineum]
Length=400

 Score =   151 bits (381),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 122/396 (31%), Positives = 183/396 (46%), Gaps = 85/396 (21%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQ+L PV++ ++TYA+ W +P RK  T +D  G  +PTWNDKF F++D+E 
Sbjct  8     QILELNIISAQELAPVARCMKTYAIAWIDPERKLMTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L    S V +EIY + WF+D+ VGTV   +S+L++PS    R + L++ R SG P GLLN
Sbjct  68    LYHGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS-AMRFITLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNI------LEYHNSEDEERERLHA  690
             ++  + +N+G  +SMPL         +++DL   K+NI      L    S+         
Sbjct  127   IAVGVIDNSG--QSMPLL--------FEEDLMFHKKNISSKPIALRRSKSDSSSMVESPR  176

Query  689   KILQWRRSMTPDMMSDVNGEEFPGKPGSIC--------NGSMVNGGSMVNGGSM------  552
             ++ Q R S T    S    +EF      +         N  +      V G  M      
Sbjct  177   RVAQTRMSST---TSGFEKDEFSSDSQMVVYEPQRKTPNTMLRQTKHTVYGTPMRPRNTN  233

Query  551   --------VNYGSEVC--------SDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGDS  420
                     + YG+ +         SD+GPSASVVAA+IA+  +A      E     VG+ 
Sbjct  234   AYTPKRNNIEYGTPMRSRPVVITESDLGPSASVVAAQIAKE-KAMTGKDAESTVISVGER  292

Query  419   MV-------------LPANL------TPeeakrrreaaeddeneeemeMIPKN-------  318
              V             LP  L       P    +         + +  E +P+N       
Sbjct  293   SVEGLRSKLERWQANLPVVLDVGSSYQPSSDYKTSSNFNPKSSYKPNETVPRNQQMIVAP  352

Query  317   ----AGRRKP--DNGMYSCF--VYGFQFTIVCGANN  234
                 A R K   DNG++SCF  + G + +IVCG ++
Sbjct  353   VQKQARRNKKGGDNGLFSCFGNICGIECSIVCGGSS  388



>emb|CDY37207.1| BnaA09g08280D [Brassica napus]
Length=407

 Score =   150 bits (380),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 122/392 (31%), Positives = 187/392 (48%), Gaps = 70/392 (18%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQ+L PV++ ++TYA+ W +P RK TT +D  G  +PTWNDKF F++D+E 
Sbjct  8     QILEMNIISAQELAPVARCMKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L    S V +EIY + WF+D+ VGTV   +S+L++PS  G R V L++ R SG P GLLN
Sbjct  68    LYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS-GMRFVTLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPL---SDLM-------STASGYKKD-------LELEKRNILEYHN  723
             ++  L +N+G  +SMPL    DLM       S   G ++        +E  ++ + +   
Sbjct  127   IAVGLIDNSG--QSMPLLFEEDLMFHKTNITSKPVGLRRSKSDTSSMVESPRKKVTQQQT  184

Query  722   S----------EDEERERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMV--NG  579
             +          E +E       ++   +  TP+ MS        G P    N +      
Sbjct  185   TRVSSTTNSGFEKDEFSSDSQMVVYEPQRKTPNTMSRQTKHIVHGTPMRPRNTNAFTPKR  244

Query  578   GSMVNGGSMVNYGSEVC---SDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGDSMV--  414
              S+  G  M +    V    SD+GPSASVVAA+IA+  +A      E     VG+  V  
Sbjct  245   NSIEYGTPMRSRSRPVVITESDLGPSASVVAAQIAKE-KALTGRDAESTVISVGERSVEG  303

Query  413   -----------LPANL------TPeeakrrreaaeddeneeemeMIPKN-----------  318
                        LP  L       P    +     +   + +  E +P+N           
Sbjct  304   LRSKLERWQANLPVVLDVGSSYQPSSDYKTSSNFKPKSSYKPNETVPRNQQMIVAPVPKQ  363

Query  317   --AGRRKPDNGMYSCF--VYGFQFTIVCGANN  234
                 ++  DNG++SCF  + G + +IVCG ++
Sbjct  364   GGRKKKGGDNGLFSCFGNICGIECSIVCGGSS  395



>ref|XP_009112245.1| PREDICTED: uncharacterized protein LOC103837642 [Brassica rapa]
Length=407

 Score =   150 bits (379),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 122/392 (31%), Positives = 187/392 (48%), Gaps = 70/392 (18%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQ+L PV++ ++TYA+ W +P RK TT +D  G  +PTWNDKF F++D+E 
Sbjct  8     QILEMNIISAQELAPVARCMKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L    S V +EIY + WF+D+ VGTV   +S+L++PS  G R V L++ R SG P GLLN
Sbjct  68    LYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS-GMRFVTLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPL---SDLM-------STASGYKKD-------LELEKRNILEYHN  723
             ++  L +N+G  +SMPL    DLM       S   G ++        +E  ++ + +   
Sbjct  127   IAVGLIDNSG--QSMPLLFEEDLMFHKTNITSKPVGLRRSKSDTSSMVESPRKKVTQQQT  184

Query  722   S----------EDEERERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMV--NG  579
             +          E +E       ++   +  TP+ MS        G P    N +      
Sbjct  185   TRVSSTTNSGFEKDEFSSDSQMVVYEPQRKTPNTMSRQTKHIVHGTPMRPRNTNAFTPKR  244

Query  578   GSMVNGGSMVNYGSEVC---SDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGDSMV--  414
              S+  G  M +    V    SD+GPSASVVAA+IA+  +A      E     VG+  V  
Sbjct  245   NSIEYGTPMRSRSRPVVITESDLGPSASVVAAQIAKE-KALTGRDAESTVISVGERSVEG  303

Query  413   -----------LPANL------TPeeakrrreaaeddeneeemeMIPKN-----------  318
                        LP  L       P    +     +   + +  E +P+N           
Sbjct  304   LRSKLERWQANLPVVLDVGSSYQPSSDYKTSSNFKPKSSYKPNETVPRNQQMIVAPLPKQ  363

Query  317   --AGRRKPDNGMYSCF--VYGFQFTIVCGANN  234
                 ++  DNG++SCF  + G + +IVCG ++
Sbjct  364   GGRKKKGGDNGLFSCFGNICGIECSIVCGGSS  395



>ref|XP_010674263.1| PREDICTED: uncharacterized protein LOC104890461 [Beta vulgaris 
subsp. vulgaris]
Length=372

 Score =   149 bits (376),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 102/142 (72%), Gaps = 5/142 (4%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +L I +ISA+DL PVSKS+ TY + W NPNRK TT +D  GN  P WNDKF F+V  +
Sbjct  5     FQLLHINIISARDLAPVSKSMNTYVVGWVNPNRKLTTRVDHKGNNCPEWNDKFVFRVTPK  64

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGT--REVALQIRRPSGSPQ  864
             FL S+ S V +EIY+ +W RD L+G+V V+++NLI +  + G+  R VALQIRRPSG PQ
Sbjct  65    FLNSDSSIVDIEIYSQAWLRDALIGSVRVSIANLIPTGYQNGSTRRSVALQIRRPSGRPQ  124

Query  863   GLLNMSATLQENTGTSRSMPLS  798
             G+LN+  ++ +  G+ +SMPLS
Sbjct  125   GILNVVVSVLD--GSRQSMPLS  144



>ref|XP_010488836.1| PREDICTED: uncharacterized protein LOC104766620 [Camelina sativa]
Length=403

 Score =   149 bits (377),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 123/398 (31%), Positives = 186/398 (47%), Gaps = 86/398 (22%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQ+L PV++ ++TYA+ W +P RK TT +D  G  +PTWNDKF F++D+E 
Sbjct  8     QILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L    S V +EIY + WF+D+ VGTV   +S+L+SPS    R V L++ R SG P GLLN
Sbjct  68    LYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSS-AMRFVTLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNI------LEYHNSEDEERERLHA  690
             ++  L +N+G  +SMPL         ++ DL   K+NI      L    S+         
Sbjct  127   IAVGLIDNSG--QSMPLL--------FEDDLLFHKKNISPKPVGLRRSKSDTSSMVDSPR  176

Query  689   KILQWRRSMTPDMMSDVNGEEFPG--------------------KPGSICNGSMV---NG  579
             K+ Q R S T +  S    +EF                      K   I  G+ +   N 
Sbjct  177   KVTQSRVSSTTN--SGFEKDEFSSDSQMVVYEHQRKTPNTLLRQKKQQIVYGTPMRPRNK  234

Query  578   GSMVNGGSMVNYGSEVC--------SDVGPSASVVAAEIAQSWQASAAPRKEIMERGVGD  423
              +     + + YG+ +         SD+GPSASVVAA+IA+  +A      E     VG+
Sbjct  235   TAYTPKRNNIEYGTPMRSRPIIITESDLGPSASVVAAQIAKE-KALTGKDAESTVISVGE  293

Query  422   SMV-------------LP------ANLTPeeakrrreaaeddeneeemeMIPKNA-----  315
               V             LP      ++  P    +         N +  E++P+N      
Sbjct  294   RSVEGLRSKLERWQANLPVVVDVGSSYQPSSEYKTNSNFNPKSNYKPNEIVPRNTQMVGA  353

Query  314   ---------GRRKPDNGMYSCF--VYGFQFTIVCGANN  234
                       ++  D G++SCF  + G + +IVCG ++
Sbjct  354   PLAKQGGRNNKKGGDYGLFSCFGNICGIECSIVCGGSS  391



>ref|XP_007145354.1| hypothetical protein PHAVU_007G232100g [Phaseolus vulgaris]
 gb|ESW17348.1| hypothetical protein PHAVU_007G232100g [Phaseolus vulgaris]
Length=438

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 105/161 (65%), Gaps = 12/161 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL P  +S+RTYA+ W +P+RK +T +D +G  NPTWNDKF F++D +
Sbjct  8     FQLLELHVISAQDLAPAGRSMRTYAVAWIDPDRKLSTRVDSHGGTNPTWNDKFVFRMDQD  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK----------GTREVALQIR  885
             FL  + S +T++IY + WFRD+ VGT  V  ++L  PS +          G R + LQ++
Sbjct  68    FLYDDSSVITIDIYALHWFRDIHVGTAEVLSTDLFPPSSQPQQPNAYKSTGMRFLGLQVQ  127

Query  884   RPSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKD  762
             RPSG P+G+LN+ A + ++  + RSMPL    S   GY +D
Sbjct  128   RPSGRPKGILNVGAAIIDS--SMRSMPLYSQNSPIIGYSQD  166



>emb|CDX89815.1| BnaA10g02670D [Brassica napus]
Length=498

 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 110/171 (64%), Gaps = 10/171 (6%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL PVS+ ++TYA+ W +  RK TT +D N   NPTWNDKF F+VD+E
Sbjct  8     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNAGTNPTWNDKFVFRVDEE  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK-GTREVALQIRR--PSG---  873
             FL ++ S V +EIY + WFRDV VGTV V +SNLI PS + G R    + RR  P G   
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPQGMRF  127

Query  872   -SPQGLLNMSATLQENTGTSRSMPLSDLM-STASGYKKDLELEKRNILEYH  726
              + QG+LN+   + +  G+ RSMPL   M S+A GY+  L  E R++   H
Sbjct  128   VALQGILNIGVGVLD--GSMRSMPLYTHMDSSAVGYRDLLGEEDRHLQHLH  176



>gb|KCW57325.1| hypothetical protein EUGRSUZ_H00124 [Eucalyptus grandis]
Length=153

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 97/145 (67%), Gaps = 9/145 (6%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             +H+LE+ +ISAQDL PVS+ +RTYA+VW +P+ K  T +D  G  +PTWND+F F+V++E
Sbjct  9     FHLLEVDIISAQDLAPVSRYMRTYAVVWVHPDGKLPTRVDACGRCDPTWNDRFVFRVNEE  68

Query  1034  FLASEKSTVTVEIYTV-SWFRDVLVGTVSVNVSNLI-SPSEKGTRE-------VALQIRR  882
             FL  + S V +EIY V   F+DV VGTV V VSN    PS    RE       +ALQ+RR
Sbjct  69    FLRRDTSAVMIEIYAVRRLFKDVRVGTVRVLVSNFFPRPSRSFRREQHSGRHVMALQVRR  128

Query  881   PSGSPQGLLNMSATLQENTGTSRSM  807
             PSG PQG+LN+   L +++  S+ M
Sbjct  129   PSGRPQGILNVGVALLDSSTRSKPM  153



>gb|KCW60206.1| hypothetical protein EUGRSUZ_H02915 [Eucalyptus grandis]
Length=452

 Score =   145 bits (365),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 110/159 (69%), Gaps = 12/159 (8%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL  V++++RTYA+ W +P+RK +T +D NG  +PTWNDKF F+VD+E
Sbjct  9     FQLLELNIISAQDLAMVARTMRTYAVAWVHPDRKLSTRVDSNGRNSPTWNDKFVFRVDEE  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------GTREVALQIRR  882
             FL S+ S V +EIY V WF+DVLVG V V V +L++P            G R VALQ+RR
Sbjct  69    FLRSDTSGVMIEIYAVHWFKDVLVGRVRVLVGHLVTPQPHPFRHQQHHVGMRFVALQVRR  128

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPLS-DLMSTASGYK  768
             PSG PQG+LN+   + ++  + RSMPL   L ++A GY+
Sbjct  129   PSGRPQGILNIGVAVLDS--SMRSMPLYMQLNASAVGYR  165



>ref|XP_010026783.1| PREDICTED: protein bunched, class 2/F/G isoform-like [Eucalyptus 
grandis]
Length=456

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 110/159 (69%), Gaps = 12/159 (8%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LE+ +ISAQDL  V++++RTYA+ W +P+RK +T +D NG  +PTWNDKF F+VD+E
Sbjct  9     FQLLELNIISAQDLAMVARTMRTYAVAWVHPDRKLSTRVDSNGRNSPTWNDKFVFRVDEE  68

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEK---------GTREVALQIRR  882
             FL S+ S V +EIY V WF+DVLVG V V V +L++P            G R VALQ+RR
Sbjct  69    FLRSDTSGVMIEIYAVHWFKDVLVGRVRVLVGHLVTPQPHPFRHQQHHVGMRFVALQVRR  128

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPLS-DLMSTASGYK  768
             PSG PQG+LN+   + ++  + RSMPL   L ++A GY+
Sbjct  129   PSGRPQGILNIGVAVLDS--SMRSMPLYMQLNASAVGYR  165



>ref|XP_003590193.1| hypothetical protein MTR_1g045780 [Medicago truncatula]
 gb|AES60444.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=459

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 104/161 (65%), Gaps = 12/161 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             Y +LE+ +ISAQDL  V +S+RTYA+ W +P+RK +T +D     NP WNDKF F+VD++
Sbjct  8     YQLLELNVISAQDLAEVGRSMRTYAVAWVDPDRKLSTRVDSQSGTNPAWNDKFVFRVDED  67

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSE---------KGTREVALQIRR  882
             FL  E ST+T++IY + WF+D+ VGT  V   ++I PS          +G + V LQ+ R
Sbjct  68    FLYDENSTITIDIYAIHWFKDIHVGTAHVLADDIIPPSRPSHSNNYKPQGMQFVGLQVHR  127

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPLSDLMST-ASGYKKD  762
             PSG P+G+LN+   + ++  + RSMPL    +T  +GY ++
Sbjct  128   PSGRPKGILNVGVAVIDS--SMRSMPLYTHNNTPTAGYHQN  166



>gb|AFK13837.1| C2 domain-containing protein SRC2 [Beta vulgaris subsp. vulgaris]
Length=331

 Score =   140 bits (354),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +L I +ISA+DL PVSKS+ TY + W NP RK TT +D  GN  P WNDKF F+V  +
Sbjct  5     FQLLHINIISARDLAPVSKSMNTYVVGWVNPYRKLTTRVDHKGNNCPEWNDKFVFRVTPK  64

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGT--REVALQIRRPSGSPQ  864
             FL S+ S V +EIY+ +W RD L+G+V V+++NLI +  + G+  R VALQIRRPSG PQ
Sbjct  65    FLNSDSSIVDIEIYSQAWLRDALIGSVRVSIANLIPTGYQNGSTRRSVALQIRRPSGRPQ  124

Query  863   GLLNMSATLQENT  825
             G+LN+  ++ + T
Sbjct  125   GILNVVVSVLDGT  137



>emb|CDX89605.1| BnaC03g45190D [Brassica napus]
Length=406

 Score =   142 bits (357),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 95/283 (34%), Positives = 146/283 (52%), Gaps = 50/283 (18%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQ+L PV++ ++TYA+ W +P  K TT +D  G  +PTWNDKF F++D+E 
Sbjct  8     QILELNVISAQELAPVARCMKTYAIAWIDPECKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L    S V +EIY + WF+D+ VGTV   +S+L+ PS    R V L++ R SG P GLLN
Sbjct  68    LYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVDPSS-AMRFVTLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILE-----YHNSEDEERERLHA-  690
             ++  L +N+G  +SMPL         +++DL   K+ I+         S+ +    + + 
Sbjct  127   IAVGLIDNSG--QSMPLL--------FEEDLMFHKKKIISSKPAGLRRSKSDTSSMVESP  176

Query  689   --KILQWRRSMTPDMMSDVNGEEFPG-------KPGSICNGSMVNGGSM-VNGGSM----  552
               K+ Q +  ++    S    ++F         KP      +M+      V G  M    
Sbjct  177   RKKVAQQQTRVSSTTNSGFEKDDFSSDSQMVVYKPQKKTPNAMLKQTKHNVYGTPMRPKN  236

Query  551   -----------VNYGSEVC--------SDVGPSASVVAAEIAQ  480
                        + YG+ +         SD+GPSASVVAA+IA+
Sbjct  237   KNAYTTPKRKNIEYGTPMRSRPVVITESDLGPSASVVAAQIAK  279



>ref|XP_009136211.1| PREDICTED: uncharacterized protein LOC103860372 [Brassica rapa]
 emb|CDX93113.1| BnaA03g38350D [Brassica napus]
Length=404

 Score =   142 bits (357),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 95/283 (34%), Positives = 146/283 (52%), Gaps = 50/283 (18%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQ+L PV++ ++TYA+ W +P  K TT +D  G  +PTWNDKF F++D+E 
Sbjct  8     QILELNVISAQELAPVARCMKTYAIAWIDPECKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L    S V +EIY + WF+D+ VGTV   +S+L+ PS    R V L++ R SG P GLLN
Sbjct  68    LYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVDPSS-AMRFVTLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILE-----YHNSEDEERERLHA-  690
             ++  L +N+G  +SMPL         +++DL   K+ I+         S+ +    + + 
Sbjct  127   IAVGLIDNSG--QSMPLL--------FEEDLMFHKKKIISSKPVGLRRSKSDTSSMVESP  176

Query  689   --KILQWRRSMTPDMMSDVNGEEFPG-------KPGSICNGSMVNGGSM-VNGGSM----  552
               K+ Q +  ++    S    ++F         KP      +M+      V G  M    
Sbjct  177   RKKVAQQQTRVSSTTNSGFEKDDFSSDSQMVVYKPQKKTPNAMLKQTKHNVYGTPMRPKN  236

Query  551   -----------VNYGSEVC--------SDVGPSASVVAAEIAQ  480
                        + YG+ +         SD+GPSASVVAA+IA+
Sbjct  237   KNAYTTPKRKNIEYGTPMRSRPVVITESDLGPSASVVAAQIAK  279



>emb|CDY49343.1| BnaA05g33050D [Brassica napus]
Length=384

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 108/180 (60%), Gaps = 18/180 (10%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             +LEI LISAQDL P+SK+++TY++ W  T+P RK TT +DQ   ANP WN+KF F+VDD+
Sbjct  10    VLEINLISAQDLAPISKNMKTYSVAWINTDPMRKLTTRVDQANRANPIWNEKFVFRVDDK  69

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SEKGTREVALQ  891
              L  + S++ +EIY  +W +D LVGTV+V +S+L +P                 R V LQ
Sbjct  70    ILDVDASSIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  890   IRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNSEDE  711
             IRRPSG  QG L +   L +  G  RSMPLS  +    G ++D + +   ++    + D+
Sbjct  130   IRRPSGRLQGFLRLGVALLD--GGQRSMPLS--VEVFDGSRRDSKRDDAKMMHRRTNSDQ  185



>ref|XP_009123999.1| PREDICTED: uncharacterized protein LOC103848923 [Brassica rapa]
Length=384

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 108/180 (60%), Gaps = 18/180 (10%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             +LEI LISAQDL P+SK+++TY++ W  T+P RK TT +DQ   ANP WN+KF F+VDD+
Sbjct  10    VLEINLISAQDLAPISKNMKTYSVAWINTDPMRKLTTRVDQANRANPIWNEKFVFRVDDK  69

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SEKGTREVALQ  891
              L  + S++ +EIY  +W +D LVGTV+V +S+L +P                 R V LQ
Sbjct  70    ILDVDASSIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  890   IRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNSEDE  711
             IRRPSG  QG L +   L +  G  RSMPLS  +    G ++D + +   ++    + D+
Sbjct  130   IRRPSGRLQGFLRLGVALLD--GGQRSMPLS--VEVFDGSRRDSKRDDAKMMHRRTNSDQ  185



>ref|XP_010485810.1| PREDICTED: putative lysozyme-like protein [Camelina sativa]
Length=391

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 135/249 (54%), Gaps = 37/249 (15%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             +LEI LISAQDL PVS++++TY++ W  T+P RK TT +DQ+  ANP WN+KF F+V+D+
Sbjct  10    VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SEKGTREVALQ  891
              L ++ S + +EIY  +W +D LVGTV+V +S+L +P                 R V LQ
Sbjct  70    ILDADASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  890   IRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNSEDE  711
             IRRPSG  QG L +   L +  G  RSMPLS            +E+   +     N  D+
Sbjct  130   IRRPSGRLQGFLRLGVALLD--GGQRSMPLS------------IEVFDGSRRGDTNKRDQ  175

Query  710   ERERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGS---MVNGGSMVNYG  540
             E  R+  +      S   D+ +  N  ++  K G + NG    GG    ++   SMVN G
Sbjct  176   EASRMMHRRTN---SDQSDLTTSTN--DYGVKTGVVTNGGGGGGGGGGLVIGADSMVN-G  229

Query  539   SEVCSDVGP  513
             S   SD+GP
Sbjct  230   SLCSSDIGP  238



>ref|XP_009625033.1| PREDICTED: uncharacterized protein LOC104115986 [Nicotiana tomentosiformis]
Length=397

 Score =   139 bits (349),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 92/134 (69%), Gaps = 5/134 (4%)
 Frame = -3

Query  1229  RPPVGYHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSF  1050
             +PP  + ILEI +ISAQDLPPVSK LRT+A+ + +P+ + TT +D NG  NPTWN K  F
Sbjct  4     QPP--FKILEINVISAQDLPPVSKMLRTFAVAYIHPDHRLTTRVDHNGKTNPTWNYKMVF  61

Query  1049  KVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP-SEKG--TREVALQIRRP  879
             +VDD+FL SE ++VT EIY V+W RD+ +GT  + +++   P S K    R   L IRRP
Sbjct  62    RVDDKFLNSESASVTFEIYNVAWLRDLPIGTTHLMINSFFPPLSSKNPTMRSTTLHIRRP  121

Query  878   SGSPQGLLNMSATL  837
             SG  QGLL++S  L
Sbjct  122   SGHLQGLLHVSVQL  135



>gb|KFK37859.1| hypothetical protein AALP_AA3G038400 [Arabis alpina]
Length=387

 Score =   138 bits (348),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 98/160 (61%), Gaps = 16/160 (10%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWND  1062
             + R      +LEI LISAQDL P+S++++TY++ W  T+P RK TT +DQN  ANP WN+
Sbjct  1     MGRLKFACPVLEINLISAQDLAPISRNMKTYSVAWINTDPMRKLTTRVDQNNRANPIWNE  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SE  918
             KF F+V+D+ L  + S + +EIY  +W +D LVGTV+V +S+L +P              
Sbjct  61    KFVFRVNDKILDVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDVGGGN  120

Query  917   KGTREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLS  798
                R V LQIRRPSG  QG L +   L +  G  RSMPLS
Sbjct  121   NNMRLVTLQIRRPSGRLQGFLRLGVALLD--GGQRSMPLS  158



>emb|CDY42921.1| BnaC05g47300D [Brassica napus]
Length=377

 Score =   138 bits (347),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 96/151 (64%), Gaps = 16/151 (11%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             +LEI LISAQDL P+SK+++TY++ W  T+P RK TT +DQ   +NP WN+KF F+VDD+
Sbjct  10    VLEINLISAQDLAPISKNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVDDK  69

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SEKGTREVALQ  891
              L  + S++ +EIY  +W +D LVGTV+V +S+L +P                 R V LQ
Sbjct  70    ILDVDASSIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  890   IRRPSGSPQGLLNMSATLQENTGTSRSMPLS  798
             IRRPSG  QG L +   L +  G  RSMPLS
Sbjct  130   IRRPSGRLQGFLRLGVALLD--GGQRSMPLS  158



>gb|AAF26778.1|AC016829_2 hypothetical protein [Arabidopsis thaliana]
Length=353

 Score =   137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 96/151 (64%), Gaps = 16/151 (11%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             +LEI LISAQDL PVS++++TY++ W  T+P RK TT +DQ+  ANP WN+KF F+V+D+
Sbjct  10    VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SEKGTREVALQ  891
              L  + S + +EIY  +W +D LVGTV+V +S+L +P                 R V LQ
Sbjct  70    ILYVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVTLQ  129

Query  890   IRRPSGSPQGLLNMSATLQENTGTSRSMPLS  798
             IRRPSG  QG L +   L +  G  RSMPLS
Sbjct  130   IRRPSGRLQGFLRLGVALLD--GGQRSMPLS  158



>gb|ABK28543.1| unknown [Arabidopsis thaliana]
Length=354

 Score =   137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 98/160 (61%), Gaps = 16/160 (10%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWND  1062
             + R      +LEI LISAQDL PVS++++TY++ W  T+P RK TT +DQ+  ANP WN+
Sbjct  1     MGRLKFACPVLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNE  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SE  918
             KF F+V+D+ L  + S + +EIY  +W +D LVGTV+V +S+L +P              
Sbjct  61    KFVFRVNDKILYVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGN  120

Query  917   KGTREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLS  798
                R V LQIRRPSG  QG L +   L +  G  RSMPLS
Sbjct  121   NNMRLVTLQIRRPSGRLQGFLRLGVALLD--GGQRSMPLS  158



>ref|XP_010463915.1| PREDICTED: uncharacterized protein LOC104744544 [Camelina sativa]
Length=392

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 97/151 (64%), Gaps = 16/151 (11%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             +LEI LISAQDL PVS++++TY++ W  T+P RK TT +DQ+  ANP WN+KF F+V+D+
Sbjct  10    VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SEKGTREVALQ  891
              L ++ S + +EIY  +W +D LVGTV+V +S+L +P                 R V LQ
Sbjct  70    ILDADASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  890   IRRPSGSPQGLLNMSATLQENTGTSRSMPLS  798
             IRRPSG  QG L +   L +  G  RSMPLS
Sbjct  130   IRRPSGRLQGFLRLGVALLD--GGQRSMPLS  158



>ref|XP_006297897.1| hypothetical protein CARUB_v10013938mg [Capsella rubella]
 gb|EOA30795.1| hypothetical protein CARUB_v10013938mg [Capsella rubella]
Length=382

 Score =   137 bits (346),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 99/160 (62%), Gaps = 16/160 (10%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWND  1062
             ++R      +LEI LISAQDL PVS++++TY++ W  T+P RK TT +DQ+  ANP WN+
Sbjct  1     MARLKFACPVLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNE  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SE  918
             KF F+V+D+ L  + S + +EIY  +W +D LVGTV+V +S+L +P              
Sbjct  61    KFVFRVNDKILDFDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDCGGRN  120

Query  917   KGTREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLS  798
                R V LQIRRPSG  QG L +   L +  G  RSMPLS
Sbjct  121   NNMRLVTLQIRRPSGRLQGFLRLGVALLD--GGQRSMPLS  158



>ref|XP_002884443.1| hypothetical protein ARALYDRAFT_477695 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60702.1| hypothetical protein ARALYDRAFT_477695 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   137 bits (344),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 98/160 (61%), Gaps = 16/160 (10%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWND  1062
             + R      +LEI LISAQDL PVS++++TY++ W  T+P RK TT +DQ+  ANP WN+
Sbjct  1     MGRLKFACPVLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNE  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SE  918
             KF F+V+D+ L  + S + +EIY  +W +D LVGTV+V +S+L +P              
Sbjct  61    KFVFRVNDKILDVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGN  120

Query  917   KGTREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLS  798
                R V LQIRRPSG  QG L +   L +  G  RSMPLS
Sbjct  121   NNMRLVTLQIRRPSGRLQGFLRLGVALLD--GGQRSMPLS  158



>emb|CDX74193.1| BnaA03g28540D [Brassica napus]
Length=387

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/259 (37%), Positives = 136/259 (53%), Gaps = 44/259 (17%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWND  1062
             + R      +LEI LISAQDL  VSK+++TY++ W  T+P RK TT +DQ   +NP WN+
Sbjct  1     MVRQKFACPVLEINLISAQDLSLVSKNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNE  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SE  918
             KF F+V+D+ L ++ S + +EIY  +W +D LVGTV+V +S+L +P              
Sbjct  61    KFVFRVNDKTLQADVSAIVIEIYAAAWSKDALVGTVNVLLSDLFAPWSGFGDGDEGGGGN  120

Query  917   KGTREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNI  738
                R V LQIRRPSG  QG L +   L +  G  RSMPLS   S  +  K+D +   + +
Sbjct  121   NNMRLVTLQIRRPSGRLQGFLRLGVALLD--GGQRSMPLS---SEVNDVKRDGQDGVKVM  175

Query  737   LEYHNSEDEERERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGS----M  570
                 NS+                    D+ +  N  ++  K G +  G  V+GG+    +
Sbjct  176   HRRTNSD------------------LTDLTTSTN--DYGVKTGVVTGGGRVSGGNNGSVV  215

Query  569   VNGGSMVNYGSEVCSDVGP  513
             V   SMVN GS   SD+GP
Sbjct  216   VGVDSMVN-GSYCNSDIGP  233



>ref|XP_010533203.1| PREDICTED: uncharacterized protein LOC104809022 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010533204.1| PREDICTED: uncharacterized protein LOC104809022 isoform X2 [Tarenaya 
hassleriana]
Length=431

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 103/159 (65%), Gaps = 7/159 (4%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQDL PV++ ++TYA+ W +P RK TT +D  G  +PTWNDKF F++D+E 
Sbjct  8     QILELNIISAQDLAPVARYMKTYAIAWLDPERKLTTRVDNTGGTSPTWNDKFVFRLDEES  67

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGLLN  852
             L  E S V +EIY + WF+D+ VGTV   VS+L++      R V L++ R SG P GLLN
Sbjct  68    LYDETSLVVIEIYALHWFKDIHVGTVQALVSDLVN-HVSAMRFVTLEVLRASGRPHGLLN  126

Query  851   MSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNIL  735
             ++  L ++  + +S+PL     T S +++DL   ++  L
Sbjct  127   IAVGLIDS--SRQSVPL----YTPSLFEQDLMFHQKKTL  159



>ref|NP_566225.4| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
 gb|AEE74070.1| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
Length=391

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 98/160 (61%), Gaps = 16/160 (10%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWND  1062
             + R      +LEI LISAQDL PVS++++TY++ W  T+P RK TT +DQ+  ANP WN+
Sbjct  1     MGRLKFACPVLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNE  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SE  918
             KF F+V+D+ L  + S + +EIY  +W +D LVGTV+V +S+L +P              
Sbjct  61    KFVFRVNDKILYVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGN  120

Query  917   KGTREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLS  798
                R V LQIRRPSG  QG L +   L +  G  RSMPLS
Sbjct  121   NNMRLVTLQIRRPSGRLQGFLRLGVALLD--GGQRSMPLS  158



>gb|AAM67146.1| unknown [Arabidopsis thaliana]
Length=391

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 98/160 (61%), Gaps = 16/160 (10%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWND  1062
             + R      +LEI LISAQDL PVS++++TY++ W  T+P RK TT +DQ+  ANP WN+
Sbjct  1     MGRLKFACPVLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNE  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SE  918
             KF F+V+D+ L  + S + +EIY  +W +D LVGTV+V +S+L +P              
Sbjct  61    KFVFRVNDKILDVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGN  120

Query  917   KGTREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLS  798
                R V LQIRRPSG  QG L +   L +  G  RSMPLS
Sbjct  121   NNMRLVTLQIRRPSGRLQGFLRLGIALLD--GGQRSMPLS  158



>ref|XP_010558947.1| PREDICTED: uncharacterized protein LOC104827473 [Tarenaya hassleriana]
Length=396

 Score =   136 bits (343),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 99/158 (63%), Gaps = 14/158 (9%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWND  1062
             + RP +   +LEI +ISAQDL  VS++++TYA+ W  T+P RK TT +DQ   ANP WN+
Sbjct  1     MGRPRILLPVLEINMISAQDLASVSRNMKTYAVAWINTDPMRKLTTRVDQTNRANPIWNE  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP----------SEKG  912
             K  F+V+D+ L  + S + +EIY  +W +D LVG+++V +S+L +P              
Sbjct  61    KLVFRVNDKILNVDASAIVIEIYAAAWAKDALVGSINVLLSDLFAPWSGFNHGGGNGNNN  120

Query  911   TREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLS  798
              R V LQIRRPSG  QGLL +   L +  GT RSMPLS
Sbjct  121   MRLVTLQIRRPSGRLQGLLRLGIALLD--GTQRSMPLS  156



>ref|XP_006408192.1| hypothetical protein EUTSA_v10020890mg [Eutrema salsugineum]
 gb|ESQ49645.1| hypothetical protein EUTSA_v10020890mg [Eutrema salsugineum]
Length=392

 Score =   136 bits (342),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 92/258 (36%), Positives = 137/258 (53%), Gaps = 34/258 (13%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWND  1062
             + R      +LEI LISAQDL P+S++++TY++ W  T+P RK TT +DQ+  ANP WN+
Sbjct  1     MGRLKFACPVLEINLISAQDLAPISRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNE  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SE  918
             KF F+V+D+ L  + S + +E+Y  +W +D LVGTV+V +S+L +P              
Sbjct  61    KFVFRVNDKILDVDASAIVIEVYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGN  120

Query  917   KGTREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNI  738
                R V LQIRRPSG  QG L +   L +  G  RSMPLS  +    G ++         
Sbjct  121   NNMRLVTLQIRRPSGRLQGFLRLGVALLD--GGQRSMPLS--IEVFDGSRRG--------  168

Query  737   LEYHNSEDEERERLHAKILQWRRSMTPDMMSDVNGEEFPGKPGSIC---NGSMVNGGSMV  567
                    + +RE+  +K++  RR+ +       +  ++  K G +     G    GG +V
Sbjct  169   ----GRSNSKREQEVSKMMHHRRTNSDQTDLTTSSNDYGVKTGLVTGGGGGGGGGGGVVV  224

Query  566   NGGSMVNYGSEVCSDVGP  513
                SMVN GS   SD+GP
Sbjct  225   GADSMVN-GSLCSSDIGP  241



>emb|CDX92066.1| BnaC03g33680D [Brassica napus]
Length=383

 Score =   132 bits (332),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 97/160 (61%), Gaps = 16/160 (10%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWND  1062
             + R      +LEI LISAQDL  VSK+++TY++ W  T+P RK TT +DQ   +NP WN+
Sbjct  1     MVRQKFACPVLEINLISAQDLSLVSKNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNE  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SE  918
             KF F+V+D+ L ++ S + +EIY  +W +D LVGTV+V +S+L +P              
Sbjct  61    KFVFRVNDKTLQADVSAIVIEIYAAAWSKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGN  120

Query  917   KGTREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLS  798
                R V LQIRRPSG  QG L +   L +  G  RSMPLS
Sbjct  121   NNMRLVTLQIRRPSGRLQGFLRLGVALLD--GGQRSMPLS  158



>ref|XP_009134757.1| PREDICTED: uncharacterized protein LOC103859027 [Brassica rapa]
Length=397

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 97/160 (61%), Gaps = 16/160 (10%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWND  1062
             + R      +LEI LISAQDL  VSK+++TY++ W  T+P RK TT +DQ   +NP WN+
Sbjct  1     MVRQKFACPVLEINLISAQDLSLVSKNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNE  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP------------SE  918
             KF F+V+D+ L ++ S + +EIY  +W +D LVGTV+V +S+L +P              
Sbjct  61    KFVFRVNDKTLQADVSAIVIEIYAAAWSKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGN  120

Query  917   KGTREVALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLS  798
                R V LQIRRPSG  QG L +   L +  G  RSMPLS
Sbjct  121   NNMRLVTLQIRRPSGRLQGFLRLGVALLD--GGLRSMPLS  158



>ref|XP_010557577.1| PREDICTED: uncharacterized protein LOC104826528 [Tarenaya hassleriana]
Length=446

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 101/160 (63%), Gaps = 8/160 (5%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
              ILE+ +ISAQDL PV++ ++TYA+ W +P  K TT +D  G  NPTWNDKF F++D E 
Sbjct  10    QILELNIISAQDLAPVARYMKTYAVAWLDPQHKLTTRVDNTGGTNPTWNDKFVFRLDKEA  69

Query  1031  LASEKSTVTV-EIYTVSWFRDVLVGTVSVNVSNLISP-SEKGTREVALQIRRPSGSPQGL  858
             L    S++ V EIY + WF+D+ +GTV   +++L+SP S    R V L++ R SG P GL
Sbjct  70    LYYGTSSIMVIEIYALHWFKDIHIGTVQALITDLLSPTSLPAMRFVTLEVLRASGRPHGL  129

Query  857   LNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNI  738
             LN++  L +++    SMPL     T S +++DL   +  I
Sbjct  130   LNIAVGLIDSSRP--SMPL----YTPSTFEEDLVFHQNKI  163



>ref|XP_006842598.1| hypothetical protein AMTR_s00077p00167680 [Amborella trichopoda]
 gb|ERN04273.1| hypothetical protein AMTR_s00077p00167680 [Amborella trichopoda]
Length=355

 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 98/156 (63%), Gaps = 10/156 (6%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
             H+LE+ +ISAQD+ P ++++  YA+ W + + K +T  D  G+  PTWNDKF F+V + F
Sbjct  21    HLLELNIISAQDIHPATQAMHPYAVAWVHRDHKLSTRTDPQGHTEPTWNDKFIFRVTETF  80

Query  1031  LASEKSTVTVEIYT---VSWFRDVLVGTVSVNVSNLIS-----PSEKGTREVALQIRRPS  876
             L S+ + VT++I+T      F D L+GTV V V NL+S     P   G R  ALQ+RRPS
Sbjct  81    LRSDTAAVTIQIFTHRPCCVFPDPLIGTVRVLVGNLLSAQSHAPGYSGMRFTALQVRRPS  140

Query  875   GSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYK  768
             G PQG+LN+  TL +     RSMPL    ++A GY+
Sbjct  141   GRPQGILNLGITLLDP--ALRSMPLYVQATSALGYQ  174



>ref|XP_009406969.1| PREDICTED: uncharacterized protein LOC103989745 [Musa acuminata 
subsp. malaccensis]
Length=283

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 106/173 (61%), Gaps = 15/173 (9%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             +H+LEIT+IS Q L P S+SL+ YA  W +P  K  T +D+ G  +PTWNDKF F+VDD 
Sbjct  28    FHLLEITIISGQGLFPASRSLQAYASAWVDPKHKLYTRVDRAGVTDPTWNDKFVFRVDDA  87

Query  1034  FLASEKSTVTVEIYT----VSWFRDVLVGTVSVNVSNL-ISPSEKGTREVALQIRRPSG-  873
             FL SE S V V ++     +S  RD L+GTV V +S L ++P     R VALQ+RRPS  
Sbjct  88    FLRSETSAVNVHLHAARGRLSPLRDHLLGTVRVVLSALRLAPG--AGRCVALQVRRPSTL  145

Query  872   SPQGLLNMSATLQENTGTSRSMPLS-DLMSTASGYKKDLELEKRNILEYHNSE  717
              P G+LN+   L +   + + MPLS DL S A+   KDL   K+   E +NSE
Sbjct  146   CPHGILNLGVALHD---SDKIMPLSFDLQSLAAFAYKDLIGAKQ---EKYNSE  192



>ref|XP_006842901.1| hypothetical protein AMTR_s00075p00073210 [Amborella trichopoda]
 gb|ERN04576.1| hypothetical protein AMTR_s00075p00073210 [Amborella trichopoda]
Length=404

 Score =   130 bits (327),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 100/173 (58%), Gaps = 8/173 (5%)
 Frame = -3

Query  1238  CLSRPPVGYHILEITLISAQDLPPV---SKSLRTYALVWTNPNRKRTTCIDQNGNANPTW  1068
             C  +    Y +LE+ LISAQDL P+   +K++ TYA+ W +P +K  T +D  G  NPTW
Sbjct  8     CAPKKSEKYQLLEVNLISAQDLKPIIHSNKTIHTYAVAWVDPRKKLRTRVDTLGRENPTW  67

Query  1067  NDKFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQI  888
             NDKF F VD  FL+ E S +++EI+ V + RDVL GTV   V++L+     G    ALQ+
Sbjct  68    NDKFIFTVDQSFLSGESSAISIEIFYVRYLRDVLAGTVRALVADLMKGG--GLSFAALQV  125

Query  887   RRPSGSPQGLLNMSATLQENTGTSRSMPL---SDLMSTASGYKKDLELEKRNI  738
             RRPSG   G+LN+   + +      ++P    S     A  Y++ + ++ R+I
Sbjct  126   RRPSGRFHGVLNLGLIVLDANNAIGALPTSPSSSFHGFALNYRELMGIKTRSI  178



>ref|XP_009377282.1| PREDICTED: BON1-associated protein 2 [Pyrus x bretschneideri]
Length=223

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 85/128 (66%), Gaps = 3/128 (2%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             H+LEI LISAQDL P S +LR   TYAL W +   K  + +D+ G  NPTWND+F FKV 
Sbjct  13    HVLEINLISAQDLKPPSAALRRMQTYALAWVDSAHKIRSRVDKIGGENPTWNDRFLFKVP  72

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQG  861
               FL+SE S V+++IY V  F D LVGTV + ++N +  + K     A+QIRRPSG  QG
Sbjct  73    SAFLSSETSQVSIQIYAVGCFSDHLVGTVRLLINNFLDVASKVPSFTAIQIRRPSGRFQG  132

Query  860   LLNMSATL  837
             +LN++A +
Sbjct  133   VLNVAAMV  140



>ref|XP_010262513.1| PREDICTED: uncharacterized protein LOC104601031 [Nelumbo nucifera]
Length=318

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 111/342 (32%), Positives = 160/342 (47%), Gaps = 66/342 (19%)
 Frame = -3

Query  1205  LEITLISAQDLPPVSKSLRTYALVWTNPNRK--RTTCIDQNGNANPTWNDKFSFKVDDEF  1032
             LEI +ISA DL PV+ ++RTYA+   +  RK  ++T I   G+ NPTWN KF F VD++F
Sbjct  16    LEINVISALDLAPVTSAMRTYAVACLDRERKCKQSTRIALIGHTNPTWNAKFIFPVDEDF  75

Query  1031  LASEKSTVTVEIYTVSW-FRDVLVGTVSVNVSNLISPSEKGTRE------VALQIRRPSG  873
             L S  S+V +EIY + + FR+VLVGTV V VSN I PS     +      V LQ+RRPS 
Sbjct  76    LKSYTSSVIIEIYALRYLFRNVLVGTVHVLVSNFIHPSSLQPHDRDYGQLVCLQVRRPSD  135

Query  872   SPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNSEDEERERLH  693
              PQGLLN+S  L +N  + R MPL +  ST +    DL + K+    +H S     +++ 
Sbjct  136   RPQGLLNISVALLDN--SVRIMPLCNQPSTTTVGYSDL-MGKKMHTPHHRSYTP--KKVQ  190

Query  692   AKILQWRRSMTPDMMSDVNGEEFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEVCSDVGP  513
              +  + +RS+  D                     + +G S   G + +   S + SD G 
Sbjct  191   PRSSKSKRSVESD------------------KDDLSSGWS---GSTTITNSSHLKSDTGR  229

Query  512   SASVVA---AEIAQSWQASAAPRKEIMERGVGDSMVLPANLTPeeakrrreaaeddenee  342
             + S      A I + + A       ++ER   D                           
Sbjct  230   TYSTFTSTEAAITEDYFAEEEIGSSVLERWSVDE--------------------------  263

Query  341   emeMIPKNAGRRKPDNGMYSCF--VYGFQFTIVCGANNNPPK  222
             E +   K+A R     G++SCF   +G Q  + CGA  N  K
Sbjct  264   ENDEGTKHARRHTDGRGVFSCFGGSFGCQCNVYCGARPNEEK  305



>ref|XP_007051663.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
 gb|EOX95820.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
Length=266

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 107/184 (58%), Gaps = 21/184 (11%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             ++LEITLISAQ L   S  LR   TYAL W + + K  TC+D+ G  NPTWNDKF FKV 
Sbjct  5     YVLEITLISAQGLKEPSGKLRRMQTYALAWIDSSVKLRTCVDRVGGENPTWNDKFLFKVS  64

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREV------ALQIRRP  879
              EFL+SE S ++VEI+ V   RD LVGTV   VSN + PS             A+QIRRP
Sbjct  65    SEFLSSETSGISVEIFAVGVLRDSLVGTVRFLVSNFL-PSGSAFNAAKTHSFNAVQIRRP  123

Query  878   SGSPQGLLNMSATLQEN------TGTSRSMPLSDLMSTAS--GYKKDLELEKRNILEYHN  723
             SG  QG+LN+ AT+ +       TG S +M   DL+   S    K  L + + N+  + +
Sbjct  124   SGRFQGVLNIGATVLDGAYVPSWTGVS-AMGFRDLIGHRSLKKSKSALPISRENL--FPD  180

Query  722   SEDE  711
             S+D+
Sbjct  181   SDDQ  184



>ref|XP_010549648.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104820763 
[Tarenaya hassleriana]
Length=397

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 95/155 (61%), Gaps = 11/155 (7%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVSKSLRTYALVW--TNPNRKRTTCIDQNGNANPTWND  1062
             + R  +   +LEI +ISAQDL  VS++++TYA+ W  T+P RK TT +DQ   ANP WN+
Sbjct  1     MGRLRLSLPVLEINVISAQDLASVSRNMKTYAVAWINTDPMRKLTTPVDQTNRANPIWNE  60

Query  1061  KFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP-------SEKGTRE  903
             KF F+V+D+ L  + S + +EIY  +W +D LVG+V+V +S+L +P          G   
Sbjct  61    KFVFRVNDKILKVDASAIVIEIYAAAWAKDALVGSVNVLLSDLFAPWSGFADGDGGGNNN  120

Query  902   VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLS  798
               L IRRPSG  QG L +   L +  G  RSMPLS
Sbjct  121   XPLHIRRPSGRLQGFLRLGVALLD--GMQRSMPLS  153



>ref|XP_007147256.1| hypothetical protein PHAVU_006G109100g [Phaseolus vulgaris]
 gb|ESW19250.1| hypothetical protein PHAVU_006G109100g [Phaseolus vulgaris]
Length=249

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 103/177 (58%), Gaps = 13/177 (7%)
 Frame = -3

Query  1223  PVGYHILEITLISAQDLPPVS---KSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFS  1053
             P  + +LEI LISAQ L P S   + L+TYA+ W +P+ K  T +D+ G  NPTWNDKF 
Sbjct  4     PKTHQVLEINLISAQGLKPPSSPRRRLQTYAVTWIHPDTKLRTRVDKLGGHNPTWNDKFL  63

Query  1052  FKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLIS--PSEKGTREVALQIRRP  879
             F+V  EFL+S+ S++ + IY V  FRD LVGT+   +SN++S    E      A QIRRP
Sbjct  64    FRVSPEFLSSDTSSICIAIYAVGTFRDHLVGTLRFLISNILSRDADESTPCFSAFQIRRP  123

Query  878   SGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNSEDEE  708
             SG   G++N+ A + E +G     P  D +S A GY+   +L   NI +      EE
Sbjct  124   SGRFHGVMNIGAMVMEGSG----FPALDKIS-AIGYR---DLMGENIQQRRRKTAEE  172



>gb|KDP28538.1| hypothetical protein JCGZ_14309 [Jatropha curcas]
Length=259

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 115/213 (54%), Gaps = 30/213 (14%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
             ILEI LISAQ L P S ++R   TYA+VW + + K  T +D+ G+ +P WNDKF FKV  
Sbjct  6     ILEINLISAQGLKPPSANIRRMQTYAVVWIDSSTKLRTRVDRVGSGDPIWNDKFLFKVSP  65

Query  1037  EFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSN--LISPSEKGTRE--VALQIRRPSGS  870
             EFLA E S V VEIY V + RD L+GTV + +SN  L  P+E+      +ALQIRRPSG 
Sbjct  66    EFLAGETSGVCVEIYAVGYLRDALLGTVRLLISNIPLFLPNERMRTPSFIALQIRRPSGR  125

Query  869   PQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEYHNSEDEERERLHA  690
              QGLLN+ A + +          SD  S    +     +  R+++  +N     R R   
Sbjct  126   FQGLLNIGAVISDG---------SDFAS----FNGVSAISYRDLVGENN---RRRRRCDL  169

Query  689   KILQWRRSMTPDMMSDVNGEEFPGKPGSICNGS  591
             K        +   + D +GE F G  G I +G+
Sbjct  170   K-------KSTSTVEDGHGENFCGDSGDISDGA  195



>gb|EYU32591.1| hypothetical protein MIMGU_mgv1a006056mg [Erythranthe guttata]
Length=459

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 92/163 (56%), Gaps = 31/163 (19%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             + +LEI +IS QDL PV K +RTYA  W NP RK ++                   VDD+
Sbjct  9     FQLLEINIISGQDLQPVLKKMRTYARAWVNPGRKLSS-------------------VDDD  49

Query  1034  FLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISP---------SEKGTREVALQIRR  882
             FL  + S V +EIY   WFRDV+VGTV V V NLI P            G R VALQ+RR
Sbjct  50    FLGEDTSAVMIEIYAAHWFRDVIVGTVRVLVGNLIPPPLMTRRNGGGPIGMRFVALQVRR  109

Query  881   PSGSPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLE  756
             PSG PQG+LN+   L +  G+ RSMPL   L ++A GY+  ++
Sbjct  110   PSGRPQGILNIGVALLD--GSMRSMPLYRQLSASAVGYRDLMQ  150



>ref|XP_009111426.1| PREDICTED: uncharacterized protein LOC103836878 [Brassica rapa]
Length=256

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 87/132 (66%), Gaps = 4/132 (3%)
 Frame = -3

Query  1220  VGYHILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSF  1050
             V  H+LEI LISAQ L   +  LR   TYA VW + + K  T ID+ G  NP WNDKF F
Sbjct  3     VESHVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSTKLRTRIDRIGAENPIWNDKFVF  62

Query  1049  KVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGTREVALQIRRPSG  873
             +V  EFL+SE S V++EIY V + RD L+GTV   VSN + + +EK    VALQIRRPSG
Sbjct  63    QVSSEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAEKVPSLVALQIRRPSG  122

Query  872   SPQGLLNMSATL  837
               +G+LN++A +
Sbjct  123   KFRGVLNIAAMV  134



>ref|XP_010456220.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=252

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 87/131 (66%), Gaps = 4/131 (3%)
 Frame = -3

Query  1211  HILEITLISAQDLP-PVSK--SLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             H+LEI LISAQDL  P  K   L+TYA VW + + K  T ID+ G  NP WNDKF F+V 
Sbjct  6     HVLEINLISAQDLKEPTGKLRQLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVS  65

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGTREVALQIRRPSGSPQ  864
              EFL+SE S V++EIY V + RD L+GTV   VSN + + + K    VALQIRRPSG   
Sbjct  66    PEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPSLVALQIRRPSGKFH  125

Query  863   GLLNMSATLQE  831
             G+LN++A + +
Sbjct  126   GVLNIAAMVMD  136



>ref|XP_009385178.1| PREDICTED: uncharacterized protein LOC103972545 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 120/207 (58%), Gaps = 17/207 (8%)
 Frame = -3

Query  1226  PPVGY--HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFS  1053
             PP+ +  H LE+T+ISAQDL P ++S+RTYA+ +  P+ +  T ID +G+ +PTWNDKF 
Sbjct  32    PPIPFSRHHLEVTVISAQDLYPAARSMRTYAVAYFRPDHRARTRIDASGHTDPTWNDKFV  91

Query  1052  FKVDDEFLASEKSTVTVEIYT----VSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIR  885
             F+VDD  L S+ S +T+++Y     +    D+L+GT    +S L  PS       ALQIR
Sbjct  92    FRVDDAVLHSDTSAITIDVYADRPGLLPGPDILLGTARALLSTL-RPSS-AIHYAALQIR  149

Query  884   RPSG-SPQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDE  711
             RP+   PQG+LN+   L +   ++R++P+ ++    +S  + ++   KR       + D 
Sbjct  150   RPASLRPQGILNLGVALVDP--SARTVPVHANRGHASSTPRPEVPKPKRPTAGTSRAADR  207

Query  710   ERERLHAKILQWRRSMTPDMMSDVNGE  630
             ER  L  K+ +WR  + P     V+GE
Sbjct  208   ERTELERKLEKWRAELPP-----VSGE  229



>ref|XP_008362824.1| PREDICTED: uncharacterized protein LOC103426513 [Malus domestica]
 ref|XP_008362377.1| PREDICTED: uncharacterized protein LOC103426067 [Malus domestica]
Length=270

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 97/151 (64%), Gaps = 7/151 (5%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             H+LEI LISAQ L P S +LR   TYAL W +   K  + +D+ G  NPTWND+F FKV 
Sbjct  13    HVLEINLISAQGLKPPSAALRRMQTYALAWVDSAHKIRSRVDKIGGENPTWNDRFLFKVP  72

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQG  861
               FL+SE S V+++IY V  F D LVGTV + ++N +  + K     A+QIRRPSG  QG
Sbjct  73    SAFLSSETSQVSIQIYAVGCFSDHLVGTVRLLINNFLDVASKVPSFTAIQIRRPSGRFQG  132

Query  860   LLNMSATLQENTGTSRSMPLSDLMSTASGYK  768
             +LN++A + +  G+  +  +S+L  +A GY+
Sbjct  133   VLNVAAMVID--GSYLAPAVSEL--SAVGYR  159



>ref|XP_010544424.1| PREDICTED: uncharacterized protein LOC104817045 [Tarenaya hassleriana]
Length=260

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 88/133 (66%), Gaps = 4/133 (3%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             H+L+I LISAQ L   S  LR   TYA+VW +P+ K  T ID+ G  NP WNDKF F+V 
Sbjct  10    HVLQINLISAQGLKEPSGKLRRMQTYAVVWVDPSCKLRTRIDRIGAENPIWNDKFLFQVS  69

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGTREVALQIRRPSGSPQ  864
              +FL+ E S V++EIYT+ + RD L+GTV   VSN + + S K    +ALQIRRPSG   
Sbjct  70    ADFLSRETSGVSIEIYTIGYLRDHLIGTVRFLVSNFLPTVSLKAPSLLALQIRRPSGKFH  129

Query  863   GLLNMSATLQENT  825
             G+LN+ A + +++
Sbjct  130   GVLNIGAMVIDSS  142



>ref|XP_009401202.1| PREDICTED: uncharacterized protein LOC103985274 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 103/163 (63%), Gaps = 9/163 (6%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             +H+LEIT+ISAQ+L P ++ L+TYA  W +P  K  T +D+ G+A+PTWNDK  F+VDD 
Sbjct  27    FHLLEITIISAQELYPAARCLKTYASAWVDPEHKLYTRVDRAGHADPTWNDKLVFRVDDS  86

Query  1034  FLASEKSTVTVEIYT----VSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSG-S  870
             FL S+ + VTV ++      S   D L+GTV V +S L  P+    R VALQ+RRPS   
Sbjct  87    FLRSDMAAVTVHLHATRGRFSPLPDHLLGTVRVVLSAL-GPAAGPRRCVALQVRRPSSLR  145

Query  869   PQGLLNMSATLQENTGTSRSMPL-SDLMSTASGYKKDLELEKR  744
             P G++N+   + ++   +++MPL  DL S ++   KDL   KR
Sbjct  146   PHGIINLGVAILDS--FAKNMPLYYDLNSKSAFAYKDLIGAKR  186



>ref|XP_002511946.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50615.1| conserved hypothetical protein [Ricinus communis]
Length=265

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 85/132 (64%), Gaps = 7/132 (5%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
              ILEI LISAQDL P S SLR   TYA+VW +   K  T ID+ G  NPTWNDKF FKV 
Sbjct  5     KILEINLISAQDLKPPSASLRQMQTYAVVWLDSTAKLRTRIDRVGGENPTWNDKFLFKVT  64

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSE-KGTRE---VALQIRRPSG  873
              E L+ E S V+ EIY V  FRD L+GTV   +S +  PS  K TR    +ALQI+RPSG
Sbjct  65    PEILSRETSGVSFEIYAVGCFRDPLIGTVRFLISTIPLPSPIKPTRTPSCIALQIQRPSG  124

Query  872   SPQGLLNMSATL  837
               QG+LN+ A +
Sbjct  125   RFQGVLNIGAMV  136



>ref|XP_003553776.1| PREDICTED: uncharacterized protein LOC100793541 [Glycine max]
Length=260

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 97/161 (60%), Gaps = 11/161 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVS---KSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKV  1044
             + +LEI LISAQ L P S   + L+TYA+ W +P  K  T +D+ G  NPTWNDKF F+V
Sbjct  8     HQVLEINLISAQGLKPPSSPRRRLQTYAVTWIDPATKLRTRVDKLGGHNPTWNDKFLFRV  67

Query  1043  DDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREV--ALQIRRPSGS  870
               +FLA + S+V V IY V  FRD LVGTV   +SN+ SP          A QIRRPSG 
Sbjct  68    TPDFLAGDTSSVCVAIYAVGTFRDHLVGTVRFLISNMFSPDADYATPCFSAFQIRRPSGR  127

Query  869   PQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEK  747
               G++N+ A + +++G     P  + +S A GY +DL  EK
Sbjct  128   FHGVMNIGAMVMDSSG----FPALEKIS-AIGY-RDLMGEK  162



>ref|XP_009420756.1| PREDICTED: uncharacterized protein LOC104000435 [Musa acuminata 
subsp. malaccensis]
Length=266

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 106/173 (61%), Gaps = 12/173 (7%)
 Frame = -3

Query  1235  LSRPPVG---YHILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWN  1065
             L RP      +H+LEIT+ISAQ L P ++S+ TYA  W +P  K  T +D+ G+A+PTWN
Sbjct  11    LGRPTTALMPFHLLEITIISAQGLYPATRSINTYASAWVDPKHKLCTRVDRAGHADPTWN  70

Query  1064  DKFSFKVDDEFLASEKSTVTVEIYT----VSWFRDVLVGTVSVNVSNLISPSEKGTREVA  897
             DKF F+VDD FL S+ + V V ++     +S   D L+GTV V +S+L SP+    R VA
Sbjct  71    DKFIFRVDDAFLRSDTACVDVHLHAARSRLSPLPDHLLGTVRVVLSSL-SPAPGVRRFVA  129

Query  896   LQIRRPSG-SPQGLLNMSATLQENTGTSRSMPLS-DLMSTASGYKKDLELEKR  744
             L +RRPS   P G+LN+S  + E     RSMPL   L S A+   KD+ + ++
Sbjct  130   LLVRRPSSLRPHGILNLSVAILEP--HVRSMPLYFGLDSPAAFAYKDITVGRQ  180



>ref|XP_006577334.1| PREDICTED: BON1-associated protein 2-like [Glycine max]
Length=208

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 94/161 (58%), Gaps = 11/161 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVS---KSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKV  1044
             + +LEI LISAQ + P S   + L+TYA+ W +P  K  T +D+ G  NPTWNDKF F V
Sbjct  8     HQVLEINLISAQGMKPPSSPRRRLQTYAVTWIDPATKLRTRVDKLGGHNPTWNDKFLFGV  67

Query  1043  DDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREV--ALQIRRPSGS  870
               +FLA + S+V V IY V  FR  LVGTV   +SN+ SP          A QIRRPSG 
Sbjct  68    TKDFLAGDTSSVCVAIYAVGTFRHHLVGTVRFLISNMFSPDADDATPCFSAFQIRRPSGR  127

Query  869   PQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEK  747
               G++N+ A + + +G     P  + +S A GY +DL  EK
Sbjct  128   FHGVMNIGAMVMDGSG----FPALEKIS-ALGY-RDLMGEK  162



>ref|XP_010669605.1| PREDICTED: uncharacterized protein LOC104886787 [Beta vulgaris 
subsp. vulgaris]
Length=271

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 101/154 (66%), Gaps = 6/154 (4%)
 Frame = -3

Query  1217  GYHILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFK  1047
             G H+LEI LISAQ+L P S +LR   TYA+ + NP+RK  T +D+ G  NPTWNDKF F+
Sbjct  17    GTHLLEINLISAQNLKPPSTNLRRLQTYAVAYINPSRKLRTRVDRLGAENPTWNDKFIFR  76

Query  1046  VDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTRE-VALQIRRPSGS  870
             + D FL+S+ S+ TV+I++V   +D ++G+V   +SN ++ +  G    VA+QIRRPSG 
Sbjct  77    ISDAFLSSQTSSFTVDIFSVGVLKDAILGSVRFILSNCVTRNSIGLPSCVAVQIRRPSGR  136

Query  869   PQGLLNMSATLQENTGTSRSMPLSDLMSTASGYK  768
               G+LN+   + + + +     L+ + S+A GY+
Sbjct  137   FHGVLNVGVMVIDAS-SELGFSLAGI-SSAIGYR  168



>ref|XP_010092894.1| hypothetical protein L484_022489 [Morus notabilis]
 gb|EXB52712.1| hypothetical protein L484_022489 [Morus notabilis]
Length=266

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 80/127 (63%), Gaps = 3/127 (2%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
             +LEI LISAQ L P S S R   TYAL+W +   K  T +D+ G  NPTWND+F F+V  
Sbjct  12    VLEINLISAQGLKPSSGSSRPVHTYALIWIDSTTKLRTGVDKVGGENPTWNDRFLFRVTP  71

Query  1037  EFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGL  858
             EFL+ + S + VEIYTV   RD L+GTV + + N +    K     ALQIRRPSG   G+
Sbjct  72    EFLSGDTSGIYVEIYTVGRIRDSLIGTVRLLIGNFLDVRAKTPSFTALQIRRPSGRFHGV  131

Query  857   LNMSATL  837
             LN+ AT+
Sbjct  132   LNVGATV  138



>ref|XP_010427687.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=256

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 84/131 (64%), Gaps = 4/131 (3%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             H+LEI LISAQ L   +  LR   TYA VW   + K  T ID+ G  NP WNDKF F+V 
Sbjct  6     HVLEINLISAQRLKEPTGKLRRLQTYASVWVESSNKLRTRIDRIGAENPIWNDKFVFQVS  65

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGTREVALQIRRPSGSPQ  864
              EFL+SE S V++EIY V + RD L+GTV   VSN + + + K    VALQIRRPSG   
Sbjct  66    PEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPSLVALQIRRPSGKFH  125

Query  863   GLLNMSATLQE  831
             G+LN++A + +
Sbjct  126   GVLNIAAMVMD  136



>gb|EYU38921.1| hypothetical protein MIMGU_mgv1a022778mg [Erythranthe guttata]
Length=242

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 84/140 (60%), Gaps = 14/140 (10%)
 Frame = -3

Query  1220  VGYHILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSF  1050
             +G  ILEI LISAQ L P S +LR   TYA+ W +P  K  T +D  G  NPTWNDKF F
Sbjct  1     MGTQILEINLISAQGLKPPSANLRRIQTYAITWIDPATKLRTHVDSVGGENPTWNDKFLF  60

Query  1049  KVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI----SPSEKGTRE-------  903
             +V DEF+A + S V VEI+ V + +D+L+GTV   +S  +    SP +            
Sbjct  61    RVSDEFIAGDTSAVAVEIFAVGYIKDILIGTVRFLLSTCLKRAASPIDSAGEGSIGTPSC  120

Query  902   VALQIRRPSGSPQGLLNMSA  843
               LQIRRPSG  QG+LN++A
Sbjct  121   TGLQIRRPSGRFQGVLNIAA  140



>ref|XP_004308328.1| PREDICTED: uncharacterized protein LOC101301728 [Fragaria vesca 
subsp. vesca]
Length=293

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 84/138 (61%), Gaps = 3/138 (2%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
              +LEI LIS Q L P S +LR   TYA+ W   + K  T +D+ G  NPTWND+F FKV 
Sbjct  11    QVLEINLISGQGLKPPSGTLRRMKTYAVAWVESSHKIRTRVDKVGAENPTWNDRFLFKVS  70

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQG  861
              EFLA E S +T+EIY V  FRD LVGTV + +SN +    K     ALQIRR SG   G
Sbjct  71    SEFLARETSGITIEIYAVGSFRDHLVGTVRLILSNFLDLDSKIPSFTALQIRRRSGRFHG  130

Query  860   LLNMSATLQENTGTSRSM  807
             +LN++A +   +  S+ +
Sbjct  131   VLNVAALVNHESEWSKEL  148



>ref|XP_010422779.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=252

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 4/131 (3%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             H+LEI LISAQ L   +  LR   TYA VW + + K  T ID+ G  NP WNDKF F+V 
Sbjct  6     HVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVS  65

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGTREVALQIRRPSGSPQ  864
              +FL+SE S V++EIY V + RD L+GTV   VSN + + + K    VALQIRRPSG   
Sbjct  66    PDFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPSLVALQIRRPSGKFH  125

Query  863   GLLNMSATLQE  831
             G+LN++A + +
Sbjct  126   GVLNIAAMVMD  136



>ref|XP_002301388.2| hypothetical protein POPTR_0002s16800g, partial [Populus trichocarpa]
 gb|EEE80661.2| hypothetical protein POPTR_0002s16800g, partial [Populus trichocarpa]
Length=243

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 86/131 (66%), Gaps = 7/131 (5%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
             +LEI LISAQ L P S +LR   TYA+VW +P+ K  T  D+ G+ NPTWNDKF FKV  
Sbjct  5     VLEINLISAQGLKPPSANLRRMQTYAIVWIDPSTKLRTRTDRVGSENPTWNDKFLFKVTP  64

Query  1037  EFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSN--LISPSEKGTRE--VALQIRRPSGS  870
             E+L+SE S V++EIY +   RD L+GTV   V N  L +PS   T    +ALQIRRPSG 
Sbjct  65    EYLSSETSGVSIEIYAIGCIRDALIGTVRFLVGNLRLSTPSAAITMPSCIALQIRRPSGR  124

Query  869   PQGLLNMSATL  837
               G++N+ A +
Sbjct  125   FHGVINIGANV  135



>ref|XP_006396291.1| hypothetical protein EUTSA_v10028892mg [Eutrema salsugineum]
 gb|ESQ37744.1| hypothetical protein EUTSA_v10028892mg [Eutrema salsugineum]
Length=260

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 84/129 (65%), Gaps = 4/129 (3%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             H+LE+ LISAQ L   +  LR   TYA VW + + K  T ID+ G  NP WNDKF F+V 
Sbjct  12    HVLELNLISAQGLKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVS  71

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGTREVALQIRRPSGSPQ  864
              +FL+SE S V++EIY V + RD L+GTV   VSN + + + K    VALQIRRPSG   
Sbjct  72    SDFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPSLVALQIRRPSGKFH  131

Query  863   GLLNMSATL  837
             G+LN++A +
Sbjct  132   GVLNIAAMV  140



>ref|XP_002872904.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49163.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 4/131 (3%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             H+LEI LISAQ L   +  LR   TYA VW + + K  T ID+ G+ NP WNDKF F+V 
Sbjct  5     HVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGSENPIWNDKFVFQVS  64

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGTREVALQIRRPSGSPQ  864
              EFL+SE S V++EIY V + RD  +GTV   VSN + + + K    VALQIRRPSG   
Sbjct  65    PEFLSSETSGVSIEIYAVGYLRDHQIGTVRFLVSNFLPTAAVKVPSLVALQIRRPSGKFH  124

Query  863   GLLNMSATLQE  831
             G+LN++A + +
Sbjct  125   GVLNIAAMVMD  135



>ref|NP_192029.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 emb|CAB80929.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL87353.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45098.1| unknown protein [Arabidopsis thaliana]
 gb|AEE81993.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=250

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 4/131 (3%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
              +LEI LISAQ L   +  LR   TYA VW + + K  T ID+ G+ NP WNDKF F+V 
Sbjct  5     QVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSSKLRTRIDRIGSENPIWNDKFVFQVS  64

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGTREVALQIRRPSGSPQ  864
              EFL+SE S V++EIY V + RD L+GTV   VSN + + + K    VALQIRRPSG   
Sbjct  65    PEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPSLVALQIRRPSGKFH  124

Query  863   GLLNMSATLQE  831
             G+LN++A + +
Sbjct  125   GVLNIAAMVMD  135



>ref|XP_004494776.1| PREDICTED: uncharacterized protein LOC101496947 [Cicer arietinum]
Length=260

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 103/178 (58%), Gaps = 16/178 (9%)
 Frame = -3

Query  1235  LSRPPVGYHILEITLISAQDLPPVS---KSLRTYALVWTNPNRKRTTCIDQNGNANPTWN  1065
             ++ P     +LEI LISAQ L P S   +  +TYAL W + + K  T +D+ G  NPTWN
Sbjct  1     MASPAKTQLVLEINLISAQGLKPPSSPRRRFQTYALTWIDSSTKLRTQVDKIGGQNPTWN  60

Query  1064  DKFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTRE---VAL  894
             DKF F+V  EFLASE S V V IY V  FRD +VGTV    SN++S S+ G R     A 
Sbjct  61    DKFLFRVTPEFLASETSGVCVAIYAVGTFRDHIVGTVRFLTSNILS-SDGGNRTPCFSAC  119

Query  893   QIRRPSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYK----KDLELEKRNILE  732
             QIRR SG   G++N+ A + + +G     P  + +S A GY+    + L+  +R +LE
Sbjct  120   QIRRESGRFHGVMNIGAMVIDGSG----FPALEKIS-AIGYRDLMGEKLKHRRRKLLE  172



>ref|XP_004133823.1| PREDICTED: uncharacterized protein LOC101212280 [Cucumis sativus]
 ref|XP_004155854.1| PREDICTED: uncharacterized protein LOC101225970 [Cucumis sativus]
 gb|KGN56448.1| hypothetical protein Csa_3G119780 [Cucumis sativus]
Length=279

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 86/139 (62%), Gaps = 5/139 (4%)
 Frame = -3

Query  1226  PPVGYHILEITLISAQDLPPVSKSL---RTYALVWTNPNRKRTTCIDQNGNANPTWNDKF  1056
             P    H+LEI LISAQDL   S       TYA+ W +P+ +  T +D  G  NPTWNDKF
Sbjct  13    PATPMHVLEINLISAQDLKIPSNHFNPKHTYAVAWVHPSHRLRTRLDTIGGENPTWNDKF  72

Query  1055  SFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTRE--VALQIRR  882
              F+V  EFLA E S V++EIY++  F D LVGTV   + N+I+P++  T     A+Q+RR
Sbjct  73    LFRVSPEFLARETSGVSIEIYSLGRFCDTLVGTVRFLIGNVIAPNDCSTTPSFTAVQVRR  132

Query  881   PSGSPQGLLNMSATLQENT  825
             PSG   G+LN++  +  N+
Sbjct  133   PSGRFHGVLNVAVMVNGNS  151



>ref|XP_011023248.1| PREDICTED: uncharacterized protein LOC105124808 [Populus euphratica]
Length=260

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 85/131 (65%), Gaps = 7/131 (5%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
             +LE+ LISAQ L P S +LR   TYA+VW +P+ K  T  D+ G+ NPTWNDKF FKV  
Sbjct  5     VLEVNLISAQGLKPPSANLRRMQTYAIVWIDPSTKLRTRTDRVGSENPTWNDKFLFKVTP  64

Query  1037  EFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTRE----VALQIRRPSGS  870
             E+L+SE S V+++IY +   RD L+GTV   VSNL   + +        +ALQIRRPSG 
Sbjct  65    EYLSSETSGVSIQIYAIGCIRDALIGTVRFLVSNLPLSTPRAAITMPSCIALQIRRPSGR  124

Query  869   PQGLLNMSATL  837
               G++N+ A +
Sbjct  125   FHGVINIGANV  135



>ref|XP_006289671.1| hypothetical protein CARUB_v10003230mg [Capsella rubella]
 gb|EOA22569.1| hypothetical protein CARUB_v10003230mg [Capsella rubella]
Length=244

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 84/131 (64%), Gaps = 4/131 (3%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
              +LEI LISAQ +   +  LR   TYA VW + + K  T ID+ G  NP WNDKF F+V 
Sbjct  5     QVLEINLISAQGIKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVS  64

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGTREVALQIRRPSGSPQ  864
              EFL+SE S V++EIY V + RD L+GTV   VSN + + + K    VALQIRRPSG   
Sbjct  65    PEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPSLVALQIRRPSGKFH  124

Query  863   GLLNMSATLQE  831
             G+LN++A + +
Sbjct  125   GVLNIAAMVMD  135



>gb|KDO86360.1| hypothetical protein CISIN_1g047341mg [Citrus sinensis]
Length=254

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 96/161 (60%), Gaps = 9/161 (6%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
              ILEI LISAQ L   S  +R   TYALVW + + K  T +D+ G  +P WN+KF FKV 
Sbjct  4     QILEIILISAQGLKSPSSKMRRMQTYALVWIDSSTKLCTRVDRAGAESPIWNEKFLFKVT  63

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNL-ISPSEKGTREVALQIRRPSGSPQ  864
              EFL+SE S ++VEIY   + RD L+GTV   VSN+ +S + K     A QIRRPSG  Q
Sbjct  64    PEFLSSETSAISVEIYASGYLRDYLIGTVRFLVSNISLSVATKTPSFTAFQIRRPSGRFQ  123

Query  863   GLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRN  741
             G+L++ + L + +     +P  D +S A GY+  +   KR 
Sbjct  124   GVLSIGSMLIDGS----DLPAFDEVS-AIGYRDLMGESKRK  159



>ref|XP_006444911.1| hypothetical protein CICLE_v10021815mg [Citrus clementina]
 ref|XP_006491213.1| PREDICTED: BON1-associated protein 2-like [Citrus sinensis]
 gb|ESR58151.1| hypothetical protein CICLE_v10021815mg [Citrus clementina]
Length=254

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 96/161 (60%), Gaps = 9/161 (6%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
              ILEI LISAQ L   S  +R   TYALVW + + K  T +D+ G  +P WN+KF FKV 
Sbjct  4     QILEIILISAQGLKSPSSKMRRMQTYALVWIDSSTKLCTRVDRAGAESPIWNEKFLFKVT  63

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNL-ISPSEKGTREVALQIRRPSGSPQ  864
              EFL+SE S ++VEIY   + RD L+GTV   VSN+ +S + K     A QIRRPSG  Q
Sbjct  64    PEFLSSETSAISVEIYASGYLRDYLIGTVRFLVSNISLSVATKTPSFTAFQIRRPSGRFQ  123

Query  863   GLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRN  741
             G+L++ + L + +     +P  D +S A GY+  +   KR 
Sbjct  124   GVLSIGSMLIDGS----DLPAFDEVS-AIGYRDLMGESKRK  159



>ref|XP_010936043.1| PREDICTED: uncharacterized protein LOC105055767 [Elaeis guineensis]
Length=280

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 100/169 (59%), Gaps = 13/169 (8%)
 Frame = -3

Query  1211  HILEITLISAQDL-PPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             H+LE+T+ISAQDL P  ++++R YA  W +P++K +T  D+ G+  PTWNDK  F+VDD 
Sbjct  21    HLLELTVISAQDLFPATARAMRAYATAWVHPDKKLSTRTDRAGHTEPTWNDKLVFRVDDA  80

Query  1034  FLASEKSTVTVEIYTVSW-----FRDVLVGTVSVNVSNLISPSEKGTREVALQIRRP-SG  873
             FL S  S +TV+I+ V        +D  +GTV V +S L  P     R  ALQ+RRP S 
Sbjct  81    FLLSVTSAITVDIFAVRHRLSPRLQDPHLGTVRVLLSAL-RPDPGARRFAALQVRRPNSL  139

Query  872   SPQGLLNMSATLQENTG-TSRSMPLSDLMSTASGYK-KDLE---LEKRN  741
              PQG+LN+   L ++     R +PL D +     +  KDLE   +E+R 
Sbjct  140   RPQGILNVGVALLDDFAYVDRMVPLHDDIGEPYAFAYKDLEALSMERRG  188



>emb|CDY48509.1| BnaA09g00140D [Brassica napus]
Length=1733

 Score =   121 bits (304),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 86/129 (67%), Gaps = 4/129 (3%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             H+LEI LISAQ L   +  LR   TYA VW + + K  T ID+ G  NP WNDKF F+V 
Sbjct  1011  HVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSTKLRTRIDRIGAENPIWNDKFVFQVS  1070

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGTREVALQIRRPSGSPQ  864
              EFL+SE S V++EIY V + RD L+GTV   VSN + + +EK    VALQIRRPSG  +
Sbjct  1071  SEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAEKVPSLVALQIRRPSGKFR  1130

Query  863   GLLNMSATL  837
             G+LN++A +
Sbjct  1131  GVLNIAAMV  1139



>emb|CDY07180.1| BnaCnng01950D [Brassica napus]
Length=1640

 Score =   121 bits (304),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 86/129 (67%), Gaps = 4/129 (3%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             H+LEI LISAQ L   +  LR   TYA VW + + K  T ID+ G  NP WNDKF F+V 
Sbjct  1015  HVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSDKLRTRIDRIGAENPIWNDKFVFQVS  1074

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-SPSEKGTREVALQIRRPSGSPQ  864
              EFL+SE S V++EIY V + RD L+GTV   VSN + + +EK    VALQIRRPSG  +
Sbjct  1075  SEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAEKVPSLVALQIRRPSGKFR  1134

Query  863   GLLNMSATL  837
             G+LN++A +
Sbjct  1135  GVLNIAAMV  1143



>ref|XP_002276427.1| PREDICTED: uncharacterized protein LOC100258448 [Vitis vinifera]
Length=265

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 83/136 (61%), Gaps = 11/136 (8%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
              +LEI LISAQ L P S +LR   TYA+ W +   K  T +D+ G  NPTWNDKF F+V 
Sbjct  4     QLLEIILISAQGLKPPSGNLRRMQTYAIAWIDSANKLRTQVDRVGAENPTWNDKFIFRVS  63

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREV--------ALQIR  885
              +FLA + S V VEIY V   RD L+GTV + +SN +  ++  +R          A+QIR
Sbjct  64    SDFLACDTSAVAVEIYAVGVIRDHLIGTVRILISNCLPAADLRSRNFAARSPSLTAVQIR  123

Query  884   RPSGSPQGLLNMSATL  837
             RPSG   G+LN++A +
Sbjct  124   RPSGRFHGVLNVAAAV  139



>gb|EPS68074.1| hypothetical protein M569_06693, partial [Genlisea aurea]
Length=233

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 87/141 (62%), Gaps = 14/141 (10%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
              ILEITLISAQ + P S +LR   TYA+ W NP  K  T +D  G  NPTWNDKF F+V 
Sbjct  4     RILEITLISAQGIKPPSGNLRRLQTYAVTWVNPATKLRTRVDSMGGENPTWNDKFLFRVC  63

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLIS-------PSEKGT----REVAL  894
             ++F++ + S V+VEI+ V + +D L+GTV   +S+            E+GT       A+
Sbjct  64    NDFISGDTSAVSVEIFAVGYIKDFLIGTVRFLLSSCFKRPGSVELSREEGTIGTPAFTAV  123

Query  893   QIRRPSGSPQGLLNMSATLQE  831
             QIRRPSG  QG+LN++A + +
Sbjct  124   QIRRPSGRFQGVLNIAAAVYQ  144



>gb|AES82742.2| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=256

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 101/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  1241  SCLSRPPVGYHILEITLISAQDLPPVS---KSLRTYALVWTNPNRKRTTCIDQNGNANPT  1071
             S +  P     +LEI LISAQ L P S   ++ +TYAL W + + K  T +D+ G  NPT
Sbjct  3     SLVKSPAKTQLVLEINLISAQGLKPPSSPRRNFQTYALTWIDSSTKLRTRVDKIGGQNPT  62

Query  1070  WNDKFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSV--NVSNLISPSEKGTRE--  903
             WNDKF F++  EFLASE S V+V IY V  FRD LVGTV    +     S ++ G R   
Sbjct  63    WNDKFLFRITPEFLASETSGVSVAIYAVGTFRDHLVGTVRFLISNILSSSSADSGNRTPC  122

Query  902   -VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLS-----DLMSTASGYKKDLELEKR  744
               A+QIRRPSGS  G+LN+ A + + +G      +S     DLM     +++   LE++
Sbjct  123   FSAVQIRRPSGSFCGILNIGAMVVDGSGFPALEKISAIGYHDLMGEKIKHRRKKLLEQK  181



>ref|XP_009350266.1| PREDICTED: uncharacterized protein LOC103941795 [Pyrus x bretschneideri]
 ref|XP_009350267.1| PREDICTED: uncharacterized protein LOC103941796 [Pyrus x bretschneideri]
Length=271

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 94/151 (62%), Gaps = 7/151 (5%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             H+LEI L+SAQ L   S +LR   TYAL W +   K  + +D+ G  NPTWND+  FKV 
Sbjct  13    HVLEINLVSAQGLKAPSVTLRRMQTYALAWVDSAHKIRSRVDKVGGENPTWNDRCLFKVP  72

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQG  861
               FL+SE S V+V+IY V  FRD LVGTV   ++N +  S       A+QIRRPSG  +G
Sbjct  73    SGFLSSETSQVSVQIYAVGCFRDHLVGTVRFLINNFLDVSSAIPSFTAIQIRRPSGRFRG  132

Query  860   LLNMSATLQENTGTSRSMPLSDLMSTASGYK  768
             +LN++A + +  G+S +  +S+L   A GY+
Sbjct  133   VLNVAALVID--GSSLAPAVSEL--PAIGYR  159



>ref|XP_007218843.1| hypothetical protein PRUPE_ppa010336mg [Prunus persica]
 gb|EMJ20042.1| hypothetical protein PRUPE_ppa010336mg [Prunus persica]
Length=253

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 81/127 (64%), Gaps = 3/127 (2%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
             +LEI LISAQ L   + +LR   TYAL W +   K  + +D+ G +NPTWND+F FKV  
Sbjct  14    VLEIHLISAQGLKAPTGTLRRMQTYALAWVDSAHKLRSRVDKIGASNPTWNDRFLFKVPP  73

Query  1037  EFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGL  858
              FL+SE S V+V+IYTV  FRD LVG+V   ++N +    K     A+QIRRPSG   G+
Sbjct  74    GFLSSETSAVSVQIYTVGTFRDHLVGSVRFLINNFLDVHSKMPSFTAVQIRRPSGRFYGV  133

Query  857   LNMSATL  837
             LN+ A +
Sbjct  134   LNVGAMV  140



>ref|XP_003626524.1| hypothetical protein MTR_7g116840 [Medicago truncatula]
Length=284

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 101/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  1241  SCLSRPPVGYHILEITLISAQDLPPVS---KSLRTYALVWTNPNRKRTTCIDQNGNANPT  1071
             S +  P     +LEI LISAQ L P S   ++ +TYAL W + + K  T +D+ G  NPT
Sbjct  3     SLVKSPAKTQLVLEINLISAQGLKPPSSPRRNFQTYALTWIDSSTKLRTRVDKIGGQNPT  62

Query  1070  WNDKFSFKVDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSV--NVSNLISPSEKGTRE--  903
             WNDKF F++  EFLASE S V+V IY V  FRD LVGTV    +     S ++ G R   
Sbjct  63    WNDKFLFRITPEFLASETSGVSVAIYAVGTFRDHLVGTVRFLISNILSSSSADSGNRTPC  122

Query  902   -VALQIRRPSGSPQGLLNMSATLQENTGTSRSMPLS-----DLMSTASGYKKDLELEKR  744
               A+QIRRPSGS  G+LN+ A + + +G      +S     DLM     +++   LE++
Sbjct  123   FSAVQIRRPSGSFCGILNIGAMVVDGSGFPALEKISAIGYHDLMGEKIKHRRKKLLEQK  181



>ref|XP_009347863.1| PREDICTED: uncharacterized protein LOC103939495 [Pyrus x bretschneideri]
Length=271

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 94/151 (62%), Gaps = 7/151 (5%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             H+LEI L+SAQ L   S +LR   TYAL W +   K  + +D+ G  NPTWND+  FKV 
Sbjct  13    HVLEINLVSAQGLKAPSVTLRRMQTYALAWVDSAHKIRSRLDKVGGENPTWNDRCLFKVP  72

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQG  861
               FL+SE S V+V+IY V  FRD LVGTV   ++N +  S       A+QIRRPSG  +G
Sbjct  73    SGFLSSETSQVSVQIYAVGCFRDHLVGTVRFLINNFLDVSSTIPSFTAIQIRRPSGRFRG  132

Query  860   LLNMSATLQENTGTSRSMPLSDLMSTASGYK  768
             +LN++A + +  G+S +  +S+L   A GY+
Sbjct  133   VLNVAALVID--GSSLAPAVSEL--PAIGYR  159



>ref|XP_010055064.1| PREDICTED: uncharacterized protein LOC104443389 [Eucalyptus grandis]
 gb|KCW71540.1| hypothetical protein EUGRSUZ_E00081 [Eucalyptus grandis]
Length=267

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 97/158 (61%), Gaps = 13/158 (8%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
             ILE+ LISAQ+L P   ++R   TY+LVW +P+ K  T +D+ G+ NPTWNDKF F+V  
Sbjct  11    ILELHLISAQNLKPPPANMRRTETYSLVWVDPSTKLRTRLDRVGSDNPTWNDKFFFRVGP  70

Query  1037  EFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLIS-PSEKGTREV----ALQIRRPSG  873
             +FL+S  S VTVEIY V + RD LVG+V + +S ++S P   G  ++    A+ IRRPSG
Sbjct  71    DFLSSHTSAVTVEIYAVGYIRDYLVGSVRLLLSTVLSWPDFVGNSKLPYFTAVGIRRPSG  130

Query  872   SPQGLLNMSATLQENTGTS-----RSMPLSDLMSTASG  774
                G+LN+   L   +  +      ++   DLM  ++G
Sbjct  131   KIHGVLNIGIMLTNGSDFTALKGASAIGYRDLMGQSAG  168



>ref|XP_010251574.1| PREDICTED: uncharacterized protein LOC104593437 [Nelumbo nucifera]
Length=269

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             H+LEI LISAQ L P S +LR   TYA+ W +   K  T +D+ G  NPTWNDKF F+V 
Sbjct  6     HLLEINLISAQGLKPPSANLRRMQTYAVAWIDSAIKLRTRVDRVGCENPTWNDKFIFRVS  65

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRP-SGSPQ  864
               FL+++ S V+VEIY V + +D L+GTV   + N +S S       ALQIRRP SG   
Sbjct  66    SAFLSTDTSAVSVEIYVVGYLKDTLIGTVRFLIGNCLSSSAPTFS--ALQIRRPSSGRFH  123

Query  863   GLLNMSATLQEN  828
             G+LN+ A + +N
Sbjct  124   GVLNIGAMVIKN  135



>gb|KDP30266.1| hypothetical protein JCGZ_17048 [Jatropha curcas]
Length=200

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 83/132 (63%), Gaps = 5/132 (4%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
              ILEI LISAQ L P S S R   TYA+V  + + K  + ID +G  +P W DKF FKV 
Sbjct  2     KILEINLISAQGLNPPSSSRRRMQTYAVVSIDSSTKLRSRIDLDGGEDPIWGDKFLFKVT  61

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSN--LISPSEKGTREVALQIRRPSGSP  867
              EFL+ E ++V+VEI+ V   RD L+GTV + +SN  L S   +    VA+QIRRPSG  
Sbjct  62    PEFLSGETTSVSVEIFAVGCLRDKLLGTVRLLISNIPLFSQEMRTPSFVAMQIRRPSGRF  121

Query  866   QGLLNMSATLQE  831
             QGLLN+ A + +
Sbjct  122   QGLLNIGAIIHD  133



>ref|XP_008801291.1| PREDICTED: uncharacterized protein LOC103715451 [Phoenix dactylifera]
Length=337

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 112/212 (53%), Gaps = 31/212 (15%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
             H+LE+T++SAQDL   S+S+RTYA+ W  P  K  T +D  G+  PTWNDKF F+VDD  
Sbjct  22    HLLEVTVVSAQDLFANSRSMRTYAVAWIEPAHKLRTRLDAAGHTEPTWNDKFVFRVDDAV  81

Query  1031  LASEKSTVTVEIYTVS-WF---RDVLVGTVSVNVSNLISPSEKGTREVALQIRRP-SGSP  867
             L S+ + VTV IY     F    D+L+GT    +S L  PS   TR VA+ +RRP S  P
Sbjct  82    LRSDTAAVTVNIYAARPRFLPASDILIGTARALLSAL-RPS-TATRFVAVLVRRPQSLRP  139

Query  866   QGLLNMSATLQENTGTSRSMPLSDLMSTASG-----------YKKDLELEKRN------I  738
             QG+LN+  +L +     RS+P+   ++ A              KK      R+       
Sbjct  140   QGILNIGVSLLD--AYVRSLPIFAELAGAGAPSAVVCNNAPKNKKTRPPVDRDGATVESK  197

Query  737   LEYHNSE-----DEERERLHAKILQWRRSMTP  657
             LE   SE     ++ER  L AK+ +WR  + P
Sbjct  198   LEQWRSELPPVSEKERTALEAKLFKWRAELPP  229



>ref|XP_008796382.1| PREDICTED: uncharacterized protein LOC103711856 [Phoenix dactylifera]
Length=282

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 95/168 (57%), Gaps = 13/168 (8%)
 Frame = -3

Query  1211  HILEITLISAQDL-PPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDE  1035
             H+LE+T+ISAQDL P  ++S+R YA  W +P+RK  T  D+ G  +PTWNDK  F+VD  
Sbjct  21    HLLELTVISAQDLFPATARSMRAYATAWVHPDRKLLTRTDRAGRTDPTWNDKLVFRVDAA  80

Query  1034  FLASEKSTVTVEIYTVS-----WFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRP-SG  873
             FL S  S VTV+I+          RD  +GTV V +S    P     R  ALQ+RRP S 
Sbjct  81    FLLSVTSAVTVDIFAARRRLSPRLRDPHLGTVRVLLSAF-RPEPGSRRFAALQVRRPNSL  139

Query  872   SPQGLLNMSATLQENTG-TSRSMPLSDLMSTASGYK-KDLE---LEKR  744
              PQG+LN+   L +      R +PL D +     +  KDLE   +E+R
Sbjct  140   RPQGILNVGIALLDGLAYVDRMVPLHDDIGEPYAFAYKDLEALSMERR  187



>ref|XP_008233233.1| PREDICTED: uncharacterized protein LOC103332288 [Prunus mume]
Length=273

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 80/127 (63%), Gaps = 3/127 (2%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
             +LEI LISAQ L   + +LR   TYAL W +   K  + +D+ G +NPTWND+F FKV  
Sbjct  15    VLEIHLISAQGLKAPAGTLRRMQTYALAWVDSAHKLRSRVDKIGASNPTWNDRFLFKVPP  74

Query  1037  EFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREVALQIRRPSGSPQGL  858
              FL+SE S V+V+IY V  FRD LVG+V   ++N +    K     A+QIRRPSG   G+
Sbjct  75    GFLSSETSAVSVQIYAVGTFRDHLVGSVRFLINNFLDVHSKMPSFTAVQIRRPSGRFYGV  134

Query  857   LNMSATL  837
             LN+ A +
Sbjct  135   LNVGAMV  141



>ref|XP_011093241.1| PREDICTED: uncharacterized protein LOC105173247 [Sesamum indicum]
Length=262

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 93/160 (58%), Gaps = 18/160 (11%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKV  1044
             + ILEI LI+AQ L   S +LR   TYA++W NP +K  T +D  G  NPTWNDKF F+V
Sbjct  4     HQILEINLITAQGLKTPSANLRRMQTYAVIWVNPGKKLRTRLDSLGGENPTWNDKFLFRV  63

Query  1043  DDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPS----------EKGTREVAL  894
              +EF++ + S V+VEI+ + + +D L+GTV   +S  +  +             +   A+
Sbjct  64    SNEFISGDTSAVSVEIFALGYIKDFLIGTVRFLLSTCLKRTIPIASAGGGSVGSSAFTAV  123

Query  893   QIRRPSGSPQGLLNMSATLQENT-----GTSRSMPLSDLM  789
             QIRRPSG  QG+LN++  + +++     G   ++   DLM
Sbjct  124   QIRRPSGRFQGVLNIATAVYDSSEFPILGKISAVSFHDLM  163



>emb|CDP08734.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 82/138 (59%), Gaps = 11/138 (8%)
 Frame = -3

Query  1217  GYHILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFK  1047
             G  ILEI LISAQ L   S S R   TYAL W +P  K  T  D+ G  NPTWNDKF F+
Sbjct  19    GDQILEINLISAQGLKTPSGSRRRMHTYALAWVDPTAKLRTRTDRVGAENPTWNDKFLFR  78

Query  1046  VDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLIS--PSEKGTREV------ALQ  891
             V   FLA E S VTVEIY V + RD L+GTV   +S+ +   PS      +      A+Q
Sbjct  79    VSSRFLACETSGVTVEIYAVGYIRDYLIGTVRFLLSSCLGKFPSSADAIAIGTPAFTAVQ  138

Query  890   IRRPSGSPQGLLNMSATL  837
             I+RPSG   G+LN++A++
Sbjct  139   IQRPSGRFHGVLNIAASV  156



>ref|XP_004229965.1| PREDICTED: BON1-associated protein 2 [Solanum lycopersicum]
Length=270

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 97/168 (58%), Gaps = 15/168 (9%)
 Frame = -3

Query  1217  GYHILEITLISAQDLP-PVS--KSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFK  1047
             G  ILEI LISAQ L  PV+  + ++TYA++W + + K  T ID  G  NPTWNDKF F+
Sbjct  4     GTQILEINLISAQSLKTPVANLRRMQTYAILWVDSSTKLRTKIDHLGGENPTWNDKFLFR  63

Query  1046  VDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREV------ALQIR  885
             V  EF++ E S V+VEIY V + +D L+GTV + +S+ +    K           A+Q+R
Sbjct  64    VSPEFISGETSGVSVEIYAVGYIKDFLIGTVRLLISSCLKGIAKHGITTATPAFNAVQVR  123

Query  884   RPSGSPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRN  741
             RPSG   G+LN++A +  ++  S    L  L +   G   DL  EK N
Sbjct  124   RPSGRFHGVLNIAAAVYSSSDFSL---LDGLSAICFG---DLMEEKEN  165



>ref|XP_006339653.1| PREDICTED: uncharacterized protein LOC102592387 [Solanum tuberosum]
Length=269

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 85/140 (61%), Gaps = 17/140 (12%)
 Frame = -3

Query  1217  GYHILEITLISAQDLP-PVS--KSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFK  1047
             G  ILEI LISAQ L  PV+  + ++TYA++W + + K  T ID  G  NPTWNDKF F+
Sbjct  4     GTQILEINLISAQSLKTPVANLRRMQTYAILWVDSSTKLRTKIDHLGGENPTWNDKFLFR  63

Query  1046  VDDEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTRE----------VA  897
             V  EF++ E S V+VEIY V + +D L+GTV +    LIS   KG              A
Sbjct  64    VSPEFISGETSGVSVEIYAVGYIKDFLIGTVRL----LISSCLKGIANHGITTATPAFTA  119

Query  896   LQIRRPSGSPQGLLNMSATL  837
             +Q+RRPSG   G+LN++A +
Sbjct  120   VQVRRPSGRFHGVLNIAAAV  139



>ref|XP_009764572.1| PREDICTED: uncharacterized protein LOC104216252 [Nicotiana sylvestris]
Length=263

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 86/141 (61%), Gaps = 13/141 (9%)
 Frame = -3

Query  1211  HILEITLISAQDLP-PVS--KSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
              ILEI LISAQ L  P++  + ++TYAL+W N + K  T ID  G  NPTWNDKF F+V 
Sbjct  7     QILEINLISAQSLKTPITNLRRMQTYALLWVNSSNKLRTKIDHFGGENPTWNDKFLFRVS  66

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTRE------VALQIRRP  879
              +F++ + S V+VEIY V   +D LVGTV +    L+S   KG          A+QIRRP
Sbjct  67    PKFISGDTSGVSVEIYAVGVLKDFLVGTVRL----LLSSCFKGMVNTATPAFTAVQIRRP  122

Query  878   SGSPQGLLNMSATLQENTGTS  816
             SG  QG+LN+ A +  +T  S
Sbjct  123   SGRFQGVLNIGAAVYISTDFS  143



>ref|XP_011093070.1| PREDICTED: uncharacterized protein LOC105173112 [Sesamum indicum]
Length=258

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 81/135 (60%), Gaps = 10/135 (7%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
              ILEI LISAQ L   S +LR   TYA+ W N   K  TC D  G  NP WNDKF F+V 
Sbjct  4     QILEIDLISAQGLKTPSGNLRRLQTYAVTWINSAAKLRTCTDSLGGENPNWNDKFLFRVS  63

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI---SPSEKGTRE----VALQIRR  882
             +EF++ E S V VEI+ V   +D+L+G+V   +S  +   +P   G+       A+QIRR
Sbjct  64    NEFISRETSAVAVEIFVVGRIKDILIGSVRFLLSTCLKRATPLASGSTGTPVFTAVQIRR  123

Query  881   PSGSPQGLLNMSATL  837
             PSG  QG+LN++A +
Sbjct  124   PSGRFQGVLNIAAAV  138



>ref|XP_010920373.1| PREDICTED: CASP-like protein 4A1 [Elaeis guineensis]
Length=458

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 113/212 (53%), Gaps = 31/212 (15%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
             H+LE+T++SAQDL   S+S+RTYA+ W +P  K  T +D  G+  PTWNDKF F++DD  
Sbjct  22    HLLEVTVVSAQDLFANSRSMRTYAVAWIDPAHKLRTRLDAAGHTEPTWNDKFVFRLDDAI  81

Query  1031  LASEKSTVTVEIYTVSWF----RDVLVGTVSVNVSNLISPSEKGTREVALQIRRP-SGSP  867
             L S+ + VTV I+          D L+GT    +S L  PS   TR VA+Q+RRP S  P
Sbjct  82    LRSDTAAVTVNIFAARPRFLPGSDNLIGTARALLSTL-RPS-TTTRFVAVQVRRPQSLRP  139

Query  866   QGLLNMSATLQENTGTSRSMPL-SDLMS----------TASGYKKDLELEKRN------I  738
             QG+LN+  +L +     RS P+ ++L S           A   KK      R+       
Sbjct  140   QGILNLGVSLLD--AYVRSFPIFAELASDGAPSAIVCNNAPKNKKARPSVDRDGAAVQSK  197

Query  737   LEYHNSE-----DEERERLHAKILQWRRSMTP  657
             L+   SE     DEER  L AK+ +WR  + P
Sbjct  198   LDQWRSELPPVSDEERMALEAKLAKWRAELPP  229



>ref|XP_008437926.1| PREDICTED: uncharacterized protein LOC103483209 [Cucumis melo]
 gb|ADN34173.1| c2 domain-containing protein [Cucumis melo subsp. melo]
Length=279

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 5/133 (4%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVSKSL---RTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
             +LEI LISAQDL   S       TYA+ W +P+ +  T +D  G  NPTWNDKF F+V  
Sbjct  19    VLEINLISAQDLKVPSNPFNPKHTYAVAWIHPSHRLRTRLDTIGGENPTWNDKFLFRVSP  78

Query  1037  EFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTRE--VALQIRRPSGSPQ  864
             EFLA E S V++EIY++  F D LVGTV   + N+++ ++        A+Q+RRPSG   
Sbjct  79    EFLARETSGVSIEIYSLGRFCDTLVGTVRFLIGNVVASNDCSATPAFTAVQVRRPSGRFH  138

Query  863   GLLNMSATLQENT  825
             G+LN+   +  N+
Sbjct  139   GVLNIGVMVNGNS  151



>emb|CDP17419.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 82/138 (59%), Gaps = 9/138 (7%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
              ILEI LISAQ L   S S R   TYAL W +P  K  T  D+ G  NPTWN+ F F+V 
Sbjct  20    QILEINLISAQGLKTPSGSRRRMQTYALAWVDPATKLRTRTDRVGAENPTWNELFLFRVS  79

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLI-----SPSEKGTREV-ALQIRRP  879
               FLA E S VTVEIY V + RD L+GTV   +S+ +     S    GT    A+QIRRP
Sbjct  80    SHFLACEPSGVTVEIYAVGYIRDYLIGTVRFLLSSCLGKFPSSADAIGTPAFTAVQIRRP  139

Query  878   SGSPQGLLNMSATLQENT  825
             SG   G+LN++A++  +T
Sbjct  140   SGRFHGVLNIAASVCSST  157



>emb|CAN79006.1| hypothetical protein VITISV_040896 [Vitis vinifera]
Length=380

 Score =   109 bits (272),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 80/136 (59%), Gaps = 11/136 (8%)
 Frame = -3

Query  1211  HILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
              +LEI LIS QDL P S +LR   T ALVW +   K  T +D+ G  NPTWNDKF F+  
Sbjct  27    QLLEIILISTQDLKPPSGNLRRMQTCALVWVDSANKLRTQVDRVGVENPTWNDKFIFRAS  86

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREV--------ALQIR  885
              +FLA   S V VEIY V   RD L+GTV + +SN +  ++  +R          A+QIR
Sbjct  87    SDFLACATSIVAVEIYAVGVIRDHLIGTVRILISNCLPAADLRSRNFAARSPSLTAVQIR  146

Query  884   RPSGSPQGLLNMSATL  837
             RPSG    +LN++A +
Sbjct  147   RPSGRFHSVLNVAAAV  162



>ref|XP_009591358.1| PREDICTED: uncharacterized protein LOC104088405 [Nicotiana tomentosiformis]
Length=267

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 86/145 (59%), Gaps = 17/145 (12%)
 Frame = -3

Query  1211  HILEITLISAQDLP-PVS--KSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
              ILEI LISAQ L  P++  + L+TYAL++ + + K  T ID  G  NPTWNDKF F+V 
Sbjct  7     QILEINLISAQSLKTPIANFRRLQTYALIFVDSSNKLRTKIDHFGGENPTWNDKFLFRVS  66

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTRE----------VALQ  891
              +F++ + S V+VEIY V   +D LVGTV +    L+S   KG              A+Q
Sbjct  67    PKFISGDTSGVSVEIYAVGVLKDFLVGTVRL----LLSSCFKGMVNSGISTATPVFTAVQ  122

Query  890   IRRPSGSPQGLLNMSATLQENTGTS  816
             IRRPSG  QG+LN+ A +  +T  S
Sbjct  123   IRRPSGRFQGVLNIGAAVYSSTDFS  147



>gb|ABK23345.1| unknown [Picea sitchensis]
Length=194

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 72/108 (67%), Gaps = 6/108 (6%)
 Frame = -3

Query  1154  LRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEFLASEKSTVTVEIYTVSWFR  975
             +R YA+ + +P +K +T IDQ+G  NPTWN+K     DDE L++  + +TVEIY+ S  R
Sbjct  1     MRCYAVAYIDPEQKASTRIDQDGGINPTWNEKLVLAADDELLSNVLAAITVEIYSYSHIR  60

Query  974   DVLVGTVSVNVSNLI------SPSEKGTREVALQIRRPSGSPQGLLNM  849
             D LVGT  + +S+L+      +PS+   + +A+Q+RRPS  PQG+LN+
Sbjct  61    DKLVGTARILISDLLKGGDPANPSDNPIQCIAVQVRRPSSRPQGILNV  108



>ref|XP_008679175.1| PREDICTED: uncharacterized protein LOC103654122 [Zea mays]
 gb|AFW64016.1| hypothetical protein ZEAMMB73_220242 [Zea mays]
Length=271

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 98/178 (55%), Gaps = 15/178 (8%)
 Frame = -3

Query  1211  HILEITLISAQDL--PPVSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
             H+LE+T+ISAQDL    + + +R YA+ W +  +K  T +D  G A PTWND+F F+VD 
Sbjct  16    HLLEVTVISAQDLQRRRLGRRVRAYAVAWADARQKLRTGVDHAGGAAPTWNDRFLFRVDG  75

Query  1037  EFLASEKSTVTVEIYTVSWF-RDVLVGTVSVNVSNLISPSEKGTREVALQIRRP-SGSPQ  864
              FL SE + VTVE+        D ++G   + VS  + P+  G +  ALQ+RRP S  PQ
Sbjct  76    AFLRSETAAVTVEVRGAGVLGGDTVLGVTRIVVSTFVRPA-GGAQVAALQLRRPRSLRPQ  134

Query  863   GLLNMSATLQENTGTSRSMPLSDLMSTASGYK-KDLELEK------RNILEYHNSEDE  711
             G++N++  L +    +R+ PL  +  +      KDL + +      R + E   + DE
Sbjct  135   GIVNVAVALLD---AARAPPLDGVPGSPDAVAVKDLVMRRPAAPPLRKVGEASEASDE  189



>gb|AEW08214.1| hypothetical protein 2_3193_01, partial [Pinus radiata]
 gb|AFG52317.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52318.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52322.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52323.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52324.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52328.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52329.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52331.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52332.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 76/120 (63%), Gaps = 8/120 (7%)
 Frame = -3

Query  1184  AQDLPPVSK--SLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEFLASEKST  1011
             A+DL  V +   ++ YA+ + +P+ K +T IDQ+G  NP W+ K     DDE L++  + 
Sbjct  1     AEDLKNVKRIRKMKCYAVAYIDPDHKASTRIDQDGGINPNWHQKLVLAADDELLSNVLAA  60

Query  1010  VTVEIYTVSWFRDVLVGTVSVNVSNLI------SPSEKGTREVALQIRRPSGSPQGLLNM  849
             +TV+IY+ S  RD LVGT  + V +L+      +PS+   + +A+Q+RRPSG PQG+LN+
Sbjct  61    ITVDIYSYSHIRDKLVGTARILVPDLLKGGDPANPSDNPIQCIAVQVRRPSGRPQGILNI  120



>ref|XP_003572941.1| PREDICTED: uncharacterized protein LOC100843074 [Brachypodium 
distachyon]
Length=278

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 80/250 (32%), Positives = 118/250 (47%), Gaps = 56/250 (22%)
 Frame = -3

Query  1232  SRPPVGYHILEITLISAQDLPPVSKSLR-----TYALVWTNPNRKRTTCIDQNGNANPTW  1068
             S PP   H+LE+T+ISAQDL      L       YA+ WT+  RK  T +D  G A+PTW
Sbjct  10    SPPP---HLLEVTVISAQDLHRGRLGLGRRRVRAYAMAWTDGARKLRTGVDLAGGADPTW  66

Query  1067  NDKFSFKVDDEFLASEKSTVTVEIYTVSWFR--DVLVGTVSVNVSNLISPSEK-----GT  909
             ND+F F+VD  FL SE ++V VE+         D ++G   + VS  +S S       G 
Sbjct  67    NDRFLFRVDPGFLRSETASVAVEVRGARSLLGGDAVLGHTRIVVSAFVSASRGDGRPIGG  126

Query  908   REV-ALQIRRP-SGSPQGLLNMSATLQENT-----------GTSRSMPLSDLMSTAS---  777
             R+V ALQ+RRP S  PQG++N++  L +             G+  +  + DLM+ A+   
Sbjct  127   RQVAALQLRRPRSLRPQGIVNVAVALLDGATHAVPPVYNAPGSPDAFAVKDLMAVAARQL  186

Query  776   ---------------GYKKDLELEKRNILEYHNSEDE-----ERERLHAKILQWRRSMTP  657
                            G   D    +R  +E     D      E+ +L  K+ +W+  ++P
Sbjct  187   PPALGKIAEEDEEEGGAVLDHHGRRRRFVENSGPLDARGAAVEQSKLEMKLEKWKADLSP  246

Query  656   DMMSDVNGEE  627
             D     +GEE
Sbjct  247   D-----HGEE  251



>ref|XP_008791481.1| PREDICTED: uncharacterized protein LOC103708363 [Phoenix dactylifera]
Length=244

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 78/133 (59%), Gaps = 7/133 (5%)
 Frame = -3

Query  1214  YHILEITLISAQDLPPVS--KSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             YH LEI LI AQ L P +  +  + YA+ W +P  K  T +D+ G  NPTWNDKF F V 
Sbjct  3     YHFLEINLICAQGLKPPAGFRRAQAYAVAWVDPAFKLRTRVDRTGGENPTWNDKFIFHVP  62

Query  1040  DEFLASEKST-VTVEIY-TVSW-FRDVLVGTVSVNVSNLISPSEKGTREV--ALQIRRPS  876
               FLA + S+ V+VEIY T  W   D L+GTV + V NL   S +    V  A+ IRRPS
Sbjct  63    AGFLADDSSSAVSVEIYATAGWILTDSLLGTVRLLVGNLRLLSRRDGCPVFDAVGIRRPS  122

Query  875   GSPQGLLNMSATL  837
             G   G+LN+ A L
Sbjct  123   GRLHGVLNVGAML  135



>ref|XP_008798687.1| PREDICTED: uncharacterized protein LOC103713510 [Phoenix dactylifera]
Length=238

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 91/168 (54%), Gaps = 9/168 (5%)
 Frame = -3

Query  1211  HILEITLISAQDL-PPVS-KSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
             H+LEI LISAQ L PP   + ++ YA+ W +P  K  T +D+ G  NPTWNDKF F+V  
Sbjct  4     HVLEINLISAQGLKPPFGLRRVQAYAVAWVDPAFKVRTRVDRTGGENPTWNDKFIFRVPA  63

Query  1037  EFLASEK-STVTVEIYTVS-W-FRDVLVGTVSVNVSNLISPSEKGTREV--ALQIRRPSG  873
              FLA +  S V++EIY  + W   D L+GTV + V NL   S +       A+ IRRPSG
Sbjct  64    GFLADDSTSAVSIEIYAAAGWILPDPLLGTVRLLVGNLRLLSRRRACPAFDAVGIRRPSG  123

Query  872   SPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRNILEY  729
                G+LN+ ATL        +  L+     A GY+  +  E   I  +
Sbjct  124   RFHGILNVGATLLHCVSLVATEALA--ACPAVGYRDLMGKEASKIRRF  169



>gb|AFG52315.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52316.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52319.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52325.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52327.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52330.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 75/120 (63%), Gaps = 8/120 (7%)
 Frame = -3

Query  1184  AQDLPPVSK--SLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEFLASEKST  1011
             A+DL  V +   ++ YA+ + +P+ K +T IDQ+G  NP W+ K     DDE L++  + 
Sbjct  1     AEDLKNVKRIRKMKCYAVAYIDPDHKASTRIDQDGGINPNWHQKLVLAADDELLSNVLAA  60

Query  1010  VTVEIYTVSWFRDVLVGTVSVNVSNLI------SPSEKGTREVALQIRRPSGSPQGLLNM  849
             +TV+IY+ S  RD LVGT  + V +L+      +PS+   +  A+Q+RRPSG PQG+LN+
Sbjct  61    ITVDIYSYSHIRDKLVGTARILVPDLLKGGDPANPSDNPIQCSAVQVRRPSGRPQGILNI  120



>ref|XP_010914657.1| PREDICTED: uncharacterized protein LOC105039993 [Elaeis guineensis]
Length=251

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 78/132 (59%), Gaps = 7/132 (5%)
 Frame = -3

Query  1211  HILEITLISAQDL-PPVS-KSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
              +LEI LISAQ L PP   + ++ YA+ W  P  K  T +D+ G  NPTWNDKF F+V  
Sbjct  4     QLLEINLISAQSLKPPFGLRRVQAYAVAWVEPAFKVRTLVDRTGGENPTWNDKFIFRVPS  63

Query  1037  EFLASEK-STVTVEIYTVS--WFRDVLVGTVSVNVSN--LISPSEKGTREVALQIRRPSG  873
              FLA++  STV VEIY  +     D L+GTV + V N  L+S         A+ IRRPSG
Sbjct  64    GFLANDSASTVAVEIYAAAGRILPDPLLGTVRLLVGNLRLLSRRRDCPAFDAVGIRRPSG  123

Query  872   SPQGLLNMSATL  837
                G+LN+ ATL
Sbjct  124   RFHGVLNVGATL  135



>gb|EAY87999.1| hypothetical protein OsI_09421 [Oryza sativa Indica Group]
Length=281

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 92/148 (62%), Gaps = 11/148 (7%)
 Frame = -3

Query  1214  YHILEITLISAQDL-PPVSKSLRT-YALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
               +LE+T+ISAQDL   + + +R  YA+ W +   K  T +D  G A+PTWND+F F+VD
Sbjct  23    LQLLEVTVISAQDLHRRLGRRVRAAYAVAWADVAHKLRTGVDLAGGADPTWNDRFLFRVD  82

Query  1040  DEFLASEKSTVTVEIYTVSWF-RDVLVGTVSVNVSNLI---SPSEKGT--REV-ALQIRR  882
             + FL S+ + VTVE+     F  D ++G   + VS  +   S S +GT  R+V ALQ+RR
Sbjct  83    EAFLRSDTAAVTVEVRAPRRFGGDAVLGVTRIVVSTFVGSASSSARGTTGRQVAALQLRR  142

Query  881   P-SGSPQGLLNMSATLQENTGTSRSMPL  801
             P S  PQG++N++  + + T  +R++PL
Sbjct  143   PRSLRPQGIVNVAVAVLDAT-DARAVPL  169



>gb|AFG52320.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52321.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52326.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 74/120 (62%), Gaps = 8/120 (7%)
 Frame = -3

Query  1184  AQDLPPVSK--SLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEFLASEKST  1011
             A+DL  V +   ++ YA+ + +P+ K +T IDQ+G  NP W+ K     DDE L++  + 
Sbjct  1     AEDLKNVKRIRKMKCYAVAYIDPDHKASTRIDQDGGINPNWHQKLVLAADDELLSNVLAA  60

Query  1010  VTVEIYTVSWFRDVLVGTVSVNVSNLI------SPSEKGTREVALQIRRPSGSPQGLLNM  849
             +TV+IY+ S  RD LVGT  + V +L+      +P +   +  A+Q+RRPSG PQG+LN+
Sbjct  61    ITVDIYSYSHIRDKLVGTARILVPDLLKGGDPANPFDNPIQCSAVQVRRPSGRPQGILNI  120



>ref|XP_007031704.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
 gb|EOY02630.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
Length=306

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 88/164 (54%), Gaps = 13/164 (8%)
 Frame = -3

Query  1208  ILEITLISAQDLPPVS----KSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVD  1041
             +LE+  ISAQ L   S    + L+TYA+ W + + K  T +D+ G  NPTWNDKF FKV 
Sbjct  7     VLELNFISAQGLVHPSLIPDRHLKTYAVAWVDSSTKLHTRVDRVGGENPTWNDKFLFKVS  66

Query  1040  DEFLASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTREV----ALQIRRPSG  873
              EFL ++ STV+VEIY    FRD L+G+V + + N I  +     +     AL I  P G
Sbjct  67    PEFLFNKTSTVSVEIYAAGTFRDRLIGSVRLLIHNFIPTASAAAMKTPAFAALLIHSPFG  126

Query  872   SPQGLLNMSATLQENTGTSRSMPLSDLMSTASGYKKDLELEKRN  741
                G LN+   + +  G+   + LS + +      +DL  E RN
Sbjct  127   QFFGTLNVGGMVLD--GSRFQLALSKVSTIDY---RDLTGENRN  165



>ref|XP_010914471.1| PREDICTED: uncharacterized protein LOC105039856 [Elaeis guineensis]
Length=251

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 78/132 (59%), Gaps = 7/132 (5%)
 Frame = -3

Query  1211  HILEITLISAQDL-PPVS-KSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDD  1038
              +LEI LISAQ L PP   + ++ YA+ W  P  K  T +D+ G  NPTWNDKF F+V  
Sbjct  4     QLLEINLISAQSLKPPFRLRHVQAYAVAWVEPAFKVRTLVDRTGGENPTWNDKFIFRVPS  63

Query  1037  EFLASEK-STVTVEIYTVS--WFRDVLVGTVSVNVSN--LISPSEKGTREVALQIRRPSG  873
              FLA++  STV VEIY  +     D L+GTV + V N  L+S         A+ IRRPSG
Sbjct  64    GFLANDSTSTVAVEIYAAAGRILPDPLLGTVRLLVGNLRLLSRRRDCPAFDAVGIRRPSG  123

Query  872   SPQGLLNMSATL  837
                G+LN+ AT+
Sbjct  124   RFHGVLNVGATI  135



>gb|ABK22654.1| unknown [Picea sitchensis]
Length=203

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 72/127 (57%), Gaps = 8/127 (6%)
 Frame = -3

Query  1205  LEITLISAQDLPPVS--KSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
             +E+ +ISAQDL  V     +R YA+++ +P  K +T ID+NG  NP WN+    + DDE 
Sbjct  18    IEVRIISAQDLEDVKLIGKMRCYAVLYIDPEHKASTRIDENGGINPFWNELLVLQADDEL  77

Query  1031  LASEKSTVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTRE------VALQIRRPSGS  870
             L+   + V V+IY     RD LVGT  + +S ++   +           + + +RRPSG 
Sbjct  78    LSQNMAAVNVDIYARGHMRDKLVGTSRILISQVLKGGDAANLYDNPIGCMPVLVRRPSGR  137

Query  869   PQGLLNM  849
             PQG+LN+
Sbjct  138   PQGILNI  144



>ref|XP_009400560.1| PREDICTED: uncharacterized protein LOC103984726 [Musa acuminata 
subsp. malaccensis]
Length=251

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 77/130 (59%), Gaps = 7/130 (5%)
 Frame = -3

Query  1205  LEITLISAQDLPPV--SKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
             LEI LISAQ L P   ++ L+ YA++W + + K  T +D+ G  NPTWNDKF F+V   F
Sbjct  11    LEINLISAQGLQPPGGNRRLQAYAVIWIDSSIKLRTLVDRVGGENPTWNDKFLFRVHPSF  70

Query  1031  LASEK-STVTVEIYTV-SWFR-DVLVGTVSVNVSNLISPSEKGTREV--ALQIRRPSGSP  867
             LA +     +VEIY    W+  D LVG+V   V NL   S    R V  A+ IRRPSG  
Sbjct  71    LAYDSPCAYSVEIYAAGGWYLPDSLVGSVRFLVGNLRLLSRHSDRPVFDAVGIRRPSGRF  130

Query  866   QGLLNMSATL  837
             QG+LN+ A +
Sbjct  131   QGVLNVGAAV  140



>ref|XP_006605265.1| PREDICTED: uncharacterized protein LOC102668124 [Glycine max]
Length=165

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 95/169 (56%), Gaps = 10/169 (6%)
 Frame = -3

Query  1004  VEIYTVSWFRDVLVGTVSVNVSNLISPSEK-GTREVALQIRRPSGSPQGLLNMSATLQEN  828
             VEIY+ +W R VL+GTV+V V+NL+ P+ K   R VALQIRRPSG PQG+LN+   L ++
Sbjct  2     VEIYSHAWLRQVLIGTVAVLVTNLLPPNRKPKLRFVALQIRRPSGRPQGILNIGINLLDS  61

Query  827   TGTSRSMPL-SDLMSTASGYKKDLELEKRNILEYHNSEDEERER--LHAKILQWRRSMTP  657
               T RSMPL S+L S+A GY  ++   K    E  + ++ +     L + +L  +R  + 
Sbjct  62    --TMRSMPLYSELSSSAVGYWDNIIKNKNAKTEDDDDDNTQHHHLPLDSSLLTLQRCQSE  119

Query  656   DMMSDVNGEEFPGKPGSI-CNGSMVNGGSMVNGGSMVNYGSEVCSDVGP  513
                S VN   + G       +G   + G  V  G + N GS + SDVGP
Sbjct  120   KNDSTVNDYAYHGNAKHYGYDGQDSDEG--VRKGGVFNEGS-LISDVGP  165



>gb|EPS60622.1| hypothetical protein M569_14180, partial [Genlisea aurea]
Length=283

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 81/148 (55%), Gaps = 24/148 (16%)
 Frame = -3

Query  1205  LEITLISAQDLPPVSKSLRTYALVWTNPN--RKRTTCIDQNGNANPTWND--KFSFKVDD  1038
             + I+LISA  LP +S S++TYA  +  PN  +K  T ID  G  NP W D  +F F+ D 
Sbjct  26    IYISLISANGLPELSDSMQTYAAAYVPPNHTKKHLTAIDSRGQVNPRWEDSNQFCFRTDR  85

Query  1037  EFLASEKSTVTVEIYTVS--WF------RDVLVGTVSVNVSNLISPSEKGTREVALQIRR  882
             +      S++  EIY VS   F      RDVL+GT +V++ +LI    K T  ++LQ+ R
Sbjct  86    D------SSLVAEIYAVSDPQFRGPDPDRDVLIGTAAVSIGHLI----KATPFLSLQVNR  135

Query  881   PSGSPQGLLNM--SATLQENTGTSRSMP  804
             PSGSP G+LN+     L  N  T    P
Sbjct  136   PSGSPGGILNLGVDVALDWNANTEAEFP  163


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 62/131 (47%), Gaps = 27/131 (21%)
 Frame = -3

Query  629  EFPGKPGSICNGSMVNGGSMVNGGSMVNYGSEVCSDVGPSASVVAAEIAQSWQASAAPRK  450
            EFP KPGS+CNG   NG             SE+ SD+GPSAS+VAAE+++  + +A  R+
Sbjct  161  EFPRKPGSVCNGDRDNG-------------SELWSDIGPSASIVAAELSRK-RTAAETRR  206

Query  449  EIMERGVGDSMVLPANLTPeeakrrreaaeddeneeemeMIPKNAGRRKPDNG-MYSCFV  273
            +    G G      +++   +      +                  RR   NG + +CFV
Sbjct  207  QEDRNGSGGGWQKSSDVDESDGSALSRSETSGLM------------RRGSSNGSLLACFV  254

Query  272  YGFQFTIVCGA  240
             G +FT+VCG 
Sbjct  255  CGVEFTVVCGG  265



>dbj|BAK03653.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=286

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 74/242 (31%), Positives = 115/242 (48%), Gaps = 54/242 (22%)
 Frame = -3

Query  1226  PPVGYHILEITLISAQDLPPVSKSLR---TYALVWTNPNRKRTTCIDQNGNANPTWNDKF  1056
             PP+  ++LE+T+ISAQDL    +       YA+ W +  RK  T +D  G A+PTWND+F
Sbjct  16    PPL--YLLEVTVISAQDLHRRRRLSHRVRAYAVAWIDGARKLRTEVDLAGGADPTWNDRF  73

Query  1055  SFKVDDEFLASEKSTVTVEIY-TVSWFRDVLVGTVSVNVSNLI---------------SP  924
              F+VD  FL SE + V VE+  T     DV++G   + VS  +               + 
Sbjct  74    LFRVDAGFLKSETAAVVVEVRETRRLGSDVVLGRTGIVVSTFLRVHSSSRLTAAAPAVAA  133

Query  923   SEKGTREVALQIRRP-SGSPQGLLNMSATL------------QENTGTSRSMPLSDLMS-  786
             +  G +  ALQ+RRP S  PQG+LN++ TL                G+  +  + DL++ 
Sbjct  134   APTGRQVAALQLRRPRSLRPQGVLNVAVTLLGAAQARAVAPIYHMPGSPDAFAMKDLVAM  193

Query  785   ---------TASGYKKDLELE-----KRNILEYHNSEDE-----ERERLHAKILQWRRSM  663
                      T  G  +  ELE     +R ++E+    D      E+ +L  K+ +WR  +
Sbjct  194   RPAPFLCEITEEGATEARELEHHARRQRPLVEHSGPLDPRGAAIEQSKLAMKLEKWRVDL  253

Query  662   TP  657
             +P
Sbjct  254   SP  255



>ref|XP_010245272.1| PREDICTED: uncharacterized protein LOC104588843 [Nelumbo nucifera]
Length=195

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 81/132 (61%), Gaps = 10/132 (8%)
 Frame = -3

Query  1205  LEITLISAQDLPP--VSKSLRTYALVWTNPNRKRTTCIDQNGNANPTWNDKFSFKVDDEF  1032
             +E+ LISAQ L      K ++TYA+ W NP +K  + ID  G +NPTWNDKF F +D E 
Sbjct  9     VELNLISAQGLNSGRWWKGMKTYAVSWINPTQKLRSRIDTVGRSNPTWNDKFIFVMDGER  68

Query  1031  -LASEKSTVTVEIYTVSWF-RDVLVGTVSVNVSNLISPSEKGTREVALQIRRP-SGSPQG  861
              L +  S + +EIYTV  F +D  +G VS+ + NL+    KG   +A+++  P SG+ +G
Sbjct  69    DLGNSTSALEIEIYTVRRFWKDQCIGVVSIPLDNLM----KGGF-MAIELHHPSSGAVEG  123

Query  860   LLNMSATLQENT  825
             +LN+  T+ +N 
Sbjct  124   ILNVGVTMLDNV  135



>ref|XP_002989504.1| hypothetical protein SELMODRAFT_428112 [Selaginella moellendorffii]
 gb|EFJ09380.1| hypothetical protein SELMODRAFT_428112 [Selaginella moellendorffii]
Length=174

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 76/131 (58%), Gaps = 16/131 (12%)
 Frame = -3

Query  1205  LEITLISAQDLPPVSKSLRT--YALVWTNPNR--KRTTCIDQNGNANPTWNDKFSFKVDD  1038
             LEI +ISAQ L  VS   RT  YA+ W +     K +T +D+ G  NP+WN   +F VD 
Sbjct  19    LEIHIISAQRLSKVSYFQRTRAYAVAWIDSQHETKLSTPVDRKGGRNPSWNAILTFYVDT  78

Query  1037  EFLASEK---STVTVEIYTVSWFRDVLVGTVSVNVSNLISPSEKGTRE-----VALQIRR  882
             + L       + +T+EIYT +W RD L+G+V V +++L+    KG RE     ++  + R
Sbjct  79    DDLVERHGINAGMTIEIYTKAWVRDKLIGSVRVLIADLV----KGMRESKGLCLSFMVIR  134

Query  881   PSGSPQGLLNM  849
             PSG  +GLLN+
Sbjct  135   PSGLRKGLLNL  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3721193409042