BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84099_g1_i1 len=547 path=[1:0-546]

Length=547
                                                                      Score     E

ref|XP_008382279.1|  PREDICTED: uncharacterized protein LOC103445090    200   1e-56   
ref|XP_008391921.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    202   4e-56   
ref|XP_008347114.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    198   1e-54   
ref|XP_008363369.1|  PREDICTED: uncharacterized protein LOC103427080    197   4e-54   
ref|XP_008348642.1|  PREDICTED: uncharacterized protein LOC103411795    196   1e-53   
ref|XP_008392425.1|  PREDICTED: uncharacterized protein LOC103454605    185   2e-50   
ref|XP_008232773.1|  PREDICTED: uncharacterized protein LOC103331871    140   3e-36   
ref|XP_008231916.1|  PREDICTED: uncharacterized protein LOC103331078    142   4e-36   
ref|XP_008229034.1|  PREDICTED: uncharacterized protein LOC103328423    142   1e-35   
ref|XP_009350424.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    144   1e-35   
ref|XP_009350425.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    144   1e-35   
ref|XP_008244659.1|  PREDICTED: uncharacterized protein LOC103342780    137   3e-35   
ref|XP_008218681.1|  PREDICTED: uncharacterized protein LOC103318979    142   5e-35   
ref|XP_008359227.1|  PREDICTED: uncharacterized protein LOC103422941    138   7e-35   
ref|XP_008363921.1|  PREDICTED: uncharacterized protein LOC103427632    140   9e-35   
ref|XP_008229249.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    140   1e-34   
ref|XP_008245146.1|  PREDICTED: uncharacterized protein LOC103343257    140   1e-34   
ref|XP_008245764.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    140   1e-34   
ref|XP_010247674.1|  PREDICTED: uncharacterized protein LOC104590651    135   2e-34   
ref|XP_008359939.1|  PREDICTED: uncharacterized protein LOC103423628    135   3e-34   
ref|XP_008231791.1|  PREDICTED: uncharacterized protein LOC103330964    134   1e-33   
ref|XP_008234114.1|  PREDICTED: uncharacterized protein LOC103333099    137   2e-33   
ref|XP_010245393.1|  PREDICTED: uncharacterized protein LOC104588947    130   1e-32   
ref|XP_008243391.1|  PREDICTED: uncharacterized protein LOC103341623    134   2e-32   
ref|XP_008245419.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    134   2e-32   
ref|XP_008345475.1|  PREDICTED: uncharacterized protein LOC103408398    129   3e-32   
emb|CAN78493.1|  hypothetical protein VITISV_037041                     133   4e-32   Vitis vinifera
ref|XP_008383907.1|  PREDICTED: uncharacterized protein LOC103446552    127   1e-31   
ref|XP_008376307.1|  PREDICTED: uncharacterized protein LOC103439527    131   1e-31   
ref|XP_010247584.1|  PREDICTED: uncharacterized protein LOC104590568    130   2e-31   
ref|XP_008361955.1|  PREDICTED: uncharacterized protein LOC103425645    130   4e-31   
ref|XP_008390120.1|  PREDICTED: uncharacterized protein LOC103452408    130   5e-31   
ref|XP_008361921.1|  PREDICTED: uncharacterized protein LOC103425609    127   5e-31   
ref|XP_008366643.1|  PREDICTED: uncharacterized protein LOC103430285    129   5e-31   
ref|XP_008229164.1|  PREDICTED: uncharacterized protein LOC103328545    125   5e-31   
ref|XP_008356957.1|  PREDICTED: uncharacterized protein LOC103420687    129   6e-31   
ref|XP_010242052.1|  PREDICTED: uncharacterized protein LOC104586489    129   6e-31   
ref|XP_008349253.1|  PREDICTED: uncharacterized protein LOC103412480    126   6e-31   
ref|XP_008346316.1|  PREDICTED: uncharacterized protein LOC103409283    129   1e-30   
ref|XP_008351163.1|  PREDICTED: uncharacterized protein LOC103414572    127   1e-30   
ref|XP_010687151.1|  PREDICTED: uncharacterized protein LOC104901296    125   1e-30   
ref|XP_008388875.1|  PREDICTED: uncharacterized protein LOC103451222    125   1e-30   
ref|XP_008357149.1|  PREDICTED: uncharacterized protein LOC103420888    126   1e-30   
ref|XP_008347427.1|  PREDICTED: uncharacterized protein LOC103410512    127   2e-30   
ref|XP_008360946.1|  PREDICTED: uncharacterized protein LOC103424627    125   3e-30   
ref|XP_009335454.1|  PREDICTED: uncharacterized protein LOC103928169    126   3e-30   
ref|XP_008351903.1|  PREDICTED: uncharacterized protein LOC103415338    127   4e-30   
ref|XP_008367789.1|  PREDICTED: uncharacterized protein LOC103431410    127   4e-30   
gb|ABD63156.1|  Retrotransposon gag protein                             122   4e-30   Asparagus officinalis
ref|XP_010695673.1|  PREDICTED: uncharacterized protein LOC104908276    126   4e-30   
ref|XP_008367967.1|  PREDICTED: uncharacterized protein LOC103431580    123   5e-30   
ref|XP_008354153.1|  PREDICTED: uncharacterized protein LOC103417773    124   5e-30   
ref|XP_010669073.1|  PREDICTED: uncharacterized protein LOC104886310    123   7e-30   
ref|XP_008363140.1|  PREDICTED: uncharacterized protein LOC103426835    126   7e-30   
ref|XP_008341098.1|  PREDICTED: uncharacterized protein LOC103404019    126   1e-29   
ref|XP_006605072.1|  PREDICTED: uncharacterized protein LOC102665365    125   1e-29   
ref|XP_008384013.1|  PREDICTED: uncharacterized protein LOC103446659    125   1e-29   
ref|XP_008232204.1|  PREDICTED: uncharacterized protein LOC103331359    122   1e-29   
ref|XP_008342990.1|  PREDICTED: uncharacterized protein LOC103405745    124   2e-29   
ref|XP_010677707.1|  PREDICTED: uncharacterized protein LOC104893306    125   3e-29   
ref|XP_008351167.1|  PREDICTED: uncharacterized protein LOC103414576    124   3e-29   
ref|XP_008229520.1|  PREDICTED: uncharacterized protein LOC103328892    120   3e-29   
ref|XP_010678061.1|  PREDICTED: uncharacterized protein LOC104893627    124   4e-29   
ref|XP_006494715.1|  PREDICTED: uncharacterized protein LOC102612045    124   4e-29   
ref|XP_010675344.1|  PREDICTED: uncharacterized protein LOC104891359    123   6e-29   
ref|XP_010247575.1|  PREDICTED: probable pectinesterase/pectinest...    123   7e-29   
ref|XP_010669074.1|  PREDICTED: uncharacterized protein LOC104886311    120   7e-29   
ref|XP_010667599.1|  PREDICTED: uncharacterized protein LOC104884611    123   7e-29   
ref|XP_008343613.1|  PREDICTED: uncharacterized protein LOC103406410    122   8e-29   
ref|XP_010668059.1|  PREDICTED: uncharacterized protein LOC104885048    122   1e-28   
ref|XP_008246187.1|  PREDICTED: uncharacterized protein LOC103344363    118   1e-28   
ref|XP_008390118.1|  PREDICTED: uncharacterized protein LOC103452407    122   1e-28   
ref|XP_010667186.1|  PREDICTED: uncharacterized protein LOC104884260    122   1e-28   
ref|XP_010670262.1|  PREDICTED: uncharacterized protein LOC104887343    120   1e-28   
ref|XP_009598127.1|  PREDICTED: uncharacterized protein LOC104093994    120   2e-28   
ref|XP_009615864.1|  PREDICTED: uncharacterized protein LOC104108510    119   2e-28   
ref|XP_009368824.1|  PREDICTED: uncharacterized protein LOC103958290    120   2e-28   
ref|XP_004301918.1|  PREDICTED: uncharacterized protein LOC101298139    121   2e-28   
ref|XP_010675528.1|  PREDICTED: uncharacterized protein LOC104891519    122   3e-28   
ref|XP_010694411.1|  PREDICTED: uncharacterized protein LOC104907215    121   3e-28   
gb|EPS62135.1|  hypothetical protein M569_12658                         118   3e-28   
ref|XP_006826167.1|  hypothetical protein AMTR_s04947p00003620          118   3e-28   
ref|XP_008351162.1|  PREDICTED: uncharacterized protein LOC103414571    120   1e-27   
ref|XP_009588655.1|  PREDICTED: uncharacterized protein LOC104086164    115   1e-27   
ref|XP_010670070.1|  PREDICTED: uncharacterized protein LOC104887170    115   2e-27   
ref|XP_010687013.1|  PREDICTED: uncharacterized protein LOC104901165    116   2e-27   
ref|XP_010684693.1|  PREDICTED: uncharacterized protein LOC104899241    119   3e-27   
ref|XP_009339431.1|  PREDICTED: uncharacterized protein LOC103931640    119   5e-27   
ref|XP_010681827.1|  PREDICTED: uncharacterized protein LOC104896735    115   6e-27   
ref|XP_010247770.1|  PREDICTED: uncharacterized protein LOC104590728    117   7e-27   
ref|XP_008776509.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    118   8e-27   
ref|XP_010242023.1|  PREDICTED: uncharacterized protein LOC104586472    117   8e-27   
ref|XP_011074617.1|  PREDICTED: uncharacterized protein LOC105159304    115   9e-27   
ref|XP_011070697.1|  PREDICTED: uncharacterized protein LOC105156296    114   1e-26   
ref|XP_006494090.1|  PREDICTED: uncharacterized protein LOC102610671    117   1e-26   
ref|XP_009586851.1|  PREDICTED: uncharacterized protein LOC104084616    113   1e-26   
ref|XP_009603781.1|  PREDICTED: uncharacterized protein LOC104098686    113   1e-26   
ref|XP_006577573.1|  PREDICTED: uncharacterized protein LOC102670185    114   2e-26   
ref|XP_010267895.1|  PREDICTED: uncharacterized protein LOC104604999    112   2e-26   
ref|XP_008365323.1|  PREDICTED: uncharacterized protein LOC103428962    115   2e-26   
ref|XP_004492121.1|  PREDICTED: uncharacterized protein LOC101498022    114   3e-26   
ref|XP_008779129.1|  PREDICTED: uncharacterized protein LOC103698859    112   3e-26   
ref|XP_009773211.1|  PREDICTED: uncharacterized protein LOC104223460    112   4e-26   
ref|XP_006465129.1|  PREDICTED: uncharacterized protein LOC102627778    115   5e-26   
emb|CAN77722.1|  hypothetical protein VITISV_020621                     111   5e-26   Vitis vinifera
ref|XP_010677841.1|  PREDICTED: uncharacterized protein LOC104893431    115   6e-26   
ref|XP_006480387.1|  PREDICTED: uncharacterized protein LOC102611294    115   6e-26   
ref|XP_010248013.1|  PREDICTED: uncharacterized protein LOC104590935    113   8e-26   
ref|XP_011076838.1|  PREDICTED: uncharacterized protein LOC105160988    113   1e-25   
ref|XP_011075651.1|  PREDICTED: uncharacterized protein LOC105160085    114   1e-25   
ref|XP_010681878.1|  PREDICTED: uncharacterized protein LOC104896783    111   1e-25   
ref|XP_010669189.1|  PREDICTED: uncharacterized protein LOC104886435    110   1e-25   
ref|XP_009776827.1|  PREDICTED: uncharacterized protein LOC104226516    111   1e-25   
ref|XP_008232715.1|  PREDICTED: uncharacterized protein LOC103331824    112   1e-25   
emb|CAN60094.1|  hypothetical protein VITISV_039038                     110   1e-25   Vitis vinifera
ref|XP_010244273.1|  PREDICTED: uncharacterized protein LOC104588150    111   2e-25   
ref|XP_010669222.1|  PREDICTED: uncharacterized protein LOC104886473    108   3e-25   
ref|XP_011081478.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    113   3e-25   
ref|XP_011101065.1|  PREDICTED: uncharacterized protein LOC105179165    113   3e-25   
ref|XP_010246704.1|  PREDICTED: uncharacterized protein LOC104589923    108   4e-25   
ref|XP_008354481.1|  PREDICTED: uncharacterized protein LOC103418110    112   5e-25   
ref|XP_010270239.1|  PREDICTED: uncharacterized protein LOC104606632    112   5e-25   
ref|XP_006493879.1|  PREDICTED: uncharacterized protein LOC102616274    112   5e-25   
ref|XP_006584323.1|  PREDICTED: uncharacterized protein LOC102667491    110   6e-25   
ref|XP_010248059.1|  PREDICTED: uncharacterized protein LOC104590989    110   8e-25   
ref|XP_010279321.1|  PREDICTED: uncharacterized protein LOC104613275    108   1e-24   
ref|XP_011102224.1|  PREDICTED: uncharacterized protein LOC105180247    111   1e-24   
ref|XP_010462887.1|  PREDICTED: uncharacterized protein LOC104743516    108   2e-24   
emb|CAN75576.1|  hypothetical protein VITISV_022177                     108   2e-24   Vitis vinifera
emb|CAN81882.1|  hypothetical protein VITISV_017921                     107   2e-24   Vitis vinifera
emb|CAN71101.1|  hypothetical protein VITISV_007818                     110   2e-24   Vitis vinifera
ref|XP_008372202.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    111   2e-24   
emb|CAN75002.1|  hypothetical protein VITISV_014928                     109   3e-24   Vitis vinifera
emb|CAN69402.1|  hypothetical protein VITISV_023832                     106   3e-24   Vitis vinifera
ref|XP_008245619.1|  PREDICTED: uncharacterized protein LOC103343761    108   3e-24   
emb|CAN68415.1|  hypothetical protein VITISV_016893                     107   3e-24   Vitis vinifera
ref|XP_010670276.1|  PREDICTED: uncharacterized protein LOC104887359    107   4e-24   
emb|CAN63956.1|  hypothetical protein VITISV_034256                     105   4e-24   Vitis vinifera
ref|XP_011082210.1|  PREDICTED: uncharacterized protein LOC105165031    106   4e-24   
gb|EPS65810.1|  hypothetical protein M569_08967                         106   5e-24   
emb|CAN60671.1|  hypothetical protein VITISV_010298                     103   5e-24   Vitis vinifera
ref|XP_010677759.1|  PREDICTED: uncharacterized protein LOC104893361    108   6e-24   
ref|XP_008222399.1|  PREDICTED: uncharacterized protein LOC103322270    106   7e-24   
ref|XP_010689626.1|  PREDICTED: uncharacterized protein LOC104903310    106   7e-24   
ref|XP_006575943.1|  PREDICTED: uncharacterized protein LOC102663625    107   7e-24   
emb|CAN66304.1|  hypothetical protein VITISV_036682                     108   8e-24   Vitis vinifera
emb|CAN82293.1|  hypothetical protein VITISV_021853                     109   8e-24   Vitis vinifera
emb|CAN65344.1|  hypothetical protein VITISV_009876                     108   9e-24   Vitis vinifera
ref|XP_008238736.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    109   9e-24   
gb|EPS63230.1|  hypothetical protein M569_11557                         107   9e-24   
emb|CAN65919.1|  hypothetical protein VITISV_000285                     108   9e-24   Vitis vinifera
emb|CAN82424.1|  hypothetical protein VITISV_026746                     109   9e-24   Vitis vinifera
emb|CAN75875.1|  hypothetical protein VITISV_019783                     109   9e-24   Vitis vinifera
ref|XP_008245898.1|  PREDICTED: uncharacterized protein LOC103344048    108   1e-23   
emb|CAN79587.1|  hypothetical protein VITISV_009564                     109   1e-23   Vitis vinifera
emb|CAN77795.1|  hypothetical protein VITISV_040891                     109   1e-23   Vitis vinifera
emb|CAN72758.1|  hypothetical protein VITISV_012803                     105   1e-23   Vitis vinifera
ref|XP_010665755.1|  PREDICTED: uncharacterized protein LOC104883015    108   1e-23   
ref|XP_010244533.1|  PREDICTED: uncharacterized protein LOC104588349    107   1e-23   
ref|XP_010513615.1|  PREDICTED: uncharacterized protein LOC104789646    108   1e-23   
emb|CAN70730.1|  hypothetical protein VITISV_010386                     108   1e-23   Vitis vinifera
emb|CAN77444.1|  hypothetical protein VITISV_022435                     105   1e-23   Vitis vinifera
emb|CAN74811.1|  hypothetical protein VITISV_015188                     108   1e-23   Vitis vinifera
emb|CAN65622.1|  hypothetical protein VITISV_020763                     107   2e-23   Vitis vinifera
emb|CAN70016.1|  hypothetical protein VITISV_013424                     107   2e-23   Vitis vinifera
emb|CAN66401.1|  hypothetical protein VITISV_026847                     108   2e-23   Vitis vinifera
ref|XP_010667902.1|  PREDICTED: uncharacterized protein LOC104884899    105   2e-23   
ref|XP_010673853.1|  PREDICTED: uncharacterized protein LOC104890162    108   2e-23   
emb|CAN68891.1|  hypothetical protein VITISV_019181                     104   2e-23   Vitis vinifera
emb|CAN78079.1|  hypothetical protein VITISV_020735                     107   2e-23   Vitis vinifera
emb|CAN73138.1|  hypothetical protein VITISV_024470                     108   2e-23   Vitis vinifera
emb|CAN60440.1|  hypothetical protein VITISV_032287                     107   2e-23   Vitis vinifera
emb|CAN62698.1|  hypothetical protein VITISV_002842                     104   2e-23   Vitis vinifera
emb|CAN80981.1|  hypothetical protein VITISV_020253                     107   2e-23   Vitis vinifera
ref|XP_008362479.1|  PREDICTED: uncharacterized protein LOC103426169    107   2e-23   
emb|CAN80076.1|  hypothetical protein VITISV_029997                     106   2e-23   Vitis vinifera
emb|CAN61957.1|  hypothetical protein VITISV_041046                     108   3e-23   Vitis vinifera
emb|CAN60529.1|  hypothetical protein VITISV_004809                     104   3e-23   Vitis vinifera
emb|CAN66953.1|  hypothetical protein VITISV_012317                     107   3e-23   Vitis vinifera
emb|CAN74673.1|  hypothetical protein VITISV_020204                     107   3e-23   Vitis vinifera
ref|XP_008391146.1|  PREDICTED: uncharacterized protein LOC103453381    105   3e-23   
emb|CAN66314.1|  hypothetical protein VITISV_035171                     107   3e-23   Vitis vinifera
ref|XP_010489385.1|  PREDICTED: uncharacterized protein LOC104767061    102   3e-23   
emb|CAN63403.1|  hypothetical protein VITISV_001870                     104   3e-23   Vitis vinifera
gb|EPS74455.1|  hypothetical protein M569_00300                         107   3e-23   
emb|CAN63062.1|  hypothetical protein VITISV_030509                     105   4e-23   Vitis vinifera
emb|CAN60680.1|  hypothetical protein VITISV_033696                     107   4e-23   Vitis vinifera
emb|CAN82158.1|  hypothetical protein VITISV_033259                     107   4e-23   Vitis vinifera
ref|XP_010496957.1|  PREDICTED: uncharacterized protein LOC104773983    107   4e-23   
emb|CAN73553.1|  hypothetical protein VITISV_021946                     101   4e-23   Vitis vinifera
emb|CAN66388.1|  hypothetical protein VITISV_019683                     107   4e-23   Vitis vinifera
emb|CAN68000.1|  hypothetical protein VITISV_021930                     107   4e-23   Vitis vinifera
ref|XP_010693949.1|  PREDICTED: uncharacterized protein LOC104906823    104   4e-23   
emb|CAN78930.1|  hypothetical protein VITISV_008432                     107   4e-23   Vitis vinifera
emb|CAN81728.1|  hypothetical protein VITISV_004185                     107   4e-23   Vitis vinifera
ref|XP_009334875.1|  PREDICTED: uncharacterized protein LOC103927658    104   4e-23   
emb|CAN74943.1|  hypothetical protein VITISV_031312                     107   4e-23   Vitis vinifera
ref|XP_010689588.1|  PREDICTED: uncharacterized protein LOC104903267    106   4e-23   
emb|CAN81952.1|  hypothetical protein VITISV_022527                     107   5e-23   Vitis vinifera
emb|CAN76192.1|  hypothetical protein VITISV_025047                     103   5e-23   Vitis vinifera
emb|CAN63646.1|  hypothetical protein VITISV_012334                     106   5e-23   Vitis vinifera
ref|XP_011072318.1|  PREDICTED: uncharacterized protein LOC105157605    103   5e-23   
emb|CAN62871.1|  hypothetical protein VITISV_015208                     106   5e-23   Vitis vinifera
ref|XP_011071675.1|  PREDICTED: uncharacterized protein LOC105157079    105   5e-23   
ref|XP_011098876.1|  PREDICTED: uncharacterized protein LOC105177421    106   5e-23   
emb|CAN78174.1|  hypothetical protein VITISV_028988                     107   5e-23   Vitis vinifera
ref|XP_010669531.1|  PREDICTED: uncharacterized protein LOC104886741    105   6e-23   
emb|CAN74585.1|  hypothetical protein VITISV_017114                     107   6e-23   Vitis vinifera
emb|CAN78819.1|  hypothetical protein VITISV_015506                     107   6e-23   Vitis vinifera
ref|XP_009606080.1|  PREDICTED: uncharacterized protein LOC104100531    102   6e-23   
emb|CAN66527.1|  hypothetical protein VITISV_014493                     106   6e-23   Vitis vinifera
emb|CAN64212.1|  hypothetical protein VITISV_031909                     105   6e-23   Vitis vinifera
emb|CAN71526.1|  hypothetical protein VITISV_030249                     106   6e-23   Vitis vinifera
emb|CAN74400.1|  hypothetical protein VITISV_038281                     105   6e-23   Vitis vinifera
emb|CAN83811.1|  hypothetical protein VITISV_019431                     106   7e-23   Vitis vinifera
emb|CAN61136.1|  hypothetical protein VITISV_023515                     106   7e-23   Vitis vinifera
ref|XP_010666875.1|  PREDICTED: uncharacterized protein LOC104883989    103   7e-23   
emb|CAN71987.1|  hypothetical protein VITISV_001129                     104   8e-23   Vitis vinifera
emb|CAN82706.1|  hypothetical protein VITISV_037843                     105   8e-23   Vitis vinifera
emb|CAN77867.1|  hypothetical protein VITISV_001382                     107   8e-23   Vitis vinifera
emb|CAN82333.1|  hypothetical protein VITISV_010517                     106   8e-23   Vitis vinifera
ref|XP_008355589.1|  PREDICTED: uncharacterized protein LOC103419248    103   8e-23   
ref|XP_010430883.1|  PREDICTED: uncharacterized protein LOC104715140    105   8e-23   
ref|XP_008352292.1|  PREDICTED: uncharacterized protein LOC103415785    104   8e-23   
emb|CAN82864.1|  hypothetical protein VITISV_012737                     106   8e-23   Vitis vinifera
emb|CAN65863.1|  hypothetical protein VITISV_015140                     106   9e-23   Vitis vinifera
emb|CAN62976.1|  hypothetical protein VITISV_043801                     104   9e-23   Vitis vinifera
ref|XP_010689442.1|  PREDICTED: uncharacterized protein LOC104903138    106   9e-23   
ref|XP_010689473.1|  PREDICTED: uncharacterized protein LOC104903173    105   1e-22   
ref|XP_010677742.1|  PREDICTED: uncharacterized protein LOC104893344    104   1e-22   
ref|XP_010696491.1|  PREDICTED: uncharacterized protein LOC104909...    102   1e-22   
ref|XP_008344209.1|  PREDICTED: uncharacterized protein LOC103407026    103   1e-22   
emb|CAN68346.1|  hypothetical protein VITISV_010935                     106   1e-22   Vitis vinifera
emb|CAN70323.1|  hypothetical protein VITISV_036687                     105   1e-22   Vitis vinifera
emb|CAN62377.1|  hypothetical protein VITISV_020017                     105   1e-22   Vitis vinifera
emb|CAN71959.1|  hypothetical protein VITISV_026708                     106   1e-22   Vitis vinifera
ref|XP_011076836.1|  PREDICTED: uncharacterized protein LOC105160986    105   1e-22   
ref|XP_009790384.1|  PREDICTED: uncharacterized protein LOC104237851    102   1e-22   
ref|XP_008229049.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    105   1e-22   
emb|CAN61965.1|  hypothetical protein VITISV_031520                     106   1e-22   Vitis vinifera
emb|CAN82726.1|  hypothetical protein VITISV_009678                     105   1e-22   Vitis vinifera
emb|CAN74399.1|  hypothetical protein VITISV_038280                     102   1e-22   Vitis vinifera
emb|CAN81566.1|  hypothetical protein VITISV_034902                     105   1e-22   Vitis vinifera
emb|CAN75740.1|  hypothetical protein VITISV_044054                     105   1e-22   Vitis vinifera
ref|XP_010684909.1|  PREDICTED: uncharacterized protein LOC104899422    102   1e-22   
emb|CAN74658.1|  hypothetical protein VITISV_037667                     105   1e-22   Vitis vinifera
emb|CAN64968.1|  hypothetical protein VITISV_017418                     102   1e-22   Vitis vinifera
ref|XP_010690194.1|  PREDICTED: uncharacterized protein LOC104903782    105   2e-22   
emb|CAN66329.1|  hypothetical protein VITISV_000597                     105   2e-22   Vitis vinifera
emb|CAN82506.1|  hypothetical protein VITISV_039313                     105   2e-22   Vitis vinifera
ref|XP_010430969.1|  PREDICTED: uncharacterized protein LOC104715245    104   2e-22   
emb|CAN64834.1|  hypothetical protein VITISV_031830                     104   2e-22   Vitis vinifera
ref|XP_008355602.1|  PREDICTED: uncharacterized protein LOC103419262    104   2e-22   
ref|XP_010678922.1|  PREDICTED: uncharacterized protein LOC104894399    105   2e-22   
emb|CAN77607.1|  hypothetical protein VITISV_014680                     105   2e-22   Vitis vinifera
emb|CAN79689.1|  hypothetical protein VITISV_018578                     104   2e-22   Vitis vinifera
emb|CAN76488.1|  hypothetical protein VITISV_018835                     105   2e-22   Vitis vinifera
ref|XP_008351337.1|  PREDICTED: uncharacterized protein LOC103414750    104   2e-22   
ref|XP_010687403.1|  PREDICTED: uncharacterized protein LOC104901511    102   2e-22   
emb|CAN68656.1|  hypothetical protein VITISV_002111                     105   2e-22   Vitis vinifera
emb|CAN66853.1|  hypothetical protein VITISV_004745                     105   2e-22   Vitis vinifera
emb|CAN64965.1|  hypothetical protein VITISV_002893                     105   2e-22   Vitis vinifera
ref|XP_008229105.1|  PREDICTED: uncharacterized protein LOC103328489    105   2e-22   
emb|CAN70775.1|  hypothetical protein VITISV_036087                     105   2e-22   Vitis vinifera
emb|CAN70642.1|  hypothetical protein VITISV_020042                     105   2e-22   Vitis vinifera
emb|CAN61433.1|  hypothetical protein VITISV_010534                     102   2e-22   Vitis vinifera
ref|XP_010696490.1|  PREDICTED: uncharacterized protein LOC104909...    101   2e-22   
ref|XP_010468765.1|  PREDICTED: uncharacterized protein LOC104748884    102   2e-22   
ref|XP_009777100.1|  PREDICTED: uncharacterized protein LOC104226739    102   2e-22   
emb|CAN80406.1|  hypothetical protein VITISV_020335                     105   2e-22   Vitis vinifera
emb|CAN63487.1|  hypothetical protein VITISV_021708                     105   2e-22   Vitis vinifera
emb|CAN66226.1|  hypothetical protein VITISV_006069                     104   2e-22   Vitis vinifera
emb|CAN83897.1|  hypothetical protein VITISV_005489                     105   2e-22   Vitis vinifera
ref|XP_011078528.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    105   2e-22   
ref|XP_010689794.1|  PREDICTED: uncharacterized protein LOC104903457    105   3e-22   
emb|CAN79129.1|  hypothetical protein VITISV_033616                     105   3e-22   Vitis vinifera
emb|CAN71169.1|  hypothetical protein VITISV_038360                     105   3e-22   Vitis vinifera
emb|CAN71982.1|  hypothetical protein VITISV_011140                     104   3e-22   Vitis vinifera
emb|CAN61940.1|  hypothetical protein VITISV_008747                     101   3e-22   Vitis vinifera
emb|CAN74220.1|  hypothetical protein VITISV_032121                     105   3e-22   
emb|CAN62969.1|  hypothetical protein VITISV_030527                     105   3e-22   
emb|CAN64967.1|  hypothetical protein VITISV_002895                     104   3e-22   
ref|XP_010666800.1|  PREDICTED: uncharacterized protein LOC104883922    104   3e-22   
emb|CAN61358.1|  hypothetical protein VITISV_027765                     105   3e-22   
ref|XP_011100524.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    104   3e-22   
emb|CAN66738.1|  hypothetical protein VITISV_022969                     104   3e-22   
gb|AAB18645.1|  unknown                                                 101   3e-22   
emb|CAN68768.1|  hypothetical protein VITISV_024756                     104   3e-22   
emb|CAN69451.1|  hypothetical protein VITISV_040943                     104   3e-22   
emb|CAN63039.1|  hypothetical protein VITISV_029665                     104   4e-22   
emb|CAN64500.1|  hypothetical protein VITISV_020340                     104   4e-22   
emb|CAN78799.1|  hypothetical protein VITISV_038948                     104   4e-22   
emb|CAN68943.1|  hypothetical protein VITISV_020198                     103   4e-22   
gb|EPS68889.1|  hypothetical protein M569_05880                         102   4e-22   
ref|XP_011072317.1|  PREDICTED: uncharacterized protein LOC105157604    100   4e-22   
emb|CAN65711.1|  hypothetical protein VITISV_040067                     104   4e-22   
emb|CAN68404.1|  hypothetical protein VITISV_035041                     104   4e-22   
emb|CAN70697.1|  hypothetical protein VITISV_006308                     104   4e-22   
emb|CAN76716.1|  hypothetical protein VITISV_010638                     104   4e-22   
ref|XP_008351301.1|  PREDICTED: uncharacterized protein LOC103414712    102   4e-22   
emb|CAN84108.1|  hypothetical protein VITISV_009821                     104   4e-22   
emb|CAN77736.1|  hypothetical protein VITISV_009106                     101   4e-22   
emb|CAN78772.1|  hypothetical protein VITISV_016285                     104   5e-22   
emb|CAN76371.1|  hypothetical protein VITISV_011467                     104   5e-22   
emb|CAN68864.1|  hypothetical protein VITISV_010015                     102   5e-22   
emb|CAN67515.1|  hypothetical protein VITISV_013281                     103   5e-22   
ref|XP_009602735.1|  PREDICTED: uncharacterized protein LOC104097822    102   5e-22   
gb|ABD63131.1|  Retrotransposon gag protein                             100   5e-22   
ref|XP_010670092.1|  PREDICTED: uncharacterized protein LOC104887193    102   5e-22   
ref|XP_010687196.1|  PREDICTED: uncharacterized protein LOC104901332    103   5e-22   
emb|CAN66021.1|  hypothetical protein VITISV_033202                     104   5e-22   
emb|CAN66756.1|  hypothetical protein VITISV_012504                     104   5e-22   
emb|CAN76883.1|  hypothetical protein VITISV_036351                     104   5e-22   
ref|XP_010696343.1|  PREDICTED: uncharacterized protein LOC104908874    104   5e-22   
ref|XP_008363175.1|  PREDICTED: uncharacterized protein LOC103426874    100   5e-22   
emb|CAN79155.1|  hypothetical protein VITISV_025696                     104   5e-22   
emb|CAN64603.1|  hypothetical protein VITISV_033149                     103   5e-22   
ref|XP_010670252.1|  PREDICTED: uncharacterized protein LOC104887336    103   6e-22   
emb|CAN73191.1|  hypothetical protein VITISV_020470                     103   6e-22   
ref|XP_010463442.1|  PREDICTED: uncharacterized protein LOC104744123    102   6e-22   
emb|CAN70562.1|  hypothetical protein VITISV_008842                     103   6e-22   
emb|CAN60696.1|  hypothetical protein VITISV_022982                     103   6e-22   
ref|XP_010667645.1|  PREDICTED: uncharacterized protein LOC104884660    103   6e-22   
emb|CAN76126.1|  hypothetical protein VITISV_028047                     103   6e-22   
emb|CAN81852.1|  hypothetical protein VITISV_004007                     103   7e-22   
emb|CAN69776.1|  hypothetical protein VITISV_042272                     103   7e-22   
emb|CAN83846.1|  hypothetical protein VITISV_023222                     103   7e-22   
emb|CAN62378.1|  hypothetical protein VITISV_020018                     103   7e-22   
ref|XP_010694721.1|  PREDICTED: uncharacterized protein LOC104907484    103   7e-22   
emb|CAN67542.1|  hypothetical protein VITISV_026552                     103   7e-22   
emb|CAN75177.1|  hypothetical protein VITISV_032736                     103   7e-22   
emb|CAN83199.1|  hypothetical protein VITISV_013917                     103   7e-22   
emb|CAN71263.1|  hypothetical protein VITISV_014448                     100   8e-22   
emb|CAN81820.1|  hypothetical protein VITISV_006137                     103   8e-22   
ref|XP_010667635.1|  PREDICTED: uncharacterized protein LOC104884648    102   8e-22   
emb|CAN79510.1|  hypothetical protein VITISV_002952                     103   8e-22   
ref|XP_010527651.1|  PREDICTED: uncharacterized protein LOC104804961    100   8e-22   
emb|CAN61221.1|  hypothetical protein VITISV_000892                     102   8e-22   
emb|CAN83713.1|  hypothetical protein VITISV_040438                     103   8e-22   
emb|CAN66744.1|  hypothetical protein VITISV_013698                     103   8e-22   
ref|XP_004309479.1|  PREDICTED: uncharacterized protein LOC101310482    102   8e-22   
ref|XP_010240905.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    103   8e-22   
emb|CAN61908.1|  hypothetical protein VITISV_034393                     103   8e-22   
ref|XP_008244896.1|  PREDICTED: uncharacterized protein LOC103343004    103   9e-22   
emb|CAN64443.1|  hypothetical protein VITISV_005110                     103   9e-22   
emb|CAN62635.1|  hypothetical protein VITISV_032517                     103   9e-22   
emb|CAN78202.1|  hypothetical protein VITISV_016088                     102   9e-22   
emb|CAN78358.1|  hypothetical protein VITISV_033648                     102   9e-22   
emb|CAN63875.1|  hypothetical protein VITISV_014027                     102   1e-21   
emb|CAN73908.1|  hypothetical protein VITISV_029160                     103   1e-21   
emb|CAN82716.1|  hypothetical protein VITISV_017288                     103   1e-21   
emb|CAN62529.1|  hypothetical protein VITISV_029280                     103   1e-21   
emb|CAN67234.1|  hypothetical protein VITISV_043349                     102   1e-21   
emb|CAN63154.1|  hypothetical protein VITISV_043851                   98.6    1e-21   
emb|CAN75426.1|  hypothetical protein VITISV_003716                     103   1e-21   
ref|XP_010535314.1|  PREDICTED: uncharacterized protein LOC104810662  99.8    1e-21   
ref|XP_010247874.1|  PREDICTED: uncharacterized protein LOC104590819  99.4    1e-21   
emb|CAN59874.1|  hypothetical protein VITISV_035142                     101   1e-21   
ref|XP_009791811.1|  PREDICTED: uncharacterized protein LOC104238978    101   1e-21   
emb|CAN66943.1|  hypothetical protein VITISV_010070                   99.8    1e-21   
emb|CAN69796.1|  hypothetical protein VITISV_036334                     103   1e-21   
emb|CAN72315.1|  hypothetical protein VITISV_037426                     102   1e-21   
emb|CAN61735.1|  hypothetical protein VITISV_000019                     103   1e-21   
emb|CAN65411.1|  hypothetical protein VITISV_009723                     103   1e-21   
emb|CAN67422.1|  hypothetical protein VITISV_012575                     103   1e-21   
emb|CAN82873.1|  hypothetical protein VITISV_019905                     102   1e-21   
emb|CAN66502.1|  hypothetical protein VITISV_004586                   99.4    1e-21   
ref|XP_008354793.1|  PREDICTED: uncharacterized protein LOC103418439    100   1e-21   
emb|CAN72638.1|  hypothetical protein VITISV_016815                     102   2e-21   
ref|XP_011090638.1|  PREDICTED: uncharacterized protein LOC105171279    101   2e-21   
emb|CAN78529.1|  hypothetical protein VITISV_043798                     102   2e-21   
emb|CAN68595.1|  hypothetical protein VITISV_043526                     102   2e-21   
emb|CAN61555.1|  hypothetical protein VITISV_035095                     102   2e-21   
emb|CAN66840.1|  hypothetical protein VITISV_032725                     102   2e-21   
ref|XP_010245800.1|  PREDICTED: uncharacterized protein LOC104589246  98.2    2e-21   
emb|CAN67374.1|  hypothetical protein VITISV_026455                     102   2e-21   
emb|CAN78093.1|  hypothetical protein VITISV_042581                     102   2e-21   
emb|CAN78247.1|  hypothetical protein VITISV_030606                     102   2e-21   
ref|XP_010241476.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    102   2e-21   
emb|CAN82599.1|  hypothetical protein VITISV_032033                     102   2e-21   
emb|CAN66393.1|  hypothetical protein VITISV_019688                     102   2e-21   
emb|CAN59711.1|  hypothetical protein VITISV_042378                     101   2e-21   
emb|CAN82613.1|  hypothetical protein VITISV_037070                     101   2e-21   
emb|CAN62982.1|  hypothetical protein VITISV_019039                     102   2e-21   
emb|CAN72256.1|  hypothetical protein VITISV_034187                     102   2e-21   
ref|XP_010251937.1|  PREDICTED: uncharacterized protein LOC104593668    102   2e-21   
emb|CAN74453.1|  hypothetical protein VITISV_041739                     102   2e-21   
emb|CAN77947.1|  hypothetical protein VITISV_014923                     102   3e-21   
ref|XP_009779404.1|  PREDICTED: uncharacterized protein LOC104228...    100   3e-21   
emb|CAN70715.1|  hypothetical protein VITISV_004701                     102   3e-21   
ref|XP_009779403.1|  PREDICTED: uncharacterized protein LOC104228...    100   3e-21   
ref|XP_010245878.1|  PREDICTED: uncharacterized protein LOC104589313  99.8    3e-21   
ref|XP_008361867.1|  PREDICTED: uncharacterized protein LOC103425555    102   3e-21   
emb|CAN68444.1|  hypothetical protein VITISV_008870                   97.8    3e-21   
emb|CAN68787.1|  hypothetical protein VITISV_039016                     102   3e-21   
emb|CAN69624.1|  hypothetical protein VITISV_018631                     101   3e-21   
emb|CAN80731.1|  hypothetical protein VITISV_024549                     102   3e-21   
emb|CAN82667.1|  hypothetical protein VITISV_026690                     101   3e-21   
ref|XP_006485841.1|  PREDICTED: uncharacterized protein LOC102619730    100   3e-21   
ref|XP_010669723.1|  PREDICTED: uncharacterized protein LOC104886889  99.0    3e-21   
ref|XP_010496931.1|  PREDICTED: uncharacterized protein LOC104773959  99.0    3e-21   
emb|CAN67576.1|  hypothetical protein VITISV_025810                     102   3e-21   
ref|XP_010687491.1|  PREDICTED: uncharacterized protein LOC104901597    100   3e-21   
emb|CAN66137.1|  hypothetical protein VITISV_028398                     101   3e-21   
emb|CAN63431.1|  hypothetical protein VITISV_037608                     101   3e-21   
emb|CAN75073.1|  hypothetical protein VITISV_025186                   99.0    3e-21   
emb|CAN72822.1|  hypothetical protein VITISV_008448                     101   4e-21   
emb|CAN80998.1|  hypothetical protein VITISV_035893                     101   4e-21   
ref|XP_010682305.1|  PREDICTED: uncharacterized protein LOC104897178    100   4e-21   
emb|CAN77460.1|  hypothetical protein VITISV_022318                   99.8    4e-21   
emb|CAN66067.1|  hypothetical protein VITISV_009221                     101   4e-21   
emb|CAN71298.1|  hypothetical protein VITISV_032375                     101   4e-21   
gb|AFN88198.1|  retropepsin-like protein                                100   4e-21   
emb|CAN69415.1|  hypothetical protein VITISV_026852                     101   4e-21   
emb|CAN68123.1|  hypothetical protein VITISV_028330                     101   4e-21   
ref|XP_009124476.1|  PREDICTED: uncharacterized protein LOC103849475    100   4e-21   
emb|CAN72027.1|  hypothetical protein VITISV_020326                     101   4e-21   
emb|CAN81973.1|  hypothetical protein VITISV_039218                     101   5e-21   
emb|CAN60386.1|  hypothetical protein VITISV_027364                     100   5e-21   
emb|CAN69021.1|  hypothetical protein VITISV_032753                     101   5e-21   
ref|XP_010475339.1|  PREDICTED: uncharacterized protein LOC104754767    100   5e-21   
emb|CAN77619.1|  hypothetical protein VITISV_040500                     101   5e-21   
emb|CAN60102.1|  hypothetical protein VITISV_021670                     101   5e-21   
emb|CAN83451.1|  hypothetical protein VITISV_021235                     101   5e-21   
emb|CAN73927.1|  hypothetical protein VITISV_020985                     101   5e-21   
emb|CAN78001.1|  hypothetical protein VITISV_012986                     100   6e-21   
emb|CAN83774.1|  hypothetical protein VITISV_029494                     101   6e-21   
emb|CAN83814.1|  hypothetical protein VITISV_010843                     101   6e-21   
emb|CAN65960.1|  hypothetical protein VITISV_018297                     101   6e-21   
emb|CAN79744.1|  hypothetical protein VITISV_006788                     100   7e-21   
emb|CAN71876.1|  hypothetical protein VITISV_002499                     100   7e-21   
emb|CAN63117.1|  hypothetical protein VITISV_010453                   97.1    7e-21   
ref|XP_009782928.1|  PREDICTED: uncharacterized protein LOC104231610    100   8e-21   
ref|XP_010445853.1|  PREDICTED: uncharacterized protein LOC104728593  99.4    8e-21   
emb|CAN75671.1|  hypothetical protein VITISV_010501                     100   9e-21   
gb|AEL30354.1|  retrotransposon gag protein                             100   1e-20   
emb|CAN74327.1|  hypothetical protein VITISV_005775                     100   1e-20   
ref|XP_008348675.1|  PREDICTED: uncharacterized protein LOC103411837  96.7    1e-20   
gb|ABD63142.1|  Retrotransposon gag protein                             100   1e-20   
ref|XP_009629109.1|  PREDICTED: uncharacterized protein LOC104119332  99.0    1e-20   
ref|XP_008387505.1|  PREDICTED: uncharacterized protein LOC103449960  99.8    1e-20   
ref|XP_010523648.1|  PREDICTED: uncharacterized protein LOC104801963  96.3    1e-20   
ref|XP_010431083.1|  PREDICTED: uncharacterized protein LOC104715368  99.0    1e-20   
ref|XP_009151543.1|  PREDICTED: uncharacterized protein LOC103874867  99.4    1e-20   
ref|XP_009804617.1|  PREDICTED: uncharacterized protein LOC104249819  98.2    1e-20   
ref|XP_010269430.1|  PREDICTED: uncharacterized protein LOC104606077  99.0    1e-20   
ref|XP_006593040.1|  PREDICTED: uncharacterized protein LOC100794810  98.6    1e-20   
ref|XP_008347293.1|  PREDICTED: uncharacterized protein LOC103410355  99.4    1e-20   
emb|CAN81328.1|  hypothetical protein VITISV_026276                     100   1e-20   
emb|CAN67207.1|  hypothetical protein VITISV_002055                     100   1e-20   
emb|CAN83154.1|  hypothetical protein VITISV_030979                   98.2    1e-20   
ref|XP_009123492.1|  PREDICTED: uncharacterized protein LOC103848322  96.7    2e-20   
ref|XP_010496827.1|  PREDICTED: uncharacterized protein LOC104773854  96.7    2e-20   
ref|XP_008381954.1|  PREDICTED: uncharacterized protein LOC103444793  99.4    2e-20   
emb|CAN75212.1|  hypothetical protein VITISV_042071                     100   2e-20   
emb|CAN69428.1|  hypothetical protein VITISV_004072                   99.8    2e-20   
emb|CAN66621.1|  hypothetical protein VITISV_023013                   99.8    2e-20   
emb|CAN62899.1|  hypothetical protein VITISV_041023                   99.4    2e-20   
emb|CAN80421.1|  hypothetical protein VITISV_008672                   99.4    2e-20   
emb|CAN74640.1|  hypothetical protein VITISV_020693                   99.8    2e-20   
emb|CAN79368.1|  hypothetical protein VITISV_024599                   97.8    2e-20   
ref|XP_010525710.1|  PREDICTED: uncharacterized protein LOC104803476  95.9    2e-20   
emb|CAN79577.1|  hypothetical protein VITISV_000545                   99.8    2e-20   
ref|XP_008339254.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  99.4    2e-20   
emb|CAN62915.1|  hypothetical protein VITISV_003802                   99.8    2e-20   
ref|XP_009340002.1|  PREDICTED: uncharacterized protein LOC103932177  96.7    2e-20   
ref|XP_010490332.1|  PREDICTED: uncharacterized protein LOC104768097  97.8    2e-20   
emb|CAN76124.1|  hypothetical protein VITISV_038778                   95.9    3e-20   
gb|ABD63157.1|  Retrotransposon gag protein                           95.5    3e-20   
ref|XP_010670375.1|  PREDICTED: uncharacterized protein LOC104887...  95.9    3e-20   
emb|CAN65984.1|  hypothetical protein VITISV_027066                   99.4    3e-20   
emb|CAN72184.1|  hypothetical protein VITISV_042598                   99.0    3e-20   
ref|XP_010670376.1|  PREDICTED: uncharacterized protein LOC104887...  95.5    3e-20   
emb|CAN70541.1|  hypothetical protein VITISV_004847                   96.7    3e-20   
ref|XP_010279066.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  99.0    3e-20   
emb|CAN74993.1|  hypothetical protein VITISV_038390                   93.6    3e-20   
emb|CAN75109.1|  hypothetical protein VITISV_010027                   99.0    3e-20   
emb|CAN77316.1|  hypothetical protein VITISV_041301                   99.0    3e-20   
ref|XP_010670269.1|  PREDICTED: uncharacterized protein LOC104887350  97.8    3e-20   
ref|XP_008370874.1|  PREDICTED: uncharacterized protein LOC103434314  98.6    3e-20   
emb|CAN71897.1|  hypothetical protein VITISV_017079                   99.0    3e-20   
ref|XP_009795132.1|  PREDICTED: uncharacterized protein LOC104241874  95.5    3e-20   
emb|CAN80692.1|  hypothetical protein VITISV_030023                   97.8    3e-20   
emb|CAN76969.1|  hypothetical protein VITISV_029689                   99.0    3e-20   
emb|CAN66500.1|  hypothetical protein VITISV_004584                   95.5    3e-20   
ref|XP_010693276.1|  PREDICTED: uncharacterized protein LOC104906241  99.0    4e-20   
emb|CAN77251.1|  hypothetical protein VITISV_005023                   97.8    4e-20   
ref|XP_008345145.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  98.2    4e-20   
ref|XP_010678060.1|  PREDICTED: uncharacterized protein LOC104893626  98.2    4e-20   
emb|CAN70203.1|  hypothetical protein VITISV_010325                   99.0    4e-20   
ref|XP_010679710.1|  PREDICTED: uncharacterized protein LOC104895009  97.8    4e-20   
ref|XP_010676952.1|  PREDICTED: uncharacterized protein LOC104892661  97.8    4e-20   
emb|CAN62261.1|  hypothetical protein VITISV_008437                   98.2    4e-20   
ref|XP_010430984.1|  PREDICTED: uncharacterized protein LOC104715262  98.2    4e-20   
emb|CAN71007.1|  hypothetical protein VITISV_010109                   98.6    4e-20   
ref|XP_010681279.1|  PREDICTED: uncharacterized protein LOC104896263  97.8    4e-20   
ref|XP_008222752.1|  PREDICTED: uncharacterized protein LOC103322601  98.6    4e-20   
emb|CAN83639.1|  hypothetical protein VITISV_038462                   98.6    5e-20   
ref|XP_008347142.1|  PREDICTED: uncharacterized protein LOC103410170  98.6    5e-20   
ref|XP_009135959.1|  PREDICTED: uncharacterized protein LOC103860108  95.5    5e-20   



>ref|XP_008382279.1| PREDICTED: uncharacterized protein LOC103445090 [Malus domestica]
Length=736

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD AK+W M L PGSL TW  V  KF++KF+S  KT  LR +I  F Q +GEPF+
Sbjct  156  FPYTLKDRAKSWLMTLAPGSLITWDAVAKKFLEKFFSTQKTATLRGQIFNFKQDDGEPFN  215

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK LL+QCPHHG P  LQ+Q FYD LTQT QS VDNAAGG++ +K A+E+  +YE
Sbjct  216  ECWERFKGLLLQCPHHGLPFHLQMQIFYDGLTQTCQSTVDNAAGGALKKKNAQESYNIYE  275

Query  361  MLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
            MLG N+Q K++RG+  G+YE NSN +L + ++ L K++
Sbjct  276  MLGSNAQHKDLRGKKVGVYETNSNHELSLQVANLEKKL  313



>ref|XP_008391921.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103454109, 
partial [Malus domestica]
Length=1530

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 118/158 (75%), Gaps = 0/158 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD AK+W M L PGSL TW  V  KF++KF+S  KT  LR +I  F Q +GEPF+
Sbjct  149  FPYTLKDKAKSWLMTLAPGSLTTWDAVAKKFLEKFFSTQKTATLRGQIFNFKQDDGEPFN  208

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK LL+QCPHHG PL LQ+Q FYD LTQT QS VDNAAGG++ +K A+E+  +YE
Sbjct  209  ECWERFKGLLLQCPHHGLPLHLQMQIFYDGLTQTCQSTVDNAAGGALKKKNAQESYNIYE  268

Query  361  MLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
            MLG N+Q K++RG+  G+YE N+N DL + ++ L +++
Sbjct  269  MLGSNAQHKDVRGKKLGVYETNANHDLSLQVANLERKL  306



>ref|XP_008347114.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103410138, 
partial [Malus domestica]
Length=1560

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 116/158 (73%), Gaps = 0/158 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD AK+W M LTPGSL TW  V  KF++KF+S  KT  LR +I  F Q +GEPF+
Sbjct  85   FPYTLKDRAKSWLMTLTPGSLTTWDAVAKKFLEKFFSTQKTATLRGQIFNFKQDDGEPFN  144

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK LL+QCPHHG P  LQ+Q FYD LTQT QS VDNAAGG++ +K A+E+  +YE
Sbjct  145  ECWERFKGLLLQCPHHGLPFHLQMQLFYDGLTQTCQSTVDNAAGGALKKKNAQESYNIYE  204

Query  361  MLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
            MLG N Q K++RG+  G+YE + N DL + ++ L +++
Sbjct  205  MLGSNXQHKDLRGKKVGVYETSXNHDLSLQVANLERKL  242



>ref|XP_008363369.1| PREDICTED: uncharacterized protein LOC103427080 [Malus domestica]
Length=1631

 Score =   197 bits (500),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 116/158 (73%), Gaps = 0/158 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD AK+W M L PGSL TW  V  KF++KF+S  KT  LR +I  F Q +GEPF+
Sbjct  149  FPYTLKDKAKSWLMTLAPGSLTTWDAVAKKFLEKFFSTQKTATLRGQIFNFKQDDGEPFN  208

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK LL+QCPHHG P  LQ+Q FYD LTQT QS VDNAAGG++ +K A+E+  +YE
Sbjct  209  ECWERFKGLLLQCPHHGLPFHLQMQIFYDGLTQTCQSTVDNAAGGALKKKNAQESYNIYE  268

Query  361  MLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
            MLG N Q K++RG+  G+YE +SN +L + ++ L +++
Sbjct  269  MLGSNXQHKDVRGKKLGVYETSSNHELSLQVANLERKL  306



>ref|XP_008348642.1| PREDICTED: uncharacterized protein LOC103411795 [Malus domestica]
Length=1706

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 116/158 (73%), Gaps = 0/158 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD AK W M L PGSL TW  V  KF++KF+S  KT  LR +I  F Q +GEPF+
Sbjct  142  FPYTLKDRAKGWLMTLAPGSLTTWDAVAKKFLEKFFSTQKTATLRGQIFNFKQDDGEPFN  201

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK LL+QCPHHG PL LQ+Q FYD LTQT QS VDNAAGG++ +K A+E+  +YE
Sbjct  202  ECWERFKGLLLQCPHHGLPLHLQMQIFYDGLTQTCQSTVDNAAGGALKKKNAQESYNIYE  261

Query  361  MLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
            MLG  +Q K++RG+  G+YE +SN +L + ++ L K++
Sbjct  262  MLGSXAQHKDLRGKKVGIYETSSNHELSLQVANLEKKL  299



>ref|XP_008392425.1| PREDICTED: uncharacterized protein LOC103454605 [Malus domestica]
Length=1228

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD AK+W M L PGSL TW  V  KF++KF+S  KT  LR +I  F Q +GEPF+
Sbjct  150  FPYTLKDRAKSWLMTLAPGSLITWDAVAKKFLEKFFSTQKTATLRGQIFNFKQDDGEPFN  209

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK LL+QCPHHG P  LQ+Q FYD LTQT QS VDNAAGG++ +K A+E+  +YE
Sbjct  210  ECWERFKGLLLQCPHHGLPXHLQMQIFYDGLTQTCQSTVDNAAGGALKKKNAQESYNIYE  269

Query  361  MLGENSQQKNIRGRTQG  411
            MLG N+Q K+ RG TQG
Sbjct  270  MLGSNAQHKDXRGVTQG  286



>ref|XP_008232773.1| PREDICTED: uncharacterized protein LOC103331871 [Prunus mume]
Length=409

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 85/134 (63%), Gaps = 0/134 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD AK W   L P SL TW  +  KF++K++S  KT  LR KI  F Q + E F 
Sbjct  163  FPYTLKDKAKYWLNSLKPSSLTTWGAIQKKFLEKYFSTQKTDMLRDKILLFAQQDDESFC  222

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF  LL QCPHHG PL+LQ++ FY  LT +S +IV N AGGS   KT EE   L+E
Sbjct  223  EAWERFNGLLNQCPHHGIPLKLQMRMFYKGLTPSSHNIVTNFAGGSYKTKTPEETYELFE  282

Query  361  MLGENSQQKNIRGR  402
             +   +Q  + RG+
Sbjct  283  EIAMETQHTDTRGK  296



>ref|XP_008231916.1| PREDICTED: uncharacterized protein LOC103331078 [Prunus mume]
Length=607

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 104/161 (65%), Gaps = 3/161 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W +     S+RTW ++  KF+ KF+   KT + ++ I +F Q + EP +
Sbjct  85   FPFSLKDKAKLWLLSQPQDSIRTWDDLSKKFLAKFFPPAKTAKFQQDIMSFAQYDKEPLY  144

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK LL +CPHH  P  +Q+QTFY+ L+QTS+++VD AAGG++  KTA EA  L+E
Sbjct  145  EAWERFKDLLRKCPHHELPTWIQVQTFYNGLSQTSRTLVDAAAGGALMVKTATEAFELFE  204

Query  361  MLGENSQQ---KNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             +  N+ Q   + +  +  G+ EV++   L   +S L K++
Sbjct  205  TMASNNYQWPNERMNPKPAGVLEVDAMALLTAQISNLTKKV  245



>ref|XP_008229034.1| PREDICTED: uncharacterized protein LOC103328423 [Prunus mume]
Length=735

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 103/161 (64%), Gaps = 3/161 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W +     S+RTW ++  KF+ KF+   KT + R+ I +F Q + EP +
Sbjct  85   FPFSLKDKAKLWLLSQPQDSIRTWDDLSKKFLAKFFPPAKTAKFRQDIMSFAQYDKEPLY  144

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK LL +CPHH  P  +Q+QTFY+ L+QTS+++VD AAGG++  KTA EA  L E
Sbjct  145  EAWERFKDLLRKCPHHELPTWIQVQTFYNGLSQTSRTLVDAAAGGALMAKTATEAFELLE  204

Query  361  MLGENSQQ---KNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             +  N+ Q   + +  +  G+ EV++   L   +S L K++
Sbjct  205  TMASNNYQWPSERMNLKPAGVLEVDAMALLTAQISNLTKKV  245



>ref|XP_009350424.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103941949 
[Pyrus x bretschneideri]
Length=1625

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 105/160 (66%), Gaps = 3/160 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L   S+ TW ++ NKF+ KF+  +KT +LR +I TF Q +GEPF+
Sbjct  41   FPFSLKDKAKNWLHSLPSNSITTWNDLANKFLQKFFPPSKTAKLRNEIMTFAQFQGEPFY  100

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E+WERF+ LL++CPHHG P  LQ+Q+FY  L+  ++ ++D A+GG++  KT +EA  L+ 
Sbjct  101  ESWERFRHLLLKCPHHGLPEWLQLQSFYQGLSADNKRMIDAASGGAIMTKTVDEASTLFN  160

Query  361  MLGENSQQ---KNIRGRTQGMYEVNSNPDLIVYMSELAKQ  471
             L  NSQ    +  + +  G++E+++   +   +S L K+
Sbjct  161  TLAANSQNWGGEREQPKKAGVHEIDAFTAMAAQISNLNKK  200



>ref|XP_009350425.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103941950 
[Pyrus x bretschneideri]
 ref|XP_009350426.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103941951 
[Pyrus x bretschneideri]
Length=1671

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 105/160 (66%), Gaps = 3/160 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L   S+ TW ++ NKF+ KF+  +KT +LR +I TF Q +GEPF+
Sbjct  87   FPFSLKDKAKNWLHSLPSNSITTWNDLANKFLQKFFPPSKTAKLRNEIMTFAQFQGEPFY  146

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E+WERF+ LL++CPHHG P  LQ+Q+FY  L+  ++ ++D A+GG++  KT +EA  L+ 
Sbjct  147  ESWERFRHLLLKCPHHGLPEWLQLQSFYQGLSADNKRMIDAASGGAIMTKTVDEASTLFN  206

Query  361  MLGENSQQ---KNIRGRTQGMYEVNSNPDLIVYMSELAKQ  471
             L  NSQ    +  + +  G++E+++   +   +S L K+
Sbjct  207  TLAANSQNWGGEREQPKKAGVHEIDAFTAMAAQISNLNKK  246



>ref|XP_008244659.1| PREDICTED: uncharacterized protein LOC103342780 [Prunus mume]
Length=392

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 88/144 (61%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F YTLKD AK W   L PG L +W EV NKF++KF S  KT  LR KI  F Q   E F 
Sbjct  17   FSYTLKDKAKMWLNSLRPGLLTSWTEVQNKFLEKFSSTQKTDALRDKIMQFSQQTDESFS  76

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF   LIQCPHHG    + ++ FY +L  +S++ V+N AGGS+  KT  E   L++
Sbjct  77   EAWERFNNFLIQCPHHGLLTLVLMRIFYKALIVSSKAAVNNYAGGSVKNKTPTECQTLFD  136

Query  361  MLGENSQQKNIRGRTQGMYEVNSN  432
             L   +Q  + RG+  G+YE+ S+
Sbjct  137  TLAIETQHSDTRGKRAGIYEIGSS  160



>ref|XP_008218681.1| PREDICTED: uncharacterized protein LOC103318979 [Prunus mume]
 ref|XP_008231298.1| PREDICTED: uncharacterized protein LOC103330487 [Prunus mume]
 ref|XP_008231996.1| PREDICTED: uncharacterized protein LOC103331166 [Prunus mume]
Length=1585

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 103/161 (64%), Gaps = 3/161 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W +     S+RTW ++  KF+ KF+   KT + R+ I +F Q + EP +
Sbjct  85   FPFSLKDKAKLWLLSQPQDSIRTWDDLSKKFLAKFFPPAKTAKFRQDIMSFAQYDKEPLY  144

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK LL +CPHH  P  +Q+QTFY+ L+QTS+++VD AAGG++  KTA EA  L E
Sbjct  145  EAWERFKDLLRKCPHHELPTWIQVQTFYNGLSQTSRTLVDAAAGGALMAKTATEAFELLE  204

Query  361  MLGENSQQ---KNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             +  N+ Q   + +  +  G+ EV++   L   +S L K++
Sbjct  205  TMASNNYQWPSERMNLKPAGVLEVDAMALLTAQISNLTKKV  245



>ref|XP_008359227.1| PREDICTED: uncharacterized protein LOC103422941 [Malus domestica]
Length=573

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 106/160 (66%), Gaps = 3/160 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD   +WF +L   S+ TW E+ N+F+ +F+  +KT + R +I TF Q + E F+
Sbjct  87   FPFSLKDKGNSWFNYLPANSITTWDELANQFLQRFFPPSKTSKFRNEIMTFAQFDSEAFY  146

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
             +WERF+ LL++CPHHG P  LQ+Q+FY  LT  ++ ++D A+GG++  KT  EA AL++
Sbjct  147  NSWERFRDLLMKCPHHGLPEWLQLQSFYQGLTPENKRMIDAASGGALMTKTVAEASALFK  206

Query  361  MLGENSQQKNI-RG--RTQGMYEVNSNPDLIVYMSELAKQ  471
             L  +SQQ  + RG  +  G++E+++   +  ++S L K+
Sbjct  207  TLATHSQQWGVERGPPKRAGVHEIDAMSTMAAHISNLNKK  246



>ref|XP_008363921.1| PREDICTED: uncharacterized protein LOC103427632 [Malus domestica]
Length=883

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYT+KD AKTW   L P +L +W ++ NKF++KF+S  KT  LR     F Q   E F 
Sbjct  126  FPYTMKDKAKTWLNSLRPRTLTSWNDIQNKFLEKFFSTXKTDTLRDXXXQFTQQADETFS  185

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF  LLIQCPHHG P  + ++ FY  LT +S++ V+N AGGS+   T     AL +
Sbjct  186  EAWERFNNLLIQCPHHGLPTLVLMRIFYKGLTVSSKAAVNNYAGGSIKNXTPXXCQALXD  245

Query  361  MLGENSQQKNIRGRTQGMYEVNSN  432
             L   +Q    RGR  G++E+N++
Sbjct  246  TLALXTQHSEARGRXAGVFEINNS  269



>ref|XP_008229249.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103328625 
[Prunus mume]
Length=1544

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 85/134 (63%), Gaps = 0/134 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD AK W   L P SL TW  +  KF++K++S  KT  LR KI  F Q + E F 
Sbjct  187  FPYTLKDKAKYWLNSLKPSSLTTWGAIQKKFLEKYFSTQKTDMLRDKILLFAQQDDESFC  246

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF  LL QCPHHG PL+LQ++ FY  LT +S +IV N AGGS   KT EE   L+E
Sbjct  247  EAWERFNGLLNQCPHHGIPLKLQMRMFYKGLTPSSHNIVTNFAGGSYKTKTPEETYELFE  306

Query  361  MLGENSQQKNIRGR  402
             +   +Q  + RG+
Sbjct  307  EIAMETQHTDTRGK  320



>ref|XP_008245146.1| PREDICTED: uncharacterized protein LOC103343257 [Prunus mume]
Length=1559

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 96/159 (60%), Gaps = 5/159 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD AK W   L P SL TW  +  KF++K++S  KT  LR KI  F Q + E F 
Sbjct  42   FPYTLKDKAKYWLYSLKPSSLTTWGAIQKKFLEKYFSTQKTDMLRDKILLFAQQDDESFC  101

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF  LL QCPHHG PL+LQ++ FY  LT +S +IV N AGGS   KT EE   L+E
Sbjct  102  EAWERFNGLLNQCPHHGIPLKLQMRMFYKGLTPSSHNIVTNFAGGSYKTKTPEETYELFE  161

Query  361  MLGENSQQKNIRG-RTQGMYEVNSNPDLIVYMSELAKQM  474
             +   +Q  + RG R  G     SN    V +S+L +++
Sbjct  162  EIAMETQHTDTRGKRIAG----GSNDSSSVQISKLEQKL  196



>ref|XP_008245764.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103343902, 
partial [Prunus mume]
Length=1625

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 85/134 (63%), Gaps = 0/134 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD AK W   L P SL TW  +  KF++K++S  KT  LR KI  F Q + E F 
Sbjct  232  FPYTLKDKAKYWLNSLKPSSLTTWGAIQKKFLEKYFSTQKTDMLRDKILLFAQQDDESFC  291

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF  LL QCPHHG PL+LQ++ FY  LT +S +IV N AGGS   KT EE   L+E
Sbjct  292  EAWERFNGLLNQCPHHGIPLKLQMRMFYKGLTPSSHNIVTNFAGGSYKTKTPEETYELFE  351

Query  361  MLGENSQQKNIRGR  402
             +   +Q  + RG+
Sbjct  352  EIAMETQHTDTRGK  365



>ref|XP_010247674.1| PREDICTED: uncharacterized protein LOC104590651 [Nelumbo nucifera]
Length=371

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 105/163 (64%), Gaps = 6/163 (4%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP +LKD AKTW   L   S+ TW E+ + F+ K++  +KT ++R  ITTF Q +GE  +
Sbjct  45   FPLSLKDKAKTWLNSLQARSISTWDEMASPFLSKYFPPSKTAKMRNDITTFSQQDGESLY  104

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E+WER+K LL + PHHG P+ LQ+QTFY+ LT+ +++I+D AAGGS+  KT + A AL E
Sbjct  105  ESWERYKELLKKVPHHGLPVLLQVQTFYNGLTEANKTIMDAAAGGSINNKTPKVAHALIE  164

Query  361  MLGEN-----SQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             +  N     S++  +R R   ++ V++   L   +S L+K++
Sbjct  165  EMAANNYQCHSERAQVR-RQPDLHNVDTYIALFAQISALSKKI  206



>ref|XP_008359939.1| PREDICTED: uncharacterized protein LOC103423628 [Malus domestica]
Length=485

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 87/144 (60%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYT+KD  KTW   L P +L  W ++ NKF++KF+S   T  LR  I  F Q   E F 
Sbjct  126  FPYTMKDKXKTWLNSLRPRTLTXWNDIQNKFLEKFFSTXXTDTLRDXIXQFTQQADETFS  185

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWE F  LLIQCPHHG P  + ++ FY  LT +S++ V+N AGGS+   T  E  AL++
Sbjct  186  EAWEXFNNLLIQCPHHGLPTLVLMRIFYKGLTVSSKAAVNNYAGGSIKNXTPXECQALFD  245

Query  361  MLGENSQQKNIRGRTQGMYEVNSN  432
             L   +Q     GR  G++E+N++
Sbjct  246  TLALXTQHXEAXGRRAGVFEINNS  269



>ref|XP_008231791.1| PREDICTED: uncharacterized protein LOC103330964 [Prunus mume]
Length=414

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 91/144 (63%), Gaps = 1/144 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK+W   L   S+RTW E+ NKF+ KF+   KT ++R++I  F Q EGE FH
Sbjct  146  FPFSLKDKAKSWLYSLPNASIRTWDELSNKFLQKFFPAQKTNKIRKEILGFTQKEGEAFH  205

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+K ++  CPHH     +Q+Q+FY+ L  + + +VD  +G  +  KTAEEA  L+E
Sbjct  206  ECWERYKEMISSCPHHNIESWMQMQSFYEGLLDSERMMVDATSGEGLMNKTAEEAFTLFE  265

Query  361  MLGENSQQ-KNIRGRTQGMYEVNS  429
             L  NSQQ  + +GR   M  V S
Sbjct  266  SLSANSQQWSHNKGRGAPMKAVVS  289



>ref|XP_008234114.1| PREDICTED: uncharacterized protein LOC103333099 [Prunus mume]
Length=1585

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 103/159 (65%), Gaps = 1/159 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L   S+ +W  +  KF+ KF+   KT +LRR I  F Q E EPF+
Sbjct  148  FPFSLKDRAKAWLHSLPAESITSWEGLAQKFLQKFFPAQKTNQLRRDIMHFSQGEHEPFY  207

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF+ LL +CPHHG    +Q+  FY+ LT T++ +VD+A GG++ EKT ++A   ++
Sbjct  208  EAWERFRELLQKCPHHGIIDWMQMHLFYEGLTTTNKRMVDSACGGALMEKTPQQAFDQFD  267

Query  361  MLGENSQQ-KNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
            +L  N+QQ  + R +  G+YEV+++  +   +S L K++
Sbjct  268  LLANNNQQCGSERTKKVGVYEVDTDTAVAAQISSLEKKL  306



>ref|XP_010245393.1| PREDICTED: uncharacterized protein LOC104588947 [Nelumbo nucifera]
Length=354

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 97/147 (66%), Gaps = 4/147 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L  GS+ T  E+ ++F+ K++  +K  ++R  ITTF Q +GEP +
Sbjct  35   FPFSLKDKAKAWMNSLPSGSIATLDEMASRFLSKYFPPSKIAKMRNDITTFFQQKGEPLY  94

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+K LL + PHH  P+ LQ+QT Y+ LT+++++I+D AAGGS+  KT E A AL E
Sbjct  95   ELWERYKELLRRVPHHALPIWLQVQTLYNCLTESNKTILDAAAGGSINNKTPEVAHALIE  154

Query  361  MLGENSQQ---KNIRGRTQ-GMYEVNS  429
             +  N+ Q   +  + R Q G++ V++
Sbjct  155  EMAANNYQWHSERTQARKQHGLHNVDT  181



>ref|XP_008243391.1| PREDICTED: uncharacterized protein LOC103341623 [Prunus mume]
Length=1724

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 91/147 (62%), Gaps = 2/147 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK+WF  L  GS+ +W E+  KF+ KF+  TKT+ LR++IT F Q   E FH
Sbjct  126  FPFTLKDKAKSWFTSLPAGSITSWEELAQKFMLKFFPATKTLLLRKEITNFEQKPQESFH  185

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERF  LL QCPHHG    +Q+Q FY  LT  S++ VD A GG++ EK  +E    +E
Sbjct  186  ECWERFCDLLQQCPHHGVETWMQMQIFYQGLTSASRNNVDAACGGALSEKDPKECFKTFE  245

Query  361  MLGENSQQ--KNIRGRTQGMYEVNSNP  435
             +  NS Q   +   R   ++ V++NP
Sbjct  246  RVAANSMQWGDDRFTRKITVHSVDTNP  272



>ref|XP_008245419.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103343534, 
partial [Prunus mume]
Length=1030

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 91/144 (63%), Gaps = 1/144 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK+W   L   S+RTW E+ NKF+ KF+   KT ++R++I  F Q EGE FH
Sbjct  104  FPFSLKDKAKSWLYSLPNASIRTWDELSNKFLQKFFPAQKTNKIRKEILGFTQKEGEAFH  163

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+K ++  CPHH     +Q+Q+FY+ L  + + +VD  +G  +  KTAEEA  L+E
Sbjct  164  ECWERYKEMISSCPHHNIESWMQMQSFYEGLLDSERMMVDATSGEGLMNKTAEEAFTLFE  223

Query  361  MLGENSQQ-KNIRGRTQGMYEVNS  429
             L  NSQQ  + +GR   M  V S
Sbjct  224  SLSANSQQWSHNKGRGAPMKAVVS  247



>ref|XP_008345475.1| PREDICTED: uncharacterized protein LOC103408398 [Malus domestica]
Length=418

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 101/158 (64%), Gaps = 2/158 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L   S+ TW E+  KF++KF+  +KT+ L+++I  F Q   + FH
Sbjct  153  FPFSLKDKAKAWLHSLPANSITTWIELQEKFLNKFFPSSKTLALKKEILAFAQKPNKSFH  212

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER+  +  +CPH G+   LQ+  FYD L  T++S V+ +AGGS+  K A EA  L++
Sbjct  213  EAWERYNEMYTKCPHAGFDSNLQMNIFYDGLNATTKSQVNASAGGSLMSKLAREAFELFD  272

Query  361  MLGENSQQ-KNIRGRTQGMYEVN-SNPDLIVYMSELAK  468
            M+   SQQ    + + +G++E++ S+P++   ++++ K
Sbjct  273  MMASESQQWTEEQTQKRGVFEISQSSPNVSAQIAKMEK  310



>emb|CAN78493.1| hypothetical protein VITISV_037041 [Vitis vinifera]
Length=1048

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 94/146 (64%), Gaps = 4/146 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L + AK W + L PG++ TW  + N F+ K++   K+ ++R  IT FLQ + E  +
Sbjct  37   FPFSLNNKAKAWLISLPPGTITTWDGLVNAFLAKYFPLAKSTKMRNDITNFLQQDQESLY  96

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK LL +CPHHG P+ +Q Q FY+SL   +Q++VD A+GG+   KT +E   L +
Sbjct  97   EAWERFKDLLRKCPHHGLPIWMQAQMFYNSLHPNTQTMVDAASGGAFINKTPDEGYQLIK  156

Query  361  MLGEN----SQQKNIRGRTQGMYEVN  426
            ++  N    S  +N + RT G+++++
Sbjct  157  VMASNNFLKSTDRNAQKRTVGVHDID  182



>ref|XP_008383907.1| PREDICTED: uncharacterized protein LOC103446552 [Malus domestica]
Length=329

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 99/170 (58%), Gaps = 11/170 (6%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D A +W   L   S+ TW  +  KF+ KF+   +T  L  +I +F Q EGE FH
Sbjct  97   FPFSLRDKASSWLDSLPEASIDTWTXLSKKFLSKFFPARRTNALINEIMSFRQQEGEQFH  156

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E+WER+K L +QCPHHG+    ++  FY  L    +S+VD+  GG++ +KT E+A+  +E
Sbjct  157  ESWERYKDLFLQCPHHGFNTWQKVHYFYKGLNSQCRSLVDSTVGGTLIDKTPEDAIHAFE  216

Query  361  MLGENSQQ-----KNIRGRTQ------GMYEVNSNPDLIVYMSELAKQMT  477
             + ENS+      K++R  T       G+YEVN+   L   ++ L K +T
Sbjct  217  TICENSEHWDFPTKDLRVPTASSTKKGGIYEVNTRTGLEAQVAALTKLLT  266



>ref|XP_008376307.1| PREDICTED: uncharacterized protein LOC103439527 [Malus domestica]
Length=853

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (60%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPY +KD AKTW   L   +L +W ++ NKF++KF+S  KT  LR     F Q   E F 
Sbjct  126  FPYXMKDKAKTWLNSLRXRTLTSWNDIQNKFLEKFFSTQKTDTLRDXXXQFTQQADETFS  185

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF  LLI CPHHG P  + ++ FY  LT +S++ V+N AGGS+   T     AL++
Sbjct  186  EAWERFNNLLIXCPHHGLPTLVLMRIFYKGLTVSSKAAVNNYAGGSIKNXTPAXCQALFD  245

Query  361  MLGENSQQKNIRGRTQGMYEVNSN  432
                 +Q    RGR  G++E+N++
Sbjct  246  TXALETQHSEARGRRAGVFEINNS  269



>ref|XP_010247584.1| PREDICTED: uncharacterized protein LOC104590568 [Nelumbo nucifera]
Length=784

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 103/163 (63%), Gaps = 6/163 (4%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD  KTW   L   S+ TW E+ ++F+ K++  +K  ++R  ITTF Q +GE  +
Sbjct  224  FPFSLKDKVKTWLSSLPARSISTWDEMASRFLSKYFPPSKIAKMRNDITTFSQQDGESLY  283

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E+WER+K LL + PHHG P+ LQ+QTFY+ LT+ +++I+D  AGGS+  KT E A AL E
Sbjct  284  ESWERYKELLRKVPHHGLPVWLQVQTFYNELTEANKTIMDATAGGSINNKTPEVAHALIE  343

Query  361  MLGEN-----SQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             +  N     S++  +R R   ++ V++   L   +  L+K++
Sbjct  344  EMTANNYQWHSERAQVR-RQPELHNVDTYTTLSAQIDALSKKI  385



>ref|XP_008361955.1| PREDICTED: uncharacterized protein LOC103425645 [Malus domestica]
Length=1385

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS+ TWA++  KF++K+Y  +KT+++R +I +F Q   E FH
Sbjct  141  FPYTLKDQARRWLLTLPSGSITTWAQLSEKFLNKYYPASKTLDMRTQILSFAQKPNEEFH  200

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L+ +CPH G     Q+  F+  L  T++++V+ + GG+  +K A+EA  L+E
Sbjct  201  EAWERFKELIRKCPHSGIXTTDQMHIFFRGLNMTTKTLVNASCGGTYKDKNAQEACLLFE  260

Query  361  MLGENSQQ  384
             + E++QQ
Sbjct  261  KMAEDTQQ  268



>ref|XP_008390120.1| PREDICTED: uncharacterized protein LOC103452408 [Malus domestica]
Length=1015

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 105/160 (66%), Gaps = 2/160 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS+ TWA++  KF++K+Y  +KT+++R +I +F Q   E FH
Sbjct  337  FPYTLKDQARRWLLXLPSGSITTWAQLSEKFLNKYYPASKTLDMRTQILSFAQKPNEEFH  396

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L+ +CPH G     Q+  F+  L  T++++V+ + GGS  +K A+EA  L+E
Sbjct  397  EAWERFKELIRKCPHSGINTTDQMHIFFRGLNMTTKTLVNASCGGSYKDKNAQEACLLFE  456

Query  361  MLGENSQQKNI-RGRTQGMYEV-NSNPDLIVYMSELAKQM  474
             +  ++QQ  + + +++ ++E+ N +P +   + ++ K++
Sbjct  457  KMAADTQQWAVEQPQSRSVFEMSNGSPYVTAQIEKMEKRL  496



>ref|XP_008361921.1| PREDICTED: uncharacterized protein LOC103425609 [Malus domestica]
Length=470

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 98/158 (62%), Gaps = 2/158 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L   S+ TW E+  KF++KF+  +KT+ L++ I  F Q   E FH
Sbjct  88   FPFSLKDKAKAWLHSLPANSITTWTELQEKFLNKFFPSSKTLALKKDILAFAQKPNESFH  147

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER   +  +CPH G+   LQ+  FYD L   ++S V+ +AGGS+  K+A EA  L++
Sbjct  148  EAWERSNEMYTKCPHAGFDSNLQMNIFYDGLNAATKSKVNASAGGSLMSKSAREAFELFD  207

Query  361  MLGENSQQ-KNIRGRTQGMYEVN-SNPDLIVYMSELAK  468
            M+   SQ+    + + +G+ E++ S+P++   ++++ K
Sbjct  208  MMASESQRWTEEQTQKRGVXEISQSSPNVSAQIAKMEK  245



>ref|XP_008366643.1| PREDICTED: uncharacterized protein LOC103430285 [Malus domestica]
Length=901

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 83/128 (65%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L   S+ TW E+  KF++KF+  +KT+ L+++I  F Q   E FH
Sbjct  88   FPFSLKDKAKAWLHSLPANSITTWXELQEKFLNKFFPSSKTLALKKEILAFAQKPNESFH  147

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER+  +  +CPH G+   LQ+  FYD L  T++S V+ +AGGS+  K+A EA  L++
Sbjct  148  EAWERYNEMYTKCPHAGFDSNLQMNIFYDGLNATTKSXVNASAGGSLMSKSAREAFELFD  207

Query  361  MLGENSQQ  384
            M+   SQQ
Sbjct  208  MMASESQQ  215



>ref|XP_008229164.1| PREDICTED: uncharacterized protein LOC103328545 [Prunus mume]
Length=341

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 88/144 (61%), Gaps = 1/144 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++LKD AK+W   L   S+ TW E+ NKF+ KF+   KT ++R++I  F Q EGE FH
Sbjct  28   FSFSLKDKAKSWLYSLPNASIHTWDELSNKFLHKFFPAQKTNKIRKEILGFTQKEGEAFH  87

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+K ++  CPHH     +Q+Q+FY+ L  + + +VD  +G  +  K A+EA  L+E
Sbjct  88   ECWERYKEMISSCPHHNIESWMQMQSFYEGLLDSERMMVDATSGEGLMNKRADEAFTLFE  147

Query  361  MLGENSQQ-KNIRGRTQGMYEVNS  429
             L  NSQQ  + +GR   M  V S
Sbjct  148  SLSANSQQWSHNKGRGAPMKAVVS  171



>ref|XP_008356957.1| PREDICTED: uncharacterized protein LOC103420687 [Malus domestica]
Length=849

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS+ TWA++  KF++K+Y  +KT+++R +I +F Q   E FH
Sbjct  88   FPYTLKDQARRWLLTLPSGSITTWAQLSEKFLNKYYPASKTLDMRTQILSFAQKPNEEFH  147

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L+ +CPH G     Q+  F+  L  T++++V+ + GG+  +K A+EA  L+E
Sbjct  148  EAWERFKELIRKCPHSGINTTDQMHIFFRGLNMTTKTLVNASCGGTYKDKNAQEACLLFE  207

Query  361  MLGENSQQ  384
             + E++QQ
Sbjct  208  KMAEDTQQ  215



>ref|XP_010242052.1| PREDICTED: uncharacterized protein LOC104586489 [Nelumbo nucifera]
Length=755

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 100/157 (64%), Gaps = 6/157 (4%)
 Frame = +1

Query  19   DAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFHEAWERF  198
            + AK W   L  GS+ TW E+ ++F+ K++  +KT ++R  ITTF Q +GE  +E+WER+
Sbjct  73   NGAKAWLNSLPAGSIATWDEMASRFLSKYFPPSKTAKMRNDITTFFQQDGESLYESWERY  132

Query  199  KMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYEMLGEN-  375
            K LL + PHHG P+ LQ+QTFYD LT+ +++I D  AGGS+  KT E A AL E +  N 
Sbjct  133  KELLRKVPHHGLPIWLQVQTFYDGLTEANKTIRDAVAGGSINNKTPEVAHALIEEMTANN  192

Query  376  ----SQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
                S++  +R +  G++ V++   L V +  L+K++
Sbjct  193  YQWHSRRAQVR-KQHGLHNVDTYTALSVQIGALSKKI  228



>ref|XP_008349253.1| PREDICTED: uncharacterized protein LOC103412480 [Malus domestica]
Length=412

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 98/170 (58%), Gaps = 11/170 (6%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D A +W   L   S+ TW  +  KF+ KF+   +T  L  +I +F Q EGE FH
Sbjct  97   FPFSLRDKASSWLDSLPEASIDTWTXLSKKFLSKFFPARRTNALINEIMSFRQQEGEQFH  156

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E+WER+K L +QCPHHG+    ++  FY  L    +S+VD+  GG++ +KT E+A+  +E
Sbjct  157  ESWERYKDLFLQCPHHGFNTWQKVHYFYKGLNSQCRSLVDSTVGGTLXDKTPEDAIHAFE  216

Query  361  MLGENSQQ-----KNIRGRTQ------GMYEVNSNPDLIVYMSELAKQMT  477
             + ENS+      K+ R  T       G+YEV++   L   ++ L K +T
Sbjct  217  TICENSEHWDFPTKDXRVPTASSTKXGGIYEVBTRTGLEAQVAALTKLLT  266



>ref|XP_008346316.1| PREDICTED: uncharacterized protein LOC103409283 [Malus domestica]
Length=993

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS+ TWA++  KF++K+Y  +KT+++R +I +F Q   E FH
Sbjct  88   FPYTLKDQARRWLLTLPSGSITTWAQLSEKFLNKYYPASKTLDMRTQILSFAQKPNEEFH  147

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L+ +CPH G     Q+  F+  L  T++++V+ + GG+  +K A+EA  L+E
Sbjct  148  EAWERFKELIRKCPHSGINTTDQMHIFFRGLNMTTKTLVNASCGGTYKDKNAQEACLLFE  207

Query  361  MLGENSQQ  384
             + E++QQ
Sbjct  208  KMAEDTQQ  215



>ref|XP_008351163.1| PREDICTED: uncharacterized protein LOC103414572 [Malus domestica]
Length=574

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 90/143 (63%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L   S+ TW E+  +F++KF+  +KT  L+ +I  F Q   E FH
Sbjct  88   FPFSLKDKAKAWLHSLPANSITTWTELQERFLNKFFPSSKTFALKIEILAFAQKPNESFH  147

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER+  +  +CPH G+   LQ+  FYD L  T++S V+ +AGGS+  K+A EA  L++
Sbjct  148  EAWERYNEMYTKCPHAGFDSNLQMNIFYDGLNATTKSHVNASAGGSLMSKSAREAFELFD  207

Query  361  MLGENSQQ-KNIRGRTQGMYEVN  426
            M+   SQQ    + + +G++E++
Sbjct  208  MMASESQQWTEEQTQKRGVFEIS  230



>ref|XP_010687151.1| PREDICTED: uncharacterized protein LOC104901296 [Beta vulgaris 
subsp. vulgaris]
Length=468

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 85/145 (59%), Gaps = 4/145 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W     P S  TWA +   F+ K+++  KT + R  IT+F Q +GE  +
Sbjct  140  FPFSLKDKAKMWLKSNPPNSFTTWATLSQAFLSKYFTPGKTAKFRNNITSFAQYDGESLY  199

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGS-MGEKTAEEALALY  357
            EAWERFK L  +CPHHG P  L +QTFY+ L ++ +  +D A GG+ MG  T      L 
Sbjct  200  EAWERFKDLQRKCPHHGVPDWLLVQTFYNGLNESVRITIDAATGGAIMGNTTEVANRLLE  259

Query  358  EMLGENSQQKNIRGRTQ---GMYEV  423
            EM   N    N RG+T+   GMYEV
Sbjct  260  EMASNNYHWSNNRGKTKNAAGMYEV  284



>ref|XP_008388875.1| PREDICTED: uncharacterized protein LOC103451222 [Malus domestica]
Length=411

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 104/160 (65%), Gaps = 2/160 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS+ TWA++   F++K+Y  +KT+++R +I +F Q   E FH
Sbjct  143  FPYTLKDQARRWILTLPSGSITTWAQLSEIFLNKYYPASKTLDMRTQILSFAQKPNEEFH  202

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L+ +CPH G     Q+  F+  L  T++++V+ + GGS  +K A+EA  L+E
Sbjct  203  EAWERFKELIRKCPHSGINTNDQMHIFFRWLNMTTKTLVNASCGGSYKDKNAQEACLLFE  262

Query  361  MLGENSQQKNI-RGRTQGMYEV-NSNPDLIVYMSELAKQM  474
             +  ++QQ  + + +++ ++E+ N +P +   + ++ K++
Sbjct  263  KMAADTQQWAVEQPQSRSVFEMSNGSPYVSAQIEKMEKKL  302



>ref|XP_008357149.1| PREDICTED: uncharacterized protein LOC103420888 [Malus domestica]
Length=575

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 101/156 (65%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L   S+ TW ++  +F++KF+  +KT+ L+++I  F Q   E FH
Sbjct  88   FPFSLKDKAKAWLHSLPANSITTWTKLQERFLNKFFPSSKTLALKKEILAFAQKPNESFH  147

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWE++  +  +CPH G+  +LQ+  FYD L  T++S V+ +AGGS+  K+A EA  L++
Sbjct  148  EAWEQYNEMYKKCPHAGFDSDLQMNIFYDGLNATTKSQVNASAGGSLMSKSAREAFELFD  207

Query  361  MLGENSQQ-KNIRGRTQGMYEVN-SNPDLIVYMSEL  462
            M+   SQQ    + + +G++E++ S P++   ++++
Sbjct  208  MMASESQQWTEEQTQKRGVFEISQSYPNVSAQIAKM  243



>ref|XP_008347427.1| PREDICTED: uncharacterized protein LOC103410512 [Malus domestica]
Length=768

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS+ TWA++   F++K+Y  +KT+++R +I +F Q   E FH
Sbjct  45   FPYTLKDQARRWLLXLPSGSITTWAQLSXXFLNKYYPASKTLDMRTQILSFAQKPNEEFH  104

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L+ +CPH G     Q+  F+  L  T++++V+ + GG+  +K A+EA  L+E
Sbjct  105  EAWERFKELIRKCPHSGINTTDQMHIFFRGLNMTTKTLVNASCGGTYKDKNAQEACLLFE  164

Query  361  MLGENSQQ  384
             + E++QQ
Sbjct  165  KMAEDTQQ  172



>ref|XP_008360946.1| PREDICTED: uncharacterized protein LOC103424627 [Malus domestica]
Length=601

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 103/160 (64%), Gaps = 2/160 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS+ TWA++   F++K+Y  +KT+++R +I +F     E FH
Sbjct  199  FPYTLKDQARRWLLXLPSGSITTWAQLSEXFLNKYYPASKTLDMRTQILSFAXKPNEEFH  258

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L+ +CPH G     Q+  F+  L  T++++V+ + GGS  +K A+EA  L+E
Sbjct  259  EAWERFKELIRKCPHSGINTTDQMHIFFRGLNMTTKTLVNASCGGSYKDKNAQEACLLFE  318

Query  361  MLGENSQQKNI-RGRTQGMYEV-NSNPDLIVYMSELAKQM  474
             +  ++QQ  + + +++ ++E+ N +P +   + ++ K++
Sbjct  319  KMAADTQQWAVEQPQSRSVFEMSNGSPYVTAQIEKMEKRL  358



>ref|XP_009335454.1| PREDICTED: uncharacterized protein LOC103928169 [Pyrus x bretschneideri]
 ref|XP_009335459.1| PREDICTED: uncharacterized protein LOC103928178 [Pyrus x bretschneideri]
Length=736

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 103/160 (64%), Gaps = 2/160 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS+ TW ++  KF+ K+Y  +KT+++R +I +F Q   E FH
Sbjct  142  FPYTLKDQARRWLLTLPSGSITTWNQLSEKFLSKYYPASKTLDMRTQILSFAQKPNEEFH  201

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L+ +CPH G     Q+  F+  L  T++++V+ + GGS  +K A+EA  L+E
Sbjct  202  EAWERFKELIRKCPHSGINSTDQMHIFFRGLNMTTKTLVNASCGGSYKDKNAQEACLLFE  261

Query  361  MLGENSQQKNI-RGRTQGMYEV-NSNPDLIVYMSELAKQM  474
             +  ++QQ  I + +++ ++E+ N +P +   + ++ K++
Sbjct  262  KMATDTQQWTIEQPQSRSVFEMSNGSPYVSAQIEKMEKKL  301



>ref|XP_008351903.1| PREDICTED: uncharacterized protein LOC103415338 [Malus domestica]
Length=837

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 104/160 (65%), Gaps = 2/160 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS+ TWA++  KF++K+Y  +KT+++R +I +F Q   E FH
Sbjct  143  FPYTLKDQARRWLLTLPSGSITTWAQLSEKFLNKYYPASKTLDMRTQILSFXQKXNEEFH  202

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L+ +CPH       Q+  F+  L  T++++V+ + GG+  +K A+EA  L+E
Sbjct  203  EAWERFKELIRKCPHSXINTTDQMHIFFRGLNMTTKTLVNASCGGTYKDKNAQEACLLFE  262

Query  361  MLGENSQQKNI-RGRTQGMYEV-NSNPDLIVYMSELAKQM  474
             + E++QQ  + + +++  +E+ N +P +   + ++ K++
Sbjct  263  KMAEDTQQWAVEQPQSRSAFEMPNGSPYVTAQIEKMEKRL  302



>ref|XP_008367789.1| PREDICTED: uncharacterized protein LOC103431410 [Malus domestica]
Length=881

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 105/160 (66%), Gaps = 2/160 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS+ TWA++  KF++K+Y   KT+++R +I +F Q   E FH
Sbjct  141  FPYTLKDQARRWLLTLPSGSITTWAQLSEKFLNKYYPAFKTLDMRTQILSFSQKPNEEFH  200

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAW+RFK L+ +CPH G     Q+  F+  L  T++++V+ + GG+  +K A+EA  L+E
Sbjct  201  EAWDRFKELIRKCPHSGINTTDQMHIFFRGLNMTTKTLVNASCGGTYKDKNAQEACLLFE  260

Query  361  MLGENSQQKNI-RGRTQGMYEV-NSNPDLIVYMSELAKQM  474
             + E++QQ  + + +++ ++E+ N +P +   + ++ K++
Sbjct  261  KMAEDTQQWAVEQPQSRSVFEMPNGSPYVTAQIEKMEKRL  300



>gb|ABD63156.1| Retrotransposon gag protein [Asparagus officinalis]
Length=275

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 93/147 (63%), Gaps = 5/147 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D A+ W   L PGS+ TW ++   F+ K++  +KT +LR +ITTF Q EGE  +
Sbjct  14   FPFSLRDKARAWLQSLPPGSITTWDQLSEAFLAKYFPPSKTAQLRNQITTFTQKEGESLY  73

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            +AWER+K LL  CPHHG    L I TFY+ L   ++  VD AAGG++  K+  +A  L E
Sbjct  74   DAWERYKDLLRMCPHHGLEDWLIIHTFYNGLLYNTRMTVDAAAGGALMNKSVRDAKQLIE  133

Query  361  MLGEN----SQQKNIRGRTQGMYEVNS  429
             + +N    S ++++  ++ G Y+V++
Sbjct  134  DMAQNHFQWSGERSLPKKS-GRYDVDA  159



>ref|XP_010695673.1| PREDICTED: uncharacterized protein LOC104908276 [Beta vulgaris 
subsp. vulgaris]
Length=817

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W       S  TW ++   F+ K++   KT +LR  IT+F+Q +GE  +
Sbjct  138  FPFSLKDKAKIWLKSNPANSFTTWEDLSGAFLRKYFPPGKTAKLRNDITSFIQNDGESLY  197

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L  QCPHHG P  L +QTFY+ L ++ +  +D AAGG++  KT E A  L E
Sbjct  198  EAWERFKHLQRQCPHHGVPDWLLVQTFYNGLNESVRITIDAAAGGAIMGKTTEVANKLLE  257

Query  361  MLGEN----SQQKNIRGRTQGMYEV  423
             +  N    S  +N   RT G YEV
Sbjct  258  EMASNNYHWSNDRNKPRRTGGKYEV  282



>ref|XP_008367967.1| PREDICTED: uncharacterized protein LOC103431580 [Malus domestica]
Length=389

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 96/158 (61%), Gaps = 2/158 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L   S+ TW E+  KF++KF+  +KT+ L++ I  F Q   E FH
Sbjct  88   FPFSLKDKAKAWLHSLPANSITTWTELQEKFLNKFFPSSKTLALKKDILAFAQKPNESFH  147

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER   +  +CPH G+    Q   FYD L   ++S V+ +AGGS+  K+A E   L++
Sbjct  148  EAWERSNEMYTKCPHAGFDSNXQXNIFYDGLNAATKSXVNASAGGSLMSKSAREXFELFD  207

Query  361  MLGENSQQ-KNIRGRTQGMYEVN-SNPDLIVYMSELAK  468
            M+   SQ+    + + +G++E++ S+P++   ++++ K
Sbjct  208  MMASESQRWTEEQTQKRGVFEISQSSPNVSAQIAKMEK  245



>ref|XP_008354153.1| PREDICTED: uncharacterized protein LOC103417773 [Malus domestica]
Length=515

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 99/158 (63%), Gaps = 2/158 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L   S+ TW E+  KF++KF+  +KT+ L+++I  F Q     FH
Sbjct  153  FPFSLKDKAKAWLHSLPANSITTWTELQEKFLNKFFPXSKTLALKKEILAFAQKPNXSFH  212

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER+  +  + PH G+   LQ+  FYD L  T++S V+ +AGGS+  K+A E   L++
Sbjct  213  EAWERYNEMYTKXPHAGFDSNLQMNIFYDGLNATTKSQVNASAGGSLMSKSAREXFELFD  272

Query  361  MLGENSQQ-KNIRGRTQGMYEVN-SNPDLIVYMSELAK  468
            M+   SQQ    + + +G++E++ S+P++   ++++ K
Sbjct  273  MMASESQQWTEEQTQKRGVFEISQSSPNVSAQIAKMEK  310



>ref|XP_010669073.1| PREDICTED: uncharacterized protein LOC104886310, partial [Beta 
vulgaris subsp. vulgaris]
Length=463

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 96/167 (57%), Gaps = 11/167 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++LKD AK W    T  +L TWA++   F+ KFY   K   +RR ITTF Q   E FH
Sbjct  42   FNFSLKDKAKEWLN--TKQNLTTWAQLQRDFLKKFYPIGKLSAMRRAITTFSQNPNEQFH  99

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF+ LL +CPHH  P    I +FY  L + +Q ++D + GG+  +K +++A  L+E
Sbjct  100  EAWERFRGLLCECPHHEVPQWQLIHSFYYGLNEHNQQMIDASCGGNFMQKNSDQAWQLFE  159

Query  361  MLGENSQQ-----KNIRGRT----QGMYEVNSNPDLIVYMSELAKQM  474
             L ENS Q     +N+  R+     G+YEV+   DL   +  L K+M
Sbjct  160  DLSENSLQHATSSRNVSSRSLGGKGGIYEVSHTHDLTYKVDILTKKM  206



>ref|XP_008363140.1| PREDICTED: uncharacterized protein LOC103426835 [Malus domestica]
Length=844

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 100/156 (64%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L   S+ TW ++  +F++KF+  +KT+ L+++I  F Q   E FH
Sbjct  28   FPFSLKDKAKAWLHSLPANSITTWTKLQERFLNKFFPSSKTLALKKEILAFAQKPNESFH  87

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER+  +  +CPH G+   LQ+  FYD L  T++S V+ +AGGS+  K+A EA  L++
Sbjct  88   EAWERYNEMYTKCPHAGFDSNLQMNIFYDGLNATTKSHVNASAGGSLMSKSAREAFELFD  147

Query  361  MLGENSQQ-KNIRGRTQGMYEVN-SNPDLIVYMSEL  462
            M+   SQQ    + + +G++E++ S P++   ++++
Sbjct  148  MMAFESQQWTEEQTQKRGVFEISQSYPNVSAQIAKM  183



>ref|XP_008341098.1| PREDICTED: uncharacterized protein LOC103404019 [Malus domestica]
Length=1768

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 84/128 (66%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS+ TWA +  KF +K+Y  +KT+++R +I +F Q   E FH
Sbjct  143  FPYTLKDQARRWLLTLPSGSITTWAXLSEKFJNKYYPASKTLDMRTQILSFAQKPNEEFH  202

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF  L+ +CPH G     Q+  F+  L  T++++V+ + GG+  +K A+EA  L+E
Sbjct  203  EAWERFXELIRKCPHSGISTTDQMHIFFRGLNMTTKTLVNASCGGTYKDKNAQEACLLFE  262

Query  361  MLGENSQQ  384
             + E++QQ
Sbjct  263  KMAEDTQQ  270



>ref|XP_006605072.1| PREDICTED: uncharacterized protein LOC102665365, partial [Glycine 
max]
Length=660

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 92/148 (62%), Gaps = 3/148 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+  AK W  +L P S+ +W ++   F++KF+  ++T+ +R+ I+   Q+ GE  +
Sbjct  173  FPHSLEGVAKDWLYYLAPRSITSWDDLKRVFLEKFFPASRTIAIRKDISGIRQLSGESLY  232

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK L   CPHH    +L +Q FY+ L+   +S++D A+GG++G+ T  EA  L E
Sbjct  233  EYWERFKKLCASCPHHQISEQLLLQYFYEGLSNMERSMIDAASGGALGDMTYAEARNLIE  292

Query  361  MLGENSQQKNIRGRT---QGMYEVNSNP  435
             +  NSQQ + R      +G++EV +NP
Sbjct  293  KMASNSQQFSARNDAIVIRGVHEVATNP  320



>ref|XP_008384013.1| PREDICTED: uncharacterized protein LOC103446659 [Malus domestica]
Length=865

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 99/170 (58%), Gaps = 11/170 (6%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D A +W   L   S+ TW E+  KF+ KF+   +T  L  +I +F Q EGE FH
Sbjct  131  FPFSLRDKASSWLDSLPEASIDTWTELSKKFLSKFFPARRTNALINEIMSFRQQEGEQFH  190

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E+WER+K L +QCPHHG+    ++  FY  L    +S+VD+  GG++ +KT E+A+  +E
Sbjct  191  ESWERYKDLFLQCPHHGFNTWQKVHYFYKGLNSQCRSLVDSTVGGTLMDKTPEDAIHAFE  250

Query  361  MLGENSQQ-----KNIRGRTQ------GMYEVNSNPDLIVYMSELAKQMT  477
             + ENS+      K+ R  T       G+YEV++   L   ++ L K +T
Sbjct  251  TICENSEHWDFPTKDSRVPTASSTKRGGIYEVDTRTGLEAQVAALTKLLT  300



>ref|XP_008232204.1| PREDICTED: uncharacterized protein LOC103331359 [Prunus mume]
Length=388

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 88/144 (61%), Gaps = 1/144 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++LKD AK+W   L   S+ T  E+ NKF+ KF+   KT ++R++I  F Q EGE FH
Sbjct  146  FLFSLKDKAKSWLYSLPNASIHTREELSNKFLQKFFPAQKTNKIRKEILGFAQKEGEAFH  205

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+K ++  CPHH     +Q+Q+FY+ L  + + +VD  +G  +  KTAEEA  L+E
Sbjct  206  ECWERYKEMISSCPHHNIESWMQMQSFYEGLLDSERMMVDATSGEGLMNKTAEEAFTLFE  265

Query  361  MLGENSQQ-KNIRGRTQGMYEVNS  429
             L  NSQQ  + +GR   M  V S
Sbjct  266  SLSANSQQWSHNKGRGAPMKAVVS  289



>ref|XP_008342990.1| PREDICTED: uncharacterized protein LOC103405745 [Malus domestica]
Length=660

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 91/149 (61%), Gaps = 7/149 (5%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L   S   W E+  KF++KF+  +KT+ L++++ TF Q   + FH
Sbjct  43   FPFSLKDKAKAWLHSLPANSFTKWTELQEKFLNKFFPSSKTLALKKEMLTFAQKPNDSFH  102

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER+     +CPH G+   LQ+  FYD L  T++S  + +AGGS+  K+A EA  L++
Sbjct  103  EAWERYNETYTKCPHAGFDSNLQMNIFYDGLNATTKSQANASAGGSLMSKSAREAFELFD  162

Query  361  MLGENSQQ----KNIRGRTQGMYEVNSNP  435
            M+   SQQ    +  +GR   ++E++ +P
Sbjct  163  MMASESQQWTEEQTQKGR---VFEISQSP  188



>ref|XP_010677707.1| PREDICTED: uncharacterized protein LOC104893306 [Beta vulgaris 
subsp. vulgaris]
Length=1068

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 89/145 (61%), Gaps = 4/145 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W     P S  TWA +   F+ K++   KT + R  IT+F+Q++GE  +
Sbjct  140  FPFSLKDKAKMWLKSNPPNSFTTWATLSQAFLSKYFPPGKTAKFRNDITSFVQLDGESLY  199

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L  +CPHHG P  L +QTFY+ L ++ +  +D AA G++  KT E A  L E
Sbjct  200  EAWERFKDLQRKCPHHGVPDWLLVQTFYNGLNESVRITIDAAARGAIMCKTTEVANRLLE  259

Query  361  MLGENSQQ-KNIRGRTQ---GMYEV  423
             +  N+    N RG+++   GMYEV
Sbjct  260  EMASNNYHWSNNRGKSKNAAGMYEV  284



>ref|XP_008351167.1| PREDICTED: uncharacterized protein LOC103414576 [Malus domestica]
Length=854

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 92/149 (62%), Gaps = 2/149 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L   S+ TW E+   F++KF+  +KT+ L+++I  F Q   E FH
Sbjct  153  FPFSLKDKAKAWLHSLPANSITTWTELQEXFLNKFFPSSKTLALKKEILAFAQKPNESFH  212

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER+  +  +CPH G+   L +  FYD L  T++S V+ +AGGS+  K A EA  L++
Sbjct  213  EAWERYNEMYTKCPHAGFDSNLXMNIFYDGLNATTKSHVNASAGGSLMSKXAREAFELFD  272

Query  361  MLGENSQQ-KNIRGRTQGMYEVN-SNPDL  441
            M+   SQQ      + +G++E++ S P++
Sbjct  273  MMASESQQWTEEXTQKRGVFEISQSXPNV  301



>ref|XP_008229520.1| PREDICTED: uncharacterized protein LOC103328892 [Prunus mume]
 ref|XP_008229521.1| PREDICTED: uncharacterized protein LOC103328892 [Prunus mume]
Length=330

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 81/129 (63%), Gaps = 0/129 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD+AK WF  L P S+ TWA + ++F+ KF+   +T ++R++I    Q++GEPFH
Sbjct  86   FPFSLKDSAKAWFYSLPPNSITTWATLASRFLQKFFPAQRTRKIRKEIVEIQQLDGEPFH  145

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+K +L  C +H  P  L +  FY+ L    + IVD  +GGS+  KT E+A   +E
Sbjct  146  EYWERYKKVLNSCANHNIPEWLLMHCFYEGLLDLDRMIVDATSGGSLMNKTVEQARETFE  205

Query  361  MLGENSQQK  387
             +  NS  K
Sbjct  206  NVSNNSLHK  214


 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  67   TWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFHEAWERFKMLLIQCPHHGYPLEL  246
            T+  V N  + K+   +K  +++++I    Q++GEPFHE WER+K LL   P H  P   
Sbjct  203  TFENVSNNSLHKYCGDSKR-KIKKEILEIQQLDGEPFHEYWERYKKLLNSYPDHNIPEWH  261

Query  247  QIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYEMLGENSQQKNIRGRTQGMYEVN  426
             + TFY  L    + IVD  +GGS+ +KT ++A   +E + +NS Q + R       EV 
Sbjct  262  LMHTFYGGLLYLDRMIVDATSGGSLMDKTRKQARETFENVSDNSLQFDNRRSPPKKSEVY  321

Query  427  SNPDLIV  447
             N  L++
Sbjct  322  ENNSLLM  328



>ref|XP_010678061.1| PREDICTED: uncharacterized protein LOC104893627 [Beta vulgaris 
subsp. vulgaris]
Length=764

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 96/167 (57%), Gaps = 11/167 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W+   T  ++  W  +  +F+ K++   K  ++RR+ITTF Q+  E FH
Sbjct  83   FPFSLKDKAKHWWT--TKENITNWQNLVTQFLKKYFPIGKLTKIRREITTFSQLPSEQFH  140

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERF+ LL  CPHH  P   Q+Q+FY  L + +Q ++D++ GG+   KT  EA  L+E
Sbjct  141  ECWERFRDLLRSCPHHEVPKWQQVQSFYSGLDERNQQMIDSSCGGTFFIKTPNEAWELFE  200

Query  361  MLGENSQQ---------KNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             L +NS Q             G   G+YE++ +PDL   +  L K++
Sbjct  201  HLSDNSLQHANSSRMGISRSLGSKGGIYEISHSPDLSSKVEVLTKKL  247



>ref|XP_006494715.1| PREDICTED: uncharacterized protein LOC102612045 [Citrus sinensis]
Length=810

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 104/168 (62%), Gaps = 10/168 (6%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++L+D A+ W   L P S+ TW+++ +KF+ K++  TK  +LR +IT+F Q+E E   
Sbjct  128  FSFSLRDRARAWLNSLPPDSITTWSDLADKFLLKYFPPTKNAKLRNEITSFHQLEDESLC  187

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            +AWERFK LL +CPHHG P  +Q++T Y+ L Q+++ IVD +A G++  K+  EA  + E
Sbjct  188  DAWERFKELLRRCPHHGIPCCIQLETLYNGLNQSTRLIVDASANGALLFKSYNEAYEILE  247

Query  361  MLGEN------SQQKNIRGRTQGMYEVNSNPDL---IVYMSELAKQMT  477
             +  N      ++Q   RG T G++ V++   L   +  ++++ K MT
Sbjct  248  RIANNNYQWPSTRQAATRG-TAGVHNVDALTALSAQVTSLTKMVKAMT  294



>ref|XP_010675344.1| PREDICTED: uncharacterized protein LOC104891359 [Beta vulgaris 
subsp. vulgaris]
Length=810

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 87/146 (60%), Gaps = 5/146 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W     P S  TWA +   F+ K++   KT + R  IT+F Q +GE  +
Sbjct  140  FPFSLKDKAKMWLKSNPPNSFTTWATLSQAFLSKYFPLGKTAKFRNNITSFAQYDGESLY  199

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGS-MGEKTAEEALALY  357
            EAWERFK L  +CPHHG P  L +QTFY+ L ++ +  +D AAGG+ MG+ T E A  L 
Sbjct  200  EAWERFKDLQRKCPHHGVPDWLLVQTFYNGLNESVRITIDAAAGGAIMGKITTEVANRLL  259

Query  358  -EMLGENSQQKNIRGRTQ---GMYEV  423
             EM   N    N RG+ +   GMYEV
Sbjct  260  EEMTSNNYHWFNNRGKPKNAAGMYEV  285



>ref|XP_010247575.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Nelumbo nucifera]
Length=922

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 101/163 (62%), Gaps = 6/163 (4%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L   S+ TW E+ ++F+ K++  +KT ++R  ITTF Q E E  +
Sbjct  727  FPFSLKDKAKAWLNSLPARSIATWDEMASRFLSKYFPPSKTTKMRNDITTFFQQEEESLY  786

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E+WER+K LL + PHH  P+  Q+QTFY+ LT ++++I+D  + GS+  KT E A AL E
Sbjct  787  ESWERYKDLLRKVPHHVLPIWQQVQTFYNGLTDSNKTILDATSKGSINNKTPEVAHALIE  846

Query  361  MLGEN-----SQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             +  N     S++  +R +  G++ V+S   L   +  L+K++
Sbjct  847  EMTTNNYQWHSERTQVR-KQDGLHNVDSYTTLSAQIGALSKKL  888



>ref|XP_010669074.1| PREDICTED: uncharacterized protein LOC104886311, partial [Beta 
vulgaris subsp. vulgaris]
Length=463

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 95/167 (57%), Gaps = 11/167 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++LKD AK W    T  +L TWA++   F+ KFY   K   +RR ITTF Q   E FH
Sbjct  42   FNFSLKDKAKEWLN--TKQNLTTWAQLQRDFLKKFYPIGKLSAMRRAITTFSQNPNEQFH  99

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF+ LL +CPHH  P    I +FY  L + +Q ++D + GG+  +K +++A  L+E
Sbjct  100  EAWERFRGLLRECPHHEVPQWQLIHSFYYGLNEHNQQMIDASCGGNFMQKNSDQAWQLFE  159

Query  361  MLGENSQQ-----KNIRGRT----QGMYEVNSNPDLIVYMSELAKQM  474
             L ENS Q     +N+  R+     G+YEV+   D    +  L K+M
Sbjct  160  DLSENSLQHATSSRNVSSRSLGGKGGIYEVSHTHDFAYKVDILTKKM  206



>ref|XP_010667599.1| PREDICTED: uncharacterized protein LOC104884611 [Beta vulgaris 
subsp. vulgaris]
Length=803

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W     P S  TWA +   F+ K++   KT + R  IT+F Q +GE  +
Sbjct  140  FPFSLKDKAKMWLKSNPPNSFTTWATLSQAFLSKYFPPGKTAKFRNNITSFAQYDGESLY  199

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L  +CPHHG P  L +QTFY+ L ++ +  +D AAGG++  KT E A  L E
Sbjct  200  EAWERFKDLQRKCPHHGVPDWLLVQTFYNGLNESVRITIDAAAGGAIMGKTTEVANRLLE  259

Query  361  MLGENSQQ-KNIRGRTQ---GMYEV  423
             +  N+    N RG+ +    MYEV
Sbjct  260  EMASNNYHWSNNRGKPKNDASMYEV  284



>ref|XP_008343613.1| PREDICTED: uncharacterized protein LOC103406410 [Malus domestica]
Length=624

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 101/160 (63%), Gaps = 2/160 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS+ +W ++   F+ K+Y  +KT+++R +I TF Q   E  H
Sbjct  88   FPYTLKDGARKWLLTLPFGSITSWNQLSAAFLSKYYPASKTLDMRTQILTFAQKPNEAIH  147

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER+K LL +CPH G   + Q+  FY  L  T++++V+ + GG+  +K A +A  L+E
Sbjct  148  EAWERYKDLLRKCPHSGINGDTQMNLFYRGLNLTTKTLVNASCGGTYSDKNALQAYQLFE  207

Query  361  MLGENSQQKNIR-GRTQGMYEVNS-NPDLIVYMSELAKQM  474
             +   SQQ  I   +T+G++E++S +P +   M ++ K++
Sbjct  208  NMATESQQWAIDIPQTRGVFEMSSGSPYVYAQMEKMEKKL  247



>ref|XP_010668059.1| PREDICTED: uncharacterized protein LOC104885048 [Beta vulgaris 
subsp. vulgaris]
Length=753

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D AK W     P S  TWA +   F+ K++   KT + R  IT+F Q  GE  +
Sbjct  87   FPFSLRDKAKMWLKSNPPNSFTTWATLSQAFLSKYFPPGKTAKFRNNITSFTQYYGESLY  146

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L  +CPHHG P  L +QTFY+ L ++ +  +D AAGG++  KT E A  L E
Sbjct  147  EAWERFKDLQRKCPHHGVPDWLLVQTFYNGLNESVRITIDAAAGGAIMGKTTEVANRLLE  206

Query  361  MLGENSQQ-KNIRGRTQ---GMYEV  423
             +  N+    N RG+ +   GMYEV
Sbjct  207  EMASNNYHWSNNRGKPKNAAGMYEV  231



>ref|XP_008246187.1| PREDICTED: uncharacterized protein LOC103344363, partial [Prunus 
mume]
Length=285

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 87/144 (60%), Gaps = 1/144 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+++KD AK+    L   S+  W E+ NKF+ KF+   KT ++R++I  F + E E FH
Sbjct  100  FPFSVKDKAKSSLYSLPNASIHAWEELSNKFLQKFFPAQKTNKIRKEILGFTRKEVEAFH  159

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+K ++  CPHH     +Q+Q+FY+ L  + + +VD  +G  +  KTAEEA  L+E
Sbjct  160  ECWERYKEMISSCPHHNIESWMQMQSFYEGLLDSERMMVDATSGEGLMNKTAEEAFTLFE  219

Query  361  MLGENSQQ-KNIRGRTQGMYEVNS  429
             L  NSQQ  + +GR   M  V S
Sbjct  220  SLSANSQQWSHNKGRGAPMKAVVS  243



>ref|XP_008390118.1| PREDICTED: uncharacterized protein LOC103452407 [Malus domestica]
Length=744

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 82/128 (64%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS  TWA++   F++K+Y  +KT++ R +I +F Q   E FH
Sbjct  141  FPYTLKDQARRWLLTLPSGSXTTWAQLSEXFLNKYYPASKTLDXRTQILSFAQKPNEEFH  200

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF  L+ +CPH G     Q+  F+  L  T++++V+ + GG   +K A+EA  L+E
Sbjct  201  EAWERFXELIRKCPHSGINTTDQMHIFFRGLNMTTKTLVNASCGGXYKDKNAQEACLLFE  260

Query  361  MLGENSQQ  384
             + E++QQ
Sbjct  261  KMAEDTQQ  268



>ref|XP_010667186.1| PREDICTED: uncharacterized protein LOC104884260 [Beta vulgaris 
subsp. vulgaris]
Length=712

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W     P S  TWA +   F+ K++   KTV+ R  IT+F Q +GE  +
Sbjct  140  FPFSLKDKAKMWLKSNPPNSFTTWATLSQAFLSKYFPSGKTVKFRNNITSFSQYDGESLY  199

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALY-  357
            EAWERFK L  +CPHHG P  L +QTFY+ L ++ +  +D AA G++  KT E A  L  
Sbjct  200  EAWERFKDLQRKCPHHGVPDWLLVQTFYNGLNESVRITIDAAAEGAIMGKTIEVANRLLE  259

Query  358  EMLGENSQQKNIRGRTQ---GMYEV  423
            EM   N    N RG+ +   GMYEV
Sbjct  260  EMAFSNYHWSNNRGKPKNVAGMYEV  284



>ref|XP_010670262.1| PREDICTED: uncharacterized protein LOC104887343 [Beta vulgaris 
subsp. vulgaris]
Length=509

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 82/145 (57%), Gaps = 4/145 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W     P S  TWA +Y  F+  ++   KT + R  ITTF Q +GE  +
Sbjct  87   FPFSLKDKAKMWLKSNPPNSFTTWATLYQAFLSTYFPPGKTAKFRNNITTFAQCDGESLY  146

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALY-  357
            EAWERFK L  +CP HG P  L + TFY+ L ++ +  +D  AGG +  KT E A  L  
Sbjct  147  EAWERFKDLQRKCPPHGVPDWLLVPTFYNGLNESVRITIDAVAGGVIMGKTTEVANRLLE  206

Query  358  EMLGENSQQKNIRGRTQ---GMYEV  423
            EM   N    N RG+ +   GMYEV
Sbjct  207  EMASNNYHWSNNRGKPKNAAGMYEV  231



>ref|XP_009598127.1| PREDICTED: uncharacterized protein LOC104093994 [Nicotiana tomentosiformis]
Length=532

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 101/166 (61%), Gaps = 7/166 (4%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L  GS+RTW E+  KF++K++S  KT  +R++I  F Q EGE   
Sbjct  141  FPFSLKDDAKQWMRSLPTGSIRTWEEMTTKFLEKYFSAAKTGRIRKEIHNFSQGEGEIVF  200

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK LL +CPH+     +Q+Q F DSL  +S+ ++++A    + +KT EE + L  
Sbjct  201  EAWERFKELLWRCPHNEIEQWMQLQDFGDSLNPSSRRLLNSAVAVPLMKKTPEEIVTLLN  260

Query  361  MLGENSQQ----KNIRGRTQGMYEVNSNPDL---IVYMSELAKQMT  477
             L E++ Q    +  R  + G+++V S+  +   I  M++  KQ+T
Sbjct  261  ELSEDADQWSTDQGDRRNSAGVHQVESSVAMQAQIAAMTKDIKQLT  306



>ref|XP_009615864.1| PREDICTED: uncharacterized protein LOC104108510, partial [Nicotiana 
tomentosiformis]
Length=447

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 97/162 (60%), Gaps = 4/162 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD  K W   L  GS+RTW E+  KF+ K +S  KT   R++I  F Q EGE   
Sbjct  78   FPFSLKDDIKQWLRSLPTGSIRTWEEMTTKFLGKKFSAAKTGRKRKEIHNFSQGEGETVF  137

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK LL +CPH+G    +Q+Q F+D L  +S+ ++++A  G + +KT EE + L  
Sbjct  138  EAWERFKELLRRCPHNGMEQWIQLQDFWDGLNLSSRRLLNSAVAGPLMKKTLEEIVTLLN  197

Query  361  MLGENSQQKNI----RGRTQGMYEVNSNPDLIVYMSELAKQM  474
             L E++ Q +     R ++ G++++ S   +   ++ +AK +
Sbjct  198  ELSEDADQWSTDQVDRKKSAGVHQLESTVAMQAQIATMAKDI  239



>ref|XP_009368824.1| PREDICTED: uncharacterized protein LOC103958290 [Pyrus x bretschneideri]
Length=537

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 100/160 (63%), Gaps = 2/160 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS+ +W ++   F+ K+Y  +KT+++  +I TF Q   E  H
Sbjct  224  FPYTLKDGARRWLLTLPSGSITSWNQLSAAFLSKYYPASKTLDMSTQILTFAQKPNEAIH  283

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER+K LL +CPH G   + Q+  FY  L  T++++V+ + GG+  +K A +A  L+E
Sbjct  284  EAWERYKDLLRKCPHSGINGDTQMNLFYRGLNLTTKTLVNASCGGTYSDKNALQAYQLFE  343

Query  361  MLGENSQQKNIR-GRTQGMYEVNS-NPDLIVYMSELAKQM  474
             +   SQQ  I   +T+G++E++S +P +   + ++ K++
Sbjct  344  NMATESQQWAIDIPQTRGVFEMSSGSPHVSAQIEKMEKKL  383



>ref|XP_004301918.1| PREDICTED: uncharacterized protein LOC101298139 [Fragaria vesca 
subsp. vesca]
Length=793

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 96/154 (62%), Gaps = 3/154 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W   L  G + TW  +  KF+ +F+    T +LRR+I  F Q +G+  +
Sbjct  156  FPFSLKDEAKHWLYSLPAGIITTWDGMVKKFLKQFFPAQLTKKLRREIQNFTQKDGDTLY  215

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWE F+ L  +CPHHGY L+  +Q FYD L  +++ +VD+  G +   KT +EA  L +
Sbjct  216  EAWEEFQELQRKCPHHGYDLDDLVQFFYDGLDTSNRGMVDSVCGCTFMNKTGQEAYNLID  275

Query  361  MLGENSQQ---KNIRGRTQGMYEVNSNPDLIVYM  453
             L +N++Q   ++ R + +G+YEV+S+ + +V M
Sbjct  276  DLADNNRQFSTRDKRPKGRGVYEVSSSWNQMVAM  309



>ref|XP_010675528.1| PREDICTED: uncharacterized protein LOC104891519 [Beta vulgaris 
subsp. vulgaris]
Length=1865

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 96/167 (57%), Gaps = 11/167 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++LKD AK W    T  +L TWA++   F+ KFY   K   +RR ITTF Q   E FH
Sbjct  240  FNFSLKDKAKEWLN--TKQNLTTWAQLQRDFLKKFYPIGKLSAMRRAITTFSQNPNEQFH  297

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF+ LL +CPHH  P    I +FY  L + +Q ++D + GG+  +K +++A  L+E
Sbjct  298  EAWERFRGLLCECPHHEVPQWQLIHSFYYGLNEHNQQMIDASCGGNFMQKNSDQAWQLFE  357

Query  361  MLGENSQQ-----KNIRGRT----QGMYEVNSNPDLIVYMSELAKQM  474
             L ENS Q     +N+  R+     G+YEV+   DL   +  L K+M
Sbjct  358  DLSENSLQHATSSRNVSSRSLGGKGGIYEVSHTHDLTYKVDILTKKM  404



>ref|XP_010694411.1| PREDICTED: uncharacterized protein LOC104907215 [Beta vulgaris 
subsp. vulgaris]
Length=818

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D AK       P S  TWA +   F+ K++   KT + R  IT+F Q +GE  +
Sbjct  140  FPFSLRDKAKMLLKSNPPNSFTTWATLSQAFLSKYFPPGKTAKFRNNITSFAQYDGESLY  199

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L  +CPHHG P  L +QTFY+ L ++ +  +D AAGG++  KT E A  L E
Sbjct  200  EAWERFKDLQRKCPHHGVPDWLLVQTFYNGLNESVRITIDAAAGGAIMGKTTEVANRLLE  259

Query  361  MLGENSQQ-KNIRGR---TQGMYEV  423
             +  N+    N RG+   T GMYEV
Sbjct  260  EMASNNYHWSNNRGKPKNTAGMYEV  284



>gb|EPS62135.1| hypothetical protein M569_12658, partial [Genlisea aurea]
Length=376

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 92/159 (58%), Gaps = 3/159 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK WF  L  GS+ TW ++   F+DK++   K + +R+ I++  Q  GE  +
Sbjct  172  FPFSLMDGAKDWFYSLDNGSIHTWRDMRQAFLDKYFPSDKVIHVRKAISSVQQQNGESLY  231

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            + WER+K LL  CP H    +  I  FY+ LT   + I++ AAGG++  KTA+EA  +  
Sbjct  232  DYWERYKRLLATCPKHQLGKKSIILYFYEGLTDEERKIINAAAGGNLKRKTADEAREIIT  291

Query  361  MLGENSQQ--KNIRGRTQGMYEV-NSNPDLIVYMSELAK  468
            M+  NSQQ     R R +G++ V  S+PD    + +L K
Sbjct  292  MMANNSQQFAPRSRERHKGVHAVTESSPDWGKKIDDLTK  330



>ref|XP_006826167.1| hypothetical protein AMTR_s04947p00003620 [Amborella trichopoda]
 gb|ERM93404.1| hypothetical protein AMTR_s04947p00003620 [Amborella trichopoda]
Length=379

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 94/159 (59%), Gaps = 5/159 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D A++W   L P S+  W ++  KF+ K++  T+  + R +I +F Q+E E   
Sbjct  101  FPFSLRDRARSWLNTLPPDSVTNWNDLAEKFLRKYFPPTRNAKFRSEIMSFQQLEDESTS  160

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            +AWERFK LL +CPHHG P  +Q++TFY+ L   S+ ++D +A G++  K+  EA  + E
Sbjct  161  DAWERFKELLRKCPHHGIPHCIQMETFYNGLNAASRMVLDASANGAILSKSYNEAFEILE  220

Query  361  MLGENSQQ-KNIRGRTQ----GMYEVNSNPDLIVYMSEL  462
             +  N+ Q  N R  T     G+ EV++   L   M+ +
Sbjct  221  TIASNNYQWSNTRAPTSRKVAGVLEVDAITALTAQMASM  259



>ref|XP_008351162.1| PREDICTED: uncharacterized protein LOC103414571 [Malus domestica]
Length=1146

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 89/143 (62%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK     L   S+ TW  +  KF++KF+  +K + L+++I  F Q   E FH
Sbjct  153  FPFSLKDKAKAXLHSLPANSITTWIXLQEKFLNKFFPSSKXLALKKEILAFAQKPNESFH  212

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER+  +  +CPH G+   LQ+  FYD L  T++S V+ +AGGS+  K+A EA  L++
Sbjct  213  EAWERYNEMYTKCPHAGFDSNLQMNIFYDGLNATTKSXVNASAGGSLMSKSAREAFELFD  272

Query  361  MLGENSQQ-KNIRGRTQGMYEVN  426
            M+   SQQ    + + +G++E++
Sbjct  273  MMASESQQWTEEQTQKRGVFEIS  295



>ref|XP_009588655.1| PREDICTED: uncharacterized protein LOC104086164 [Nicotiana tomentosiformis]
Length=251

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 98/162 (60%), Gaps = 4/162 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++LKD AK     L  GS+RTW E+  KF++K++S  KT  +R++I  F Q EGE   
Sbjct  25   FSFSLKDDAKQCLRSLPTGSIRTWEEITTKFLEKYFSAAKTRRMRKEIHNFSQGEGETVF  84

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK +L +CPH+G    +Q+Q F+D L  +S+ ++++A  G + +KT EE +    
Sbjct  85   EAWERFKEMLRRCPHNGMEQWMQLQDFWDGLNPSSRRLLNSAVPGPLMKKTPEEIVTPLN  144

Query  361  MLGENSQQKNI----RGRTQGMYEVNSNPDLIVYMSELAKQM  474
             L E++ Q +     R +  G+++V S+  +   ++ +AK +
Sbjct  145  ELSEDADQWSTDQVDRRKLAGVHQVESSVAMQAQIAVIAKDI  186



>ref|XP_010670070.1| PREDICTED: uncharacterized protein LOC104887170 [Beta vulgaris 
subsp. vulgaris]
Length=288

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 89/163 (55%), Gaps = 5/163 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++L+D      M L P SL TW EV   F+ +FYS  KT E+R KI TF   EGE  +
Sbjct  2    FKFSLRDEGSRCLMDLPPNSLTTWEEVTKAFLGQFYSLQKTAEMRAKIVTFNDKEGESLN  61

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK LL +CPHH    E+Q+  FY+ L   ++  ++  +GG +  K A+EAL   E
Sbjct  62   EAWERFKSLLRECPHHDMGKEMQLHCFYNGLYSHNKMSLNAGSGGPIMMKGADEALQAIE  121

Query  361  MLGENSQQKNIRGRTQ-----GMYEVNSNPDLIVYMSELAKQM  474
             + +N +  N   R+      G YE++S   L   +  L  Q+
Sbjct  122  HVVQNDRDWNKGERSSTSKRGGRYELDSIDLLTSKVDALVNQL  164



>ref|XP_010687013.1| PREDICTED: uncharacterized protein LOC104901165 [Beta vulgaris 
subsp. vulgaris]
Length=456

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 83/145 (57%), Gaps = 4/145 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W     P S  TWA +   F+ K++   KT + +  IT+F Q +GE  +
Sbjct  140  FPFSLKDKAKMWLKSNPPNSFTTWATLSQAFLSKYFPPGKTAKFKNNITSFAQYDGESLY  199

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALY-  357
            EAWERFK L  +CPHHG P  L +QTFY+ L +  +  +D AA G++  KT E A  L  
Sbjct  200  EAWERFKDLQHKCPHHGVPDWLLVQTFYNGLNEFVRITIDAAARGAIMGKTTEVANRLLE  259

Query  358  EMLGENSQQKNIRGRTQ---GMYEV  423
            EM   N    N  G+ +   GMYEV
Sbjct  260  EMASNNYHWSNNGGKPKNAAGMYEV  284



>ref|XP_010684693.1| PREDICTED: uncharacterized protein LOC104899241 [Beta vulgaris 
subsp. vulgaris]
Length=1743

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 92/165 (56%), Gaps = 9/165 (5%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++L   AK W   L P SL TWA+V   F+D+FYS  KT E RRKI+ F+Q E E  +
Sbjct  144  FHFSLTGKAKKWLQSLPPDSLTTWAQVTAAFVDEFYSQEKTSEARRKISNFIQDEDESLN  203

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMG-------EKTAE  339
            EAW+RFK L   CPHHGY   + +Q+FYD L   +++ +D+ AGG +        E T E
Sbjct  204  EAWDRFKDLRRSCPHHGYSQWMLMQSFYDGLLPMTRASLDSGAGGQLTKLPVDNIEPTIE  263

Query  340  EALALYEMLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
            E +  Y      S  K   G+  G Y+V++   +   +  LAK++
Sbjct  264  EVVRHYSWGNTRSTSKKASGK--GKYDVDAMDHIHAKLDTLAKKL  306



>ref|XP_009339431.1| PREDICTED: uncharacterized protein LOC103931640 [Pyrus x bretschneideri]
 ref|XP_009339432.1| PREDICTED: uncharacterized protein LOC103931641 [Pyrus x bretschneideri]
Length=1725

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 100/160 (63%), Gaps = 2/160 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD A+ W + L  GS+ +W ++   F+ K+Y  +KT+++  +I TF Q   E  H
Sbjct  143  FPYTLKDGARRWLLTLPSGSITSWNQLSAAFLSKYYPASKTLDMSTQILTFAQKPNEAIH  202

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER+K LL +CPH G   + Q+  FY  L  T++++V+ + GG+  +K A +A  L+E
Sbjct  203  EAWERYKDLLRKCPHSGINGDTQMNLFYRGLYLTTKTLVNASCGGTYSDKNALQAYQLFE  262

Query  361  MLGENSQQKNIR-GRTQGMYEVNS-NPDLIVYMSELAKQM  474
             +   SQQ  I   +T+G++E++S +P +   + ++ K++
Sbjct  263  NMATESQQWAIDIPQTRGVFEMSSGSPHVSAQIEKMEKKL  302



>ref|XP_010681827.1| PREDICTED: uncharacterized protein LOC104896735 [Beta vulgaris 
subsp. vulgaris]
Length=511

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 91/165 (55%), Gaps = 9/165 (5%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++L   AK W   L P SL TWA+V   F+D+FYS  KT + R+KI+ F+Q E E  +
Sbjct  144  FHFSLTGKAKKWLQSLPPDSLTTWAQVTAAFVDEFYSQEKTSKARKKISNFIQDEDESLN  203

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMG-------EKTAE  339
            EAW+RFK L   CPHHG    + IQ+FYD L   +++ +D+ AGG +        E T E
Sbjct  204  EAWDRFKDLRRSCPHHGNSQWMLIQSFYDGLLPITRANLDSGAGGQLTKLPVDNIEPTIE  263

Query  340  EALALYEMLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
            E +  Y      S  K   G+  G Y+V++   +   +  LAK++
Sbjct  264  EVVRHYSWGNTRSTSKKASGK--GKYDVDAMDHIHAKLDTLAKKL  306



>ref|XP_010247770.1| PREDICTED: uncharacterized protein LOC104590728 [Nelumbo nucifera]
Length=653

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 75/128 (59%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F +TL+D AK W   L PGS+RTW E+   F+DK++  ++   +R++I    Q   E  +
Sbjct  82   FSFTLRDKAKDWLYILPPGSIRTWDEMNRVFLDKYFPASRAANIRKEICGIRQSSDETLY  141

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK L   CP H  P +L IQ FY+ L    +S+VD  +GG++  KT E A  L  
Sbjct  142  EYWERFKQLCASCPQHQIPEQLLIQYFYEGLQPMDRSMVDADSGGALANKTPEVAWQLIS  201

Query  361  MLGENSQQ  384
             + ENSQQ
Sbjct  202  NMVENSQQ  209



>ref|XP_008776509.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103696607 
[Phoenix dactylifera]
Length=1438

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 85/146 (58%), Gaps = 4/146 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD AK W     P S  TW  +   F+ K++   KT +LR  IT+F Q +GE  +
Sbjct  90   FPFSLKDKAKAWLNSKAPNSFTTWNALSQAFLSKYFPPGKTAKLRNDITSFAQFDGESLY  149

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALY-  357
            EA +RFK L  +CPHHG P  L +QTFY+ L  + +  +D AAGG++  K+ EEA  L  
Sbjct  150  EASKRFKDLQRKCPHHGLPDWLIVQTFYNGLIHSVRITIDAAAGGTLMSKSTEEAYELSE  209

Query  358  EMLGENSQQKNIRG---RTQGMYEVN  426
            EM   N Q  N RG   +   MY+V+
Sbjct  210  EMASNNYQWSNERGMPKKVLDMYDVD  235



>ref|XP_010242023.1| PREDICTED: uncharacterized protein LOC104586472 [Nelumbo nucifera]
Length=688

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 92/163 (56%), Gaps = 4/163 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD+ K W  +L  GS+ TW E+   F++K++  ++   +R++I    Q  GE  H
Sbjct  6    FPFSLKDSTKDWLYYLPSGSVTTWNEMKRLFLEKYFPASRAANIRKEIYGIRQYNGESLH  65

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            + WE FK L   CPHH    +L IQ FY+ L +T++SI+D A+GG++ +KT E A  L  
Sbjct  66   KYWEHFKKLCASCPHHQISEQLLIQYFYEGLQRTNRSIIDAASGGALVDKTPEAARNLIA  125

Query  361  MLGENSQQKNIR----GRTQGMYEVNSNPDLIVYMSELAKQMT  477
             +  NSQQ + R     +      ++S    I  ++ L +QM 
Sbjct  126  NMAANSQQFSYRLNPPAKHANEVNISSLEQQIASLTSLVRQMA  168



>ref|XP_011074617.1| PREDICTED: uncharacterized protein LOC105159304 [Sesamum indicum]
Length=491

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TL D AK WF  L  GS+ +W E+  +F++ ++  +KT  +R++I+   Q   E F+
Sbjct  141  FPFTLGDKAKDWFYSLPSGSIISWNELKKQFLENYFPASKTTNIRKEISGIRQFSSESFY  200

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E W RFK L+  CPHH  P    IQ FY+ L++ ++S+VD A+GG++ +KT  EA  L  
Sbjct  201  EYWGRFKQLVESCPHHQNPDHFLIQYFYEGLSEANRSLVDAASGGALYDKTPTEARKLIT  260

Query  361  MLGENSQQ  384
             +  N+QQ
Sbjct  261  TMAANNQQ  268



>ref|XP_011070697.1| PREDICTED: uncharacterized protein LOC105156296 [Sesamum indicum]
Length=371

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TL D AK WF  L  GS+ +W E+  +F++ ++  +KT  +R++I+   Q   E F+
Sbjct  83   FPFTLGDKAKDWFYSLPSGSIVSWNELKKQFLENYFPASKTTNIRKEISGIRQFSSESFY  142

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E W RF+ L+  CPHH  P  L IQ FY+ L++  +S+VD A+GG++ +KT  EA  L  
Sbjct  143  EYWGRFEQLVESCPHHQIPDYLLIQYFYEGLSEADRSLVDAASGGALYDKTPTEARKLIT  202

Query  361  MLGENSQQ  384
             +  N+QQ
Sbjct  203  TMAANNQQ  210



>ref|XP_006494090.1| PREDICTED: uncharacterized protein LOC102610671 [Citrus sinensis]
Length=877

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 81/132 (61%), Gaps = 0/132 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D++K W  +L+ G++ TW E+   F++K++  +K   +R++I    Q  GEP +
Sbjct  71   FPFSLADSSKEWLYYLSSGTVTTWNEMRQLFLEKYFPASKAGSIRKEICGIRQYNGEPLY  130

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            + WERFK L   CPHH    +L IQ FY+ L    +S++D A+GG++ +KT E A  L  
Sbjct  131  DYWERFKKLCASCPHHQISDQLLIQYFYEGLLPMDRSMIDAASGGALVDKTPEAARNLIA  190

Query  361  MLGENSQQKNIR  396
             +  NSQQ N R
Sbjct  191  NMAANSQQFNTR  202



>ref|XP_009586851.1| PREDICTED: uncharacterized protein LOC104084616 [Nicotiana tomentosiformis]
Length=303

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 96/160 (60%), Gaps = 4/160 (3%)
 Frame = +1

Query  7    YTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFHEA  186
            ++LKD AK W   L  GS+RT  ++  KF++K++S  KT  +R++I  F Q EGE   EA
Sbjct  55   FSLKDDAKQWLSSLPTGSIRTSEDMTTKFLEKYFSAAKTGRMRKEIHNFSQGEGETMFEA  114

Query  187  WERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYEML  366
            WERFK LL +CPH+G    +Q+Q F+D L ++S  ++++A  G + +KT EE + L   L
Sbjct  115  WERFKELLWRCPHNGMEQWMQLQEFWDGLNKSSMRLLNSAVAGPLIKKTLEEIVTLLNEL  174

Query  367  GENSQQ----KNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             E++ Q    +  R  + G++++ S   +   +  +AK +
Sbjct  175  SEDTDQWSTNQGDRKTSAGVHQLESTVPMHAQIEAMAKDI  214



>ref|XP_009603781.1| PREDICTED: uncharacterized protein LOC104098686 [Nicotiana tomentosiformis]
Length=349

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 93/158 (59%), Gaps = 3/158 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD A  W   L  GS+RTW E+   F++K +S  K   +R++I  F Q EGE   
Sbjct  19   FPFSLKDDANQWLRSLPTGSIRTWEEMTTMFLEKHFSAAKIGRMRKEIHHFSQGEGETVF  78

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAW+RFK LL +CPH+G    +Q+Q F+D L  TS+ ++++A  G + +KT +    +  
Sbjct  79   EAWKRFKELLWRCPHNGMEQWMQLQDFWDRLNLTSRRLLNSAVTGPLMKKTPK---VIVT  135

Query  361  MLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
            +L E S     R R+ G+++V S+  +    S +AK +
Sbjct  136  LLNELSVDHGDRRRSSGVHQVESSVAMQAQFSAMAKDI  173



>ref|XP_006577573.1| PREDICTED: uncharacterized protein LOC102670185, partial [Glycine 
max]
Length=534

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 88/147 (60%), Gaps = 3/147 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+  AK W  +L P S+ +W ++   F++K +  ++T  +R+ I+   Q+ GE  +
Sbjct  47   FPHSLEGVAKDWLYYLAPRSITSWDDLKRIFLEKIFHASRTTAIRKDISGIRQLNGESLY  106

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E  ERFK L   CPHH    +L +Q FY+ L+   +S++D A+GG++G+ T  EA  L E
Sbjct  107  EYCERFKKLCASCPHHQVSEQLLLQYFYEGLSNMERSMIDAASGGAVGDMTPAEARNLIE  166

Query  361  MLGENSQQKNIRGRT---QGMYEVNSN  432
             +  NSQQ + R      +G++EV +N
Sbjct  167  KMASNSQQFSARNDAIVIRGVHEVATN  193



>ref|XP_010267895.1| PREDICTED: uncharacterized protein LOC104604999 [Nelumbo nucifera]
Length=324

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 91/163 (56%), Gaps = 4/163 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD+AK W  +L  GS+    E+   F++K++  ++   +R++I +  Q  GE  H
Sbjct  83   FPFSLKDSAKDWLYYLPSGSITARNEMKRLFLEKYFPTSRAANIRKEICSVRQYNGESLH  142

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK L   CPHH    +L IQ FY+ L  T +S++D  +GG++ +KT E A  L  
Sbjct  143  EYWERFKKLCASCPHHQISEQLLIQYFYEGLQPTDRSMIDATSGGALVDKTPEAARNLIA  202

Query  361  MLGENSQQKNIR--GRTQGMYEVN--SNPDLIVYMSELAKQMT  477
             +  NSQQ   R    ++ + EVN  S    I  ++ L  QM 
Sbjct  203  NIAANSQQFGYRLDPPSKHVNEVNLSSLEQQIASLTSLVHQMA  245



>ref|XP_008365323.1| PREDICTED: uncharacterized protein LOC103428962 [Malus domestica]
Length=598

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 76/128 (59%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++LKD AK W   L    + TW  +   F++KF+  +KT+ L+++I  F Q   E FH
Sbjct  153  FXFSLKDKAKAWLHSLPANXITTWXXLQXXFLNKFFPSSKTLALKKEILAFAQKPNESFH  212

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER+  +  +CPH  +    Q+  FY+ L  T++S V+ +AGGS+  K+A EA  L++
Sbjct  213  EAWERYNEMYTKCPHAXFDXNJQMNIFYBGLNATTKSXVNASAGGSLMSKSAREAFELFD  272

Query  361  MLGENSQQ  384
            M+    QQ
Sbjct  273  MMASEXQQ  280



>ref|XP_004492121.1| PREDICTED: uncharacterized protein LOC101498022 [Cicer arietinum]
Length=544

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 88/147 (60%), Gaps = 5/147 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+ L+D A+ W   L   S+ TW ++   F+ +++  +KT +LR +IT+F Q EGE  +
Sbjct  44   FPFPLRDRARAWLHSLPSESITTWDQLKQAFLGRYFPPSKTAQLRNQITSFSQKEGESLY  103

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWE FK +L  CPHHG    L I TFY+ L+ T++  VD+ AGG+   K  EE+ AL E
Sbjct  104  EAWENFKEMLRLCPHHGMERWLIIHTFYNELSYTTRMTVDDDAGGAFINKNIEESYALIE  163

Query  361  MLGEN----SQQKNIRGRTQGMYEVNS  429
             +  N    S  ++   +  GMYEV++
Sbjct  164  DMEHNHYQWSSDRSPHNKG-GMYEVDA  189



>ref|XP_008779129.1| PREDICTED: uncharacterized protein LOC103698859 [Phoenix dactylifera]
Length=375

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 88/163 (54%), Gaps = 4/163 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD+AK W  +L  GS+  W E+   F++K++  ++   +R+ I    Q   E  H
Sbjct  137  FPFSLKDSAKDWLYYLPSGSITIWNEMKRLFLEKYFPASRVANIRKVICGVRQQNRESLH  196

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WE FK L   CPHH    +L IQ FY+ L  T +S++D A+GG++ +KT E A  L  
Sbjct  197  EYWEHFKKLCASCPHHQISEQLLIQYFYEGLLPTERSMIDAASGGALVDKTPETARNLIA  256

Query  361  MLGENSQQKNIR----GRTQGMYEVNSNPDLIVYMSELAKQMT  477
             +  NSQQ + R     +      ++S    I  ++ L +QM 
Sbjct  257  NMAANSQQFSTRLDPLSKHVNKVNISSLEQQIASLTSLVRQMA  299



>ref|XP_009773211.1| PREDICTED: uncharacterized protein LOC104223460, partial [Nicotiana 
sylvestris]
Length=421

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++LK  AKTW   L  GS+ TW ++  KF++K++S  KT +LR+ I+ FLQ + E  +
Sbjct  113  FRFSLKGEAKTWLRSLPQGSITTWDQMTQKFLNKYFSPAKTTKLRQDISNFLQTDTESVY  172

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            +AWER K+LL +C HH  P  +Q+  FY  L  +S++++  AAGGS+  KT  E L L  
Sbjct  173  QAWERLKILLRKCLHHDIPEHMQLYIFYHGLKPSSRNVIIAAAGGSIMGKTTVEVLQLLN  232

Query  361  MLGENSQQ  384
             + EN+ Q
Sbjct  233  EISENAIQ  240



>ref|XP_006465129.1| PREDICTED: uncharacterized protein LOC102627778 [Citrus sinensis]
Length=1020

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 87/147 (59%), Gaps = 4/147 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D+AK W  +L  G++ TW E+   F++K++  +K   +R++I    Q  GEP +
Sbjct  125  FPFSLADSAKEWLYYLPSGTVTTWNEMRQLFLEKYFPASKAGSIRKEICGIRQYNGEPLY  184

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            + WERFK L   CPHH    +L IQ FY+ L    +S++D A+GG++ +KT E A  L  
Sbjct  185  DYWERFKKLCASCPHHQISDQLLIQYFYEGLLPMDRSMIDAASGGALVDKTPEAARNLIA  244

Query  361  MLGENSQQKNIRGR----TQGMYEVNS  429
             +  NSQQ N +       +G+ EV++
Sbjct  245  NMAANSQQFNTKNDLLPPPKGVNEVST  271



>emb|CAN77722.1| hypothetical protein VITISV_020621 [Vitis vinifera]
Length=276

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 94/170 (55%), Gaps = 12/170 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L PGS+RTW +   +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  35   FPFTLKDKAKIWLNSLRPGSIRTWIDFQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFY  94

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FY  ++ + + +++   GG    K  EEA+    
Sbjct  95   ECWERYMETINACPHHGFDTWLVVSYFYYGMSSSMKQLLETMCGGDFMSKNPEEAMEFLN  154

Query  361  MLGENSQ---QKNIR--GRTQ-------GMYEVNSNPDLIVYMSELAKQM  474
             + E S+   + N+R  GR +       GMY +N + D+   ++ +A+++
Sbjct  155  YVAEVSRGWDEPNVREVGRMKSQPNVKGGMYLLNEDIDMKAKVAAMARRL  204



>ref|XP_010677841.1| PREDICTED: uncharacterized protein LOC104893431 [Beta vulgaris 
subsp. vulgaris]
Length=1320

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 91/166 (55%), Gaps = 10/166 (6%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++L   AK W   L P SL TWA+V + F+D+FYS  K  E RRKI+ F+Q E E   
Sbjct  87   FHFSLTRKAKKWLQSLPPDSLTTWAQVTSAFVDEFYSQEKASEARRKISNFIQDEDESLD  146

Query  181  EAWERFKMLLIQCPHHGYPL-ELQIQTFYDSLTQTSQSIVDNAAGGSMG-------EKTA  336
            EAW+RFK L   CPHHGY    L +Q+FYD L   +++ +D+ AGG +        E T 
Sbjct  147  EAWDRFKDLRRSCPHHGYSQWMLMMQSFYDGLLPMTRAGLDSGAGGQLTKLPVDNIEPTI  206

Query  337  EEALALYEMLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
            EE +  Y      S  K   G+  G Y+V++   +   +  LAK++
Sbjct  207  EEVVRHYSSGNTRSTSKKASGK--GKYDVDAMDHIHAKLDTLAKKL  250



>ref|XP_006480387.1| PREDICTED: uncharacterized protein LOC102611294 [Citrus sinensis]
Length=1430

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 79/132 (60%), Gaps = 0/132 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D+AK W  +L  G++ TW E+   F++K++  +K   +R++I    Q  GEP +
Sbjct  82   FPFSLADSAKEWLYYLPSGTVTTWNEMRQLFLEKYFPASKAGSIRKEICGIRQYNGEPLY  141

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            + WERFK L   CPHH    +L IQ FY+ L     S++D A+GG++ +KT E A  L  
Sbjct  142  DYWERFKKLCASCPHHQISDQLLIQYFYEGLLPMDMSMIDAASGGALVDKTPEAARNLIV  201

Query  361  MLGENSQQKNIR  396
             +  NSQQ N R
Sbjct  202  NMAANSQQFNTR  213



>ref|XP_010248013.1| PREDICTED: uncharacterized protein LOC104590935 [Nelumbo nucifera]
Length=594

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 91/149 (61%), Gaps = 7/149 (5%)
 Frame = +1

Query  43   FLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFHEAWERFKMLLIQCP  222
            FL   S+ TW ++  KF+ K++S  KT +LR  ITTF Q + E  +E+WERFK +L + P
Sbjct  73   FLEICSITTWDDLAQKFLSKYFSPAKTTKLRNDITTFSQFDNETLYESWERFKEILRKYP  132

Query  223  HHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYEMLGENS-----QQK  387
            HHG P+ +Q+QTFY  + Q++ S++D  AGG++  KT EEA  L E +  NS     ++ 
Sbjct  133  HHGLPVWMQVQTFYSGINQSNHSMLDAVAGGTLMRKTPEEAYELLEEMAANSYQWGNEKS  192

Query  388  NIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
            N +G   G+Y  +S   L   ++ L K++
Sbjct  193  NKKG--VGIYNADSITTLSAQLAALNKKL  219



>ref|XP_011076838.1| PREDICTED: uncharacterized protein LOC105160988 [Sesamum indicum]
Length=596

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK W   L  GS+  W E+   F++ ++  ++T  +R++I+   Q  GE F+
Sbjct  368  FPFSLGDKAKDWLYSLPSGSIVNWNELKKLFLENYFPASRTTNIRKEISGIRQFSGESFY  427

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E W RFK L+  CPHH  P  L IQ FY+ L++ ++S+VD A+GG++ +KT  EA  L  
Sbjct  428  EYWGRFKQLVESCPHHQIPDHLLIQYFYEGLSEANRSLVDAASGGALYDKTPTEARKLIT  487

Query  361  MLGENSQQ  384
             +  N+QQ
Sbjct  488  TMAANNQQ  495



>ref|XP_011075651.1| PREDICTED: uncharacterized protein LOC105160085 [Sesamum indicum]
Length=728

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TL D AK WF  L  GS+ +W E+  +F++ ++  +KT  +R++I+   Q   + F+
Sbjct  141  FPFTLGDKAKDWFYSLPSGSIISWNELKKQFLENYFPASKTTNIRKEISGIRQFSSQSFY  200

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E W RFK L+  CPHH  P  L IQ FY+ L + ++S+VD A+GG++ +KT  EA  L  
Sbjct  201  EYWGRFKQLVESCPHHQIPDHLLIQYFYEGLFEANRSLVDAASGGALYDKTPTEARKLIT  260

Query  361  MLGENSQQ  384
             +  N+QQ
Sbjct  261  TMAANNQQ  268



>ref|XP_010681878.1| PREDICTED: uncharacterized protein LOC104896783 [Beta vulgaris 
subsp. vulgaris]
Length=386

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 89/165 (54%), Gaps = 9/165 (5%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++L   AK     L P  L TWA+V   F+D+FYS  KT E RRKI+ F+Q E E  +
Sbjct  144  FHFSLTGKAKKLLQSLPPDFLTTWAQVTVAFVDEFYSQEKTSEARRKISNFIQDEDESLN  203

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMG-------EKTAE  339
            EAW+RFK L   CPHHGY   + +Q+FYD L   +++ +D+ AGG +        E T E
Sbjct  204  EAWDRFKDLRRSCPHHGYSQWMLMQSFYDGLLPMTRASLDSGAGGQLTKLPVDNIEPTIE  263

Query  340  EALALYEMLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
            E +  Y      S  K   G+  G Y+V+    +   +  LAK++
Sbjct  264  EVVRHYSWGNTRSTSKKANGK--GKYDVDVMDHIHAKLDTLAKKL  306



>ref|XP_010669189.1| PREDICTED: uncharacterized protein LOC104886435, partial [Beta 
vulgaris subsp. vulgaris]
Length=343

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 82/146 (56%), Gaps = 3/146 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D AK W      G+  TW ++   F+ KF    KT +LR ++ TF Q + E F+
Sbjct  15   FPFSLRDRAKEWLRDEGVGTFDTWGKLAKAFLVKFLGQEKTAKLRNELATFEQHDDESFY  74

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAW RF  L  QCPHHG P  + IQTFY+ LT   +  +D A+GGS+  K   EA  L E
Sbjct  75   EAWRRFLRLQRQCPHHGIPEWMLIQTFYNGLTHEFRIYIDAASGGSLMTKNPAEAKELIE  134

Query  361  MLGENSQ-QKNIRGRTQ--GMYEVNS  429
             +  N     N R R +  G Y+V++
Sbjct  135  KMATNDNYHPNGRNRAKKGGKYDVDA  160



>ref|XP_009776827.1| PREDICTED: uncharacterized protein LOC104226516, partial [Nicotiana 
sylvestris]
Length=421

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 93/156 (60%), Gaps = 12/156 (8%)
 Frame = +1

Query  7    YTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFHEA  186
            +TLKD AK W   L  GS+RTW E+  KF+ K++S  +T + RRKI  F Q E E   +A
Sbjct  38   FTLKDDAKYWLQSLPQGSIRTWEEMTKKFLAKYFSSAETGKFRRKIHNFCQNETETVFKA  97

Query  187  WERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYEML  366
            WERFK ++ +C H G  L +Q+Q F+D LT TS+ I+ NAAGG +        +   +  
Sbjct  98   WERFKEIMRKCQHSGIELWMQLQDFWDGLTPTSRRILSNAAGGPL--------MKCKQWP  149

Query  367  GENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             E +++   RG T G+ +V++N  + V +  +AK++
Sbjct  150  SEIAER---RGST-GVRQVDANTSMHVQLDAMAKEI  181



>ref|XP_008232715.1| PREDICTED: uncharacterized protein LOC103331824 [Prunus mume]
Length=564

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 78/125 (62%), Gaps = 1/125 (1%)
 Frame = +1

Query  58   SLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFHEAWERFKMLLIQCPHHGYP  237
            S+R W EV NKF+ KF+S  KT  LR KI  F Q   E F EAWERF   LIQCPHHG  
Sbjct  54   SIR-WTEVQNKFLVKFFSTQKTDALRDKIMQFSQQADESFSEAWERFNNFLIQCPHHGLL  112

Query  238  LELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYEMLGENSQQKNIRGRTQGMY  417
              + ++ FY +LT +S++ V+N AGGS+  KT  +   L++ L   +Q  + RG+  G+Y
Sbjct  113  TLVLMRIFYKALTVSSKAAVNNYAGGSIKNKTPTKCQTLFDTLAIETQHSDTRGKHAGIY  172

Query  418  EVNSN  432
            E+ S+
Sbjct  173  EIGSS  177



>emb|CAN60094.1| hypothetical protein VITISV_039038 [Vitis vinifera]
Length=335

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 89/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W  +L P S+RTW ++  +F+ KF+   +T  L+RKI+ F   E E F+
Sbjct  160  FPFTLKDKAKIWLNYLRPRSIRTWTDLQAEFLKKFFHTHRTNGLKRKISNFSAKENEKFY  219

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++   + +++   GG    K  EEA+    
Sbjct  220  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSLMKQLLETMCGGDFMSKNPEEAMDFLS  279

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+   ++ + +++
Sbjct  280  YVAEVSRGWDEPNNGEVGXTKSQPNAFNAKAGMYTLNEDIDMKAKVAVMPRRL  332



>ref|XP_010244273.1| PREDICTED: uncharacterized protein LOC104588150 [Nelumbo nucifera]
Length=500

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 90/162 (56%), Gaps = 4/162 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK W  +L   S+ TW +V  +F+ KF+  ++T  ++++I    Q  GE  +
Sbjct  142  FPFSLDDKAKDWLYYLPSSSITTWNDVKRQFLGKFFPASRTANIKKEICGIRQFSGETLY  201

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK L   CP H  P +L IQ FY+ L    +S++D A+GG + +KT  +A  L  
Sbjct  202  EYWERFKQLCASCPEHQIPDQLLIQYFYEGLLSMDRSMIDAASGGVLVDKTLTQAGELIS  261

Query  361  MLGENSQQKNIRGRTQGMY--EVNSNP--DLIVYMSELAKQM  474
             +  NSQQ + R      +  +VN +P    I  ++ L +QM
Sbjct  262  NMAANSQQFSYRFYPPANHANKVNISPLEQQIASLTSLVRQM  303



>ref|XP_010669222.1| PREDICTED: uncharacterized protein LOC104886473, partial [Beta 
vulgaris subsp. vulgaris]
Length=263

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 77/134 (57%), Gaps = 4/134 (3%)
 Frame = +1

Query  34   WFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFHEAWERFKMLLI  213
            W     P S  TWA +   F+ K++   KT + R  IT+F Q +GE  +EAWERF+ L  
Sbjct  2    WLKSNPPNSFTTWATLSQAFLSKYFPPGKTAKFRNNITSFAQYDGESLYEAWERFRDLQR  61

Query  214  QCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALY-EMLGENSQQKN  390
            +CPHHG P  L +QTFY+ L ++ +  +D AAGG++  KT E A  L  EM   N    N
Sbjct  62   KCPHHGVPDWLLVQTFYNGLNESVRITLDAAAGGAIMGKTIEVANRLLEEMASNNYHWSN  121

Query  391  IRGRTQ---GMYEV  423
             RG+ +   GMYEV
Sbjct  122  NRGKPKNAAGMYEV  135



>ref|XP_011081478.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105164525 
[Sesamum indicum]
Length=1610

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK W   L  GS+ +W E+   F++ ++  ++T  +R++I+   Q  GE F+
Sbjct  215  FPFSLGDKAKDWLYSLPSGSIVSWNELKKLFLENYFPASRTTNIRKEISGIRQFSGESFY  274

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E W RFK L+  CPHH  P  L IQ FY+ L++ ++S+VD A+GG++ +KT  EA  L  
Sbjct  275  EYWGRFKQLVESCPHHQIPDHLLIQYFYEGLSEANRSLVDAASGGALYDKTPTEARKLIT  334

Query  361  MLGENSQQ  384
             +  N+QQ
Sbjct  335  TMAANNQQ  342



>ref|XP_011101065.1| PREDICTED: uncharacterized protein LOC105179165 [Sesamum indicum]
Length=1460

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK W   L  GS+ +W E+   F++ ++  ++T  +R++I+   Q  GE F+
Sbjct  141  FPFSLGDKAKDWLYSLPSGSIVSWNELKKLFLENYFPASRTTNIRKEISGIRQFSGESFY  200

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E W RFK L+  CPHH  P  L IQ FY+ L++ ++S+VD A+GG++ +KT  EA  L  
Sbjct  201  EYWGRFKQLVESCPHHQIPDHLLIQYFYEGLSEANRSLVDAASGGALYDKTPTEARKLIT  260

Query  361  MLGENSQQ  384
             +  N+QQ
Sbjct  261  TMAANNQQ  268



>ref|XP_010246704.1| PREDICTED: uncharacterized protein LOC104589923 [Nelumbo nucifera]
Length=286

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 77/132 (58%), Gaps = 0/132 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L + AK W  +L  GS+ TW ++  +F++KF+  ++   ++++I    Q  GE  +
Sbjct  16   FPFSLANKAKDWLYYLPSGSITTWNDMKRQFLEKFFPASRAANIKKEICGIRQFNGETLY  75

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK L   CP H  P +L IQ FY  L    +S++D A+GG +  KT  +A  L  
Sbjct  76   EYWERFKQLCASCPQHQIPDQLFIQYFYKGLLPLDRSMIDAASGGVLVNKTPTQARELIS  135

Query  361  MLGENSQQKNIR  396
             +  N+QQ +IR
Sbjct  136  NMATNAQQFDIR  147



>ref|XP_008354481.1| PREDICTED: uncharacterized protein LOC103418110 [Malus domestica]
Length=794

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 86/143 (60%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++LKD AK     L   S+ TW  +   F++KF+  +K + L+++I  F Q   E FH
Sbjct  28   FXFSLKDKAKAXLHSLPANSITTWXXLQEXFLNKFFPSSKXLALKKEILAFAQKPNESFH  87

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWER+  +  +CPH G+   LQ+  FYD L  T++S V+ +AG S+  K+A EA  L++
Sbjct  88   EAWERYNEMYTKCPHAGFDSNLQMNIFYDGLNATTKSHVNASAGXSLMSKSAREAFELFD  147

Query  361  MLGENSQQ-KNIRGRTQGMYEVN  426
            M+   SQQ    + + +G++E++
Sbjct  148  MMASESQQWTEEQTQKRGVFEIS  170



>ref|XP_010270239.1| PREDICTED: uncharacterized protein LOC104606632 [Nelumbo nucifera]
Length=711

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 76/128 (59%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LKD+AK W  +L  GS+ TW E+   F++K++  ++   +R++  +  Q  GE  H
Sbjct  145  FPFSLKDSAKDWLYYLPSGSVTTWNEMKRLFLEKYFPVSRAANIRKEFCSVRQYNGESLH  204

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WE FK L   CPHH    +L IQ FY+ L  T +S++D  +GG + +KT E A  L  
Sbjct  205  EFWECFKKLYATCPHHQISEQLLIQYFYEGLQPTDRSLIDAISGGVLVDKTPEAARNLIT  264

Query  361  MLGENSQQ  384
             +  NSQQ
Sbjct  265  NMAANSQQ  272



>ref|XP_006493879.1| PREDICTED: uncharacterized protein LOC102616274 [Citrus sinensis]
Length=1170

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 78/132 (59%), Gaps = 0/132 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D+AK W  +L  G++ TW E+   F++K++  +K   +R++I    Q  GEP +
Sbjct  58   FPFSLADSAKEWLYYLPSGTVTTWNEMRQLFLEKYFPASKAGSIRKEICGIRQYNGEPLY  117

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            + WERFK L   CPHH    +  IQ FY+ L    +S++D A+GG+  +KT E A  L  
Sbjct  118  DYWERFKKLCAGCPHHQISDQFLIQYFYEGLLPMDKSMIDAASGGAHVDKTPEAARNLIA  177

Query  361  MLGENSQQKNIR  396
             +  NSQQ N R
Sbjct  178  NMAVNSQQFNTR  189



>ref|XP_006584323.1| PREDICTED: uncharacterized protein LOC102667491, partial [Glycine 
max]
Length=538

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 88/147 (60%), Gaps = 3/147 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+  AK W  +L P S+ +W ++   F++K +  ++T  +++ I+   Q  GE  +
Sbjct  47   FPHSLEGVAKDWLYYLAPRSITSWDDLNRVFLEKVFPASRTTTIKKDISGIRQFSGESLY  106

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK L    PHH    +L +Q FY+ L+   +S++D A+GG++G+ T  EA+ L +
Sbjct  107  EYWERFKKLCASFPHHQISEQLLLQYFYEGLSNMERSMIDAASGGALGDMTPAEAINLID  166

Query  361  MLGENSQQ---KNIRGRTQGMYEVNSN  432
             +  NSQ+   KN     +G++EV +N
Sbjct  167  KMASNSQEFSAKNDAIVIRGVHEVATN  193



>ref|XP_010248059.1| PREDICTED: uncharacterized protein LOC104590989 [Nelumbo nucifera]
Length=549

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 91/167 (54%), Gaps = 8/167 (5%)
 Frame = +1

Query  1    FPYTLKDAAKT----WFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEG  168
            F ++LKD+AK     WF FL  GS+ TW E+   F++K++  ++   +R++I    Q  G
Sbjct  83   FSFSLKDSAKDSTKDWFYFLPSGSITTWNEMKRLFLEKYFPTSRAAIIRKEICGIRQYNG  142

Query  169  EPFHEAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEAL  348
            E  HE WE FK L   CPHH    +L IQ FY+ L  T +S+VD ++GG++ +KT E A 
Sbjct  143  ESLHEYWECFKKLCASCPHHQISEQLLIQYFYEGLQPTDRSMVDASSGGALVDKTPEAAR  202

Query  349  ALYEMLGENSQQKNIRGRTQGMY--EVN--SNPDLIVYMSELAKQMT  477
             L   +  NSQQ   R      +  EVN  S    I  ++ L +QM 
Sbjct  203  NLIANMAANSQQFGYRLNPPSKHANEVNISSLEQQIASLTSLVRQMA  249



>ref|XP_010279321.1| PREDICTED: uncharacterized protein LOC104613275 [Nelumbo nucifera]
Length=421

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 88/163 (54%), Gaps = 4/163 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK W  +L  GS+ TW ++  KF++ F+  ++   ++++I   +Q  GE  +
Sbjct  142  FPFSLADKAKDWLYYLPSGSITTWNDMKRKFLEMFFPASRAANIKKEICGIIQFSGETLY  201

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK L   C  H  P +L IQ FY+ L    +S++D A+GG + +KT  +A  L  
Sbjct  202  EYWERFKQLCASCLQHQIPEQLLIQYFYEGLLSMDRSMIDAASGGVLVDKTPTQARELIL  261

Query  361  MLGENSQQKNIRGRTQGMY----EVNSNPDLIVYMSELAKQMT  477
             +  NSQQ   R      +     ++S    I  ++ L +QMT
Sbjct  262  NMAANSQQFGYRLNPPANHANKENISSLEQQIASLTSLVRQMT  304



>ref|XP_011102224.1| PREDICTED: uncharacterized protein LOC105180247, partial [Sesamum 
indicum]
Length=949

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L   AK W   L  GS+ +W E+   F++ ++  ++T  +R++I+   Q  GE F+
Sbjct  341  FPFSLGGKAKDWLYSLPSGSIVSWNELKKLFLENYFPASRTTNIRKEISGIRQFSGESFY  400

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E W RFK L+  CPHH  P  L IQ FY+ L++ ++S+VD A+GG++ +KT  EA  L  
Sbjct  401  EYWGRFKQLVESCPHHQIPDHLLIQYFYEGLSEANRSLVDAASGGALYDKTPTEARKLIT  460

Query  361  MLGENSQQ  384
             +  N+QQ
Sbjct  461  TMAANNQQ  468



>ref|XP_010462887.1| PREDICTED: uncharacterized protein LOC104743516 [Camelina sativa]
Length=409

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 69/122 (57%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++L D A  W   L PG L TWA+    F++ FY+ +++ +LR KITTF Q   E F 
Sbjct  155  FQFSLADKALRWLNLLYPGLLTTWAQCRAGFLNHFYTKSRSTKLRSKITTFSQGGMETFC  214

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK  L  CPHHGY  E  +  FY  + Q  Q  +D A+ G     TA EA AL E
Sbjct  215  EAWERFKKYLRDCPHHGYTQENLMNVFYGGIEQKYQMALDTASKGDFSTNTANEANALIE  274

Query  361  ML  366
             L
Sbjct  275  NL  276



>emb|CAN75576.1| hypothetical protein VITISV_022177 [Vitis vinifera]
Length=458

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 89/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F+ KF+   +T +L+R+I+ F   E E F+
Sbjct  194  FPFTLKDKAKIWLNSLRPRSIRTWTDLQAEFLKKFFPTHRTNDLKRQISNFSAKENEKFY  253

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  254  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  313

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      G+Y +N + D+    + + +++
Sbjct  314  YVAEVSRGWDEPNKGEVGKMKSQPNAFNAKAGVYTLNEDVDMKAKFAAMTRRL  366



>emb|CAN81882.1| hypothetical protein VITISV_017921 [Vitis vinifera]
Length=322

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 92/170 (54%), Gaps = 12/170 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK WF  L P S+R+W E+   F+ K +    T  L+R+IT F+ ++ E F+
Sbjct  35   FPFTLKDKAKLWFKSLRPQSIRSWLELQTTFLKKIFPIHHTSGLKRQITNFVALDNENFY  94

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
              WER+  ++  CPHHG+   + +  FY+ ++ T + +++   GG    K+ +EA     
Sbjct  95   ACWERYMEVVNACPHHGFDTWMLVSYFYEGMSPTIKQLLETMCGGDFMSKSPDEAFEFLN  154

Query  361  MLGENSQ------QKNIR------GRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+      ++++          +GMY +N + DL V M  L K++
Sbjct  155  YVAEISRSWDEPHERDLHKSKSQSNSKKGMYMLNEDVDLQVKMIALTKRL  204



>emb|CAN71101.1| hypothetical protein VITISV_007818 [Vitis vinifera]
Length=1068

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 89/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W  +L P S+R+W ++  +F+ KF+   +T +L+R+I+ F   E E F+
Sbjct  73   FPFTLKDKAKVWLNYLRPRSIRSWTDLQAEFLKKFFPTHRTNDLKRQISNFSAKENEKFY  132

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  133  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  192

Query  361  M---------------LGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
                            +G  + Q N      GMY +N + D     + +A+++
Sbjct  193  YVAKFSRGWDEPNAREVGRMNSQPNASNAKAGMYTLNEDTDTKAKFATMARRL  245



>ref|XP_008372202.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103435593 
[Malus domestica]
Length=2003

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 87/138 (63%), Gaps = 4/138 (3%)
 Frame = +1

Query  31   TWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFHEAWERFKMLL  210
            T+F  L          + N+ +++  S +K  EL+R+I  F + +G+ F EAW+ FK  L
Sbjct  724  TYFFDLCGTINSIMGAIGNQVLERVLSCSKDQELKREIEFFQRKDGDLFFEAWKDFKHKL  783

Query  211  IQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYEMLGENSQQKN  390
            ++CP H  P + Q+Q FY+ L  T+++IVD+A  G + EK  EEA+ ++E L ENSQQ +
Sbjct  784  LKCPTHNMPKDDQVQAFYEGLNDTNKAIVDSACNGILMEKNGEEAIEMFEELSENSQQFS  843

Query  391  IRGRT----QGMYEVNSN  432
            +RGR+    QG+YEVN+N
Sbjct  844  MRGRSTKRRQGVYEVNTN  861



>emb|CAN75002.1| hypothetical protein VITISV_014928 [Vitis vinifera]
Length=590

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 87/173 (50%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  KFI KF+   +T  L+R+I+ F   E E F+
Sbjct  151  FPFTLKDKAKIWLNSLRPRSIRTWTDLQAKFIKKFFPTHRTNGLKRQISNFSAKENEKFY  210

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + +  ++   GG    K  EEA+    
Sbjct  211  ECWERYIESINACPHHGFDTWLLVSYFYDGMSSSMKQFLETMCGGDFMSKNPEEAMDFLS  270

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+    + + +++
Sbjct  271  YVAEVSRGWDEPNKGEVGKMKSQPNAFNAKAGMYTLNEDVDMKAKFAAMTRRL  323



>emb|CAN69402.1| hypothetical protein VITISV_023832 [Vitis vinifera]
Length=329

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 86/159 (54%), Gaps = 1/159 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  KF+ KF+   +   L+R+I+ F   E E F 
Sbjct  96   FPFTLKDKAKIWLNSLRPRSIRTWTDLQAKFLKKFFPTHRKNGLKRQISNFSAKENEKFC  155

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    +  +EA+    
Sbjct  156  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSRNPDEAIDFLS  215

Query  361  MLGENSQQ-KNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+    +     GMY +N + D+   ++ + +++
Sbjct  216  YVAEVSRGWDELNKGEAGMYTLNEDIDMKAKVAAMTRRL  254



>ref|XP_008245619.1| PREDICTED: uncharacterized protein LOC103343761 [Prunus mume]
Length=496

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 97/164 (59%), Gaps = 7/164 (4%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L++ AK W   L   S+ TW  + +KF+ KF+   +T  +R++I    Q++GE FH
Sbjct  88   FPFSLQERAKEWLYSLPSASITTWTALASKFLAKFFPAQQTNHIRKEIMGVQQLDGESFH  147

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E  +RF+ LL  CPHH     L +Q FY+ L  + + +VD  +GG +  K+A +A  ++E
Sbjct  148  EYSDRFQRLLASCPHHQIEDWLLMQYFYEGLLDSERMMVDATSGGGLMNKSATQAKEMFE  207

Query  361  MLGENSQQKNIR---GRTQGMYEVNSNPDL---IVYMSELAKQM  474
             +  NSQQ N +    +  G+YEV+++ D+   I  ++ L KQ+
Sbjct  208  NIAANSQQFNYQRAPPKKAGVYEVSAS-DIGPQIANLTNLVKQL  250



>emb|CAN68415.1| hypothetical protein VITISV_016893 [Vitis vinifera]
Length=375

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 90/173 (52%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F+ KF+   +T  L+RKI+ F   E E F+
Sbjct  159  FPFTLKDKAKIWLNSLRPRSIRTWTDLQAEFLKKFFPTHRTNGLKRKISNFSAKENEKFY  218

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  219  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  278

Query  361  MLGENSQ-----QKNIRGRTQ----------GMYEVNSNPDLIVYMSELAKQM  474
             + E S+      K   G+ +          GMY +  + D+    + +A+++
Sbjct  279  YVAEVSRGWDEPNKGEVGKMKSQLSAFNAKAGMYTLKEDDDMKAKFAAMARRL  331



>ref|XP_010670276.1| PREDICTED: uncharacterized protein LOC104887359 [Beta vulgaris 
subsp. vulgaris]
Length=478

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 80/146 (55%), Gaps = 3/146 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D AK W      G+  TW ++   F+ KF    KT +LR ++ TF Q + E  +
Sbjct  125  FPFSLRDRAKEWLRDEGVGTFDTWGKLAKAFLVKFLGQEKTAKLRNELATFEQHDDESLY  184

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAW RF  L  QCPHHG P  + IQTFY+ LT   +  +D A GGS+  K   EA  L E
Sbjct  185  EAWRRFLRLQRQCPHHGIPEWMLIQTFYNGLTHEFRIYIDAALGGSLMTKNPTEAKELIE  244

Query  361  MLGENSQ-QKNIRGRTQ--GMYEVNS  429
             +  N     N R R +  G Y+V++
Sbjct  245  KMAANDNYHPNGRNRAKNGGKYDVDA  270



>emb|CAN63956.1| hypothetical protein VITISV_034256 [Vitis vinifera]
Length=233

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 90/172 (52%), Gaps = 14/172 (8%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ K +   +T  L+R+I+ F   E E FH
Sbjct  35   FPFTLKDKAKIWLNSLRPKSIRNWVDLQAEFLKKIFPTHRTNGLKRQISNFSAKENEKFH  94

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   + +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  95   ECWERYMEAINACPHHGFDTWILVSYFYDGMSFSMKQILETMCGGDFMSKNPEEAMDFLS  154

Query  361  MLGE--------NSQQKN------IRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E        NS++K        +    GMY ++ + D+   ++ +A+++
Sbjct  155  YVSEVSRGWDEPNSREKGKFPSQPTQNSKAGMYMLSEDMDMKAKVAIMARRL  206



>ref|XP_011082210.1| PREDICTED: uncharacterized protein LOC105165031 [Sesamum indicum]
Length=388

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 76/132 (58%), Gaps = 0/132 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D  K W  FL  GS+  W ++  +F++K++  ++   +R++I+   Q  GE   
Sbjct  83   FPFSLADQVKDWLYFLPSGSITRWNDLKRQFLEKYFPDSRATTIRKEISGIRQFAGESLF  142

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E W RF  L+  CPHH  P  L IQ FY+ L    + ++D A+GG++  KT  EA +L  
Sbjct  143  EYWGRFNQLVESCPHHQIPDHLLIQYFYEGLLSMDRKLIDAASGGALFNKTLTEARSLIS  202

Query  361  MLGENSQQKNIR  396
            ++  N+QQ  +R
Sbjct  203  IMTSNTQQFGVR  214



>gb|EPS65810.1| hypothetical protein M569_08967, partial [Genlisea aurea]
Length=366

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 2/143 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK WF  L  GS+ +W  +   F+++++  T+    R+++ +  Q  GE  H
Sbjct  68   FPFSLMDGAKDWFFSLESGSIDSWLAMKRAFLERYFPATQVGYARKELCSIRQQTGETLH  127

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK  L  CP+H  P  L +Q FY  L    + ++D + GG    KT EEA  L  
Sbjct  128  EYWERFKRQLASCPNHQLPPLLLMQFFYQGLFDMERMMIDASCGGCFLNKTPEEAKDLVT  187

Query  361  MLGENSQQKNIRGRTQGMYEVNS  429
            M+  N+QQ  +R R  G+  VN+
Sbjct  188  MVANNAQQYGLRDR--GVKVVNA  208



>emb|CAN60671.1| hypothetical protein VITISV_010298 [Vitis vinifera]
Length=196

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTWA++  + + KF+   KT  L+R+I+ F   E E F+
Sbjct  69   FPFTLKDKAKIWLNSLRPRSIRTWADLQAELLKKFFPTHKTNGLKRQISNFSAKENEKFY  128

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  129  ECWERYMEAINACPHHGFDTWLLVSFFYDGMSSSMKQLLETMCGGDFMSKNLEEAMDFLS  188

Query  361  MLGENSQ  381
             + E S+
Sbjct  189  YVAEVSR  195



>ref|XP_010677759.1| PREDICTED: uncharacterized protein LOC104893361 [Beta vulgaris 
subsp. vulgaris]
Length=621

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 81/146 (55%), Gaps = 3/146 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D AK W      G+  TW ++   F+ KF    KT +LR ++ TF Q + E  +
Sbjct  125  FPFSLRDRAKEWLRDEGVGTFDTWGKLAKAFLVKFLGQEKTAKLRNELATFEQHDDESLY  184

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAW RF  L  QCPHHG P  + IQTFY+ LT   +  +D A+GGS+  K   EA  L E
Sbjct  185  EAWRRFLRLQRQCPHHGIPEWMLIQTFYNGLTHEFRIYIDAASGGSLMTKNPTEAKELIE  244

Query  361  MLGENSQ-QKNIRGRTQ--GMYEVNS  429
             +  N     N R R +  G Y+V++
Sbjct  245  KMAANDNYHPNGRNRAKKGGKYDVDA  270



>ref|XP_008222399.1| PREDICTED: uncharacterized protein LOC103322270 [Prunus mume]
Length=426

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 90/142 (63%), Gaps = 2/142 (1%)
 Frame = +1

Query  55   GSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFHEAWERFKMLLIQCPHHGY  234
             S+  W +++ KF++K+Y  +KT+  +R+I TF+Q   E FH AWER+  + I+CPH   
Sbjct  36   NSITAWQQLHTKFLNKYYPASKTLNYKREILTFIQKPNEEFHAAWERYTEMYIKCPHVKI  95

Query  235  PLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYEMLGENSQQKNIR-GRTQG  411
              + Q+  F+D L  TS+S V+ +AGGS+  K+A EA  L++M+   SQQ      + +G
Sbjct  96   DSDTQMNIFFDRLNPTSKSHVNASAGGSLSNKSAREAFELFDMMATESQQWVAEPSQKRG  155

Query  412  MYEVNSN-PDLIVYMSELAKQM  474
            ++E++++ P++   M ++ K++
Sbjct  156  IFELSASFPNMSAQMEKMVKKI  177



>ref|XP_010689626.1| PREDICTED: uncharacterized protein LOC104903310 [Beta vulgaris 
subsp. vulgaris]
Length=351

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 90/163 (55%), Gaps = 5/163 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D AK WF       + TW E+   F+ KF+   +T + R +I+ F Q E E  +
Sbjct  122  FPFSLRDEAKEWFKEEEVRKIATWPELKKAFLYKFFPPMRTSKFRNEISGFQQHELESLY  181

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAW+R+K L  QCPHHG P  L IQTFY+ L    +S +D A+GG+   KT E A  L +
Sbjct  182  EAWQRYKALQRQCPHHGIPEWLLIQTFYNGLKHEVRSSIDAASGGTFMAKTPEAAKTLLD  241

Query  361  MLGENSQQKN---IRG--RTQGMYEVNSNPDLIVYMSELAKQM  474
             +  N+   +    RG  +  G YEV++   L   +  LA ++
Sbjct  242  DMAANNYLNDWSISRGAPKKGGKYEVDAIATLTNTVQVLAAKV  284



>ref|XP_006575943.1| PREDICTED: uncharacterized protein LOC102663625, partial [Glycine 
max]
Length=539

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 85/147 (58%), Gaps = 3/147 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+  AK W  +L P S+ +W ++    ++  +  ++T  +R+ I+   Q+ GE  +
Sbjct  47   FPHSLEGVAKDWLYYLAPRSITSWDDLKRVLLENIFPASRTTTIRKDISGIRQLSGESLY  106

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E W R K+L   CPHH    ++ +Q FY+ L+   +S++D A+GG++G+ T  EA  L E
Sbjct  107  EYWGRLKILYASCPHHQISEQMLLQYFYEGLSNMERSMIDAASGGALGDMTPAEAKNLIE  166

Query  361  MLGENSQQ---KNIRGRTQGMYEVNSN  432
             +  NSQQ    N     +G++E+ +N
Sbjct  167  KMASNSQQFSASNDAIVIRGVHEIATN  193



>emb|CAN66304.1| hypothetical protein VITISV_036682 [Vitis vinifera]
Length=655

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 91/170 (54%), Gaps = 12/170 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW E+   F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  166  FPFTLKDKAKIWLNSLRPRSIRTWTELQADFLKKFFPTHRTNGLKRQISNFSARENEKFY  225

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  226  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDFLS  285

Query  361  MLGE--------NSQQKNIRGRTQ----GMYEVNSNPDLIVYMSELAKQM  474
             + E        NS++   R   Q    GMY ++ + ++   ++ +A+++
Sbjct  286  YVSEVSRGWDEPNSREMGKRPVQQMSRGGMYSLSEDMEMKAKVAAMARKI  335



>emb|CAN82293.1| hypothetical protein VITISV_021853 [Vitis vinifera]
Length=2140

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 91/172 (53%), Gaps = 14/172 (8%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ K +   +T  L+R+I+ F   E E FH
Sbjct  157  FPFTLKDKAKIWLNCLRPRSIRNWVDLQAEFLKKIFPTHRTNGLKRQISNFSAKENEKFH  216

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+ L  
Sbjct  217  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDLLS  276

Query  361  MLGE--------NSQQK------NIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E        NS++K        +    GMY ++ + D+   ++ LA+++
Sbjct  277  YVAEVSRGWDEPNSREKGKFPSQQTQNPKAGMYMLSEDVDMKAKVATLARRL  328



>emb|CAN65344.1| hypothetical protein VITISV_009876 [Vitis vinifera]
Length=669

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 91/170 (54%), Gaps = 12/170 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW E+   F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  180  FPFTLKDKAKIWLNSLRPRSIRTWTELQADFLKKFFPTHRTNGLKRQISNFSARENEKFY  239

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  240  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDFLS  299

Query  361  MLGE--------NSQQKNIRGRTQ----GMYEVNSNPDLIVYMSELAKQM  474
             + E        NS++   R   Q    GMY ++ + ++   ++ +A+++
Sbjct  300  YVSEVSRGWDEPNSREMGKRPVQQMSRGGMYSLSEDMEMKAKVAAMARKI  349



>ref|XP_008238736.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103337359 
[Prunus mume]
Length=1658

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 73/134 (54%), Gaps = 19/134 (14%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD AK W   L PGSL TW  +  KF++K++S  KT  LR KI  F Q + E F 
Sbjct  81   FPYTLKDKAKYWLNSLKPGSLTTWGAIQKKFLEKYFSTQKTDMLRDKILLFAQQDDESFC  140

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF  LL QC HHG PL+LQ++                   GS   KT EE   L+E
Sbjct  141  EAWERFNGLLNQCLHHGIPLKLQMR-------------------GSYKTKTPEETYELFE  181

Query  361  MLGENSQQKNIRGR  402
             +   +Q  + RG+
Sbjct  182  EIAMETQHTDTRGK  195



>gb|EPS63230.1| hypothetical protein M569_11557 [Genlisea aurea]
Length=607

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 80/144 (56%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK WF  L  GS+ TW ++   F++K++   K + +R+ I +  Q   E  +
Sbjct  14   FPFSLMDGAKNWFYSLDNGSIHTWKDMRQAFLEKYFPPNKVIHVRKDIFSMRQQYDETLY  73

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+K LL  CP H    +  I  FY+ LT   +  +D AAGG++  KTA+EA  +  
Sbjct  74   EYWERYKKLLASCPKHQLGKKSIILYFYEGLTDEERRSLDAAAGGNLKRKTADEAREIIT  133

Query  361  MLGENSQQKNIRGRTQGMYEVNSN  432
            M+  NS   N R  T+G++    N
Sbjct  134  MMANNSHIYNSRTNTRGVHAATEN  157



>emb|CAN65919.1| hypothetical protein VITISV_000285 [Vitis vinifera]
Length=1104

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 85/158 (54%), Gaps = 11/158 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ KF+   +T  L+R+I+ F   E E FH
Sbjct  157  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKFFPTHRTNGLKRQISNFSGKENEKFH  216

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  217  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDXXSKNPEEAMDFLS  276

Query  361  MLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E            GMY ++ + D+   ++ +A+++
Sbjct  277  YVSEG-----------GMYVLSEDMDMKAKVATIARRL  303



>emb|CAN82424.1| hypothetical protein VITISV_026746 [Vitis vinifera]
Length=1754

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 93/170 (55%), Gaps = 12/170 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ KF+   +T  L+R+I+ F   E E FH
Sbjct  316  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKFFPTHRTNALKRQISNFSAKENEKFH  375

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L ++ FYD ++ +   I++   GG    K  EEA+    
Sbjct  376  ECWERYMEAINACPHHGFDTWLLVRYFYDGMSSSMTQILETMCGGDFMSKNPEEAMDFLS  435

Query  361  MLGENSQ---QKNIR--GRTQ-------GMYEVNSNPDLIVYMSELAKQM  474
             + E ++   + N R  GR +       GMY ++ + D+   ++ +A+++
Sbjct  436  YVSEVTRGWDEPNSREMGRMKAPVNPKGGMYMLSEDMDMKAKVATIARRL  485



>emb|CAN75875.1| hypothetical protein VITISV_019783 [Vitis vinifera]
Length=1453

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 94/170 (55%), Gaps = 12/170 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W  +L P S+R W ++  +F+ KF+   +T  L+R+I+ F   E E FH
Sbjct  138  FPFTLKDKAKIWLNYLRPRSIRNWVDLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFH  197

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  198  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDFLS  257

Query  361  MLGENSQ---QKNIR--GRTQ-------GMYEVNSNPDLIVYMSELAKQM  474
             + E ++   + N +  GR +       GMY ++ + D+   ++ +A+++
Sbjct  258  YVSEVTRGWDEPNSKELGRMKAPVNPKGGMYMLSEDMDMKAKVATIARRL  307



>ref|XP_008245898.1| PREDICTED: uncharacterized protein LOC103344048 [Prunus mume]
Length=1091

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 72/134 (54%), Gaps = 19/134 (14%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FPYTLKD AK W   L P SL TW  +  KF++K++S  KT  LR KI  F Q + E F 
Sbjct  164  FPYTLKDKAKYWLNSLKPSSLTTWGAIQKKFLEKYFSTQKTDMLRDKILLFAQQDDESFC  223

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERF  LL QCPHHG P +LQ++                   GS   KT EE   L+E
Sbjct  224  EAWERFNGLLNQCPHHGIPWKLQMR-------------------GSYKTKTPEETYELFE  264

Query  361  MLGENSQQKNIRGR  402
             +   +Q  + RG+
Sbjct  265  EIAMETQHTDTRGK  278



>emb|CAN79587.1| hypothetical protein VITISV_009564 [Vitis vinifera]
Length=2225

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW E+   F+ KF+   +T  L+R+I+ FL  E E F+
Sbjct  546  FPFTLKDKAKVWLNSLRPRSIRTWTELQADFLKKFFPTHRTNGLKRQISNFLARENEKFY  605

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  606  ECWERYMEAINACPHHGFDTWLLVSYFYDDMSSSMKQILETMCGGDFMSKNPEEAMDFLS  665

Query  361  MLGENSQ  381
             + E S 
Sbjct  666  YVSEVSH  672



>emb|CAN77795.1| hypothetical protein VITISV_040891 [Vitis vinifera]
Length=1736

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 83/161 (52%), Gaps = 15/161 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++ ++F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  256  FPFTLKDKAKIWLNSLRPRSIRTWTDLQSEFLKKFFPTHRTNSLKRQISNFSAKENEKFY  315

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD L+ + + +++   GG    K  EEA+    
Sbjct  316  ECWERYMEAINACPHHGFDTWLLVSYFYDGLSSSMKQLLETMCGGDFVSKNPEEAMDFLS  375

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPD  438
             + E S+               Q N      GMY +N + D
Sbjct  376  YVAEVSRGWDEPHRGEVGKMKSQPNALHAKAGMYTLNEDVD  416



>emb|CAN72758.1| hypothetical protein VITISV_012803 [Vitis vinifera]
Length=340

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 90/173 (52%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R+W ++  +F++KF+   +T  L+R+I+ F   E E F+
Sbjct  73   FPFTLKDKAKIWLNSLRPRSIRSWTDLQVEFLNKFFPTHRTNGLKRQISNFSAKENEKFY  132

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+  + 
Sbjct  133  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSFSMKQLLETMCGGDFMSKNPEEAMDFFS  192

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + + S+               Q N      GMY +  + D+   ++ + +++
Sbjct  193  YVADVSRGLDEPTKGEVGKMKSQLNAYNAKAGMYTLKEDDDMKAKLAAMTRRL  245



>ref|XP_010665755.1| PREDICTED: uncharacterized protein LOC104883015 [Beta vulgaris 
subsp. vulgaris]
Length=935

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 81/146 (55%), Gaps = 3/146 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D AK W      G+  TW ++   F+ KF    KT +LR ++ TF Q + E  +
Sbjct  125  FPFSLRDRAKEWLRDEGVGTFDTWGKLAKAFLVKFLGQEKTAKLRNELATFEQHDDESLY  184

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAW RF  L  QCPHHG P  + IQTFY+ LT   +  +D A+GGS+  K   EA  L E
Sbjct  185  EAWRRFLRLQRQCPHHGIPEWMLIQTFYNGLTHEFRIYIDAASGGSLMTKNPTEAKELIE  244

Query  361  MLGENSQ-QKNIRGRTQ--GMYEVNS  429
             +  N     N R R +  G Y+V++
Sbjct  245  KMAANDNYHPNGRNRAKKGGKYDVDA  270



>ref|XP_010244533.1| PREDICTED: uncharacterized protein LOC104588349 [Nelumbo nucifera]
Length=678

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 75/125 (60%), Gaps = 0/125 (0%)
 Frame = +1

Query  7    YTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFHEA  186
            ++LKD+AK  F +L  GS+ TW E+   F++K++  ++   +R++I    Q  GE  HE 
Sbjct  15   FSLKDSAKDCFYYLPSGSVITWNEMNRLFLEKYFPASRADNIRKEICGIKQYNGESLHEY  74

Query  187  WERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYEML  366
            WERFK L   CPHH    +L IQ FY+ L  T +S++D A+GG++ +KT E    L   +
Sbjct  75   WERFKKLCASCPHHQISEQLLIQYFYEGLQPTDKSMIDAASGGALVDKTPEAVRNLIANM  134

Query  367  GENSQ  381
              NSQ
Sbjct  135  AANSQ  139



>ref|XP_010513615.1| PREDICTED: uncharacterized protein LOC104789646 [Camelina sativa]
Length=873

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 85/160 (53%), Gaps = 3/160 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++L D A  W   L  GSL TWA+    F++ FY+ +++ +LR KITTF Q   E F 
Sbjct  430  FQFSLADKALRWLNLLDAGSLTTWAQCRAAFLNHFYTKSRSAKLRSKITTFSQGGMESFC  489

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK  L  CPHHGY  E  +  FY  + Q  Q  +D A+ G     TA EA AL E
Sbjct  490  EAWERFKEYLRDCPHHGYTQENLMNIFYGGIEQKYQMALDTASKGDFSTNTANEANALIE  549

Query  361  ML-GENSQQKNIRGRTQGMYEVNSNP--DLIVYMSELAKQ  471
             L   NS       RT  +  V+++   DL   ++ L K+
Sbjct  550  NLAASNSNHGTDYDRTVRVNSVDTDAIKDLTAKVNLLLKR  589



>emb|CAN70730.1| hypothetical protein VITISV_010386 [Vitis vinifera]
Length=940

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 93/175 (53%), Gaps = 20/175 (11%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ KF+   +T  L+R+I+ F   E E FH
Sbjct  167  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFH  226

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  227  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDFLS  286

Query  361  MLGE--------NSQQK---------NIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E        NS++K         N +G   GMY ++ + D+   ++ +A+++
Sbjct  287  YVSEVSRGWDEPNSREKGKFPSQPTQNPKG---GMYVLSEDMDMKAKVATIARRL  338



>emb|CAN77444.1| hypothetical protein VITISV_022435 [Vitis vinifera]
Length=364

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 88/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R+W ++  KF+ KF+   +T  L+R+I+ F   E E F+
Sbjct  125  FPFTLKDKAKIWLNSLRPRSIRSWTDLQAKFLKKFFPTHRTNGLKRQISNFSAKENEKFY  184

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  185  ECWERYMEAINACPHHGFDSWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFVS  244

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + + S+               Q N      GMY +  + D+   ++ + +++
Sbjct  245  YVADVSRGWDEPTKGEVGKMKSQLNPFNAKAGMYTLKEDDDMKAKLAAMTRRL  297



>emb|CAN74811.1| hypothetical protein VITISV_015188 [Vitis vinifera]
Length=857

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 88/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F  KF+   +T  L+RKI+ FL  E E F+
Sbjct  146  FPFTLKDKAKIWLNSLRPRSIRTWIDLQAEFPKKFFPTHRTNGLKRKISNFLAKENEKFY  205

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  206  ECWERYMEAINACPHHGFDTWLLVSYFYDGISSSMKQLLETMCGGDFMSKNPEEAMDFLS  265

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q +      GMY +N + D+    + + +++
Sbjct  266  YVAEVSRGWDEPNKGEVGKMKSQPSAFNAKAGMYTLNEDDDMKAKFTAMTRRL  318



>emb|CAN65622.1| hypothetical protein VITISV_020763 [Vitis vinifera]
Length=731

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 73/124 (59%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F+ KF+   +T  L+R+I+ FL  E E F+
Sbjct  73   FPFTLKDKAKIWLNSLRPRSIRTWTDLQAEFLKKFFPTHRTNGLKRQISNFLAKENEKFY  132

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+  + 
Sbjct  133  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFWS  192

Query  361  MLGE  372
             + E
Sbjct  193  YVAE  196



>emb|CAN70016.1| hypothetical protein VITISV_013424 [Vitis vinifera]
Length=691

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 83/154 (54%), Gaps = 3/154 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ K++   +T  L+R+I+ F   E E FH
Sbjct  195  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKYFPTHRTNGLKRQISNFSAKENEKFH  254

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  255  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGXFMSKNPEEAMDFLS  314

Query  361  MLGENSQ---QKNIRGRTQGMYEVNSNPDLIVYM  453
             + E S+   + N R + +   +   NP   +YM
Sbjct  315  YVAEVSRGWDEPNSREKGKFPSQQTQNPKAGMYM  348



>emb|CAN66401.1| hypothetical protein VITISV_026847 [Vitis vinifera]
Length=2036

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 89/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F+ KF+S  +T  L+R+I+ F   E E F+
Sbjct  483  FPFTLKDKAKIWLNSLRPRSIRTWTDLQVEFLKKFFSTHRTNGLKRQISNFSAKENEKFY  542

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  543  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  602

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+    + + +++
Sbjct  603  YVAEVSRGWDEPHRGEVGKMKSQPNAFHAKAGMYTLNEDVDMKAKFAAMTRRV  655



>ref|XP_010667902.1| PREDICTED: uncharacterized protein LOC104884899 [Beta vulgaris 
subsp. vulgaris]
Length=408

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 81/145 (56%), Gaps = 5/145 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L + AKTW       S  TWA +   F+ +++   KT + R  IT+ +Q +GE  +
Sbjct  87   FPFSL-NKAKTWLKSNRSNSFTTWATLSQAFLKRYFPPGKTTKFRNDITSSVQYDGESLY  145

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK L  +CPHHG    L +QTFY+ L ++ +   + AAGG++  KT E A  L E
Sbjct  146  EAWERFKDLQRKCPHHGVLDLLLVQTFYNGLNESVRITKNAAAGGAIMGKTTEVANRLLE  205

Query  361  MLGEN----SQQKNIRGRTQGMYEV  423
             +  N    S  +N      GMYEV
Sbjct  206  AMASNNYHWSNNRNKPKNNAGMYEV  230



>ref|XP_010673853.1| PREDICTED: uncharacterized protein LOC104890162 [Beta vulgaris 
subsp. vulgaris]
Length=1699

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 82/146 (56%), Gaps = 3/146 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D A+ W      GS  TW ++   F+ +F    KT ELR  I+TF Q E E  +
Sbjct  123  FPFSLRDLAREWLRDEGVGSFDTWDKLARAFLIRFLGPEKTAELRNAISTFKQSEDESLY  182

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
             +W RFK L   CPHHG P  + IQTFY+ LT   +  +D A+GGS+  K   EA AL E
Sbjct  183  HSWRRFKRLQRHCPHHGIPEWMLIQTFYNGLTHEFRIYIDAASGGSLMTKNPTEAKALIE  242

Query  361  MLGEN-SQQKNIRG--RTQGMYEVNS  429
             +  N S     R   +T+G ++V++
Sbjct  243  KMAANDSYHPGGRNSVKTRGKFDVDA  268



>emb|CAN68891.1| hypothetical protein VITISV_019181 [Vitis vinifera]
Length=303

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 87/173 (50%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R+W ++  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  35   FPFTLKDKAKIWLNSLRPRSIRSWTDLQAEFLKKFFPTHRTNSLKRQISNFSTKENEKFY  94

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   G     K  EEA+    
Sbjct  95   ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGRDFMSKNPEEAMDFLS  154

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+    + + +++
Sbjct  155  YVAEVSRGWDEPHRGEVGKMKSQPNALHAKAGMYTLNEDVDMKAKFAAMTRRV  207



>emb|CAN78079.1| hypothetical protein VITISV_020735 [Vitis vinifera]
Length=913

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 92/175 (53%), Gaps = 20/175 (11%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ KF+   +T  L+R+I+ F   E E FH
Sbjct  138  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKFFPTHRTNGLKRQISNFSTKENEKFH  197

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ T + I +   GG    K  EEA+    
Sbjct  198  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSTMKQIHETMCGGDFMSKNPEEAMDFLS  257

Query  361  MLGE--------NSQQK---------NIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E        NS++K         N +G   GMY ++ + D+   ++ +A+++
Sbjct  258  YVSEVSRGWDEPNSREKGKFPSQPTQNPKG---GMYVLSEDMDMKAKVATIARRL  309



>emb|CAN73138.1| hypothetical protein VITISV_024470 [Vitis vinifera]
Length=1151

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 90/162 (56%), Gaps = 7/162 (4%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L   S+RTW ++  +F+ KF+   KT  L+R+I+ F   E E F+
Sbjct  643  FPFTLKDKAKIWLNSLRTRSIRTWTDLQAEFLKKFFPTHKTNGLKRQISNFSAKENEKFY  702

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHH +   L +  FYD ++ + + +++N  GG    K  EEA+   +
Sbjct  703  ECWERYMETINACPHHDFDTWLLVSYFYDGMSSSMKQLLENMCGGDFMSKNQEEAIGWDD  762

Query  361  M----LGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
                 +G    Q N +G   GMY +N + D+   ++ +A+++
Sbjct  763  PNAREVGRMKSQPNAKG---GMYVLNEDIDMKAKVAAMARRL  801



>emb|CAN60440.1| hypothetical protein VITISV_032287 [Vitis vinifera]
Length=893

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 93/170 (55%), Gaps = 12/170 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW E+   F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  581  FPFTLKDKAKIWLNSLRPRSIRTWTELQADFLKKFFPTHRTNGLKRQISNFSARENEKFY  640

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  641  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDFLS  700

Query  361  MLGENSQ-----------QKNIRGRTQ-GMYEVNSNPDLIVYMSELAKQM  474
             + E S+           ++ ++  ++ GMY +N + ++   ++ +A+++
Sbjct  701  YVSEVSRGWDEPTNREMGKRPVQQMSKGGMYNLNEDMEMKAKVAAMARKI  750



>emb|CAN62698.1| hypothetical protein VITISV_002842 [Vitis vinifera]
Length=322

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 88/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R+W ++  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  125  FPFTLKDKAKIWLNSLRPRSIRSWTDLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFY  184

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  185  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  244

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + + S+               Q N      GMY +  + D+   ++ + +++
Sbjct  245  YVADVSRGWDEPTKGEVGKMKSQLNAYNAKAGMYTLKEDDDMKAKLAAMTRRL  297



>emb|CAN80981.1| hypothetical protein VITISV_020253 [Vitis vinifera]
Length=1032

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 91/170 (54%), Gaps = 12/170 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW E+   F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  196  FPFTLKDKAKIWLNSLRPRSIRTWTELQADFLKKFFPTHRTNGLKRQISNFSARENEKFY  255

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  256  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAMBFLS  315

Query  361  MLGE--------NSQQKNIRGRTQ----GMYEVNSNPDLIVYMSELAKQM  474
             + E        NS++   R   Q    GMY ++ + ++   ++ +A+++
Sbjct  316  YVSEVSRGWDEPNSREMGKRPVQQMSRGGMYSLSEDMEMKAKVAAMARKI  365



>ref|XP_008362479.1| PREDICTED: uncharacterized protein LOC103426169 [Malus domestica]
Length=897

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 95/161 (59%), Gaps = 3/161 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L   A+TWF  L   S+ +W ++ +KFI KFY+ ++T  LR  I  F Q +GEP  
Sbjct  135  FPFSLTGDARTWFKTLPARSITSWTQLSSKFIQKFYTQSRTQRLRDHIFHFRQNKGEPLF  194

Query  181  EAWERFKMLLIQCPHHGY-PLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALY  357
            +AW+RFK L+I CPHH + P +L I  FY  L+   +  +D AA G++  K  ++A  + 
Sbjct  195  QAWQRFKALIISCPHHQFLPWQL-ILYFYQHLSDECRHRLDAAADGNILGKEPDQATTII  253

Query  358  EMLGENSQQKNIRGRTQ-GMYEVNSNPDLIVYMSELAKQMT  477
            E +  NS Q + R  T+   YEV+S+ ++ V   +L   +T
Sbjct  254  ENVVANSSQWDSRELTRNSAYEVSSSNEVAVLSRKLDAVVT  294



>emb|CAN80076.1| hypothetical protein VITISV_029997 [Vitis vinifera]
Length=550

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 93/173 (54%), Gaps = 18/173 (10%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F +TLKD AK W   L P S+R+W E+  +F+ KF+   +T  L+R+I+ F+ +E E F+
Sbjct  69   FHFTLKDKAKVWLNSLRPRSIRSWPELQVEFLKKFFPAHRTSGLKRQISNFVAMENEXFY  128

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
              WER+   +  CPHHG+   + +  FY+ ++   + +++   GG    K+ +EAL    
Sbjct  129  ACWERYMETVNACPHHGFDTWMLVSYFYEGMSPAMKQLLETMCGGDFMSKSPDEALDFIN  188

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N +G   GMY +N + D+ V M+ L++++
Sbjct  189  YVAEISRSWDEPHGKDSNKVKPQNNSKG---GMYTLNEDVDMQVKMATLSRRL  238



>emb|CAN61957.1| hypothetical protein VITISV_041046 [Vitis vinifera]
Length=2064

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 92/172 (53%), Gaps = 14/172 (8%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ KF+   +T  L+R+I+ F   E E FH
Sbjct  167  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFH  226

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I+    GG    K +EEA+    
Sbjct  227  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILKTMCGGDFMSKNSEEAMDFLS  286

Query  361  MLGENSQ---QKNIRGRTQ-----------GMYEVNSNPDLIVYMSELAKQM  474
             + E S+   + N R + +           GMY ++ + D+   ++ +A+++
Sbjct  287  YVSEVSRGWDEPNSREKEKFPSQPTQNPKGGMYVLSEDMDMKAKVATIARRL  338



>emb|CAN60529.1| hypothetical protein VITISV_004809 [Vitis vinifera]
Length=433

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW  +  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  223  FPFTLKDKAKIWLNSLRPRSIRTWTNLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFY  282

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+  ++  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  283  ECWERYMEVINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  342

Query  361  MLGENSQ  381
             + E S+
Sbjct  343  YVAEVSR  349



>emb|CAN66953.1| hypothetical protein VITISV_012317 [Vitis vinifera]
Length=996

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 90/172 (52%), Gaps = 14/172 (8%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ K +   +T  L+R+I+ F   E E FH
Sbjct  174  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKIFPTHRTNGLKRQISNFSAKENEKFH  233

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  234  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDFLS  293

Query  361  MLGE--------NSQQK------NIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E        NS++K        +    GMY ++ + D+   ++ LA+++
Sbjct  294  YVAEVSRGWDEPNSREKGKFPSQQTQNPKAGMYMLSEDVDMKAKVATLARRL  345



>emb|CAN74673.1| hypothetical protein VITISV_020204 [Vitis vinifera]
Length=934

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 93/170 (55%), Gaps = 12/170 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ KF+   +T  L+R+I+ F   E E FH
Sbjct  173  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKFFPTHRTNGLKRQISXFSXKENEKFH  232

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  233  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDFLS  292

Query  361  MLGENSQ---QKNIR--GRTQ-------GMYEVNSNPDLIVYMSELAKQM  474
             + E ++   + N +  GR +       GMY ++ + D+   ++ +A+++
Sbjct  293  YVSEVTRGWDEPNSKELGRMKAPVNPKGGMYMLSEDMDMKAKVATIARRL  342



>ref|XP_008391146.1| PREDICTED: uncharacterized protein LOC103453381 [Malus domestica]
Length=529

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 79/145 (54%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TL+  AK W   L PGS+ TW +V   F+++++  TK   +R+ I    Q  GEPF 
Sbjct  139  FPFTLEAKAKEWLYNLPPGSMNTWNQVKQAFLEQYFPATKAASIRKDICAIRQQHGEPFG  198

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            + +ERF  L+  CP+H     L IQ FY+ L  T + ++D A+GG+  +KT   A AL +
Sbjct  199  DYYERFTHLVASCPNHQISEHLLIQYFYEGLCGTDRIMLDAASGGAFMDKTPINAKALLK  258

Query  361  MLGENSQQKNIRGRTQGMYEVNSNP  435
             +    +Q N  G  QG      +P
Sbjct  259  NIAGGLEQANALGGFQGQQRQKYDP  283



>emb|CAN66314.1| hypothetical protein VITISV_035171 [Vitis vinifera]
Length=1136

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 87/173 (50%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F+ KF+   +T  L+RKI+ F   E E F+
Sbjct  154  FPFTLKDKAKIWLNSLRPRSIRTWTDLQAEFLKKFFPTHRTNGLKRKISNFSAKESEKFY  213

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD +  + + +++   GG    K  EEA+    
Sbjct  214  ECWERYMEAINACPHHGFDTWLLVSYFYDGMFSSMKQLLETMCGGDFMSKNLEEAMDFLS  273

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+    + + +++
Sbjct  274  YVAEVSRGWDEPNKGEVGKMKSQPNAFNAKAGMYTLNEDVDMKAKFAAMTRRL  326



>ref|XP_010489385.1| PREDICTED: uncharacterized protein LOC104767061 [Camelina sativa]
Length=208

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 67/123 (54%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++L D A  W   L  GS+ TW +    F++ FY+ +++ +LR KITTF Q   E F 
Sbjct  5    FQFSLGDKALRWLNLLDSGSITTWEQCRAIFLNHFYTKSRSTKLRSKITTFSQGGMETFC  64

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK  L  CPHHGY  E  +  FY  + Q  Q  +D A+ G     TA EA  L E
Sbjct  65   EAWERFKEYLRDCPHHGYSQENLMNIFYGGIEQRYQMALDTASKGDFSTNTANEANLLIE  124

Query  361  MLG  369
             L 
Sbjct  125  NLA  127



>emb|CAN63403.1| hypothetical protein VITISV_001870 [Vitis vinifera]
Length=390

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 70/124 (56%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW E+   F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  261  FPFTLKDKAKIWLNSLRPRSIRTWTELQADFLKKFFPTHRTNGLKRQISNFSARENEKFY  320

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  321  ECWERYMEAINACPHHGFDTWLLVGYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDFLS  380

Query  361  MLGE  372
             + E
Sbjct  381  YVSE  384



>gb|EPS74455.1| hypothetical protein M569_00300 [Genlisea aurea]
Length=975

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 80/144 (56%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK WF  L  GS+ TW ++   F++K++   K + +R+ I +  Q   E  +
Sbjct  14   FPFSLMDGAKNWFYSLDNGSIHTWKDMRQAFLEKYFPPNKVIHVRKDIFSMRQQYDETLY  73

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+K LL  CP H    +  +  FY+ LT   +  +D AAGG++  KTA+EA  +  
Sbjct  74   EYWERYKKLLASCPKHQLGKKSVMLYFYEGLTDEERKALDAAAGGNLKRKTADEAREIIT  133

Query  361  MLGENSQQKNIRGRTQGMYEVNSN  432
            M+  NS   N R  T+G++    N
Sbjct  134  MMANNSHIYNPRTHTRGVHAATEN  157



>emb|CAN63062.1| hypothetical protein VITISV_030509 [Vitis vinifera]
Length=479

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 87/176 (49%), Gaps = 18/176 (10%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F+ KF+   +T  L+R+I+     E E F+
Sbjct  218  FPFTLKDKAKIWLNSLRPRSIRTWTDLQAEFLKKFFPTHRTNGLKRQISNLSAKENEKFY  277

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ +   +++   GG    K  EEA+    
Sbjct  278  ECWERYLEAINACPHHGFDTWLLVSYFYDGMSSSMNQLLETMCGGDFMSKNPEEAMDFLS  337

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDL---IVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+    V M+   K++
Sbjct  338  YVAEVSRGWDEPHIGEVGKMKSQPNALHAKAGMYTLNRDVDMKAKFVAMTRRVKEL  393



>emb|CAN60680.1| hypothetical protein VITISV_033696 [Vitis vinifera]
Length=1036

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 89/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F+ KF+   +T  L+R+I+ FL  E E F+
Sbjct  134  FPFTLKDKAKIWLNSLRPRSIRTWTDLQAEFLKKFFPTHRTNSLKRQISNFLAKENEKFY  193

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CP+HG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  194  ECWERYIEAINACPYHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  253

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+    + + +++
Sbjct  254  YVAEVSRGWDEPHRGEVGKMKSQPNALHAKAGMYTLNEDIDMKAKFAAMTRRV  306



>emb|CAN82158.1| hypothetical protein VITISV_033259 [Vitis vinifera]
Length=2108

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 87/173 (50%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F+ KF+   KT  L+R+I+ F   E E F+
Sbjct  164  FPFTLKDKAKIWLNSLRPRSIRTWTDLQAEFLKKFFPTHKTNGLKRQISNFSAKENEKFY  223

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD +  + + +++   GG    K  EEA+    
Sbjct  224  ECWERYMEAINACPHHGFDTWLLVSYFYDGMPSSMKQLLETMCGGDFMSKNPEEAMDFLS  283

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+    + + +++
Sbjct  284  YVAEVSRGWDESHRREVGKMKSQPNAFHAKAGMYALNEDVDMKAKFAAMTRRL  336



>ref|XP_010496957.1| PREDICTED: uncharacterized protein LOC104773983, partial [Camelina 
sativa]
Length=1834

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 85/160 (53%), Gaps = 3/160 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++L D A  W   L  GSL TWA+    F++ FY+ +++ +LR KITTF Q   E F 
Sbjct  156  FQFSLADKALRWLNLLDAGSLTTWAQCRAAFLNHFYTKSRSAKLRSKITTFSQGGMESFC  215

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK  L  CPHHGY  E  +  FY  + Q  Q  +D A+ G     TA EA AL E
Sbjct  216  EAWERFKEYLRDCPHHGYTQENLMNIFYGGIEQKYQMALDTASKGDFSTNTANEANALIE  275

Query  361  ML-GENSQQKNIRGRTQGMYEVNSNP--DLIVYMSELAKQ  471
             L   NS       RT  +  V+++   DL   ++ L K+
Sbjct  276  NLAASNSNHGTDYDRTVRVNSVDTDAIKDLTAKVNLLLKR  315



>emb|CAN73553.1| hypothetical protein VITISV_021946 [Vitis vinifera]
Length=174

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%), Gaps = 0/116 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R+W +++ +F+ KF+   +T +L+R+I+ F   E E F+
Sbjct  35   FPFTLKDKAKVWLNSLRPRSIRSWTDLHAEFLKKFFPTHRTNDLKRQISDFSAKENEKFY  94

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEAL  348
            E WER+   +  CPHHG+   L +  FYD ++ + + +++    G    K +EEA+
Sbjct  95   ECWERYMEAINTCPHHGFDTWLLVSYFYDGMSFSMKQLLETMCEGDFMNKNSEEAM  150



>emb|CAN66388.1| hypothetical protein VITISV_019683 [Vitis vinifera]
Length=2103

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 91/172 (53%), Gaps = 14/172 (8%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F  KF+   +T  L+R+I+ F   E E FH
Sbjct  200  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFSKKFFPTHRTNGLKRQISNFSAKENEKFH  259

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I+    GG    K  EEA+    
Sbjct  260  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILKTMCGGDFMSKNPEEAMDFLS  319

Query  361  MLGENSQ---QKNIRGRTQ-----------GMYEVNSNPDLIVYMSELAKQM  474
             + E S+   + N+R + +           GMY ++ + D+   ++ +A+++
Sbjct  320  YVSEVSRGWDEPNLREKGKFPSQPTQNPKGGMYVLSEDMDMKAKVATIARRL  371



>emb|CAN68000.1| hypothetical protein VITISV_021930 [Vitis vinifera]
Length=1755

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 93/170 (55%), Gaps = 12/170 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  197  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFY  256

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  257  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDFLS  316

Query  361  MLGENSQ---QKNIR--GRTQ-------GMYEVNSNPDLIVYMSELAKQM  474
             + E S+   + N R  GR +       GMY ++ + D+   ++ +A+++
Sbjct  317  YVSEVSRGWDEPNSRKMGRMKAPVNPKSGMYMLSEDMDMKAKVATMARRL  366



>ref|XP_010693949.1| PREDICTED: uncharacterized protein LOC104906823 [Beta vulgaris 
subsp. vulgaris]
Length=415

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 80/142 (56%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK W   ++ GS+ TW  +   F++KF+  ++   +R++I    Q   E  +
Sbjct  121  FPFSLHDLAKDWLYTMSTGSITTWNALQKAFLEKFFPASRIGSIRKEICGIRQHNSESLY  180

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK L   CP H    +L IQ FY+ L    + ++D A+GG++ +KT  +A  L  
Sbjct  181  EYWERFKKLCASCPQHQITDQLLIQYFYEGLLPNDRGMIDAASGGALVDKTPTQARNLIA  240

Query  361  MLGENSQQKNIRGRTQGMYEVN  426
             + +N+QQ + R   + + E++
Sbjct  241  NMAQNTQQHSTRNDVKRVNEID  262



>emb|CAN78930.1| hypothetical protein VITISV_008432 [Vitis vinifera]
Length=1488

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 91/172 (53%), Gaps = 14/172 (8%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ K++   +T  L+R+I+ F   E E FH
Sbjct  163  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKYFPTHRTNGLKRQISNFSAKENEKFH  222

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  +EA+    
Sbjct  223  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPDEAMDFLS  282

Query  361  MLGE--------NSQQK------NIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E        NS++K        +    GMY ++ + D+   ++ LA+++
Sbjct  283  YVAEVSRGWDEPNSREKGKFPSQQTQNPKAGMYMLSEDVDMKAKVATLARRL  334



>emb|CAN81728.1| hypothetical protein VITISV_004185 [Vitis vinifera]
Length=1601

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 87/173 (50%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD  K W   L P S+RTW ++  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  236  FPFTLKDKTKIWLNSLRPRSIRTWTDLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFY  295

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  296  ECWERYMAAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMNFLS  355

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+    + + +++
Sbjct  356  YMAEVSKGWDESNKGEVGKMKSQPNAFNAKAGMYTLNEDVDMKAKCAAMTRRL  408



>ref|XP_009334875.1| PREDICTED: uncharacterized protein LOC103927658 [Pyrus x bretschneideri]
Length=478

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 92/163 (56%), Gaps = 5/163 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TL+  AK WF  L PGS+ TW +V   F+++++  TK   +R+ I    Q  GEPF 
Sbjct  138  FPFTLEAKAKEWFYNLPPGSMNTWNQVKQAFLEQYFPATKAASIRKDICAIRQQHGEPFG  197

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            + ++RF  L+  CP+H     L IQ FY+ L    + ++D A+GG+  +KT   A AL +
Sbjct  198  DYYDRFTHLVASCPNHQISEHLLIQYFYEGLCGIDRVMLDVASGGAFMDKTPTNAKALLK  257

Query  361  MLGENSQQKNIRGR--TQGMYEVNSNPDL---IVYMSELAKQM  474
             +  N++Q   R     + + EV++N  +   +V ++ L +Q+
Sbjct  258  NIAGNTRQFGGRDELPLKKVNEVSANSSIELQLVNLTNLVQQV  300



>emb|CAN74943.1| hypothetical protein VITISV_031312 [Vitis vinifera]
Length=1444

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 89/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F+ KF+   +T  L+R+I+ FL  E E F+
Sbjct  176  FPFTLKDKAKIWLNSLRPKSIRTWTDLQAEFLKKFFPTHRTNGLKRQISNFLAKENEKFY  235

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FY+ ++ + + +++   GG    K  EEA+    
Sbjct  236  ECWERYMESINACPHHGFDTWLLVSYFYNGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  295

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+    + + +++
Sbjct  296  YVAEVSRGWDEPNKGEVGKMKSQPNAFHAKVGMYTLNEDVDMKAKFAAMTRRL  348



>ref|XP_010689588.1| PREDICTED: uncharacterized protein LOC104903267 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010689589.1| PREDICTED: uncharacterized protein LOC104903267 [Beta vulgaris 
subsp. vulgaris]
Length=706

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 80/142 (56%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK W   ++ GS+ TW  +   F++KF+  ++   +R++I    Q   E  +
Sbjct  121  FPFSLHDLAKDWLYTMSSGSITTWDALQKAFLEKFFPASRIGSIRKEICGIRQHNSESLY  180

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK L   CP H    +L IQ FYD L    + ++D A+GG++ +KT  +A  L  
Sbjct  181  EYWERFKRLCASCPQHQITDQLLIQYFYDVLLPNDRGMIDAASGGALVDKTPTQARNLIA  240

Query  361  MLGENSQQKNIRGRTQGMYEVN  426
             + +N+QQ + R   + + E++
Sbjct  241  NMAQNTQQHSTRNDVKRVNEID  262



>emb|CAN81952.1| hypothetical protein VITISV_022527 [Vitis vinifera]
Length=2166

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 89/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK WF  L P S+RTW ++  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  35   FPFTLKDKAKIWFNSLRPRSIRTWTDLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFY  94

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  95   ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGHFMSKNPEEAMDFLS  154

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q +      GMY +N + D+    + + +++
Sbjct  155  YVAEVSRGWDEPNKGEVGKMKSQPSAFNAKAGMYTLNEDVDMKAKFAAMTRRL  207



>emb|CAN76192.1| hypothetical protein VITISV_025047 [Vitis vinifera]
Length=285

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 88/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F+ KF+   KT  L+R+I+ F   E E F+
Sbjct  73   FPFTLKDKAKFWLNSLRPRSIRTWTDLQAEFLKKFFPTHKTNGLKRQISNFSAKENEKFY  132

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  E+A+    
Sbjct  133  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEKAMDFLS  192

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q +      GMY +  + D+   ++ + +++
Sbjct  193  YVAEVSRGWDEPTKGEVGKMKSQLSAFNAKAGMYTLKEDDDMKAKLAAMTRRL  245



>emb|CAN63646.1| hypothetical protein VITISV_012334 [Vitis vinifera]
Length=746

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 88/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TL+D AK W   L P S+RTW ++  KF+ KF+   +T  L+++I+ F   E E F+
Sbjct  162  FPFTLRDKAKIWLNSLRPRSIRTWIDLQAKFLKKFFPTHRTNGLKKQISNFSAKENEKFY  221

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  222  ECWERYMEAINACPHHGFDTWLLVSYFYDEMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  281

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+    + + +++
Sbjct  282  YVAEVSRGWDEPNKGEVGKIKSQSNAFNAKAGMYTLNEDVDMKAKFAAMTRRL  334



>ref|XP_011072318.1| PREDICTED: uncharacterized protein LOC105157605 [Sesamum indicum]
Length=285

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 85/153 (56%), Gaps = 0/153 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D A+ W   L   S+ TW ++   F+  ++  ++  EL ++I  F+Q E E   
Sbjct  85   FPFSLRDEARAWLHSLPAQSITTWEQLSEAFLANYFPPSRKAELCQQILCFVQKEDESLR  144

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            +AWERF  LL  CP+HG+   L + +FYD LT  ++ +V+ A+GG+  +KT  +  +L E
Sbjct  145  DAWERFNKLLRFCPNHGFEKWLLLHSFYDGLTYDTKMLVNAASGGAFMDKTVTDGYSLIE  204

Query  361  MLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSE  459
            ++ EN  Q +       M    SN D +  + +
Sbjct  205  VMAENQYQWSNERVVPEMSPSRSNVDSLTVLVD  237



>emb|CAN62871.1| hypothetical protein VITISV_015208 [Vitis vinifera]
Length=893

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 88/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R+W ++  +F+ KF+   +T  L+RKI+ F   E E F+
Sbjct  638  FPFTLKDKAKIWLNSLRPRSIRSWTDLQAEFLKKFFPTHRTNGLKRKISNFSAKENEKFY  697

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  698  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  757

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + + S+               Q N      GMY +  + D+   ++ + +++
Sbjct  758  YVADVSRGWDEPTKGEVGKMKSQLNAYNAKAGMYTLKEDDDMKAKLAAMTRRL  810



>ref|XP_011071675.1| PREDICTED: uncharacterized protein LOC105157079 [Sesamum indicum]
Length=573

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 76/128 (59%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK W  FL  GS+  W ++  +F++K++  ++   +R++I+   Q  G+   
Sbjct  142  FPFSLADQAKDWLYFLPSGSITRWNDLKRQFLEKYFPASRATTIRKEISGIRQFAGDSLF  201

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERF  L+   PHH  P  L IQ FY+ L+   + ++D A+GG++ +KT  EA  L  
Sbjct  202  EYWERFNRLVESFPHHQIPNHLLIQYFYEGLSNMDRKLIDAASGGALFDKTPTEARKLIS  261

Query  361  MLGENSQQ  384
            ++  N+QQ
Sbjct  262  IMASNTQQ  269



>ref|XP_011098876.1| PREDICTED: uncharacterized protein LOC105177421 [Sesamum indicum]
Length=687

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 76/128 (59%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F   L D AK W   L  GS+  W E+   F++ ++  ++T  +R++I+   Q  GE F+
Sbjct  83   FSILLGDKAKDWLYSLPSGSIVNWNELKKLFLENYFPASRTTNIRKEISGIRQFSGESFY  142

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E W RF+ L+  CPHH  P  L IQ FY+ L++ ++S+VD A+GG++ +KT  EA  L  
Sbjct  143  EYWGRFRQLVESCPHHQIPDHLLIQYFYEGLSEANRSLVDAASGGALYDKTPTEARKLIT  202

Query  361  MLGENSQQ  384
             +  N+QQ
Sbjct  203  TMAANNQQ  210



>emb|CAN78174.1| hypothetical protein VITISV_028988 [Vitis vinifera]
Length=1873

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 90/172 (52%), Gaps = 14/172 (8%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ K +   +T  L+R+I+ F   E E FH
Sbjct  204  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKNFPTHRTNGLKRQISNFSAKENEKFH  263

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  264  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQIIETMCGGDFMSKNPEEAMDFLS  323

Query  361  MLGE--------NSQQK------NIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E        NS++K        +    GMY ++ + D+   ++ LA+++
Sbjct  324  YVAEVSRGWDEPNSREKGKFPSQQAQNPKAGMYMLSEDVDIKAKVATLARRL  375



>ref|XP_010669531.1| PREDICTED: uncharacterized protein LOC104886741 [Beta vulgaris 
subsp. vulgaris]
Length=624

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 84/148 (57%), Gaps = 5/148 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D AK WF       + TW E+   F+ KF+   +T + R +I+ F Q E E  +
Sbjct  122  FPFSLRDEAKEWFKEEEVRKIATWPELKKAFLYKFFPPMRTSKFRNEISGFQQHELESLY  181

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAW+R+K L  QCPHHG P  L IQTFY+ L    +S +D A+GG+   KT E A  L +
Sbjct  182  EAWQRYKALQRQCPHHGIPEWLLIQTFYNGLKHEVRSSIDAASGGTFMAKTPEAAKTLLD  241

Query  361  MLGENSQQKN---IRG--RTQGMYEVNS  429
             +  N+   +    RG  +  G YEV++
Sbjct  242  DMAANNYLNDWSISRGAPKKGGKYEVDA  269



>emb|CAN74585.1| hypothetical protein VITISV_017114 [Vitis vinifera]
Length=1947

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 91/172 (53%), Gaps = 14/172 (8%)
 Frame = +1

Query  1     FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
             FP+TLKD  K W   L P S+R W ++  +F+ K++   +T  L+R+I+ F   E E FH
Sbjct  979   FPFTLKDKVKIWLNSLRPRSIRNWVDLQAEFLKKYFPTHRTNGLKRQISNFSAKENEKFH  1038

Query  181   EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
             E WER+  ++  CPHHG+   L +  FYD ++ + + I++   GG    K  +EA+    
Sbjct  1039  ECWERYMEVINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPDEAMDFLS  1098

Query  361   MLGE--------NSQQK------NIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
              + E        NS++K        +    GMY ++ + D+   ++ LA+++
Sbjct  1099  YVAEVSRGWDEPNSREKGKFPSQQTQNPKAGMYMLSEDVDMKAKVATLARRL  1150



>emb|CAN78819.1| hypothetical protein VITISV_015506 [Vitis vinifera]
Length=1706

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 91/172 (53%), Gaps = 14/172 (8%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ K++   +T  L+R+I+ F   E E FH
Sbjct  183  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKYFPTHRTNGLKRQISNFSAKENEKFH  242

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  +EA+    
Sbjct  243  ECWERYMESINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPDEAMDFLS  302

Query  361  MLGE--------NSQQKN------IRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E        NS++K        +    GMY ++ + D+   ++ LA+++
Sbjct  303  YVAEVSRGWDEPNSREKGKFPSQQTQNPKAGMYMLSEDVDMKAKVATLARRL  354



>ref|XP_009606080.1| PREDICTED: uncharacterized protein LOC104100531 [Nicotiana tomentosiformis]
Length=281

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 79/134 (59%), Gaps = 0/134 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+  A  W   L   S+ TW E+   F+ K++   +T ELR  I  F Q   E  H
Sbjct  145  FPFSLQGEASDWLDNLPAMSIYTWGELTKVFLAKYFPPARTAELRMGILQFKQKPHESLH  204

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAW+R+K+ + +CP+HG P +L ++TFY +L + ++S+ DNAA G++   + ++A  + +
Sbjct  205  EAWDRYKLCIKKCPNHGCPNQLLLETFYLALDKVTRSVADNAANGAIVNLSVQDARVILD  264

Query  361  MLGENSQQKNIRGR  402
             + +N+    +  R
Sbjct  265  RISDNAHASYVGER  278



>emb|CAN66527.1| hypothetical protein VITISV_014493 [Vitis vinifera]
Length=747

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 90/172 (52%), Gaps = 14/172 (8%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W     P S+R W ++  +F+ K++   +T  L+R+I+ F   E E FH
Sbjct  242  FPFTLKDKAKIWLNSSRPRSIRNWVDLQAEFLKKYFPTHRTNGLKRQISNFSAKENEKFH  301

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  302  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDFLS  361

Query  361  MLGE--------NSQQK------NIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E        NS++K        +    GMY ++ + D+   ++ LA+++
Sbjct  362  YVAEVSRGWDEPNSREKGKFPSQQTQNPKAGMYMLSEDVDMKAKVATLARRL  413



>emb|CAN64212.1| hypothetical protein VITISV_031909 [Vitis vinifera]
Length=588

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 89/159 (56%), Gaps = 1/159 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F  KF+   +T  L+R+I+ F   E E F+
Sbjct  134  FPFTLKDKAKIWLNSLRPRSIRTWTDLQAEFPKKFFPTHRTNGLKRQISNFSAKENEKFY  193

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    +  +EA+    
Sbjct  194  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSRNPDEAMDFLS  253

Query  361  MLGENSQQKNIRGRTQ-GMYEVNSNPDLIVYMSELAKQM  474
             + E S+  +   + + GMY +N + D+   ++ + +++
Sbjct  254  YVAEVSRGWDEPNKGEAGMYTLNEDIDMKAKVAAMTRRL  292



>emb|CAN71526.1| hypothetical protein VITISV_030249 [Vitis vinifera]
Length=853

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 91/170 (54%), Gaps = 12/170 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  + + KF+   +T  L+R+I+ F   E E FH
Sbjct  138  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEXLKKFFPTHRTNGLKRQISNFSAKENEKFH  197

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++   + I++   GG    K  EEA+    
Sbjct  198  ECWERYMEAINACPHHGFDTXLLVSYFYDGMSSXMKQILETMCGGDFMSKNPEEAMDFLS  257

Query  361  MLGENSQ---QKNIR--GRTQ-------GMYEVNSNPDLIVYMSELAKQM  474
             + E ++   + N R  GR +       GMY ++ + D+   ++ +A+++
Sbjct  258  YVSEVTRGWDEPNSREMGRMKAPVNPKGGMYVLSEDMDMKAKVATIARRL  307



>emb|CAN74400.1| hypothetical protein VITISV_038281 [Vitis vinifera]
Length=624

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 82/154 (53%), Gaps = 3/154 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  161  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFY  220

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+      CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  221  ECWERYMEATNACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDFLS  280

Query  361  MLGENSQ---QKNIRGRTQGMYEVNSNPDLIVYM  453
             + E S+   + N R + +   +   NP   +YM
Sbjct  281  YVSEVSRGWDEPNSREKGKFPSQPTQNPKAGMYM  314



>emb|CAN83811.1| hypothetical protein VITISV_019431 [Vitis vinifera]
Length=1580

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 89/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  KF+ KF+   +T +L+R+I+ F   E E F+
Sbjct  35   FPFTLKDKAKIWLNSLRPRSIRTWIDLQAKFLKKFFPTHRTNDLKRQISNFSAKENEKFY  94

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER    +  CPHHG+   L +  FY+ ++ + + +++   GG    K  E+A     
Sbjct  95   ECWERCIEAINSCPHHGFDTWLLVSYFYNGMSFSMKQLLETMCGGDFMSKNQEKARDFLS  154

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N+     GMY +N + D+    + +A+++
Sbjct  155  YVAEVSRGWDESNAKEVGRMKSQPNVSNAKAGMYTLNEDIDMKTKFAAMARRL  207



>emb|CAN61136.1| hypothetical protein VITISV_023515 [Vitis vinifera]
Length=1831

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 88/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R+W ++  KF+ KF+   +T  L+R+I+ F   E E F+
Sbjct  125  FPFTLKDKAKVWLNSLRPRSIRSWTDLQAKFLKKFFPTHRTNGLKRQISNFSAKENEKFY  184

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  185  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  244

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + + S+               Q N      GMY +  + D+   ++ + +++
Sbjct  245  HVADVSRGWDEPTKGEVGKMKSQLNAYNAKAGMYNLKEDDDMKAKLAAMTRRL  297



>ref|XP_010666875.1| PREDICTED: uncharacterized protein LOC104883989 [Beta vulgaris 
subsp. vulgaris]
Length=356

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 89/163 (55%), Gaps = 5/163 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D AK WF       + TW E+   F+ K +   +T + R +I+ F Q E E  +
Sbjct  85   FPFSLRDKAKEWFKEEEVRKIATWPELKKAFLYKLFPPMRTSKFRNEISGFQQHELESLY  144

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAW+R+K L  QCPHHG P  L IQTFY+ L    +S +D A+GG+   KT E A  L +
Sbjct  145  EAWQRYKALQRQCPHHGIPEWLLIQTFYNGLKHEVRSSIDAASGGTFMAKTPEAAKILLD  204

Query  361  MLGENSQQKN---IRG--RTQGMYEVNSNPDLIVYMSELAKQM  474
             +  N+   +    RG  +  G YEV++   L   +  LA ++
Sbjct  205  DMAVNNYLNDWSVSRGPPKKGGKYEVDAIATLTSTVQVLAAKV  247



>emb|CAN71987.1| hypothetical protein VITISV_001129 [Vitis vinifera]
Length=487

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 89/160 (56%), Gaps = 3/160 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R+  ++  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  125  FPFTLKDKAKIWLNSLRPRSIRSXTDLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFY  184

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+ + L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  185  ECWERYMEAINACPHHGFDIWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  244

Query  361  MLGENSQ--QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+   +  +G   GMY +  + D+   ++ + +++
Sbjct  245  YVAEVSRGWDEPTKGEA-GMYTLKEDDDMKAKLAAMTRRL  283



>emb|CAN82706.1| hypothetical protein VITISV_037843 [Vitis vinifera]
Length=819

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 88/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  126  FPFTLKDKAKIWLNSLRPRSIRTWTDLQPEFLKKFFPTHRTNGLKRQISNFSTKENEKFY  185

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  186  ECWERYMEAINTCPHHGFDTWLLVSYFYDGMSFSMKQLLETMCGGDFMSKNPEEAVDFLS  245

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+    + + +++
Sbjct  246  YVAEVSRGWDQPNKGEVGKMKSQPNTFNAKAGMYTLNEDVDMKAKFAAMTRRL  298



>emb|CAN77867.1| hypothetical protein VITISV_001382 [Vitis vinifera]
Length=2497

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 83/154 (54%), Gaps = 3/154 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ K++   +T  L+R+I+ F   E E FH
Sbjct  174  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKYFPTHRTNGLKRQISNFSAKENEKFH  233

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  +EA+    
Sbjct  234  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPDEAMDFLS  293

Query  361  MLGENSQ---QKNIRGRTQGMYEVNSNPDLIVYM  453
             + E S+   + N R + +   +   NP   +YM
Sbjct  294  YVAEVSRGWDEPNSREKGKFPSQXXQNPKAGMYM  327



>emb|CAN82333.1| hypothetical protein VITISV_010517 [Vitis vinifera]
Length=1964

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 84/162 (52%), Gaps = 15/162 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  125  FPFTLKDKAKIWLNSLRPRSIRTWTDLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFY  184

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K +EEA+    
Sbjct  185  ECWERYIEAITACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNSEEAMDFLS  244

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDL  441
             + E S+               Q +      GMY +N + D+
Sbjct  245  YVAEVSRGWDEPNKGEVGKMKSQPSAFNAKAGMYTLNEDDDM  286



>ref|XP_008355589.1| PREDICTED: uncharacterized protein LOC103419248 [Malus domestica]
Length=457

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 87/156 (56%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TL+  AK W   L PGS+ TW +V + F+++++  TK   +R+ I    Q  GEPF 
Sbjct  138  FPFTLEAKAKEWLYNLPPGSMNTWNQVKHAFLEQYFXATKAXSIRKDICAIRQQHGEPFG  197

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            + +ERF  L+  CP+H     L IQ FY+ L  T   + D A+GG+  +KT   A AL +
Sbjct  198  DYYERFTHLVASCPNHQISEHLLIQYFYEGLYGTDXVMXDAASGGAFMDKTPTNAKALLK  257

Query  361  MLGENSQQKNIRGRT--QGMYEVNSNPDLIVYMSEL  462
             +  N++Q   R     + + EV++N  + + ++ L
Sbjct  258  NIAGNTRQFGGRDELPFKKVNEVSANSSIELQLANL  293



>ref|XP_010430883.1| PREDICTED: uncharacterized protein LOC104715140 [Camelina sativa]
Length=591

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 69/123 (56%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F ++L D A  W   L  GSL TWA+    F++ FY+ +++ +L+ KITTF Q   E F 
Sbjct  167  FQFSLADKAIRWLNLLDAGSLTTWAQCRAAFLNHFYTKSRSAKLQSKITTFSQGGMESFC  226

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAWERFK  L  CPHHGY  E     FY  + Q  Q  ++ A+ G     TA EA AL +
Sbjct  227  EAWERFKEYLRDCPHHGYTQENMTNIFYGGIEQKYQMALNTASKGDFSSNTANEANALIK  286

Query  361  MLG  369
             LG
Sbjct  287  NLG  289



>ref|XP_008352292.1| PREDICTED: uncharacterized protein LOC103415785 [Malus domestica]
Length=549

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 88/156 (56%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TL+  AK W   L PGS+ TW +V   F+++++  TK   +R+ I    Q  GEPF 
Sbjct  139  FPFTLEAKAKEWLYNLPPGSMNTWNQVKQAFLEQYFPATKAASIRKDICAIRQQHGEPFG  198

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            + +ERF  L+  CP+H     L IQ FY+ L  T + ++D A+GG+  +KT   A AL +
Sbjct  199  DYYERFTHLVASCPNHQISEHLLIQYFYEGLCGTDRIMLDAASGGAFMDKTPINAKALLK  258

Query  361  MLGENSQQKNIRGRT--QGMYEVNSNPDLIVYMSEL  462
             +  N++Q   R     + + EV++N  + + ++ L
Sbjct  259  NIAGNTRQFGGRDELPFKKVNEVSANSSIELQLANL  294



>emb|CAN82864.1| hypothetical protein VITISV_012737 [Vitis vinifera]
Length=1634

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 89/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R+W ++  +F+ KF+   +T +L+R+I+ F   E E F+
Sbjct  125  FPFTLKDKAKIWLNSLRPMSIRSWTDLQAEFLKKFFPTHRTNDLKRQISNFSAKENEKFY  184

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  185  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  244

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + + S+               Q N      GMY +  + D+   ++ + +++
Sbjct  245  YIADVSRGWDEPTKGEVGKMKSQLNAYNAKAGMYNLKEDDDMKAKLAAMTRRL  297



>emb|CAN65863.1| hypothetical protein VITISV_015140 [Vitis vinifera]
Length=1918

 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 89/160 (56%), Gaps = 3/160 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R+W ++  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  186  FPFTLKDKAKIWLNSLRPRSIRSWTDLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFY  245

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  246  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSPSMKQLLETMCGGDFMSKNPEEAMDFLS  305

Query  361  MLGENSQ--QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + + S+   +  +G   GMY +  + D+   ++ + +++
Sbjct  306  YVADVSRGWDEPTKGEA-GMYNLKEDDDMKAKLAAMTRRL  344



>emb|CAN62976.1| hypothetical protein VITISV_043801 [Vitis vinifera]
Length=510

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 87/173 (50%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+ TW ++  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  148  FPFTLKDKAKIWLNSLRPRSIHTWTDLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFY  207

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  208  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  267

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+    + + +++
Sbjct  268  YVAEVSRGWDEPNKGEVGKMKSQLNAFNAKAGMYTLNEDVDMKAKFATMTRRL  320



>ref|XP_010689442.1| PREDICTED: uncharacterized protein LOC104903138 [Beta vulgaris 
subsp. vulgaris]
Length=1512

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 81/142 (57%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK WF  ++ GS+ TW  +   F++KF+  ++   +R++I    Q   E  +
Sbjct  121  FPFSLHDLAKDWFYTMSSGSITTWDALQKAFLEKFFPASRIGSIRKEICGIRQHNSETLY  180

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK L   CP H    +L IQ FY+ L    + ++D A+GG++ +KT  +A  L  
Sbjct  181  EYWERFKKLCASCPQHQITDQLLIQYFYEGLLPNDRGMIDAASGGALVDKTPTQARNLIA  240

Query  361  MLGENSQQKNIRGRTQGMYEVN  426
             + +N+QQ + R   + + E++
Sbjct  241  NMAQNTQQHSTRNDVKRVNEID  262



>ref|XP_010689473.1| PREDICTED: uncharacterized protein LOC104903173 [Beta vulgaris 
subsp. vulgaris]
Length=767

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 84/148 (57%), Gaps = 5/148 (3%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D AK WF       + TW E+   F+ KF+   +T + R +I+ F Q E E  +
Sbjct  122  FPFSLRDEAKEWFKEEEVRKIATWPELKKAFLYKFFPPMRTSKFRNEISGFQQHELESLY  181

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAW+R+K L  QCPHHG P  L IQTFY+ L    +S +D A+GG+   KT E A  L +
Sbjct  182  EAWQRYKALQRQCPHHGIPEWLLIQTFYNGLKHEVRSSIDAASGGTFMAKTPEAAKTLLD  241

Query  361  MLGENSQQKN---IRG--RTQGMYEVNS  429
             +  N+   +    RG  +  G YEV++
Sbjct  242  DMAANNYLNDWSISRGAPKKGGKYEVDA  269



>ref|XP_010677742.1| PREDICTED: uncharacterized protein LOC104893344 [Beta vulgaris 
subsp. vulgaris]
Length=536

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 81/138 (59%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++LK AA  W  +L PGS+ TWA++   F+++++  + ++ L+++I+   Q   E F+
Sbjct  131  FPFSLKGAANDWLYYLPPGSISTWADLKKAFLEQYFPTSMSLVLKKEISNIEQKSDETFY  190

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E W RF+ L   CP HG+  E  +  FY+ L+     +V+ A+GGS+  KTA+ A  L  
Sbjct  191  EYWARFRKLCASCPSHGHSDEDLVLYFYNGLSGEDARMVNAASGGSIVNKTAQAAKDLIN  250

Query  361  MLGENSQQKNIRGRTQGM  414
             L E S+Q   R  T+ M
Sbjct  251  ELAEGSRQFTRRAGTRRM  268



>ref|XP_010696491.1| PREDICTED: uncharacterized protein LOC104909013 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=277

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 79/142 (56%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK W   L PGS+ TW  +   F++ F+  ++   +R++I    Q   E  +
Sbjct  81   FPFSLFDIAKDWLYSLPPGSITTWDALQKAFLENFFPASRIGSIRKEICGVKQHSNESLY  140

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK L   CP H    +L IQ FY+ L    ++++D A+GG++ +KT  +A  L  
Sbjct  141  EYWERFKRLCASCPQHQISDQLLIQYFYEGLLGNDKNMIDAASGGALVDKTPTQARQLIS  200

Query  361  MLGENSQQKNIRGRTQGMYEVN  426
             + +N++Q   R   + + E++
Sbjct  201  NMAQNARQFGSRSDVKTVNEID  222



>ref|XP_008344209.1| PREDICTED: uncharacterized protein LOC103407026 [Malus domestica]
Length=471

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 74/128 (58%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TL+  AK W   L PGS+ TW +V   F++ ++  TK   +R+ I    Q  GEPF 
Sbjct  16   FPFTLEAKAKEWLYNLPPGSMNTWNQVKQAFLEXYFXATKAASIRKDICAIRQQHGEPFG  75

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            + +ERF  L+  CP+H     L IQ FY+ L  T + ++D A+GG+  +KT   A AL +
Sbjct  76   DYYERFTHLVASCPNHQISEHLLIQYFYEGLCGTDRVMLDAASGGAFMDKTPINAKALLK  135

Query  361  MLGENSQQ  384
             +  N++Q
Sbjct  136  DIAGNTRQ  143



>emb|CAN68346.1| hypothetical protein VITISV_010935 [Vitis vinifera]
Length=1831

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 87/173 (50%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+ TW ++  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  73   FPFTLKDKAKIWLNSLRPRSIHTWTDLQAEFLKKFFPTHRTNSLKRQISNFSAKENEKFY  132

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  133  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAIDFLS  192

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+    + + +++
Sbjct  193  YVAEVSRGWDEPHRGKVGKMKSQPNALHAKAGMYTLNEDVDMKAKFAAMTRRV  245



>emb|CAN70323.1| hypothetical protein VITISV_036687 [Vitis vinifera]
Length=861

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW E+   F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  125  FPFTLKDKAKIWLNSLRPRSIRTWTELQADFLKKFFPTHRTNGLKRQISNFSARENEKFY  184

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  185  ECWERYMEAINACPHHGFDTWLLVGYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDFLS  244

Query  361  MLGENSQ  381
             + E S+
Sbjct  245  YVSEVSR  251



>emb|CAN62377.1| hypothetical protein VITISV_020017 [Vitis vinifera]
Length=1401

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 92/170 (54%), Gaps = 12/170 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ K +   +T  L+R+I+ F   E E F+
Sbjct  172  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKIFPTHRTNGLKRQISNFFAKENEKFY  231

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  232  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDFLS  291

Query  361  MLGENSQ---QKNIR--GRTQ-------GMYEVNSNPDLIVYMSELAKQM  474
             + E S+   + N R  GR +       GMY ++ + D+   ++ +A+++
Sbjct  292  YVSEVSRGWDEPNSREMGRMKAPVNPKGGMYMLSEDMDMKAMVATMARRL  341



>emb|CAN71959.1| hypothetical protein VITISV_026708 [Vitis vinifera]
Length=1742

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 83/154 (54%), Gaps = 3/154 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ K++   +T  L+R+I+ F   E E FH
Sbjct  188  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKYFPTHRTNGLKRQISNFSAKENEKFH  247

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  +EA+    
Sbjct  248  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPDEAMDFLS  307

Query  361  MLGENSQ---QKNIRGRTQGMYEVNSNPDLIVYM  453
             + E S+   + N R + +   +   NP   +YM
Sbjct  308  YVAEVSRGWDEPNSREKGKFPSQQTQNPKAGMYM  341



>ref|XP_011076836.1| PREDICTED: uncharacterized protein LOC105160986 [Sesamum indicum]
Length=749

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 76/132 (58%), Gaps = 0/132 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK W   L  GS+  W ++  +F++K++  ++   +R++I+   Q  GE   
Sbjct  142  FPFSLADQAKDWLYLLPSGSITRWNDLKKQFLEKYFPASRATTIRKEISGIRQFTGESLF  201

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERF  L+   PHH  P  L IQ FY+ L+   + ++D A+GG++ +KT  EA  L  
Sbjct  202  EYWERFNRLVESFPHHQIPNHLLIQYFYEGLSNMDRKLIDAASGGALFDKTPTEARKLIS  261

Query  361  MLGENSQQKNIR  396
             +  N+QQ  +R
Sbjct  262  TMASNTQQFGVR  273



>ref|XP_009790384.1| PREDICTED: uncharacterized protein LOC104237851 [Nicotiana sylvestris]
Length=350

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 79/138 (57%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            F Y+L   A+ W   LTP S+ +W E++  F+ K++  +K  ELR KI  F Q++ E  H
Sbjct  77   FKYSLAGGARKWLQNLTPNSIHSWPELFRAFLSKWFPQSKKSELRDKIFFFKQIQEEQLH  136

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAW+ FK+ L++ P+HG+P  + ++ FY  L   +Q+I  N A GS  +K+      + +
Sbjct  137  EAWDHFKLYLVRSPNHGFPDSMLLENFYMGLDPMNQAIAKNVADGSFMDKSFARVTQILD  196

Query  361  MLGENSQQKNIRGRTQGM  414
             + +++Q  +    T G+
Sbjct  197  KMAKHNQAWHSEDSTGGI  214



>ref|XP_008229049.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103328437 
[Prunus mume]
Length=1479

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 79/145 (54%), Gaps = 3/145 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
             P++LKD AK+W   L   S+RTW E+ NKF+ KF+   KT +++++I  F Q EGE FH
Sbjct  146  LPFSLKDKAKSWLYSLPDASIRTWYELSNKFLQKFFPAQKTNKIQKEILGFTQKEGEAFH  205

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+K ++  CPHH     +Q+Q+FY+ L  + + +   A  G +G K   +  +  E
Sbjct  206  ECWERYKEMISSCPHHNIESWMQMQSFYEGLLDSERMM---AVTGPLGNKVEVQDQSFAE  262

Query  361  MLGENSQQKNIRGRTQGMYEVNSNP  435
             + E +     R      Y    NP
Sbjct  263  HMLEQANALQARNPNNDPYSNTYNP  287



>emb|CAN61965.1| hypothetical protein VITISV_031520 [Vitis vinifera]
Length=2703

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 89/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1     FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
             FP+TLKD AK W   L P S+RTW+++  +F+ KF+   KT  L+R+I+ FL  + E F+
Sbjct  1439  FPFTLKDKAKIWLNSLRPRSIRTWSDLQAEFLKKFFPTHKTNGLKRQISNFLAKKNERFY  1498

Query  181   EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
             E WER+   +  CPHHG+   L +  FYD +  + + +++   GG    K  +EA+    
Sbjct  1499  ECWERYMEAINACPHHGFDTWLLVSYFYDGMFSSMKQLLETMCGGDFMSKNPKEAMDFLS  1558

Query  361   MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
              + E S+               Q N      GMY +N + D+    + + +++
Sbjct  1559  YVAEVSRGWDEPNKGEVGKMKPQPNAFHVKGGMYTLNEDVDMKAKFAAMTRRL  1611


 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 86/173 (50%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD  K W   L P S++TW ++  +F+ KF+    T  L+R+I+ F   + E F+
Sbjct  96   FPFTLKDKVKIWLNSLRPRSIQTWTDLQAEFLKKFFPTHTTNGLKRQISNFSAKKNEKFY  155

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALY-  357
            E WER+   +  CPHHG+   L +   YD ++ + + +++   GG    K  EEA+    
Sbjct  156  ECWERYMEAINACPHHGFDTWLLVSYCYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLN  215

Query  358  --------------EMLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
                          E +G+   Q N      GMY +N + D+   ++ + +++
Sbjct  216  YVAEVSKGWDEPNKEEVGKAKSQPNTFNAKAGMYTLNEDIDMKAKVAAMTRRL  268



>emb|CAN82726.1| hypothetical protein VITISV_009678 [Vitis vinifera]
Length=696

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 88/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R+W ++  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  324  FPFTLKDKAKIWLNSLRPRSIRSWTDLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFY  383

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  384  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  443

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + + S+               Q N      GMY +  + D+   ++ + +++
Sbjct  444  YVADVSRGWDEPTKGEVGKMKPQLNAYNAKAGMYTLKDDDDMKAKLAAMTRRL  496



>emb|CAN74399.1| hypothetical protein VITISV_038280 [Vitis vinifera]
Length=362

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R+W ++  +F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  96   FPFTLKDKAKIWLNSLRPRSIRSWTDLQAEFLKKFFPTHRTNGLKRQISNFSAKENEKFY  155

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  156  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMEQLLETMCGGDFMSKNPEEAMDFLS  215

Query  361  MLGENSQ  381
             + + S+
Sbjct  216  YVADVSR  222



>emb|CAN81566.1| hypothetical protein VITISV_034902 [Vitis vinifera]
Length=1752

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  1     FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
             FP+TLKD AK W   L P S+RTW E+   F+ KF+   +T  L+R+I+ F   E E F+
Sbjct  1279  FPFTLKDKAKIWLNSLRPRSIRTWTELQADFLKKFFPTHRTNGLKRQISNFSARENEKFY  1338

Query  181   EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
             E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EEA+    
Sbjct  1339  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAMDFLS  1398

Query  361   MLGENS  378
              + E S
Sbjct  1399  YVSEVS  1404


 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 83/158 (53%), Gaps = 11/158 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ K +   +T  L+R+I+ F   E E F+
Sbjct  204  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKNFPTHRTNGLKRQISNFSAKENEKFY  263

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  EE +    
Sbjct  264  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEVMDFLS  323

Query  361  MLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E            GMY ++ + D+   ++ LA+++
Sbjct  324  YVAE-----------AGMYMLSEDVDMKAKVATLARRL  350



>emb|CAN75740.1| hypothetical protein VITISV_044054 [Vitis vinifera]
Length=1408

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 87/173 (50%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+RTW ++  +F+ KF+   +T  L+RKI+ F   E E F+
Sbjct  73   FPFTLKDKAKIWLNSLRPVSIRTWTDLQAEFLKKFFPTHRTNGLKRKISNFSAKENEKFY  132

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD +  + + +++   GG    K  +EA+    
Sbjct  133  ECWERYMEAINACPHHGFDTWLLVSYFYDGMFSSMKQLLETMCGGDFMSKNPKEAIDFLS  192

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E S+               Q N      GMY +N + D+    + + +++
Sbjct  193  YVAEVSRGWDEPNKGKVGKMKSQPNAFNAKVGMYTLNEDVDMKAKFAAMTRRL  245



>ref|XP_010684909.1| PREDICTED: uncharacterized protein LOC104899422 [Beta vulgaris 
subsp. vulgaris]
Length=398

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 80/142 (56%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L D AK W   ++ GS+ TW  +   F++KF+  ++   +R+++    Q   E  +
Sbjct  16   FPFSLHDLAKDWLYTMSSGSIMTWDALQKAFLEKFFPASRIGSIRKEMCGIRQHNSETLY  75

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WERFK L   CP H    +L IQ FY+ L    + ++D A+GG++ +KT  +A  L  
Sbjct  76   EYWERFKKLCASCPQHQITDQLLIQYFYEGLLPNDRGMIDAASGGALVDKTPTQARNLIA  135

Query  361  MLGENSQQKNIRGRTQGMYEVN  426
             + +N+QQ + R   + + E++
Sbjct  136  NMAQNTQQHSTRNDVKRVNEID  157



>emb|CAN74658.1| hypothetical protein VITISV_037667 [Vitis vinifera]
Length=1805

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 88/173 (51%), Gaps = 15/173 (9%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R+W ++  +F+ KF+   +T  L+RKI+ F   E E F+
Sbjct  125  FPFTLKDKAKIWLNSLRPRSIRSWTDLQAEFLKKFFPTHRTNGLKRKISNFSAKENEKFY  184

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER+   +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  185  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLS  244

Query  361  MLGENSQ---------------QKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + + S+               Q N      GMY +  + D+   ++ + +++
Sbjct  245  YVADVSRGWDEPTKGEVGKMKSQLNAYNAKAGMYTLKEDDDMKAKLAAMTRRL  297



>emb|CAN64968.1| hypothetical protein VITISV_017418 [Vitis vinifera]
Length=400

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S+R W ++  +F+ KF    +T  L+R+I+ F   E E FH
Sbjct  247  FPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKFSPTHRTNRLKRQISNFSAKENEKFH  306

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEA  345
            E WER+   +  CPHHG+   L +  FYD ++ + + I++   GG    K  +EA
Sbjct  307  ECWERYMEAINACPHHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPKEA  361



>ref|XP_010690194.1| PREDICTED: uncharacterized protein LOC104903782 [Beta vulgaris 
subsp. vulgaris]
Length=923

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 80/146 (55%), Gaps = 3/146 (2%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP++L+D AK W      G+  TW ++   F+ KF    KT +LR ++  F Q + E  +
Sbjct  125  FPFSLRDRAKEWLRDEGVGTFDTWGKLAKAFLVKFLGQEKTAKLRNELVAFEQHDDESLY  184

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            EAW RF  L  QCPHHG P  + IQTFY+ LT   +  +D A+GGS+  K   EA  L E
Sbjct  185  EAWRRFLRLQRQCPHHGIPEWMLIQTFYNGLTHEFRIYIDAASGGSLMTKNPTEAKELIE  244

Query  361  -MLGENSQQKNIRGRTQ--GMYEVNS  429
             M   ++   N R R    G Y+V++
Sbjct  245  KMTANDNYHPNGRNRANKGGKYDVDA  270



>emb|CAN66329.1| hypothetical protein VITISV_000597 [Vitis vinifera]
Length=1643

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 84/158 (53%), Gaps = 11/158 (7%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK W   L P S++TW ++  KF+ KF+   +T  L+R+I+ F   E E F+
Sbjct  96   FPFTLKDKAKIWLNSLRPRSIQTWTDLQAKFLKKFFPTHRTNGLKRQISNFSAKENEKFY  155

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
            E WER    +  CPHHG+   L +  FYD ++ + + +++   GG    K  EEA+    
Sbjct  156  ECWERCMEAINACPHHGFDTWLLVSYFYDGMSSSMKQLLETMCGGDFMSKNPEEAMDFLN  215

Query  361  MLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELAKQM  474
             + E            GMY +N + D+   ++ + +++
Sbjct  216  YVAE-----------AGMYTLNEDIDMKAKVAAMIRKL  242



>emb|CAN82506.1| hypothetical protein VITISV_039313 [Vitis vinifera]
Length=806

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 87/155 (56%), Gaps = 2/155 (1%)
 Frame = +1

Query  1    FPYTLKDAAKTWFMFLTPGSLRTWAEVYNKFIDKFYSYTKTVELRRKITTFLQVEGEPFH  180
            FP+TLKD AK WF  L   S+R+W E+   F+ KF+   +T  L+R+IT F+ ++ E F+
Sbjct  97   FPFTLKDKAKLWFNSLRSQSIRSWLELQTTFLKKFFPIHRTSGLKRQITNFVALDNEKFY  156

Query  181  EAWERFKMLLIQCPHHGYPLELQIQTFYDSLTQTSQSIVDNAAGGSMGEKTAEEALALYE  360
              WER+  ++   PHHG+   + +  FY+ ++ T + +++   GG    K+ +EA     
Sbjct  157  ACWERYMEVVSAXPHHGFDTWMLVSYFYEGMSPTMKQLLETMCGGDFMSKSXDEAFEFLN  216

Query  361  MLGENSQQKNIRGRTQGMYEVNSNPDLIVYMSELA  465
             + E S+   +  +  G +EVN+  D  +YM + +
Sbjct  217  YVAEISRLXELEAK--GFHEVNAIYDNPIYMXQCS  249



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 546044595962