BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8401_g1_i1 len=1829 path=[1807:0-782 2590:783-1828]

Length=1829
                                                                      Score     E

ref|XP_006339196.1|  PREDICTED: cytochrome P450 82C4-like               549   0.0      
ref|XP_009801176.1|  PREDICTED: cytochrome P450 CYP82D47-like           543   0.0      
gb|ABC69375.1|  CYP82M1v4                                               540   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009616319.1|  PREDICTED: cytochrome P450 CYP82D47-like           540   0.0      
gb|ABC69374.1|  CYP82M1v3                                               538   0.0      Nicotiana tabacum [American tobacco]
ref|XP_004249377.1|  PREDICTED: cytochrome P450 82C4-like               537   0.0      
ref|XP_006352674.1|  PREDICTED: cytochrome P450 82C4-like               537   0.0      
gb|ABC69373.1|  CYP82M1v2                                               536   0.0      Nicotiana tabacum [American tobacco]
gb|ABC69376.1|  CYP82M1v5                                               536   0.0      Nicotiana tabacum [American tobacco]
gb|ABC69372.1|  CYP82M1v1                                               536   0.0      Nicotiana tabacum [American tobacco]
ref|XP_011089652.1|  PREDICTED: cytochrome P450 82C2                    528   2e-178   
ref|XP_006349946.1|  PREDICTED: cytochrome P450 82C2-like               520   6e-175   
ref|XP_009606611.1|  PREDICTED: cytochrome P450 82C4-like               515   6e-173   
gb|AJD25203.1|  cytochrome P450 CYP82V2                                 514   7e-173   
ref|XP_009348373.1|  PREDICTED: cytochrome P450 CYP82D47-like           508   2e-170   
ref|XP_008372514.1|  PREDICTED: cytochrome P450 CYP82D47-like           507   3e-170   
ref|XP_008372515.1|  PREDICTED: cytochrome P450 82C4-like               502   3e-168   
ref|XP_002300088.2|  hypothetical protein POPTR_0001s34230g             502   3e-168   Populus trichocarpa [western balsam poplar]
dbj|BAM36724.1|  nicotine N-demethylase                                 501   5e-168   
ref|XP_009761500.1|  PREDICTED: cytochrome P450 82C2-like               503   5e-168   
ref|XP_008235431.1|  PREDICTED: cytochrome P450 82C4-like               501   9e-168   
dbj|BAM36727.1|  nicotine N-demethylase                                 500   1e-167   
dbj|BAM36723.1|  nicotine N-demethylase                                 500   2e-167   
ref|XP_007200049.1|  hypothetical protein PRUPE_ppa023510mg             499   4e-167   
ref|XP_009609537.1|  PREDICTED: cytochrome P450 82C4-like               498   1e-166   
ref|XP_004248527.2|  PREDICTED: cytochrome P450 CYP82D47-like           497   3e-166   
gb|ADP65809.1|  nicotine N-demethylase                                  495   1e-165   
ref|XP_009757628.1|  PREDICTED: cytochrome P450 CYP82D47-like           495   1e-165   
dbj|BAM36726.1|  nicotine N-demethylase                                 495   1e-165   
ref|XP_009348374.1|  PREDICTED: cytochrome P450 CYP82D47-like           495   1e-165   
dbj|BAM36725.1|  nicotine N-demethylase                                 494   2e-165   
ref|XP_011045174.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    493   9e-165   
ref|XP_009627979.1|  PREDICTED: cytochrome P450 82C4-like               493   1e-164   
gb|ABD39477.1|  CYP82E4v6                                               492   2e-164   Nicotiana tabacum [American tobacco]
ref|XP_009778755.1|  PREDICTED: cytochrome P450 82C4-like               492   2e-164   
gb|ABD39479.1|  CYP82E4v8                                               492   2e-164   Nicotiana tabacum [American tobacco]
ref|XP_007201695.1|  hypothetical protein PRUPE_ppa004301mg             492   3e-164   
ref|XP_009619218.1|  PREDICTED: cytochrome P450 CYP82D47-like           491   3e-164   
gb|ABA07804.1|  cytochrome P450 monooxygenase CYP82E4v2                 491   4e-164   Nicotiana tabacum [American tobacco]
gb|ABA07807.1|  cytochrome P450 monooxygenase CYP82E3                   491   4e-164   Nicotiana tabacum [American tobacco]
gb|KDP26345.1|  hypothetical protein JCGZ_17503                         491   5e-164   
gb|ABA07805.1|  cytochrome P450 monooxygenase CYP82E4v1                 491   5e-164   Nicotiana tabacum [American tobacco]
ref|XP_002531094.1|  cytochrome P450, putative                          491   5e-164   Ricinus communis
ref|XP_009609539.1|  PREDICTED: cytochrome P450 82C4-like               491   7e-164   
gb|ABD39476.1|  CYP82E4v5                                               491   7e-164   Nicotiana tabacum [American tobacco]
ref|XP_011030904.1|  PREDICTED: cytochrome P450 82C4-like               490   1e-163   
ref|XP_011101555.1|  PREDICTED: cytochrome P450 CYP82D47-like           489   3e-163   
gb|ABX56037.1|  CYP82E5v2                                               489   3e-163   Nicotiana tabacum [American tobacco]
gb|ABC69371.1|  CYP82E5                                                 489   3e-163   Nicotiana tabacum [American tobacco]
gb|ABD39478.1|  CYP82E4v7                                               489   3e-163   Nicotiana tabacum [American tobacco]
gb|ABD39475.1|  CYP82E4v4                                               489   4e-163   Nicotiana tabacum [American tobacco]
gb|ABD39474.1|  CYP82E4v3                                               489   4e-163   Nicotiana tabacum [American tobacco]
ref|XP_006375022.1|  hypothetical protein POPTR_0014s03660g             489   4e-163   
ref|XP_007136644.1|  hypothetical protein PHAVU_009G061600g             488   9e-163   
gb|AGD93125.1|  CYP450 nicotine N-demethylase                           487   2e-162   
gb|ABD39480.1|  CYP82E4v10                                              487   2e-162   Nicotiana tabacum [American tobacco]
gb|ABD39481.1|  CYP82E4v11                                              486   3e-162   Nicotiana tabacum [American tobacco]
emb|CDP15065.1|  unnamed protein product                                486   6e-162   
ref|XP_010069626.1|  PREDICTED: cytochrome P450 CYP82D47-like           486   8e-162   
ref|XP_006473405.1|  PREDICTED: cytochrome P450 82C4-like               486   8e-162   
ref|XP_002264790.1|  PREDICTED: cytochrome P450 CYP82D47                485   9e-162   Vitis vinifera
ref|XP_011045172.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    486   1e-161   
gb|ABD39482.1|  CYP82E4v12                                              485   1e-161   Nicotiana tabacum [American tobacco]
ref|XP_009758062.1|  PREDICTED: cytochrome P450 82C4-like               483   2e-161   
ref|XP_006434890.1|  hypothetical protein CICLE_v10003803mg             484   3e-161   
ref|XP_007227272.1|  hypothetical protein PRUPE_ppa017703mg             484   4e-161   
ref|XP_010069627.1|  PREDICTED: cytochrome P450 CYP82D47-like           484   6e-161   
ref|XP_004241385.1|  PREDICTED: cytochrome P450 82C2-like               483   2e-160   
gb|KDO84376.1|  hypothetical protein CISIN_1g036812mg                   481   3e-160   
ref|XP_010106089.1|  Cytochrome P450 82C4                               481   4e-160   
ref|XP_003635525.2|  PREDICTED: cytochrome P450 CYP82D47-like           480   1e-159   
gb|ABR57311.1|  cytochrome P450 monooxygenase                           478   5e-159   Nicotiana sylvestris
ref|XP_004236938.1|  PREDICTED: cytochrome P450 82C4-like               478   6e-159   
ref|XP_010069621.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    479   6e-159   
gb|KCW58034.1|  hypothetical protein EUGRSUZ_H00762                     478   7e-159   
ref|XP_008378409.1|  PREDICTED: cytochrome P450 82C4-like               478   1e-158   
ref|XP_002264464.1|  PREDICTED: cytochrome P450 CYP82D47                477   1e-158   Vitis vinifera
emb|CAN77159.1|  hypothetical protein VITISV_019026                     480   2e-158   Vitis vinifera
ref|XP_003523888.1|  PREDICTED: cytochrome P450 82C4-like               475   1e-157   
gb|ABD39485.1|  CYP82E2v4                                               474   2e-157   Nicotiana tabacum [American tobacco]
ref|XP_008235430.1|  PREDICTED: cytochrome P450 CYP82D47-like           474   2e-157   
ref|XP_002323130.1|  hypothetical protein POPTR_0016s00980g             473   2e-157   Populus trichocarpa [western balsam poplar]
gb|KDP26346.1|  hypothetical protein JCGZ_17504                         473   6e-157   
gb|ABA07806.2|  cytochrome P450 monooxygenase CYP82E2                   473   6e-157   Nicotiana tabacum [American tobacco]
ref|XP_009364162.1|  PREDICTED: cytochrome P450 82C4-like               473   9e-157   
ref|XP_004292356.1|  PREDICTED: cytochrome P450 82C4-like               471   9e-157   
ref|XP_011040244.1|  PREDICTED: cytochrome P450 82C4-like               473   1e-156   
ref|XP_004517185.1|  PREDICTED: cytochrome P450 82C4-like               472   2e-156   
gb|ABD39483.1|  CYP82E2v2                                               470   9e-156   Nicotiana tabacum [American tobacco]
ref|XP_006432712.1|  hypothetical protein CICLE_v10000809mg             470   1e-155   
emb|CDP03915.1|  unnamed protein product                                468   2e-155   
gb|KDO40892.1|  hypothetical protein CISIN_1g009347mg                   469   3e-155   
gb|ABD39484.1|  CYP82E2v3                                               468   5e-155   Nicotiana tabacum [American tobacco]
ref|XP_002284031.1|  PREDICTED: cytochrome P450 82C4                    466   3e-154   Vitis vinifera
ref|XP_002274740.1|  PREDICTED: cytochrome P450 CYP82D47                465   9e-154   Vitis vinifera
ref|XP_009599169.1|  PREDICTED: cytochrome P450 82C4-like               464   2e-153   
ref|XP_007134137.1|  hypothetical protein PHAVU_010G022400g             464   2e-153   
ref|XP_007017403.1|  Cytochrome P450, family 82, subfamily C, pol...    464   3e-153   
ref|XP_007049687.1|  Cytochrome P450 82A3, putative                     462   9e-153   
ref|XP_007049681.1|  Cytochrome P450                                    462   1e-152   
gb|KEH25406.1|  cytochrome P450 family protein                          461   2e-152   
ref|XP_010264712.1|  PREDICTED: cytochrome P450 CYP82D47-like           461   2e-152   
ref|XP_010253830.1|  PREDICTED: cytochrome P450 CYP82D47-like           461   4e-152   
ref|XP_003548652.1|  PREDICTED: cytochrome P450 82C4-like               461   4e-152   
ref|XP_006355071.1|  PREDICTED: cytochrome P450 82C4-like               461   5e-152   
ref|XP_002264520.2|  PREDICTED: cytochrome P450 82C4                    461   8e-152   Vitis vinifera
ref|XP_010091295.1|  Cytochrome P450 82G1                               461   1e-151   
emb|CAN81014.1|  hypothetical protein VITISV_025152                     459   2e-151   Vitis vinifera
ref|XP_002264473.1|  PREDICTED: cytochrome P450 82C4-like               458   3e-151   Vitis vinifera
ref|XP_002274509.1|  PREDICTED: cytochrome P450 CYP82D47-like           459   4e-151   Vitis vinifera
emb|CDP00859.1|  unnamed protein product                                456   3e-150   
ref|XP_007047111.1|  Cytochrome P450                                    456   3e-150   
ref|XP_004510285.1|  PREDICTED: uncharacterized protein LOC101505071    472   4e-150   
ref|XP_007049686.1|  Cytochrome P450, family 82, subfamily C, pol...    457   8e-150   
ref|XP_010104162.1|  Cytochrome P450 82C4                               453   9e-150   
gb|AJD25202.1|  cytochrome P450 CYP82U4                                 454   2e-149   
ref|XP_007222622.1|  hypothetical protein PRUPE_ppa004175mg             453   4e-149   
emb|CDP15728.1|  unnamed protein product                                452   1e-148   
ref|XP_006342717.1|  PREDICTED: cytochrome P450 82C4-like               452   1e-148   
ref|XP_004252778.1|  PREDICTED: cytochrome P450 82C4-like               451   2e-148   
ref|XP_010547839.1|  PREDICTED: cytochrome P450 82C4-like               450   3e-148   
emb|CAN61061.1|  hypothetical protein VITISV_018742                     451   4e-148   Vitis vinifera
gb|KHG07864.1|  Cytochrome P450 protein                                 450   5e-148   
emb|CBI29738.3|  unnamed protein product                                457   6e-148   
ref|XP_007017417.1|  Cytochrome P450 82A3, putative isoform 2           450   7e-148   
ref|XP_002531093.1|  cytochrome P450, putative                          449   2e-147   Ricinus communis
ref|XP_011008137.1|  PREDICTED: cytochrome P450 82G1-like               449   2e-147   
gb|KHG29587.1|  Cytochrome P450 protein                                 449   2e-147   
emb|CDP15727.1|  unnamed protein product                                451   2e-147   
ref|XP_008796321.1|  PREDICTED: cytochrome P450 CYP82D47-like           449   2e-147   
ref|XP_008464765.1|  PREDICTED: cytochrome P450 CYP82D47-like           448   2e-147   
ref|XP_006443549.1|  hypothetical protein CICLE_v10019706mg             448   3e-147   
ref|XP_009365841.1|  PREDICTED: cytochrome P450 CYP82D47-like           448   4e-147   
ref|XP_010437977.1|  PREDICTED: cytochrome P450 82C4-like               448   4e-147   
ref|XP_006423133.1|  hypothetical protein CICLE_v10028201mg             448   4e-147   
emb|CBI36491.3|  unnamed protein product                                447   4e-146   
ref|XP_011039260.1|  PREDICTED: cytochrome P450 CYP82D47-like           445   4e-146   
ref|XP_010436299.1|  PREDICTED: cytochrome P450 82C4-like               445   7e-146   
ref|XP_006443550.1|  hypothetical protein CICLE_v10019727mg             444   1e-145   
ref|XP_009109920.1|  PREDICTED: cytochrome P450 82C4                    444   2e-145   
ref|XP_007017416.1|  Cytochrome P450 82A3, putative isoform 1           451   6e-145   
ref|XP_010445016.1|  PREDICTED: cytochrome P450 82C4-like               442   1e-144   
ref|XP_009364189.1|  PREDICTED: cytochrome P450 82A3-like               442   1e-144   
ref|XP_002284806.1|  PREDICTED: cytochrome P450 CYP82D47                442   1e-144   Vitis vinifera
emb|CDY53704.1|  BnaC03g67210D                                          441   1e-144   
ref|XP_002305292.2|  hypothetical protein POPTR_0004s10630g             441   2e-144   Populus trichocarpa [western balsam poplar]
ref|XP_010069622.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    439   2e-144   
ref|XP_010451089.1|  PREDICTED: cytochrome P450 82C4                    441   2e-144   
emb|CDY23316.1|  BnaA08g12300D                                          441   2e-144   
ref|XP_007134140.1|  hypothetical protein PHAVU_010G022700g             441   3e-144   
ref|XP_010664626.1|  PREDICTED: cytochrome P450 CYP82D47                440   5e-144   
ref|XP_002282111.2|  PREDICTED: cytochrome P450 82A3-like               439   7e-144   Vitis vinifera
ref|XP_002869304.1|  CYP82C4                                            439   1e-143   
gb|KFK29809.1|  hypothetical protein AALP_AA7G181800                    439   1e-143   
ref|XP_006340061.1|  PREDICTED: cytochrome P450 82C4-like               438   2e-143   
ref|XP_010934114.1|  PREDICTED: cytochrome P450 82C4-like               439   2e-143   
emb|CAN66846.1|  hypothetical protein VITISV_002367                     439   2e-143   Vitis vinifera
gb|KEH18125.1|  cytochrome P450 family protein                          437   3e-143   
emb|CAN74205.1|  hypothetical protein VITISV_031127                     438   3e-143   Vitis vinifera
ref|XP_007017415.1|  Cytochrome P450, putative                          438   4e-143   
ref|XP_010028533.1|  PREDICTED: cytochrome P450 CYP82D47-like           437   5e-143   
ref|XP_004291926.1|  PREDICTED: cytochrome P450 82A3-like               438   6e-143   
ref|XP_006376421.1|  cytochrome P450 family protein                     437   7e-143   
ref|XP_004154826.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    437   1e-142   
ref|XP_002282085.3|  PREDICTED: cytochrome P450 82A1-like               452   1e-142   Vitis vinifera
ref|XP_010919967.1|  PREDICTED: cytochrome P450 CYP82D47-like           436   1e-142   
gb|KGN59914.1|  hypothetical protein Csa_3G852630                       437   1e-142   
ref|XP_004147803.1|  PREDICTED: cytochrome P450 82C4-like               436   2e-142   
ref|XP_010432796.1|  PREDICTED: cytochrome P450 82C4-like               436   2e-142   
ref|XP_006346673.1|  PREDICTED: cytochrome P450 82C4-like               435   3e-142   
ref|XP_004247061.1|  PREDICTED: cytochrome P450 82C4-like               435   3e-142   
dbj|BAF98469.1|  cytochrome P450                                        435   3e-142   Coptis japonica var. dissecta
gb|KDP38438.1|  hypothetical protein JCGZ_04363                         436   3e-142   
gb|ABK55756.1|  P450 monooxygenase-like protein                         435   4e-142   Stylosanthes guianensis [stylo]
ref|XP_009768110.1|  PREDICTED: cytochrome P450 82A4-like               435   5e-142   
ref|XP_002282118.1|  PREDICTED: cytochrome P450 CYP82D47-like           435   5e-142   Vitis vinifera
ref|XP_002282133.1|  PREDICTED: cytochrome P450 CYP82D47                435   5e-142   Vitis vinifera
ref|XP_009595933.1|  PREDICTED: cytochrome P450 82A4-like               434   7e-142   
ref|NP_194922.1|  cytochrome P450, family 82, subfamily C, polype...    434   7e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009801068.1|  PREDICTED: cytochrome P450 82C4-like               432   1e-141   
ref|XP_009780811.1|  PREDICTED: cytochrome P450 82C4-like               440   1e-141   
ref|XP_010447469.1|  PREDICTED: cytochrome P450 82C4-like               434   1e-141   
ref|NP_001236179.1|  cytochrome P450 CYP82C1                            434   2e-141   
ref|XP_002283952.2|  PREDICTED: cytochrome P450 CYP82D47-like           433   2e-141   Vitis vinifera
ref|XP_006283535.1|  hypothetical protein CARUB_v10004585mg             433   2e-141   
emb|CAN65652.1|  hypothetical protein VITISV_016780                     431   3e-141   Vitis vinifera
gb|KDP38427.1|  hypothetical protein JCGZ_04352                         433   3e-141   
gb|KDO42182.1|  hypothetical protein CISIN_1g046041mg                   433   3e-141   
emb|CDP07595.1|  unnamed protein product                                444   4e-141   
ref|XP_002510313.1|  cytochrome P450, putative                          432   4e-141   Ricinus communis
ref|XP_009364178.1|  PREDICTED: cytochrome P450 CYP82D47-like           432   4e-141   
emb|CAN75482.1|  hypothetical protein VITISV_020998                     431   4e-141   Vitis vinifera
emb|CAN64371.1|  hypothetical protein VITISV_016844                     432   5e-141   Vitis vinifera
gb|KCW68803.1|  hypothetical protein EUGRSUZ_F02402                     432   5e-141   
ref|XP_010064743.1|  PREDICTED: cytochrome P450 CYP82D47-like           432   7e-141   
ref|XP_006423130.1|  hypothetical protein CICLE_v10030016mg             432   7e-141   
ref|XP_010064744.1|  PREDICTED: cytochrome P450 CYP82D47-like           432   8e-141   
gb|KEH18124.1|  cytochrome P450 family 82 protein                       429   1e-140   
emb|CBI32510.3|  unnamed protein product                                434   2e-140   
ref|XP_007156852.1|  hypothetical protein PHAVU_002G022900g             431   2e-140   
ref|XP_003547786.2|  PREDICTED: cytochrome P450 82C2-like               431   2e-140   
ref|XP_007017410.1|  Cytochrome P450 82A3, putative                     434   3e-140   
ref|XP_007201702.1|  hypothetical protein PRUPE_ppa004095mg             430   3e-140   
gb|KCW68806.1|  hypothetical protein EUGRSUZ_F02405                     430   4e-140   
ref|XP_002284810.3|  PREDICTED: cytochrome P450 CYP82D47                433   4e-140   Vitis vinifera
ref|XP_007224041.1|  hypothetical protein PRUPE_ppa015200mg             429   5e-140   
ref|XP_003537400.1|  PREDICTED: cytochrome P450 82A3-like               430   5e-140   
ref|XP_011037409.1|  PREDICTED: cytochrome P450 82G1-like               429   5e-140   
ref|XP_010106082.1|  Cytochrome P450 82A3                               430   6e-140   
ref|XP_006432714.1|  hypothetical protein CICLE_v10000845mg             429   6e-140   
emb|CBI37514.3|  unnamed protein product                                447   6e-140   
gb|KDO40894.1|  hypothetical protein CISIN_1g009786mg                   429   6e-140   
emb|CBI40977.3|  unnamed protein product                                429   9e-140   
ref|XP_007017413.1|  Cytochrome P450                                    429   1e-139   
ref|XP_008220885.1|  PREDICTED: cytochrome P450 82A3-like               444   1e-139   
gb|KDP26347.1|  hypothetical protein JCGZ_17505                         429   1e-139   
ref|XP_006432711.1|  hypothetical protein CICLE_v10003589mg             427   1e-139   
ref|XP_007017411.1|  Cytochrome P450, putative                          429   1e-139   
ref|XP_010028535.1|  PREDICTED: cytochrome P450 CYP82D47-like           429   1e-139   
ref|XP_008235427.1|  PREDICTED: cytochrome P450 82G1-like               429   2e-139   
ref|XP_010064745.1|  PREDICTED: cytochrome P450 CYP82D47-like           429   2e-139   
ref|XP_003548649.2|  PREDICTED: cytochrome P450 82C2-like               429   2e-139   
ref|XP_002282035.1|  PREDICTED: cytochrome P450 CYP82D47-like           428   3e-139   Vitis vinifera
ref|XP_002510298.1|  cytochrome P450, putative                          427   3e-139   Ricinus communis
ref|XP_003516592.1|  PREDICTED: cytochrome P450 82A3-like isoform X1    428   3e-139   
ref|XP_007224171.1|  hypothetical protein PRUPE_ppa016912mg             427   3e-139   
ref|XP_011030967.1|  PREDICTED: cytochrome P450 CYP82D47-like           428   3e-139   
gb|KCW68807.1|  hypothetical protein EUGRSUZ_F02406                     427   4e-139   
gb|ABC69420.1|  CYP82E8                                                 427   4e-139   Nicotiana tabacum [American tobacco]
gb|KDP26344.1|  hypothetical protein JCGZ_17502                         427   4e-139   
gb|KHN36187.1|  Cytochrome P450 82A3                                    427   5e-139   
ref|XP_007017414.1|  Cytochrome P450 82A3, putative                     434   7e-139   
gb|KCW58033.1|  hypothetical protein EUGRSUZ_H00761                     427   7e-139   
ref|XP_006375031.1|  hypothetical protein POPTR_0014s03760g             427   7e-139   
ref|XP_007047112.1|  Cytochrome P450                                    432   8e-139   
ref|XP_006432704.1|  hypothetical protein CICLE_v10000846mg             426   9e-139   
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                    434   1e-138   Vitis vinifera
ref|XP_006573615.1|  PREDICTED: cytochrome P450 82A3-like isoform X2    426   1e-138   
ref|XP_006471151.1|  PREDICTED: cytochrome P450 82C4-like               427   1e-138   
gb|KDP38423.1|  hypothetical protein JCGZ_04348                         427   2e-138   
ref|XP_006375032.1|  hypothetical protein POPTR_0014s03770g             426   2e-138   
ref|XP_011030916.1|  PREDICTED: cytochrome P450 CYP82D47-like           426   2e-138   
ref|XP_006366435.1|  PREDICTED: cytochrome P450 82A3-like               425   3e-138   
ref|XP_010918630.1|  PREDICTED: cytochrome P450 82C4-like               424   3e-138   
ref|XP_008372516.1|  PREDICTED: cytochrome P450 82G1-like               425   4e-138   
ref|XP_006573616.1|  PREDICTED: cytochrome P450 82A3-like isoform X3    425   4e-138   
gb|KHN42044.1|  Cytochrome P450 82A3                                    425   4e-138   
gb|KHN36186.1|  Cytochrome P450 82A3                                    425   4e-138   
ref|XP_002869302.1|  CYP82C4                                            424   5e-138   
ref|XP_008235428.1|  PREDICTED: cytochrome P450 82G1-like               425   5e-138   
ref|XP_010664625.1|  PREDICTED: cytochrome P450 CYP82D47-like           424   6e-138   
dbj|BAA35080.1|  putative cytochrome P450                               424   7e-138   Nicotiana tabacum [American tobacco]
ref|XP_006375029.1|  putative cytochrome P450 family protein            424   8e-138   
gb|KDP45301.1|  hypothetical protein JCGZ_15166                         424   9e-138   
ref|XP_006486179.1|  PREDICTED: cytochrome P450 82C4-like               424   1e-137   
gb|KHG26594.1|  Cytochrome P450                                         424   1e-137   
ref|XP_009792748.1|  PREDICTED: cytochrome P450 CYP82D47-like           423   2e-137   
ref|XP_007201144.1|  hypothetical protein PRUPE_ppa016050mg             422   2e-137   
ref|XP_011005663.1|  PREDICTED: cytochrome P450 CYP82D47-like           422   3e-137   
ref|XP_006486181.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    422   3e-137   
ref|XP_009770601.1|  PREDICTED: cytochrome P450 CYP82D47-like           422   3e-137   
gb|KDO39483.1|  hypothetical protein CISIN_1g009723mg                   422   4e-137   
ref|XP_006464328.1|  PREDICTED: cytochrome P450 82C4-like               422   4e-137   
ref|XP_006465163.1|  PREDICTED: cytochrome P450 82C4-like               422   7e-137   
ref|XP_002281431.2|  PREDICTED: cytochrome P450 82C4                    421   8e-137   Vitis vinifera
ref|XP_004306669.1|  PREDICTED: cytochrome P450 82A3-like               422   8e-137   
ref|XP_010526010.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    421   8e-137   
ref|XP_010647827.1|  PREDICTED: cytochrome P450 CYP82D47                421   1e-136   
ref|XP_006435903.1|  hypothetical protein CICLE_v10031215mg             421   1e-136   
ref|XP_006375030.1|  hypothetical protein POPTR_0014s03750g             421   2e-136   
ref|XP_006471495.1|  PREDICTED: cytochrome P450 82C4-like               421   2e-136   
ref|XP_002510312.1|  cytochrome P450, putative                          420   2e-136   Ricinus communis
ref|XP_010106079.1|  Cytochrome P450 82A3                               421   2e-136   
ref|XP_006427755.1|  hypothetical protein CICLE_v10025349mg             421   2e-136   
ref|NP_194925.1|  cytochrome P450, family 82, subfamily C, polype...    420   2e-136   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28662.1|  unknown                                                 420   2e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011030924.1|  PREDICTED: cytochrome P450 CYP82D47-like           420   2e-136   
ref|XP_004291927.1|  PREDICTED: cytochrome P450 82A3-like               420   3e-136   
ref|XP_010092357.1|  Cytochrome P450 82A3                               420   3e-136   
ref|XP_006471496.1|  PREDICTED: cytochrome P450 82C4-like               420   4e-136   
ref|XP_003523886.1|  PREDICTED: cytochrome P450 82A1-like               420   4e-136   
ref|XP_010526011.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    419   4e-136   
emb|CAN66023.1|  hypothetical protein VITISV_042713                     418   5e-136   
ref|XP_010696237.1|  PREDICTED: cytochrome P450 82G1                    419   7e-136   
gb|KHN04536.1|  Cytochrome P450 82A1                                    417   8e-136   
ref|XP_010106088.1|  Cytochrome P450 82A4                               419   8e-136   
ref|XP_010061806.1|  PREDICTED: cytochrome P450 CYP82D47-like           419   1e-135   
gb|AAS90126.1|  cytochrome P450                                         419   1e-135   
ref|XP_007222623.1|  hypothetical protein PRUPE_ppa004179mg             418   1e-135   
gb|AJD25201.1|  cytochrome P450 CYP82D71                                417   2e-135   
ref|XP_008343753.1|  PREDICTED: cytochrome P450 CYP82D47-like           418   2e-135   
ref|XP_010106083.1|  Cytochrome P450 82A3                               417   3e-135   
ref|XP_003634362.2|  PREDICTED: cytochrome P450 CYP82D47-like           417   4e-135   
gb|KCW68808.1|  hypothetical protein EUGRSUZ_F02407                     418   4e-135   
ref|XP_008464764.1|  PREDICTED: cytochrome P450 CYP82D47-like           416   6e-135   
ref|XP_002281361.1|  PREDICTED: cytochrome P450 82C4                    416   6e-135   
ref|XP_006473406.1|  PREDICTED: cytochrome P450 82A3-like               416   7e-135   
gb|KDP38434.1|  hypothetical protein JCGZ_04359                         417   7e-135   
ref|XP_007134139.1|  hypothetical protein PHAVU_010G022600g             417   7e-135   
gb|KHN42045.1|  Cytochrome P450 82C4                                    414   7e-135   
ref|XP_006379218.1|  hypothetical protein POPTR_0009s11180g             415   9e-135   
ref|XP_009341185.1|  PREDICTED: cytochrome P450 CYP82D47-like           416   1e-134   
gb|KHG01223.1|  Cytochrome P450 protein                                 416   1e-134   
ref|XP_006418652.1|  hypothetical protein EUTSA_v10002489mg             416   1e-134   
ref|XP_010547840.1|  PREDICTED: cytochrome P450 82C4-like               416   1e-134   
ref|XP_010046449.1|  PREDICTED: cytochrome P450 CYP82D47-like           416   1e-134   
gb|KDO84377.1|  hypothetical protein CISIN_1g009899mg                   416   1e-134   
ref|XP_006435895.1|  hypothetical protein CICLE_v10031217mg             416   1e-134   
ref|XP_004147802.1|  PREDICTED: cytochrome P450 82A4-like               415   2e-134   
emb|CDP16080.1|  unnamed protein product                                416   2e-134   
ref|XP_006464300.1|  PREDICTED: cytochrome P450 82C4-like               415   2e-134   
gb|KCW85809.1|  hypothetical protein EUGRSUZ_B02554                     414   2e-134   
ref|XP_006432710.1|  hypothetical protein CICLE_v10000851mg             415   3e-134   
ref|XP_008464766.1|  PREDICTED: cytochrome P450 CYP82D47-like           414   3e-134   
ref|XP_006434891.1|  hypothetical protein CICLE_v10000852mg             414   4e-134   
gb|KDP29948.1|  hypothetical protein JCGZ_18517                         414   5e-134   
ref|XP_010248151.1|  PREDICTED: cytochrome P450 82C4-like               412   5e-134   
emb|CAN76287.1|  hypothetical protein VITISV_027433                     415   5e-134   
ref|XP_010070486.1|  PREDICTED: cytochrome P450 CYP82D47-like           414   5e-134   
ref|XP_006464298.1|  PREDICTED: cytochrome P450 82C4-like               414   6e-134   
ref|XP_009364766.1|  PREDICTED: cytochrome P450 82A3-like               414   6e-134   
gb|KDP38432.1|  hypothetical protein JCGZ_04357                         414   6e-134   
gb|KHG24650.1|  Cytochrome P450 protein                                 413   7e-134   
gb|KDO65988.1|  hypothetical protein CISIN_1g011292mg                   412   8e-134   
ref|XP_008355522.1|  PREDICTED: cytochrome P450 CYP82D47-like           414   9e-134   
emb|CBI19611.3|  unnamed protein product                                426   9e-134   
ref|XP_003554125.1|  PREDICTED: cytochrome P450 82A4-like               414   1e-133   
ref|XP_006435899.1|  hypothetical protein CICLE_v10031216mg             414   1e-133   
ref|XP_010061805.1|  PREDICTED: cytochrome P450 CYP82D47-like           414   1e-133   
ref|XP_007226343.1|  hypothetical protein PRUPE_ppa022174mg             413   1e-133   
ref|XP_009348372.1|  PREDICTED: cytochrome P450 82G1-like               414   1e-133   
ref|XP_008355533.1|  PREDICTED: cytochrome P450 CYP82D47-like           413   1e-133   
emb|CAN64501.1|  hypothetical protein VITISV_020341                     410   2e-133   
ref|XP_008378401.1|  PREDICTED: cytochrome P450 CYP82D47-like           413   2e-133   
gb|ABB20912.1|  P450 mono-oxygenase                                     413   2e-133   
ref|XP_009336438.1|  PREDICTED: cytochrome P450 82A3-like               413   2e-133   
ref|XP_008382594.1|  PREDICTED: cytochrome P450 82G1-like               413   2e-133   
ref|XP_009364774.1|  PREDICTED: cytochrome P450 82A3-like               412   3e-133   
gb|KDP38433.1|  hypothetical protein JCGZ_04358                         410   4e-133   
ref|XP_009372222.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    412   4e-133   
ref|XP_003618345.1|  Cytochrome P450                                    412   5e-133   
ref|XP_008378426.1|  PREDICTED: cytochrome P450 CYP82D47-like           412   5e-133   
ref|XP_007222593.1|  hypothetical protein PRUPE_ppa004169mg             412   5e-133   
ref|XP_009336429.1|  PREDICTED: cytochrome P450 82A3-like               412   5e-133   
ref|XP_006464299.1|  PREDICTED: cytochrome P450 82C4-like               411   6e-133   
ref|XP_009336967.1|  PREDICTED: cytochrome P450 82A4-like               411   6e-133   
gb|AGF30366.1|  CYP450 monooxygenase CYP82D62                           411   8e-133   
ref|XP_008245476.1|  PREDICTED: cytochrome P450 CYP82D47-like           411   9e-133   
ref|XP_004147820.1|  PREDICTED: cytochrome P450 82C4-like               411   1e-132   
ref|XP_010036785.1|  PREDICTED: cytochrome P450 82G1                    410   1e-132   
gb|KHN13272.1|  Cytochrome P450 82A4                                    410   1e-132   
gb|AAC39454.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   412   2e-132   
ref|XP_003554118.2|  PREDICTED: cytochrome P450 82A4-like               411   2e-132   
ref|XP_010513989.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    410   2e-132   
ref|XP_002885694.1|  CYP82G1                                            410   2e-132   
ref|XP_009364169.1|  PREDICTED: cytochrome P450 CYP82D47-like           410   2e-132   
ref|XP_003543523.2|  PREDICTED: cytochrome P450 82A4-like               410   2e-132   
ref|XP_003554859.1|  PREDICTED: cytochrome P450 82A4-like               410   3e-132   
ref|XP_010249368.1|  PREDICTED: cytochrome P450 CYP82D47-like           410   4e-132   
ref|NP_189154.1|  cytochrome P450, family 82, subfamily G, polype...    409   5e-132   
ref|XP_008391540.1|  PREDICTED: cytochrome P450 82A4-like               409   6e-132   
ref|XP_007226598.1|  hypothetical protein PRUPE_ppa023495mg             408   8e-132   
ref|XP_009795251.1|  PREDICTED: cytochrome P450 CYP82D47-like           408   9e-132   
ref|XP_009336448.1|  PREDICTED: cytochrome P450 82A3-like               408   1e-131   
ref|XP_008388075.1|  PREDICTED: cytochrome P450 82A3-like               408   2e-131   
ref|XP_007225086.1|  hypothetical protein PRUPE_ppa017464mg             407   2e-131   
gb|KHN34164.1|  Cytochrome P450 82A4                                    407   3e-131   
ref|XP_002510297.1|  cytochrome P450, putative                          407   3e-131   
ref|XP_006366471.1|  PREDICTED: cytochrome P450 82A3-like               407   3e-131   
gb|KGN59915.1|  Cytochrome P450                                         407   3e-131   
ref|XP_008236910.1|  PREDICTED: cytochrome P450 CYP82D47-like           407   4e-131   
gb|KDP38424.1|  hypothetical protein JCGZ_04349                         406   7e-131   
ref|XP_010527266.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    406   7e-131   
ref|XP_008382597.1|  PREDICTED: cytochrome P450 82G1-like               406   8e-131   
ref|XP_004488195.1|  PREDICTED: cytochrome P450 82A3-like               405   9e-131   
ref|XP_004291928.1|  PREDICTED: cytochrome P450 82A4-like               406   1e-130   
gb|AGO03797.1|  cytochrome P450-like protein                            405   1e-130   
ref|XP_007151141.1|  hypothetical protein PHAVU_004G021200g             405   1e-130   
ref|XP_010527267.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    405   1e-130   
ref|XP_009372224.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    406   1e-130   
ref|XP_007151142.1|  hypothetical protein PHAVU_004G021300g             405   2e-130   
ref|XP_009372225.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    405   3e-130   
ref|NP_001240972.1|  cytochrome P450 82A3                               405   3e-130   
emb|CBI32505.3|  unnamed protein product                                419   3e-130   
ref|XP_009372223.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    405   3e-130   
ref|XP_010466938.1|  PREDICTED: cytochrome P450 82G1-like               404   5e-130   
ref|XP_003618354.1|  Cytochrome P450                                    404   6e-130   
gb|AGF30364.1|  CYP450 monooxygenase CYP82D33                           404   6e-130   
ref|XP_010060880.1|  PREDICTED: cytochrome P450 CYP82D47-like           404   7e-130   
gb|KCW52083.1|  hypothetical protein EUGRSUZ_J01518                     404   7e-130   
ref|XP_010527265.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    403   9e-130   
gb|KDO42181.1|  hypothetical protein CISIN_1g009844mg                   403   9e-130   
gb|KHN16362.1|  Cytochrome P450 82A3                                    403   1e-129   
ref|XP_010040235.1|  PREDICTED: cytochrome P450 CYP82D47-like           403   1e-129   
ref|XP_006432669.1|  hypothetical protein CICLE_v10000844mg             403   1e-129   
ref|XP_008466638.1|  PREDICTED: cytochrome P450 CYP82D47-like           403   1e-129   
ref|XP_004147804.1|  PREDICTED: cytochrome P450 82C4-like               403   1e-129   
ref|XP_006471473.1|  PREDICTED: cytochrome P450 82A3-like               403   1e-129   
ref|XP_010527268.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    403   1e-129   
ref|XP_009364154.1|  PREDICTED: cytochrome P450 CYP82D47-like           402   2e-129   
ref|XP_006856215.1|  hypothetical protein AMTR_s00059p00202900          407   2e-129   
ref|XP_003528211.2|  PREDICTED: cytochrome P450 82A1-like               403   2e-129   
ref|XP_009336944.1|  PREDICTED: cytochrome P450 82A3-like               402   2e-129   
ref|XP_008351399.1|  PREDICTED: cytochrome P450 82A4-like               402   3e-129   
gb|KDP38422.1|  hypothetical protein JCGZ_04347                         402   3e-129   
ref|XP_004154898.1|  PREDICTED: cytochrome P450 82A3-like               401   3e-129   
ref|XP_008343493.1|  PREDICTED: cytochrome P450 82A3-like               402   4e-129   
ref|XP_006375025.1|  hypothetical protein POPTR_0014s03700g             403   4e-129   
ref|XP_007207908.1|  hypothetical protein PRUPE_ppa019731mg             400   5e-129   
ref|XP_003618361.1|  Cytochrome P450                                    401   6e-129   
ref|XP_004293232.1|  PREDICTED: cytochrome P450 82A3-like               399   6e-129   
ref|XP_007041355.1|  Cytochrome P450 82C4, putative isoform 1           404   6e-129   
ref|XP_006486180.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    401   9e-129   
gb|KHN00733.1|  Cytochrome P450 82A4                                    400   1e-128   
ref|XP_007151145.1|  hypothetical protein PHAVU_004G021600g             400   1e-128   
ref|XP_007151146.1|  hypothetical protein PHAVU_004G021700g             400   2e-128   
ref|XP_007017409.1|  Cytochrome P450, family 82, subfamily C, pol...    400   2e-128   
ref|XP_008228483.1|  PREDICTED: cytochrome P450 CYP82D47-like           400   2e-128   
ref|XP_003554074.1|  PREDICTED: cytochrome P450 82A3-like               400   2e-128   
ref|XP_008388170.1|  PREDICTED: cytochrome P450 82A3-like               400   2e-128   
ref|XP_002510308.1|  cytochrome P450, putative                          399   3e-128   
ref|XP_011030958.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    399   3e-128   
ref|XP_010089020.1|  Cytochrome P450 82A3                               399   3e-128   
ref|XP_007136643.1|  hypothetical protein PHAVU_009G061500g             399   3e-128   
ref|XP_007151143.1|  hypothetical protein PHAVU_004G021400g             399   3e-128   
ref|XP_010106080.1|  Cytochrome P450 82A3                               403   4e-128   
emb|CDP15067.1|  unnamed protein product                                397   5e-128   
gb|KHN16363.1|  Cytochrome P450 82A4                                    399   5e-128   
ref|XP_007017404.1|  Cytochrome P450 82A3, putative                     399   5e-128   
ref|XP_003519977.1|  PREDICTED: cytochrome P450 82A4-like               399   5e-128   
gb|AII31758.1|  cytochrome P450 monooxygenase                           398   6e-128   
gb|KHG01290.1|  Cytochrome P450                                         398   7e-128   
ref|XP_003619141.1|  Cytochrome P450                                    398   9e-128   
gb|KCW44328.1|  hypothetical protein EUGRSUZ_L02217                     397   1e-127   
emb|CDP07593.1|  unnamed protein product                                395   1e-127   
ref|XP_008345296.1|  PREDICTED: cytochrome P450 CYP82D47-like           398   1e-127   
ref|XP_006432705.1|  hypothetical protein CICLE_v10001118mg             395   1e-127   
gb|AES74583.2|  cytochrome P450 family 82 protein                       398   1e-127   
gb|KHG29695.1|  Cytochrome P450                                         397   2e-127   
ref|XP_004238201.1|  PREDICTED: cytochrome P450 CYP82D47-like           397   2e-127   
ref|XP_003618365.1|  Cytochrome P450                                    397   2e-127   
gb|AGN54072.1|  cytochrome P450 monooxygenase                           397   2e-127   
ref|XP_002885686.1|  CYP82G1                                            397   3e-127   
ref|XP_008219217.1|  PREDICTED: cytochrome P450 82A3-like               397   3e-127   
gb|AII31759.1|  cytochrome P450 monooxygenase                           397   3e-127   
gb|KHG29694.1|  Cytochrome P450                                         397   3e-127   
gb|AII31760.1|  cytochrome P450 monooxygenase                           396   3e-127   
ref|XP_011030947.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    397   4e-127   
ref|XP_010070484.1|  PREDICTED: cytochrome P450 CYP82D47-like           397   4e-127   
dbj|BAF98472.1|  cytochrome P450                                        397   4e-127   
gb|AAG09208.1|AF175278_1  wound-inducible P450 hydroxylase              397   5e-127   
ref|XP_003517019.1|  PREDICTED: cytochrome P450 82A4-like               395   8e-127   
gb|AFK79026.1|  cytochrome P450 CYP82T1                                 395   8e-127   
ref|XP_010527272.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    394   9e-127   
ref|XP_007133366.1|  hypothetical protein PHAVU_011G173200g             395   9e-127   
ref|XP_007151148.1|  hypothetical protein PHAVU_004G021900g             396   1e-126   
ref|XP_003619137.1|  Cytochrome P450                                    395   1e-126   
ref|XP_010527271.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    394   1e-126   
ref|XP_009804510.1|  PREDICTED: cytochrome P450 CYP82D47-like           395   2e-126   
ref|XP_006297446.1|  hypothetical protein CARUB_v10013469mg             394   2e-126   
ref|XP_009136105.1|  PREDICTED: cytochrome P450 82G1                    394   2e-126   
gb|KCW67753.1|  hypothetical protein EUGRSUZ_F01486                     394   2e-126   
ref|XP_006471191.1|  PREDICTED: cytochrome P450 82C4-like               395   3e-126   
ref|XP_010527270.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    394   3e-126   
ref|XP_010060877.1|  PREDICTED: cytochrome P450 CYP82D47-like           394   3e-126   
ref|XP_010070483.1|  PREDICTED: cytochrome P450 CYP82D47-like           394   3e-126   
gb|KEH33015.1|  cytochrome P450 family 82 protein                       394   3e-126   
ref|XP_010527269.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    394   3e-126   
gb|AES74584.2|  cytochrome P450 family protein                          394   4e-126   
ref|XP_007223263.1|  hypothetical protein PRUPE_ppa004464mg             393   4e-126   
ref|XP_011030954.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    394   4e-126   
ref|XP_009606708.1|  PREDICTED: cytochrome P450 CYP82D47-like           394   4e-126   
ref|XP_004147801.1|  PREDICTED: cytochrome P450 82A4-like               394   5e-126   
ref|XP_002510311.1|  cytochrome P450, putative                          393   5e-126   
gb|KDP38426.1|  hypothetical protein JCGZ_04351                         393   6e-126   
ref|XP_008464768.1|  PREDICTED: cytochrome P450 CYP82D47-like           393   7e-126   
ref|XP_002522370.1|  cytochrome P450, putative                          393   8e-126   
gb|EYU23762.1|  hypothetical protein MIMGU_mgv1a004588mg                393   9e-126   
ref|XP_007151144.1|  hypothetical protein PHAVU_004G021500g             393   9e-126   
sp|Q43068.2|C82A1_PEA  RecName: Full=Cytochrome P450 82A1; AltNam...    393   1e-125   
ref|XP_006856218.1|  hypothetical protein AMTR_s00059p00203770          392   1e-125   
ref|XP_004489343.1|  PREDICTED: cytochrome P450 82A3-like               393   1e-125   
ref|XP_011099742.1|  PREDICTED: cytochrome P450 CYP82D47-like           392   2e-125   
gb|KEH37856.1|  cytochrome P450 family protein                          392   2e-125   
ref|XP_004238199.1|  PREDICTED: cytochrome P450 CYP82D47-like           392   2e-125   
ref|XP_002510306.1|  cytochrome P450, putative                          392   3e-125   
gb|KHN19614.1|  Cytochrome P450 82A4                                    391   4e-125   
ref|XP_004489341.1|  PREDICTED: cytochrome P450 82A3-like               391   5e-125   
ref|XP_006366470.1|  PREDICTED: cytochrome P450 82A3-like               390   5e-125   
gb|KDP38429.1|  hypothetical protein JCGZ_04354                         390   5e-125   
ref|XP_010696627.1|  PREDICTED: cytochrome P450 CYP82D47-like           390   6e-125   
ref|XP_006366469.1|  PREDICTED: cytochrome P450 82A3-like               388   6e-125   
gb|KDP38430.1|  hypothetical protein JCGZ_04355                         391   7e-125   
ref|XP_009758036.1|  PREDICTED: cytochrome P450 82C4-like               387   9e-125   
emb|CAN82329.1|  hypothetical protein VITISV_016031                     387   1e-124   
gb|KCW60845.1|  hypothetical protein EUGRSUZ_H03582                     390   1e-124   
ref|XP_009374201.1|  PREDICTED: cytochrome P450 CYP82D47-like           390   1e-124   
ref|NP_194923.1|  cytochrome P450, family 82, subfamily C, polype...    389   1e-124   
ref|XP_003618351.1|  Cytochrome P450 82A1                               390   2e-124   
ref|XP_004147822.1|  PREDICTED: uncharacterized protein LOC101212976    404   3e-124   



>ref|XP_006339196.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=524

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/507 (52%), Positives = 360/507 (71%), Gaps = 16/507 (3%)
 Frame = -3

Query  1677  KKKTLPPEVDGARPILGHLRLLGSG-GIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             K   LPPE+ G+ PI+GHLR  G G  +PL R    ++D+YG +FT++LGMYR  V+++W
Sbjct  32    KSTKLPPEIPGSWPIIGHLRGFGDGKNVPLARTFGKLSDQYGPIFTIKLGMYRYCVINNW  91

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             EA KDCFT NDK +AARP    A++ GYNYA FS     PY+ ++RK  +  +LSS +LE
Sbjct  92    EAAKDCFTINDKELAARPISLAAEHYGYNYARFSFANYGPYYCQVRKLVLQNVLSSTRLE  151

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
             K++H+R SEVE S+KELY L     ++ T+++S+WF +LTLN+IVK++AGKR+   +++D
Sbjct  152   KVKHVRTSEVEISIKELYNLCGKGDNSNTINISKWFEKLTLNIIVKMIAGKRY-ISLEKD  210

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
             +      EAQ   + F + MYL G+F+  DA PF I ++V+FQ  + K M +I K+LD I
Sbjct  211   E------EAQCFRKAFAKIMYLAGEFILYDAIPFKIFKYVDFQGHI-KTMKQIYKDLDDI  263

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLS  781
             LQ W++EH++ ++       E   N+ QD ID MLS+   +  +   Y  + +IKAT LS
Sbjct  264   LQSWVNEHMEKKKI------EGDNNNEQDCIDSMLSVTKLEDFKAYGYTRDTVIKATVLS  317

Query  780   MIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVK  601
             MI+DGSDTTAVHLTWL+SL++N+P  M  ++++ID+KVGK+RWVE+ DIKD+ YLQA VK
Sbjct  318   MILDGSDTTAVHLTWLMSLLLNNPHVMSHVQKEIDNKVGKDRWVEESDIKDLVYLQAIVK  377

Query  600   ETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL  421
             E LRLYPP P   PH A EDC V GY+IPKGT L+ NAWK+ RDPR++ EP++FMPERFL
Sbjct  378   EALRLYPPAPLLVPHEAVEDCTVAGYNIPKGTRLFPNAWKIQRDPRVYSEPDKFMPERFL  437

Query  420   TA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSE  244
                +  DA  ++FE+IPFG GRRSC G  +A QV+HLT+ RLIQGF+F TPS  P+DM+E
Sbjct  438   NEHSNVDARGQHFEFIPFGSGRRSCPGINFATQVAHLTIGRLIQGFNFGTPSNLPVDMTE  497

Query  243   GLGITLPRATALDVVITPRLPPSFYGL  163
             G GIT+P+A  ++VVITPRL    Y L
Sbjct  498   GQGITMPKAKPVEVVITPRLNSMLYEL  524



>ref|XP_009801176.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=517

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/504 (52%), Positives = 355/504 (70%), Gaps = 20/504 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSG--GIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             + L PE+ GA PI+GHLR L      IP  R L A+ADKYG VFTLR+GMY  L+V++WE
Sbjct  29    RKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWE  88

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             A KDC TT+DK +AARP     + +GY YA F+     PY+ ++RK A+ ++LSS KLEK
Sbjct  89    AAKDCLTTHDKDLAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQQVLSSTKLEK  148

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
             ++H+RVSE+ETS+KELY L    ++ + V++S+WF QLTLN+IVK + GKR+   ++ED+
Sbjct  149   MKHIRVSEMETSIKELYSLALVKNNIQKVNISKWFEQLTLNIIVKTICGKRYS-NIEEDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
             +   +++A      FK  MY+ GQ V  DA PF + ++ +FQ  + K M +I K+LD IL
Sbjct  208   EAQRFRKA------FKGIMYVVGQIVLYDAIPFPLFKYFDFQGHI-KLMKKIYKDLDYIL  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WLD+H+           +   N+ QD +D ML +   +  +   +    +IK+T LS+
Sbjct  261   QGWLDDHM---------MKKDVNNEDQDAMDAMLKVTQLNEFKAYGFSQATVIKSTVLSL  311

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             I+DG+DTTAVHL W++SL++N+P  MK+ +E+ID KVGKERWVED DIK++ YLQA VKE
Sbjct  312   ILDGNDTTAVHLIWVMSLLLNNPHVMKQAQEEIDMKVGKERWVEDTDIKNLVYLQAIVKE  371

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
             TLRLYPP+P   PH A +DCKV GY IPKGT L++NAWKVHRDP IW EPERFMPERFLT
Sbjct  372   TLRLYPPVPFLLPHEAVQDCKVAGYHIPKGTRLHINAWKVHRDPEIWSEPERFMPERFLT  431

Query  417   A-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEG  241
             + A  DA  +NFE+IPFG GRRSC G  +A  V+HLT  RL+QGFDF TPS  P+DM+EG
Sbjct  432   SKANVDARGQNFEFIPFGSGRRSCPGINFATLVTHLTFGRLLQGFDFSTPSNTPIDMTEG  491

Query  240   LGITLPRATALDVVITPRLPPSFY  169
             +G+TLP+   ++V+I+PRLP   Y
Sbjct  492   VGVTLPKVNQVEVLISPRLPSKLY  515



>gb|ABC69375.1| CYP82M1v4 [Nicotiana tabacum]
Length=521

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/516 (52%), Positives = 358/516 (69%), Gaps = 25/516 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSG--GIPLGRKLAAMADKYGSVFTLRL  1534
             WR     + T +K L PE+ GA PI+GHLR L      IP  R L A+ADKYG VFTLR+
Sbjct  26    WR----RTLTSRK-LAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRI  80

Query  1533  GMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFA  1354
             GMY  L+V++WEA KDC TT+DK +AARP     + +GY YA F+     PY+ ++RK A
Sbjct  81    GMYPYLIVNNWEAAKDCLTTHDKDLAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLA  140

Query  1353  VTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVA  1174
             +  +LSS KLEK++H+RVSE+ETS+KELY L    ++ + V++S+WF QLTLN+IVK + 
Sbjct  141   LQHVLSSTKLEKMKHIRVSELETSIKELYSLTLGKNNMQKVNISKWFEQLTLNIIVKTIC  200

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+   ++ED++   +++A      FK  M++ GQ V  DA PF + ++ +FQ  + + 
Sbjct  201   GKRYS-NIEEDEEAQRFRKA------FKGIMFVVGQIVLYDAIPFPLFKYFDFQGHI-QL  252

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M +I K+LD+ILQ WLD+H+          N+   N  QD ID ML +   +  +   + 
Sbjct  253   MNKIYKDLDSILQGWLDDHM---------MNKDVNNKDQDAIDAMLKVTQLNEFKAYGFS  303

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
                +IK+T LS+I+DG+DTTAVHL W++SL++N+P  MK+ +E+ID KVGKERW+ED DI
Sbjct  304   QATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKVGKERWIEDTDI  363

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             K++ YLQA VKETLRLYPP+P   PH A +DCKV GY IPKGT LY+NAWKVHRDP IW 
Sbjct  364   KNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDPEIWS  423

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             EPE+FMP RFLT+ A  DA  +NFE+IPFG GRRSC G  +A  V+HLT  RL+QGFDF 
Sbjct  424   EPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRLLQGFDFS  483

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              PS  P+DM+EG+G+TLP+   ++V+ITPRLP   Y
Sbjct  484   KPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>ref|XP_009616319.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=521

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/516 (52%), Positives = 358/516 (69%), Gaps = 25/516 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSG--GIPLGRKLAAMADKYGSVFTLRL  1534
             WR     + T +K L PE+ GA PI+GHLR L      IP  R L A+ADKYG VFTLR+
Sbjct  26    WR----RTLTSRK-LAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRI  80

Query  1533  GMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFA  1354
             GMY  L+V++WEA KDC TT+DK  AARP     + +GY YA F+     PY+ ++RK A
Sbjct  81    GMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLA  140

Query  1353  VTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVA  1174
             +  +LSS KLEK++H+RVSE+ETS+KELY L    ++ + V++S+WF QLTLN+IVK + 
Sbjct  141   LQHVLSSTKLEKMKHIRVSELETSIKELYSLTLGKNNMQKVNISKWFEQLTLNIIVKTIC  200

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+   ++ED++   +++A      FK  M++ GQ V  DA PF + ++ +FQ  + + 
Sbjct  201   GKRYS-NIEEDEEAQRFRKA------FKGIMFVVGQIVLYDAIPFPLFKYFDFQGHI-QL  252

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M +I K+LD+ILQ WLD+H+          N+   N  QD ID ML +   +  +   + 
Sbjct  253   MNKIYKDLDSILQGWLDDHM---------MNKDVNNKDQDAIDAMLKVTQLNEFKAYGFS  303

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
                +IK+T LS+I+DG+DTTAVHL W++SL++N+P  MK+ +E+ID KVGKERW+ED DI
Sbjct  304   QATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKVGKERWIEDTDI  363

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             K++ YLQA VKETLRLYPP+P   PH A +DCKV GY IPKGT LY+NAWKVHRDP IW 
Sbjct  364   KNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDPEIWS  423

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             EPE+FMP+RFLT+ A  DA  +NFE+IPFG GRRSC G  +A  V+HLT  RL+QGFDF 
Sbjct  424   EPEKFMPDRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRLLQGFDFS  483

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              PS  P+DM+EG+G+TLP+   ++V+ITPRLP   Y
Sbjct  484   KPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>gb|ABC69374.1| CYP82M1v3 [Nicotiana tabacum]
Length=521

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/516 (51%), Positives = 357/516 (69%), Gaps = 25/516 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSG--GIPLGRKLAAMADKYGSVFTLRL  1534
             WR     + T +K L PE+ GA PI+GHLR L      IP  R L A+ADKYG VFTLR+
Sbjct  26    WR----RTLTSRK-LAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRI  80

Query  1533  GMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFA  1354
             GMY  L+V++WEA KDC TT+DK  AARP     + +GY YA F+     PY+ ++RK A
Sbjct  81    GMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLA  140

Query  1353  VTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVA  1174
             +  +LSS KLEK++H+RVSE+ETS+KELY L    ++ + V++S+WF QLTLN+IVK + 
Sbjct  141   LQHVLSSTKLEKMKHIRVSELETSIKELYSLTLGKNNMQKVNISKWFEQLTLNIIVKTIC  200

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+   ++ED++   +++A      FK  M++ GQ V  DA PF + ++ +FQ  + + 
Sbjct  201   GKRYS-NIEEDEEAQRFRKA------FKGIMFVVGQIVLYDAIPFPLFKYFDFQGHI-QL  252

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M +I K+LD+ILQ WLD+H+          N+   N  QD ID ML +   +  +   + 
Sbjct  253   MNKIYKDLDSILQGWLDDHM---------MNKDVNNKDQDAIDAMLKVTQLNEFKAYGFS  303

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
                +IK+T LS+I+DG+DTTAVHL W++SL++N+P  MK+ +E+ID K+GKERW+ED DI
Sbjct  304   QATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKMGKERWIEDTDI  363

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             K++ YLQA VKETLRLYPP+P   PH A +DCKV GY IPKGT LY+NAWKVHRDP IW 
Sbjct  364   KNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDPEIWS  423

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             EPE+FMP RFLT+ A  DA  +NFE+IPFG GRRSC G  +A  V+HLT  RL+QGFDF 
Sbjct  424   EPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRLLQGFDFS  483

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              PS  P+DM+EG+G+TLP+   ++V+ITPRLP   Y
Sbjct  484   KPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>ref|XP_004249377.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=524

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/507 (51%), Positives = 357/507 (70%), Gaps = 16/507 (3%)
 Frame = -3

Query  1677  KKKTLPPEVDGARPILGHLRLLGSG-GIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             K   LPP++ G+ PI+GHLR  G G  +PL R    ++++YG +FT++LGMYR  V+++W
Sbjct  32    KSTKLPPKIPGSWPIIGHLRGFGDGENVPLARTFGKLSNQYGPIFTIKLGMYRYCVINNW  91

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             EA KDCFT NDK +AARP    A++ GYNYA FS     PY+ ++RK  +  +LSS +LE
Sbjct  92    EAAKDCFTINDKELAARPISLAAEHYGYNYARFSFANYGPYYCQVRKLVLQNVLSSTRLE  151

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
             K++++R+SEVE S+KELY +     ++ T+++S+WF +LTLN+IVK++AGKR+   +++D
Sbjct  152   KVKNVRISEVEISIKELYNIWGKGENSNTINISKWFEKLTLNIIVKMIAGKRY-ISLEKD  210

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
                   +EAQ     F + MYL G+F+  DA PF I ++V+FQ  + K M +I K+LD I
Sbjct  211   ------QEAQCFRRAFAKIMYLAGEFILYDAIPFKIFKYVDFQGHI-KTMKQIYKDLDDI  263

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLS  781
             LQ W++EH++ ++       E   N+ QD ID MLS+   +  +   Y  + +IKA  LS
Sbjct  264   LQSWVNEHMEKKKI------EGDNNNEQDCIDSMLSVTKLEDFKAYGYTRDTVIKAIVLS  317

Query  780   MIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVK  601
             MI+DGSDTTAVHLTWL+SL++N+P  M   +++IDSKVGK+RW+E+ DIKD+ YLQA VK
Sbjct  318   MILDGSDTTAVHLTWLMSLLLNNPRVMNNAQKEIDSKVGKDRWIEESDIKDLVYLQAIVK  377

Query  600   ETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL  421
             E LRLYPP P   PH A EDC V GY+IPKGT L+ NAWK+ RDPR++ EP++F+PERFL
Sbjct  378   EALRLYPPAPLLVPHEAVEDCTVAGYNIPKGTRLFANAWKIQRDPRVYSEPDKFIPERFL  437

Query  420   TA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSE  244
                +  DA  ++FE+IPFG GRRSC G  +A QV+HLT+ RLIQGF F TPS  P+DM+E
Sbjct  438   NEHSNVDARGQHFEFIPFGSGRRSCPGINFATQVAHLTIGRLIQGFSFGTPSNLPVDMTE  497

Query  243   GLGITLPRATALDVVITPRLPPSFYGL  163
             G GIT+P+A  ++VVITPRL    Y L
Sbjct  498   GQGITMPKAKPVEVVITPRLNSMLYEL  524



>ref|XP_006352674.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=520

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/518 (52%), Positives = 363/518 (70%), Gaps = 25/518 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKK--TLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRL  1534
             W++KI    + K    LPPE+ GA   +GHL L  S   PL   LA +ADKYG +F++RL
Sbjct  21    WKTKIQAKNSSKVMINLPPEIPGAYFPIGHLYLFISK-TPLALILANLADKYGHIFSIRL  79

Query  1533  GMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFA  1354
             G++R ++VS+WE VK+CFTTNDKV+A RP  +   YLGYN A F      PYWR +RK  
Sbjct  80    GIHRAIIVSNWEIVKECFTTNDKVLAGRPASSAGIYLGYNNAAFGFADYGPYWRNIRKLV  139

Query  1353  VTELLSSQKLEKLRHLRVSEVETSLKELY--MLITSSSSAKTVDMSEWFGQLTLNLIVKI  1180
             + E+LSS++L++ +H+RV+EVET++KELY  +L + S++   V+MS+WF QLTLN+I+K+
Sbjct  140   LLEVLSSKRLDQFKHIRVTEVETNIKELYSSILKSGSTNPSKVNMSKWFEQLTLNVIMKM  199

Query  1179  VAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVV  1000
             + GKR+K          E ++ +H     KE+MY + QFV  D  P   ++W +FQ R+ 
Sbjct  200   ITGKRYK---------TEDEKGRHFTRTTKEYMYESVQFVLSDVIPLPFLKWFDFQGRI-  249

Query  999   KDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA  820
             K M ++ +E+D I+  W+DEH+    KR  A     K+D QDFIDVMLS ID+ F  G  
Sbjct  250   KSMKKLSQEMDKIVTSWIDEHL---MKRELAI----KDDDQDFIDVMLSKIDEQFMYG--  300

Query  819   YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDG  640
             Y  E IIKAT L++I+ GSDTT++HLTWLLSL+VN+   M + +E+ID K+GKERWVE+ 
Sbjct  301   YTRETIIKATILNIILAGSDTTSIHLTWLLSLLVNNKHVMDQAQEEIDMKIGKERWVEEC  360

Query  639   DIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRI  460
             DIK++ YLQA VKETLRLYPP P   PHAA EDC VGGY +PKGT L VN WK+HRDP+I
Sbjct  361   DIKNLVYLQAIVKETLRLYPPGPLAIPHAAMEDCTVGGYKVPKGTRLMVNVWKLHRDPQI  420

Query  459   WPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             W +PE+FMPERF+ + ++ D   +NFE+IPFG GRRSC G T+AMQV+HLT+ARL+QGF+
Sbjct  421   WSDPEKFMPERFMKSHSEIDISGQNFEFIPFGSGRRSCPGITFAMQVTHLTLARLLQGFN  480

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             F T  + P+D++ G  ITLP+A  L+V + PRL P  Y
Sbjct  481   FSTLGDLPVDLTVGNSITLPKANPLEVFVMPRLAPMLY  518



>gb|ABC69373.1| CYP82M1v2 [Nicotiana tabacum]
Length=521

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/504 (52%), Positives = 351/504 (70%), Gaps = 20/504 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSG--GIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             + L PE+ GA PI+GHLR L      IP  R L A+ADKYG VFTLR+GMY  L+V++WE
Sbjct  33    RKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWE  92

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             A KDC TT+DK  AARP     + +GY YA F+     PY+ ++RK A+  +LSS KLEK
Sbjct  93    AAKDCLTTHDKDFAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQHVLSSTKLEK  152

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
             ++H+RVSE+ETS+KELY L    ++ + V++S+WF QLTLN+IVK + GKR+   ++ED+
Sbjct  153   MKHIRVSELETSIKELYSLTLGKNNMQKVNISKWFEQLTLNIIVKTICGKRYS-NIEEDE  211

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
             +   +++A      FK  M++ GQ V  DA PF + ++ +FQ  + + M +I K+LD+IL
Sbjct  212   EAQRFRKA------FKGIMFVVGQIVLYDAIPFPLFKYFDFQGHI-QLMNKIYKDLDSIL  264

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WLD+H+          N+   N  QD ID ML +   +  +   +    +IK+T LS+
Sbjct  265   QGWLDDHM---------MNKDVNNKDQDAIDAMLKVTQLNEFKAYGFSQATVIKSTVLSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             I+DG+DTTAVHL W++SL++N+P  MK+ +E+ID KVGKERW+ED DIK++ YLQA VKE
Sbjct  316   ILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKVGKERWIEDTDIKNLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
             TLRL+PP+P   PH A +DCKV GY IPKGT LY+NAWKVHRDP IW EPE+FMP RFLT
Sbjct  376   TLRLFPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDPEIWSEPEKFMPNRFLT  435

Query  417   A-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEG  241
             + A  DA  +NFE+IPFG GRRSC G  +A  V+HLT  RL+QGFDF  PS  P DM+EG
Sbjct  436   SKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRLLQGFDFSKPSNTPTDMTEG  495

Query  240   LGITLPRATALDVVITPRLPPSFY  169
             +G+TLP+   ++V+ITPRLP   Y
Sbjct  496   VGVTLPKVNQVEVLITPRLPSKLY  519



>gb|ABC69376.1| CYP82M1v5 [Nicotiana tabacum]
Length=521

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/516 (51%), Positives = 356/516 (69%), Gaps = 25/516 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSG--GIPLGRKLAAMADKYGSVFTLRL  1534
             WR     + T +K L PE+ GA PI+GHLR L      IP  R L A+ADKYG VFTLR+
Sbjct  26    WR----RTLTSRK-LAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRI  80

Query  1533  GMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFA  1354
             GMY  L+V++WEA KDC TT+DK  AARP     + +GY YA F+     PY+ ++RK A
Sbjct  81    GMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLA  140

Query  1353  VTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVA  1174
             +  + SS KLEK++H+RVSE+ETS+KELY L    ++ + V++S+WF QLTLN+IVK + 
Sbjct  141   LQHVPSSTKLEKMKHIRVSELETSIKELYSLTLGKNNMQKVNISKWFEQLTLNIIVKTIC  200

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+   ++ED++   +++A      FK  M++ GQ V  DA PF + ++ +FQ  + + 
Sbjct  201   GKRYS-NIEEDEEAQRFRKA------FKGIMFVVGQIVLYDAIPFPLFKYFDFQGHI-QL  252

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M +I K+LD+ILQ WLD+H+          N+   N  QD ID ML +   +  +   + 
Sbjct  253   MNKIYKDLDSILQGWLDDHM---------MNKDVNNKDQDAIDAMLKVTQLNEFKAYGFS  303

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
                +IK+T LS+I+DG+DTTAVHL W++SL++N+P  MK+ +E+ID KVGKERW+ED DI
Sbjct  304   QATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKVGKERWIEDTDI  363

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             K++ YLQA VKETLRLYPP+P   PH A +DCKV GY IPKGT LY+NAWKVHRDP IW 
Sbjct  364   KNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDPEIWS  423

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             EPE+FMP RFLT+ A  DA  +NFE+IPFG GRRSC G  +A  V+HLT  RL+QGFDF 
Sbjct  424   EPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRLLQGFDFS  483

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              PS  P+DM+EG+G+TLP+   ++V+ITPRLP   Y
Sbjct  484   KPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>gb|ABC69372.1| CYP82M1v1 [Nicotiana tabacum]
Length=521

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/516 (51%), Positives = 356/516 (69%), Gaps = 25/516 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSG--GIPLGRKLAAMADKYGSVFTLRL  1534
             WR     + T +K L PE+ GA PI+GHLR L      IP  R L A+ADKYG VFTLR+
Sbjct  26    WR----RTLTSRK-LAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRI  80

Query  1533  GMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFA  1354
             GMY  L+V++WEA KDC TT+DK  AARP     + +GY YA F+     PY+ ++RK A
Sbjct  81    GMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLA  140

Query  1353  VTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVA  1174
             +  +LSS KLEK++H+RVSE+ETS+KELY L    ++ + V++S+WF QLTLN+IVK + 
Sbjct  141   LQHVLSSTKLEKMKHIRVSELETSIKELYSLTLGKNNMQKVNISKWFEQLTLNIIVKTIC  200

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+   ++ED++   +++A      FK  M++ GQ V  DA PF + ++ +FQ  + + 
Sbjct  201   GKRYS-NIEEDEEAQRFRKA------FKGIMFVVGQIVLYDAIPFPLFKYFDFQGHI-QL  252

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M +I K+LD+ILQ WLD+H+          N+   N  QD ID ML +   +  +   + 
Sbjct  253   MNKIYKDLDSILQGWLDDHM---------MNKDVNNKDQDAIDAMLKVTQLNEFKAYGFS  303

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
                +IK+T LS+I+DG+DTTAVHL W++SL++N+P  MK+ +E+ID KVGKERW+ED DI
Sbjct  304   QATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKVGKERWIEDTDI  363

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             K++ YLQA VKETLRLYPP+P   PH A +DCKV GY IPKGT LY+NAWKVHRD  IW 
Sbjct  364   KNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDSEIWS  423

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             EPE+FMP RFLT+ A  DA  +NFE+IPFG GRRSC G  +A  V+HLT  RL+QGFDF 
Sbjct  424   EPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGLGFATLVTHLTFGRLLQGFDFS  483

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              PS  P+DM+EG+G+TLP+   ++V+ITPRLP   Y
Sbjct  484   KPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>ref|XP_011089652.1| PREDICTED: cytochrome P450 82C2 [Sesamum indicum]
Length=528

 Score =   528 bits (1360),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 275/498 (55%), Positives = 354/498 (71%), Gaps = 20/498 (4%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA P++GHL LLG G +P+ R L  +AD+YG VFT+RLG++  LVVSSWEAVKDCF
Sbjct  46    PEPSGAWPVIGHLHLLG-GRVPVYRTLGGLADRYGPVFTVRLGVHTALVVSSWEAVKDCF  104

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             TTNDK++  RP  +  KYLGY+YA F   +   YWR+MRK  + E+LS+++LE L+++  
Sbjct  105   TTNDKILNKRPASSAGKYLGYDYAAFGF-SHGTYWRQMRKLVLLEVLSARRLESLKNVWE  163

Query  1299  SEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEYK  1120
             SE+ TS+ ELY       S K V +SEW  +LTLN IV ++AGKR+     +    DE  
Sbjct  164   SEIHTSINELY----KKHSGKVVVISEWIERLTLNTIVMMIAGKRYT----DSTQGDETV  215

Query  1119  EAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLDE  940
             EA+   E+ KEFMY++GQFV  DA PF  +RW++FQ  + K M RI KEL T+ +RW+ E
Sbjct  216   EARSFRELIKEFMYISGQFVASDAIPFPPLRWMDFQGHI-KSMKRISKELSTVFERWITE  274

Query  939   HVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGSD  760
             HV     RS   +  G  + QDFIDVMLS ID+ F     +  E IIKAT L++I+ GSD
Sbjct  275   HV-----RSDCKSRLG--NEQDFIDVMLSTIDEKFT-SFGHTRETIIKATALNLILAGSD  326

Query  759   TTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLYP  580
             TT++HLTWLLSL++N+   M++ +E+ID KVGKERWV++ DIK++ YLQA VKETLRL+P
Sbjct  327   TTSIHLTWLLSLLLNNRQVMQQAQEEIDMKVGKERWVQESDIKNLVYLQAVVKETLRLFP  386

Query  579   PLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQA-D  403
             P P   PH A EDC V GY +PKGT L VN WK+HRDPRIW EP+ F+PERFLT+  A D
Sbjct  387   PGPLSVPHEAMEDCCVAGYHVPKGTRLLVNVWKLHRDPRIWAEPDNFVPERFLTSHVAVD  446

Query  402   APWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITLP  223
                +N E++PFG GRRSC G T+AMQV+HLT+ARL+QGFD  TPS  P+DM+EGL ITLP
Sbjct  447   FTGQNHEFVPFGSGRRSCPGITFAMQVTHLTLARLLQGFDLATPSNGPVDMTEGLSITLP  506

Query  222   RATALDVVITPRLPPSFY  169
             +AT L+VVITPRL    Y
Sbjct  507   KATPLEVVITPRLSDGLY  524



>ref|XP_006349946.1| PREDICTED: cytochrome P450 82C2-like [Solanum tuberosum]
Length=531

 Score =   520 bits (1338),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 258/509 (51%), Positives = 353/509 (69%), Gaps = 19/509 (4%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHL-RLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             +  LPPE+ G  P++GHL +  G+  IPL RKLA +ADKYG VFT RLG+  ILVVSS++
Sbjct  33    QNPLPPEISGGWPVIGHLLQFSGADDIPLSRKLATLADKYGPVFTFRLGLPCILVVSSYD  92

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDC  TNDK  AARP     +Y+GYN A+  L    PYWRK+RK  + E+LSS +LEK
Sbjct  93    AVKDCLCTNDKAFAARPASLAGEYIGYNNAMLFLANYGPYWRKIRKIVLQEVLSSSRLEK  152

Query  1317  LRHLRVSEVETSLKELYMLITSSSS----AKTVDMSEWFGQLTLNLIVKIVAGKRFKFKV  1150
             L+ +RVSE++TS+ ELY LI+ +         V+++ W  +LTL+LIVK++AGK +    
Sbjct  153   LKFVRVSEIQTSINELYSLISVAGENVDFPVKVNVTNWIEKLTLSLIVKMIAGKSYGRVE  212

Query  1149  KEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKEL  970
             K  ++    +EA+   +  K+FMY++ +FV  DAFP  + +W++FQ  V K M R  K++
Sbjct  213   KGGNE----EEAERFKKALKDFMYISMEFVLWDAFPIALFKWIDFQGHV-KFMKRTFKDI  267

Query  969   DTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMI-DDDFARGLAYPPEIIIKA  793
             D +LQ WLDEH+  +++R    +     + QDFIDVMLSM+ ++DFA G  +  E  IKA
Sbjct  268   DCVLQNWLDEHL-KKKERVDVVD----GNEQDFIDVMLSMMSNEDFADG--HSRETTIKA  320

Query  792   TGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQ  613
             T LSM++D SDTTA+HL W+++ ++NH D MK+++E++D+KVG+ RWVE+ DIK++ Y Q
Sbjct  321   TALSMVLDASDTTAIHLNWVMATLLNHRDVMKKVQEELDTKVGRNRWVEESDIKNLVYFQ  380

Query  612   AAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMP  433
             A VKETLRLYPP P   PH + EDC V GY IPKGT L+VN  K+ RDP+IW  P  F P
Sbjct  381   AVVKETLRLYPPAPLLVPHESIEDCIVQGYHIPKGTRLWVNTMKLQRDPKIWSNPNTFDP  440

Query  432   ERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPL  256
             ERFLT+ A  D   + +E+IPFG  RRSC G TYA+QV+HL +A L+QGFDF TPS +PL
Sbjct  441   ERFLTSQAGCDVRGQQYEFIPFGSRRRSCPGITYAIQVTHLAIAHLLQGFDFSTPSNEPL  500

Query  255   DMSEGLGITLPRATALDVVITPRLPPSFY  169
             DM EGLG+T+ +   ++V+ITPR P   Y
Sbjct  501   DMKEGLGMTMRKVNPIEVMITPRFPSVLY  529



>ref|XP_009606611.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=548

 Score =   515 bits (1326),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 264/535 (49%), Positives = 363/535 (68%), Gaps = 36/535 (7%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHL-RLLGSGGIPLGRKLAAMADKYGSVFTLRLG  1531
             W+ K F+       LPPE+ G  P++GHL +  G+  IPL RKLA +A+KYG VFT RLG
Sbjct  26    WKLKYFNRSKPLNPLPPEISGGWPVIGHLLQFFGADDIPLSRKLATLAEKYGPVFTFRLG  85

Query  1530  MYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAV  1351
             + RILVVSS+EAV+DC  TNDK  AARP     +Y+GYN A+  L +  PYWRK+RK  +
Sbjct  86    LPRILVVSSYEAVRDCLNTNDKAFAARPASLAGEYIGYNNAMLFLASYGPYWRKIRKIVL  145

Query  1350  TELLSSQKLEKLRHLRVSEVETSLKELYML--ITSSSSAKT--------------VDMSE  1219
              E+LSS +LEKL+ +RVSEV+TS+KEL+ L  +T   S+ T              ++++ 
Sbjct  146   QEVLSSSRLEKLKIVRVSEVQTSIKELFSLFPVTGDHSSITGDNFPVTGDYVPVKLNLTN  205

Query  1218  WFGQLTLNLIVKIVAGK---RFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDA  1048
             W  +LTL+LIVK++AGK   R   K +++++ + +K+A       K+FMY++ +FV  DA
Sbjct  206   WIEKLTLSLIVKMIAGKSYGRLNEKGEDEEEAERFKKA------LKDFMYISMEFVLWDA  259

Query  1047  FPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFI  868
             FP  + +W++FQ  V K M R  K++D +LQ WLDEH+  R +    A      + QDFI
Sbjct  260   FPIPLFKWIDFQGHV-KFMKRTFKDIDCVLQNWLDEHMKKREEVDVVAG-----NEQDFI  313

Query  867   DVMLSMI-DDDFARGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRI  691
             DVMLSM+ ++DFA   +Y  E  IKAT LSM++D SDTTA+HL W+++ ++NH D MK++
Sbjct  314   DVMLSMMSNEDFAD--SYTRETTIKATALSMVLDASDTTAIHLNWVMATLLNHRDVMKKV  371

Query  690   REDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPK  511
             +E++D+KVG+ RWVE+ DIK++ Y QA +KETLRLYPP P   PH + EDC V GY IPK
Sbjct  372   QEELDTKVGRNRWVEESDIKNLVYFQAVIKETLRLYPPAPLLVPHESVEDCIVHGYHIPK  431

Query  510   GTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTY  334
             GT L+VN  K+ RDP IW +P+ F PERFLT  A  D   + +E+IPFG GRRSC G TY
Sbjct  432   GTRLWVNTMKLQRDPEIWSDPDTFDPERFLTCQAGFDVRGQQYEFIPFGSGRRSCPGITY  491

Query  333   AMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             A QV+HL +A L+QGFDF TP  +PL+M EGLG+T+ +   ++V+ITPRLP   Y
Sbjct  492   ASQVTHLAIAHLLQGFDFTTPFNEPLEMKEGLGMTMRKVNPIEVLITPRLPSVLY  546



>gb|AJD25203.1| cytochrome P450 CYP82V2 [Salvia miltiorrhiza]
Length=534

 Score =   514 bits (1324),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 261/505 (52%), Positives = 350/505 (69%), Gaps = 14/505 (3%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
             K    PE  GA PI+GHL LLG G IP+ R L AMADK G VFTLRLG++R +VVSS EA
Sbjct  39    KGNFAPEPSGAWPIIGHLHLLG-GKIPISRILGAMADKLGPVFTLRLGVHRTVVVSSREA  97

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKL  1315
             VKDCFTTND+V+A RP      YLGYN+A F   +  PYWR++RK  + E+L+ ++L+ L
Sbjct  98    VKDCFTTNDRVLAKRPSSTAGIYLGYNHAGFGF-SHGPYWREVRKLVLAEVLTPRRLDSL  156

Query  1314  RHLRVSEVETSLKELYMLITSSS--SAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
             R +R +E+  SL EL+ L+  S     + V +SEW  +LTL+ I+ ++AGKR   +   D
Sbjct  157   RPVREAELAASLGELHELVRGSDDDQEREVAISEWLERLTLDTIMMMLAGKRCAERDGGD  216

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
                +E  EA+ +  + K+FMY++GQFV  D+ PF  +RW++ Q  + K M RI  EL  I
Sbjct  217   AAAEE--EAKSLRHIIKQFMYISGQFVVSDSIPFPPLRWLDLQGHI-KSMKRIADELSEI  273

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLS  781
              + W+ EHV+ RR      ++ G    +DFIDVMLS IDD F R   +  E IIKAT L+
Sbjct  274   CEGWIGEHVERRR-----IDDGGLGIERDFIDVMLSAIDDKFMR-FGHTRETIIKATLLN  327

Query  780   MIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVK  601
             +I+ GSDTT+ H+TW+LSL++N+  AM++ + +ID KVGK+RWV++ DIK++ YLQA VK
Sbjct  328   LILAGSDTTSTHMTWILSLLLNNTRAMQQTQAEIDDKVGKDRWVQESDIKNLVYLQAVVK  387

Query  600   ETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL  421
             E LRL+PP P   PH A EDC+V GY + +GT + VN WK+HRDPR+W EP+ F+PERFL
Sbjct  388   EALRLFPPGPLAVPHEAMEDCRVAGYHVARGTRILVNVWKLHRDPRVWEEPDEFVPERFL  447

Query  420   T-AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSE  244
             T  A  D    + E+IPFG GRRSC G T+A QV+HLT+ARLIQGF+F TP ++P+DM+E
Sbjct  448   TRHADVDFTGHHHEFIPFGSGRRSCPGITFATQVTHLTMARLIQGFEFRTPLDEPVDMTE  507

Query  243   GLGITLPRATALDVVITPRLPPSFY  169
             GLGITLP+AT L V++ PRL P  Y
Sbjct  508   GLGITLPKATLLRVLVAPRLAPFMY  532



>ref|XP_009348373.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=538

 Score =   508 bits (1309),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 264/516 (51%), Positives = 349/516 (68%), Gaps = 17/516 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR KI  S   K  L P+  GA PI+GHL  LG G  PL R LA+MADKYG +FT+RLG 
Sbjct  35    WRVKI-QSHKTKGILTPQPSGALPIIGHLHKLG-GKKPLCRTLASMADKYGPIFTIRLGK  92

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
                LV+S+++AVK+CFT ND V  ARP  A  +YLGYNYA F       YWR MRK  + 
Sbjct  93    DPALVISNYDAVKECFTKNDIVFGARPKSAHGRYLGYNYAGFGFSPYGTYWRNMRKVVIA  152

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITS--SSSAKTVDMSEWFGQLTLNLIVKIVA  1174
             ELLSS++L+ L+H+++SEV++ +K LY +  +   +    V +SEW   LTLN+I +++A
Sbjct  153   ELLSSRRLQTLKHVQISEVDSFIKGLYEICKTKGENGQGKVVISEWIEHLTLNVITQMIA  212

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+    K  +D D   E + I E+ KEFM ++G  V  D   +    W++F   V K+
Sbjct  213   GKRYFDWGKVGNDSDNEGENKRIREIVKEFMLVSGMPVISDMIGY--PDWIDFLGEV-KN  269

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M RI KELD++   W++EH +AR++  S        D  DFIDVMLS+I+D+    L Y 
Sbjct  270   MKRIGKELDSLTASWIEEHNNARKEIDS-------RDKLDFIDVMLSVIEDNTV--LGYT  320

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              E IIKAT  ++II GSDTTA+ L W++SL++N+   +K  +E+I+  VG ERWVED DI
Sbjct  321   RETIIKATSQNLIIAGSDTTAISLKWVISLLLNNRHVLKHAQEEINLIVGTERWVEDTDI  380

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             +++ YLQA VKETLRLYPP P   PH A EDC+V G+ IPKGT L+VN WK+HRDP +W 
Sbjct  381   ENLTYLQAIVKETLRLYPPGPLSVPHEAMEDCQVCGFHIPKGTRLFVNLWKLHRDPTVWS  440

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             +PE F P+RFLT  A  D    +FE+IPFG GRRSC G T+AMQV HLT+ RLIQGF+  
Sbjct  441   DPEMFYPDRFLTTQASIDVSGNHFEFIPFGSGRRSCPGLTFAMQVIHLTLGRLIQGFELA  500

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             TP + P+DM+EGLG+TLP+AT+L+VV+TPRLP  FY
Sbjct  501   TPLDMPVDMTEGLGVTLPKATSLEVVLTPRLPIEFY  536



>ref|XP_008372514.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=524

 Score =   507 bits (1306),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 260/516 (50%), Positives = 347/516 (67%), Gaps = 17/516 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR KI  S   K  L P+  GA PI+GHL  LG G  PL R LA+MADKYG +FT++LG 
Sbjct  21    WRVKI-QSHKTKGMLAPQPSGALPIIGHLHKLG-GXNPLCRTLASMADKYGPIFTIQLGK  78

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +  LV+S+++AVK+CFT ND   A R   A  +YLGYNYA         YWR MRK A+ 
Sbjct  79    HPALVISNYDAVKECFTKNDIAFATRSKSAQGRYLGYNYAALGFSQYGTYWRNMRKMAIV  138

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITS--SSSAKTVDMSEWFGQLTLNLIVKIVA  1174
             ELLSS++L+ L+H+++SEV++ +K LY +  +   +    V +SEW   LTLN+I +++A
Sbjct  139   ELLSSRRLQTLKHVQISEVDSFIKGLYEICKTKGENGQSKVVISEWIEHLTLNVITQMIA  198

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+    K  +D D   E + I E+ KEFM + G+ V  D   F    W++   +V K+
Sbjct  199   GKRYFDWGKVGNDSDNEGENKRIREMVKEFMCVAGKPVVSDVIGF--PDWIDLMGQV-KN  255

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M RI K+ D+++  W++EH +AR +  S        D  DFIDVMLS+I+D+    L + 
Sbjct  256   MKRIGKDFDSLMASWIEEHKNAREEIDS-------RDKLDFIDVMLSVIEDNTV--LGHS  306

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              E IIKAT  ++I+ GSDTTA  LTW+LSL++N+   +K  +E I+ +VG ERWVED DI
Sbjct  307   RETIIKATSQNLILAGSDTTATSLTWILSLLLNNRHILKHAQEXINLQVGTERWVEDTDI  366

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             KD+ YLQA VKETLRLYPP P   PH A EDC+V G+ IPKGT L+ N WK+HRDP +W 
Sbjct  367   KDLTYLQAIVKETLRLYPPAPLSVPHEAXEDCQVCGFHIPKGTRLFANLWKLHRDPSVWS  426

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             +PE F P+RFLT  A  D   ++FE+IPFG GRRSC G T+AMQV HLT+ RLIQGF+  
Sbjct  427   DPEVFCPDRFLTTQASTDVSGQHFEFIPFGSGRRSCPGLTFAMQVIHLTLGRLIQGFELA  486

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             TP + P+DM+EGLGIT+P+AT+L+VV+TPRLP  FY
Sbjct  487   TPLDMPVDMAEGLGITMPKATSLEVVLTPRLPSQFY  522



>ref|XP_008372515.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=524

 Score =   502 bits (1292),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 262/516 (51%), Positives = 348/516 (67%), Gaps = 17/516 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR KI  S   K  L P+  GA PI+GHL  LG G  PL R LA+MADKYG +FT+RLG 
Sbjct  21    WRVKI-QSHKTKGVLTPQPSGALPIIGHLHKLG-GKNPLCRTLASMADKYGPIFTIRLGK  78

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +  LV+S+ +AVK+CFT ND V AARP  A  +YLGYNYA F       YWR MRK  + 
Sbjct  79    HPALVISNHDAVKECFTKNDIVFAARPKSAHGRYLGYNYAGFGFSPYGTYWRNMRKMVIA  138

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSS--SSAKTVDMSEWFGQLTLNLIVKIVA  1174
             ELLSS++L+ L+H+++SEV++ +K LY +  +   +    V +SEW   LTL +I +++A
Sbjct  139   ELLSSRRLQTLKHVQISEVDSFIKGLYEICKTKGXNGQSKVVISEWIEHLTLXVITQMIA  198

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+    K  +D D   E + I E+ KEFM ++G  V  D   +    W++F  +V K+
Sbjct  199   GKRYFDWGKVGNDSDNEGENKRIREIVKEFMLVSGMPVISDMIGY--PDWIDFLGQV-KN  255

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M RI KELD +   W++EH +AR++  S        D  DFIDVMLS+I+D+    L + 
Sbjct  256   MKRIGKELDALTASWIEEHNNARKEIDS-------RDKLDFIDVMLSVIEDNTV--LGHT  306

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              E IIKAT  ++II GSDTTA+ L W++SL++N+   +K  +E+I+ KVG ERWVED DI
Sbjct  307   RETIIKATSQNLIIAGSDTTAISLKWIISLLLNNRHVLKHAQEEINLKVGTERWVEDTDI  366

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             +++  LQA VKETLRLYPP P   PH A EDC+V G+ I KGT L+VN WK+HRDP +W 
Sbjct  367   ENLTXLQAIVKETLRLYPPGPLSVPHEAMEDCQVCGFHIXKGTRLFVNLWKLHRDPTMWS  426

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             +PE F P+RFLT  A  DA   +FE+IPFG GRRSC G T+AMQV HLT+ RLIQGF+  
Sbjct  427   DPEMFYPDRFLTTQASIDASGNHFEFIPFGSGRRSCPGLTFAMQVIHLTLGRLIQGFELA  486

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             TP + P+DM+EGLG+TLP+AT+L+VV+TPRLP   Y
Sbjct  487   TPLDMPVDMTEGLGVTLPKATSLEVVLTPRLPIELY  522



>ref|XP_002300088.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa]
 gb|EEE84893.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa]
Length=527

 Score =   502 bits (1292),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 349/506 (69%), Gaps = 15/506 (3%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             T+K   PPE  GA P++GHL LLG+    L R LAAMADKYG +FT+RLG +  +VVS+ 
Sbjct  32    TEKGLQPPEPSGALPLIGHLHLLGAQKT-LARTLAAMADKYGPIFTIRLGKHPTVVVSNL  90

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             EA+K+CFTT+D+++++RP  +  ++L YNYA F  +   P+WR+MRK    +LLSS +L+
Sbjct  91    EAIKECFTTHDRILSSRPRSSHGEHLSYNYAAFGFNNSGPFWREMRKIVTIQLLSSHRLK  150

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKE  1144
              LRH++VSEV T + +LY+L  S+    T +D+SE F ++T+N+I +++AGKR+ F   E
Sbjct  151   SLRHVQVSEVNTLINDLYLLSKSNKQGSTKIDISECFERMTINMITRMIAGKRY-FSSTE  209

Query  1143  DDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDT  964
              +  DE K    I ++ KEFMY++G FV  D  PF  + W+      VK M R+ +ELD+
Sbjct  210   AEKEDEGKR---IGKLMKEFMYISGVFVPSDVIPF--LGWMNNFLGSVKTMKRLSRELDS  264

Query  963   ILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGL  784
             +++ W+ EH   + KR  +   + K +  DFIDVMLS++DD       Y  E IIKAT +
Sbjct  265   LMESWIQEH---KLKRLESTENTNKMEDDDFIDVMLSLLDDSM---FGYSRETIIKATAM  318

Query  783   SMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAV  604
             ++II G+DTT++ LTW+LS ++N+  +++  +E++D KVG+ERW ED DI ++ Y+QA +
Sbjct  319   TLIIAGADTTSITLTWILSNLLNNRRSLQLAQEELDLKVGRERWAEDSDIGNLVYIQAII  378

Query  603   KETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERF  424
             KETLRLYPP P   PH AT+D  V GY IPKGT L+ N WK+HRDP +W  P+ +MPERF
Sbjct  379   KETLRLYPPGPLSVPHEATKDFCVAGYHIPKGTRLFANLWKLHRDPNLWSNPDEYMPERF  438

Query  423   LT-AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMS  247
             LT  A  D    +FE IPFG GRRSC G T+A+QV HLT ARL+QGFD +TP+ + +DM+
Sbjct  439   LTDHANVDVLGHHFELIPFGSGRRSCPGITFALQVLHLTFARLLQGFDMKTPTGESVDMT  498

Query  246   EGLGITLPRATALDVVITPRLPPSFY  169
             EG+ ITLP+AT L++ ITPRL P  Y
Sbjct  499   EGVAITLPKATPLEIQITPRLSPELY  524



>dbj|BAM36724.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   501 bits (1290),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 243/503 (48%), Positives = 351/503 (70%), Gaps = 21/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL    + G   PL RKL  +ADKYG V+T RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKLGDLADKYGPVYTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             A+KDCF+TND + + RP F   +YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFLANYGPYWRKNRKLIIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R+++++T +K+LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRLAKIQTGIKDLYSRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH+  +R+ ++  NE      QDFIDV+LS + +++     Y  + +IKAT  S+
Sbjct  261   QNWLEEHI-KKREVNAEGNE------QDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSL  312

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+ +A+K+ +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  313   VLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  372

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++WP P+ F PERF+ 
Sbjct  373   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWPNPDNFDPERFV-  431

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             AA  D   +++EYIPFG GRRSC G TYA+QV HLT+ARLIQGF++ TP+++PLDM EG 
Sbjct  432   AANIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMARLIQGFNYRTPTKEPLDMKEGA  491

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++V+ITPRL P  Y
Sbjct  492   GITIRKVNPVEVIITPRLAPELY  514



>ref|XP_009761500.1| PREDICTED: cytochrome P450 82C2-like [Nicotiana sylvestris]
Length=555

 Score =   503 bits (1294),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 258/542 (48%), Positives = 359/542 (66%), Gaps = 43/542 (8%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHL-RLLGSGGIPLGRKLAAMADKYGSVFTLRLG  1531
             W+ K F        LPPE+ G  P++GHL +  G+  IPL RKLA +A+KYG VFT RLG
Sbjct  26    WKLKYFKLSKPLNPLPPEISGGWPVIGHLLQFSGADDIPLSRKLATLAEKYGPVFTFRLG  85

Query  1530  MYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAV  1351
             + R+LVVSS++AV+DC   NDK  AARP     +Y+GYN A+  L +  PYWRK+RK  +
Sbjct  86    LPRVLVVSSYDAVRDCLNANDKAFAARPASLAGEYIGYNNAMLFLSSYGPYWRKIRKIVL  145

Query  1350  TELLSSQKLEKLRHLRVSEVETSLKELYML--ITSSSSAKT-------------------  1234
              E+LSS +LEKL+++RVSE++TS+KEL+ L  +T   S+ T                   
Sbjct  146   QEVLSSSRLEKLKNVRVSELQTSIKELFSLFPVTGDHSSVTGDHSSITGDNLPVTGDYVP  205

Query  1233  --VDMSEWFGQLTLNLIVKIVAGK---RFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNG  1069
               ++++ W  +LTL+LIVK++AGK   R   K +++++ + +K+A       K+FMY++ 
Sbjct  206   VKLNLTNWIEKLTLSLIVKMIAGKSYGRLNEKAEDEEEAERFKKA------LKDFMYISM  259

Query  1068  QFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGK  889
             +FV  DAFP  + +W++FQ  V K M R  K++D +LQ WLDEHV  R      A     
Sbjct  260   EFVLWDAFPIPLFKWIDFQGHV-KFMKRTFKDIDCVLQNWLDEHVKKREGVDVVAG----  314

Query  888   NDHQDFIDVMLSMI-DDDFARGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNH  712
              + QDFIDVMLSM+ ++DFA   +Y  E  IKAT LSM++D SDTTA+HL W++++++NH
Sbjct  315   -NEQDFIDVMLSMMSNEDFAD--SYTRETTIKATALSMVLDASDTTAIHLNWVMAILLNH  371

Query  711   PDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKV  532
              D MK+++E++D+K+ + RWVE+ DIK++ Y QA +KETLRLYPP P   PH + EDC V
Sbjct  372   RDVMKKVQEELDTKISRNRWVEESDIKNLVYFQAVIKETLRLYPPAPLLVPHESVEDCIV  431

Query  531   GGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRR  355
              GY IPKGT L+VN  K+ RDP IW  P+ F PERFLT+ A  D   + +E+IPFG GRR
Sbjct  432   HGYHIPKGTRLWVNTMKLQRDPEIWSNPDTFDPERFLTSQAGFDVRGQQYEFIPFGSGRR  491

Query  354   SCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPS  175
             SC G TYA QV+HL +A L+QGFDF T   +PLDM EGLG+T+ +   ++V+I PRLP  
Sbjct  492   SCPGITYATQVTHLAIAHLLQGFDFSTLLNEPLDMKEGLGMTMRKVNPIEVLIMPRLPSV  551

Query  174   FY  169
              Y
Sbjct  552   LY  553



>ref|XP_008235431.1| PREDICTED: cytochrome P450 82C4-like [Prunus mume]
Length=517

 Score =   501 bits (1289),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 252/518 (49%), Positives = 354/518 (68%), Gaps = 29/518 (6%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR +I  S   K  L P+  GA PI+GHL  L     P+ + LAAMADKYG +FT+ LG 
Sbjct  21    WRLRI-QSHKIKGMLAPQPSGALPIIGHLHKLRG---PIFKTLAAMADKYGPIFTIWLGK  76

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             + +LV+S+++AVK CFT ND V A RP  +  KYLGYNYA F      PYWR MRK  + 
Sbjct  77    HPVLVISNYDAVKQCFTKNDTVFATRPRSSHGKYLGYNYAGFGFSPYGPYWRDMRKMVMV  136

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS----SAKTVDMSEWFGQLTLNLIVKI  1180
             ELLSS++L+ L+H+++SEV+  +K L++L  +      +   V +S+W   LTLN+I ++
Sbjct  137   ELLSSRRLQNLKHVQISEVDAFIKGLFLLCKTEEHNGLNPTKVVISDWIEHLTLNVITRM  196

Query  1179  VAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVV  1000
             +AGKR+     E D+       Q   ++ KEFMY++G  V  D   F    W++F+ ++ 
Sbjct  197   IAGKRYFDSSYEGDE-------QRFGKIVKEFMYVSGNPVASDVIGF--PSWIDFKGQI-  246

Query  999   KDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA  820
             K M RIMKELD+++  W++EH         A  ++   D  DFIDVM+S+I+D+    L 
Sbjct  247   KAMKRIMKELDSVMGSWVEEHY--------AKKQTDSRDDHDFIDVMISVIEDN--STLG  296

Query  819   YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDG  640
             Y  E IIKAT L++I+ GS+TTA++L W+LSL++N+   +K  +E++D KVG++RW+ED 
Sbjct  297   YTRETIIKATSLNLILAGSETTAINLIWILSLLLNNRHVLKLAQEELDLKVGRDRWIEDT  356

Query  639   DIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRI  460
             DI+++ YLQA VKETLRLYPP P   PH A +DC+V G+DIPKGT L+VN WK+HRDP +
Sbjct  357   DIENLPYLQAMVKETLRLYPPGPLSVPHEAMQDCQVCGFDIPKGTRLFVNLWKLHRDPSL  416

Query  459   WPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             WP+PE F PERFLT     DA  ++FE+IPFG GRRSC G T+A+QV+HLT+ RL+QGF+
Sbjct  417   WPDPEVFCPERFLTTHVGIDASGKHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGFE  476

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
               TP + P+D++EGLGIT+P+AT+L+V++TPRLP  FY
Sbjct  477   LATPLDMPVDLTEGLGITMPKATSLEVILTPRLPFEFY  514



>dbj|BAM36727.1| nicotine N-demethylase [Nicotiana langsdorffii]
Length=516

 Score =   500 bits (1288),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 243/504 (48%), Positives = 349/504 (69%), Gaps = 21/504 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL    + G   PL RKL  +ADKYG V+T RLG+  +LVVSS+E
Sbjct  32    KPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKLGDLADKYGPVYTFRLGLPLVLVVSSYE  91

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             A+KDCF+TND + + RP F   +YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  92    AIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFLANYGPYWRKNRKLIIQEVLSASRLEK  151

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R+++++T +K+LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  152   FKHVRLAKIQTGIKDLYSRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  208

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  209   QVERFKNA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  261

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH+  +R+ ++  NE      QDFIDV+LS + +++     Y  + +IKAT  S+
Sbjct  262   QNWLEEHI-KKREVNAEGNE------QDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSL  313

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+ +A+K+ +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  314   VLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  373

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++WP P+ F PERF+ 
Sbjct  374   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWPNPDNFDPERFV-  432

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             AA  D   +++EYIPFG GRRSC G TYA+QV HLT+ARLIQGF++ TP+ +PLDM EG 
Sbjct  433   AADIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMARLIQGFNYRTPTNEPLDMKEGA  492

Query  237   GITLPRATALDVVITPRLPPSFYG  166
             GIT+ +   ++V+ITPRL P  Y 
Sbjct  493   GITIRKVNPVEVIITPRLAPELYN  516



>dbj|BAM36723.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   500 bits (1287),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 242/503 (48%), Positives = 351/503 (70%), Gaps = 21/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL    + G   PL RKL  +ADKYG V+T RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKLGDLADKYGPVYTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             A+KDCF+TND + + RP F   +YLGYN A+  L    P+WRK RK  + E+LS+ +LEK
Sbjct  91    AIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFLANYGPFWRKNRKLIIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R+++++T +K+LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRLAKIQTGIKDLYSRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH+  +R+ ++  NE      QDFIDV+LS + +++     Y  + +IKAT  S+
Sbjct  261   QNWLEEHI-KKREVNAEGNE------QDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSL  312

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+ +A+K+ +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  313   VLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  372

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++WP P+ F PERF+ 
Sbjct  373   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWPNPDNFDPERFV-  431

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             AA  D   +++EYIPFG GRRSC G TYA+QV HLT+ARLIQGF++ TP+++PLDM EG 
Sbjct  432   AANIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMARLIQGFNYRTPTKEPLDMKEGA  491

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++V+ITPRL P  Y
Sbjct  492   GITICKVNPVEVIITPRLAPELY  514



>ref|XP_007200049.1| hypothetical protein PRUPE_ppa023510mg [Prunus persica]
 gb|EMJ01248.1| hypothetical protein PRUPE_ppa023510mg [Prunus persica]
Length=517

 Score =   499 bits (1285),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 252/518 (49%), Positives = 354/518 (68%), Gaps = 29/518 (6%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR +I  S   K  L P+  GA PI+GHL  L    +P+ + LAAMADKYG +FT+ LG 
Sbjct  21    WRVRI-QSHKIKGMLAPQPSGALPIIGHLHKLR---VPVFKTLAAMADKYGPIFTIWLGK  76

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             + +LV+S+++AVK CFT ND V A RP  +  KYLGYNYA F      PYWR MRK  + 
Sbjct  77    HPVLVISNYDAVKQCFTKNDTVFATRPRSSHGKYLGYNYAGFGFSPYGPYWRDMRKMVMV  136

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS----SAKTVDMSEWFGQLTLNLIVKI  1180
             ELLS ++L+ L+H+++SEV+  +K L++L  +      +   V +S+W   LTLN+I ++
Sbjct  137   ELLSIRRLQNLKHVQISEVDAFIKGLFLLCKTEGLNGLNPTKVVISDWIEHLTLNVITRM  196

Query  1179  VAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVV  1000
             +AGKR+       D+ DE    Q   ++ KEFMY++G  V  D   F    W++F+ +V 
Sbjct  197   IAGKRY---FDSSDEGDE----QRFGKIVKEFMYVSGNPVAADVIGF--PSWIDFKGQV-  246

Query  999   KDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA  820
             K M RIMKELD+++  W++EH         A  E+   D  DFIDVM+S+I+D+    L 
Sbjct  247   KAMKRIMKELDSVMGSWVEEHY--------AKKETNSRDEHDFIDVMMSVIEDN--STLG  296

Query  819   YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDG  640
             Y  E IIKAT +++I+ GS+TTA++L W+LSL++N+  A+K  +E++D KVG++RW+ED 
Sbjct  297   YTRETIIKATSMNLILAGSETTAINLIWILSLLLNNRHALKLAQEELDLKVGRDRWIEDT  356

Query  639   DIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRI  460
             DI+++ YLQA VKETLRLYPP P   PH A +DC+V G+ IPKGT L+VN WK+HRDP +
Sbjct  357   DIENLPYLQAIVKETLRLYPPGPLSVPHEAMQDCQVCGFHIPKGTRLFVNLWKLHRDPCL  416

Query  459   WPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             WP+PE F PERFLT     DA  ++FE+IPFG GRRSC G T+A+QV+HLT+ RL+QGF+
Sbjct  417   WPDPEVFCPERFLTTHVGIDASGKHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGFE  476

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
               TP + P+D++EGLGIT+P+AT+L+V++TPRL   FY
Sbjct  477   LATPMDMPVDLTEGLGITMPKATSLEVILTPRLSFEFY  514



>ref|XP_009609537.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
 gb|ABM46919.1| cytochrome P450 monooxygenase CYP82E3 [Nicotiana tomentosiformis]
Length=518

 Score =   498 bits (1282),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 242/503 (48%), Positives = 342/503 (68%), Gaps = 17/503 (3%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             A+KDCF+TND + + RP F   +YLGYN A+  L     YWRK RK  + E+LS+ +LEK
Sbjct  91    AIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFLANYGSYWRKNRKLIIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++TS+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQTSIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH+  R K      E    + QDFIDV+LS + +++  G  Y  + +IKAT  S+
Sbjct  261   QNWLEEHIKKREKIMEVGTEG---NEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSL  316

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+ +A+K+ +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  317   VLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  376

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W  P++F PERF+ 
Sbjct  377   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFNPERFI-  435

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   +++EYIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM EG 
Sbjct  436   ARDIDFHGQHYEYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPTDEPLDMKEGA  495

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   + V+ITPRL P  Y
Sbjct  496   GITIRKVNPVKVIITPRLAPELY  518



>ref|XP_004248527.2| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=521

 Score =   497 bits (1279),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 250/517 (48%), Positives = 354/517 (68%), Gaps = 23/517 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGS--GGIPLGRKLAAMADKYGSVFTLRL  1534
             WR    ++ T +K L P+V GA PI+GHL  L      +P    LAA+ADKYG +FTLR+
Sbjct  22    WRRS--NTLTTEK-LAPQVPGAWPIIGHLHQLSGIDKNVPFAHTLAALADKYGPIFTLRM  78

Query  1533  GMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFA  1354
             GMY  L++++WE  KDC TT+DK  AARP     + +GY YA F+      Y+  +RK A
Sbjct  79    GMYPYLIINNWEGAKDCLTTHDKDFAARPTSMAGQSIGYKYARFTYSNFGLYYNHVRKLA  138

Query  1353  VTELLSSQKLEKLRHLRVSEVETSLKELYMLI-TSSSSAKTVDMSEWFGQLTLNLIVKIV  1177
             +T++LSS KLEK+RH+RV E+E S+K+LY L   ++ + + +++++WF QLTLN IVK +
Sbjct  139   LTQVLSSTKLEKMRHIRVVELENSIKDLYSLTQVANKNNEVINITQWFHQLTLNTIVKTI  198

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
              GKR+   +++D++   +++A      FK  MY+ GQ V  D  PF + ++V+FQ  + K
Sbjct  199   CGKRYN-NIEKDEEAKRFRKA------FKGIMYVVGQIVLYDVVPFPLFKYVDFQGHI-K  250

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
              M  I K+LD+ILQ WL++H+  +        +   +D +D ID ML     D  +   Y
Sbjct  251   LMNNIYKDLDSILQGWLEDHMKKK--------DLNNDDDEDAIDAMLKATYVDEFKAYGY  302

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
                 +IK+T LS+I+DGSDTTAVH+ W++SL++N+P AMK+ +E+ID+KVGK RWV + D
Sbjct  303   SQATVIKSTILSLILDGSDTTAVHMIWIMSLLLNNPHAMKQAQEEIDTKVGKSRWVGESD  362

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIW  457
             +K++ YLQA VKET RLYPP+P   PH A +DCKV GYDIPKGT  Y+NAWK+HRDP+IW
Sbjct  363   VKNLVYLQAIVKETSRLYPPVPLLLPHEAVQDCKVAGYDIPKGTRTYINAWKIHRDPKIW  422

Query  456   PEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDF  280
              E E+FMPERFLT+ +  DA  ++FE+IPFG GRRSC G  +A  V+HLT ARL+QGF F
Sbjct  423   SESEKFMPERFLTSKSSVDARGQHFEFIPFGSGRRSCPGINFATLVTHLTFARLLQGFAF  482

Query  279   ETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              T S  P+DM+EG+GITLP+   +++++TPRL  +FY
Sbjct  483   STSSNTPIDMTEGVGITLPKVNQVEILVTPRLSSNFY  519



>gb|ADP65809.1| nicotine N-demethylase [Nicotiana tabacum]
Length=517

 Score =   495 bits (1275),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 242/503 (48%), Positives = 343/503 (68%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLG--SGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      S   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFYFDDDSDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             A+KDCF+TND + + RP F   +YLGYN A+  L    PYWRK RK  + E+L + +LEK
Sbjct  91    AIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFLTKYGPYWRKNRKLVIQEVLCASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
             L+H+R  E++TS+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   LKHVRFGEIQTSIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +++A      FK+F+ L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFRKA------FKDFIILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EHV  ++K     N  G  + QDFIDV+LS + +++     Y  + +IKAT  S+
Sbjct  261   QNWLEEHV--KKKEKMEVNAEG--NEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+K+ +E+ID KVGK+RWVE+ DIKD+ YLQ  VKE
Sbjct  316   VLDAADTVALHMNWGMALLINNQHALKKAQEEIDKKVGKDRWVEESDIKDLVYLQTIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W  P++F PERF  
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFF-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             AA  D   +++E+IPFG GRRSC G TYAMQV HLT+A LIQGF+++TP+++PLDM EG 
Sbjct  435   AADIDFRGQHYEFIPFGSGRRSCPGMTYAMQVEHLTIAHLIQGFNYKTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             G+T+ +   ++VVITPRL P  Y
Sbjct  495   GLTIRKVNPIEVVITPRLTPELY  517



>ref|XP_009757628.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
 gb|ADP65810.1| nicotine N-demethylase [Nicotiana sylvestris]
Length=517

 Score =   495 bits (1275),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 242/503 (48%), Positives = 343/503 (68%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLG--SGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      S   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFYFDDDSDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             A+KDCF+TND + + RP F   +YLGYN A+  L    PYWRK RK  + E+L + +LEK
Sbjct  91    AIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFLTKYGPYWRKNRKLVIQEVLCASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
             L+H+R  E++TS+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   LKHVRFGEIQTSIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +++A      FK+F+ L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFRKA------FKDFIILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EHV  ++K     N  G  + QDFIDV+LS + +++     Y  + +IKAT  S+
Sbjct  261   QNWLEEHV--KKKEKMEVNAEG--NEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+K+ +E+ID KVGK+RWVE+ DIKD+ YLQ  VKE
Sbjct  316   VLDAADTVALHMNWGMALLINNQHALKKAQEEIDKKVGKDRWVEESDIKDLVYLQTIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W  P++F PERF  
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFF-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             AA  D   +++E+IPFG GRRSC G TYAMQV HLT+A LIQGF+++TP+++PLDM EG 
Sbjct  435   AADIDFRGQHYEFIPFGSGRRSCPGMTYAMQVEHLTIAHLIQGFNYKTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             G+T+ +   ++VVITPRL P  Y
Sbjct  495   GLTIRKVNPIEVVITPRLTPELY  517



>dbj|BAM36726.1| nicotine N-demethylase [Nicotiana alata]
Length=515

 Score =   495 bits (1274),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 240/503 (48%), Positives = 347/503 (69%), Gaps = 21/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL    + G   PL RKL  +ADKYG V+T RLG+  +LVVSS+E
Sbjct  32    KPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKLGDLADKYGPVYTFRLGLPLVLVVSSYE  91

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             A+KDCF+TND + + RP F   +YLGYN  +  L    PYWRK RK  + E+LS+ +LEK
Sbjct  92    AIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEK  151

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R+++++T +K+LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  152   FKHVRLAKIQTGIKDLYSRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  208

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  209   QVERFKNA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  261

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH+  +R+ ++  NE      QDFIDV+LS + +++     Y  + +IKAT  S+
Sbjct  262   QNWLEEHI-KKREVNAEGNE------QDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSL  313

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+ +A+K+ +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  314   VLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  373

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++WP P++F PERF+ 
Sbjct  374   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWPNPDKFDPERFI-  432

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   +++EYIPFG GRRSC G TYA+QV HLT+ARLIQGF++ TP+ +PLDM EG 
Sbjct  433   AGDIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMARLIQGFNYRTPTNEPLDMKEGA  492

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++V+ITPRL    Y
Sbjct  493   GITIRKVNPVEVIITPRLAHELY  515



>ref|XP_009348374.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   495 bits (1275),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 255/518 (49%), Positives = 344/518 (66%), Gaps = 21/518 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR K+  S   K  L P+  GA PI+GHL  LG G  PL R LA+MADKYG +FT+RLG 
Sbjct  21    WRVKV-QSRKTKGMLAPQASGALPIIGHLHKLG-GKKPLCRTLASMADKYGPIFTIRLGK  78

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +  LV+++++AVK+CFT ND   A+R   A  +YLGYNYA F       YWR MRK    
Sbjct  79    HPALVINNYDAVKECFTKNDIAFASRSKSAQGRYLGYNYAGFGFAPYGTYWRNMRKMVTV  138

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITS--SSSAKTVDMSEWFGQLTLNLIVKIVA  1174
             ELLSS++L+ L+H+++ EV++ +K LY +  +   +    V +SEW   LTLN+I +++A
Sbjct  139   ELLSSRRLQTLKHVQICEVDSFIKGLYEICKTKGENGQSKVVISEWIEHLTLNVITQMIA  198

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGD--AFPFWIVRWVEFQRRVV  1000
             GKR+       +D D   E + I  + KEFM + G+    D   FP WI    +     V
Sbjct  199   GKRYFDLGTVGNDSDNEGENKRIRGMVKEFMCVAGKPAVSDVIGFPHWIDLMGQ-----V  253

Query  999   KDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA  820
             K+M RI K+ D+++  W++EH +AR++  S        D  DFIDVMLS+I+D+    L 
Sbjct  254   KNMKRIGKDFDSLMAGWIEEHKNARKEIDS-------RDKLDFIDVMLSVIEDNTV--LG  304

Query  819   YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDG  640
             +  E IIKAT  ++I+ GSDTTA  LTW+LSL++N+   +K  +E+I+ +VG ERWVED 
Sbjct  305   HTRETIIKATSQTLILAGSDTTATSLTWILSLLLNNRHVLKHAQEEINLQVGTERWVEDT  364

Query  639   DIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRI  460
             DIKD+ YLQA VKETLRLYPP P    H A EDC+V G+ IPKGT L+ N WK+HRDP +
Sbjct  365   DIKDLTYLQAIVKETLRLYPPAPLSTSHEAMEDCQVCGFYIPKGTRLFTNLWKLHRDPSV  424

Query  459   WPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             W +PE F P+RFLT  A  D   ++FE+IPFG GRRSC G T+AMQV HLT+ RLIQGF+
Sbjct  425   WSDPEVFCPDRFLTTQASIDVSGQHFEFIPFGSGRRSCPGLTFAMQVIHLTLGRLIQGFE  484

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
               TP + P+DM+EGLG+T+P+AT+L+VV+TPRLP  FY
Sbjct  485   LATPLDMPVDMAEGLGVTMPKATSLEVVLTPRLPCQFY  522



>dbj|BAM36725.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   494 bits (1273),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 240/503 (48%), Positives = 347/503 (69%), Gaps = 21/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL    + G   PL RKL  +ADKYG V+T RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKLGDLADKYGPVYTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             A+KDCF+TND + + RP F   +YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFLANYGPYWRKNRKLIIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R+++++T +K+LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRLAKIQTGIKDLYSRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKNA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH+  +R+ ++  NE      QDFIDV+LS + +++     Y  + +IKAT  S+
Sbjct  261   QNWLEEHI-KKREVNAEGNE------QDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSL  312

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+ +A+K+ +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  313   VLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  372

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W  P++F PERF+ 
Sbjct  373   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFI-  431

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   +++EYIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+ +PLDM EG 
Sbjct  432   AGDIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPTNEPLDMKEGA  491

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++V+ITPRL P  Y
Sbjct  492   GITIRKVNPVEVIITPRLAPELY  514



>ref|XP_011045174.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Populus 
euphratica]
Length=531

 Score =   493 bits (1270),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 244/506 (48%), Positives = 345/506 (68%), Gaps = 16/506 (3%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             T+K    PE  GA P++GHL LLG+    L R LAA+ADKYG +FT+RLG +  +VVS+ 
Sbjct  36    TEKGLQAPEPSGALPLIGHLHLLGAQKT-LARTLAAIADKYGPIFTIRLGKHPTVVVSNL  94

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             EA+K+CFTT+D+++++RP  +  +YL YNYA F      P+WR+MRK    +LLSS +L+
Sbjct  95    EAIKECFTTHDRILSSRPRSSHGEYLSYNYAAFGFTNSGPFWREMRKIVTIQLLSSHRLK  154

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKE  1144
              LRH++VSEV T + +LY+L  S+    T + +SE F ++T+N+I +++AGKR+ F   E
Sbjct  155   SLRHVQVSEVNTLINDLYLLSKSNKQGSTKIVISECFERMTINMITRMIAGKRY-FSSTE  213

Query  1143  DDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDT  964
                  E +E + I ++ KEFMY++G FV  D  PF  + W+      VK M R+ +ELD+
Sbjct  214   A----EKEEGKRIGKLMKEFMYISGVFVPSDLIPF--LGWINNFLGSVKTMKRLSRELDS  267

Query  963   ILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGL  784
             +++ W+ EH   + KR  +   + K D  DFIDVMLS++DD  +    Y  E IIKAT +
Sbjct  268   LMESWIQEH---KLKRLESTENTNKMDDDDFIDVMLSLLDDSMS---GYSRETIIKATAM  321

Query  783   SMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAV  604
             ++II G+DTT++ LTW+LS ++N+  +++  +E++D KVG+ERW ED DI ++ Y+QA +
Sbjct  322   TLIIAGADTTSITLTWILSNLLNNRRSLQLAQEELDLKVGRERWAEDSDIGNLVYIQAII  381

Query  603   KETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERF  424
             KETLRLYPP P   PH ATED  V GY +PKGT L+ N WK+HRDP +W  P+ +MPERF
Sbjct  382   KETLRLYPPGPLSVPHEATEDFCVAGYHMPKGTRLFTNLWKLHRDPNLWSNPDEYMPERF  441

Query  423   LT-AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMS  247
             L   A  D    +FE IPFG GRRSC G T+A+QV HLT ARL+QGFD +TP  + +DM+
Sbjct  442   LNDHANLDVLGHHFELIPFGSGRRSCPGITFALQVLHLTFARLLQGFDMKTPRGESVDMT  501

Query  246   EGLGITLPRATALDVVITPRLPPSFY  169
             EG+ ITLP+AT L++ ITPRL P  Y
Sbjct  502   EGVAITLPKATPLEIHITPRLSPELY  527



>ref|XP_009627979.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=517

 Score =   493 bits (1268),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 239/503 (48%), Positives = 344/503 (68%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGGI--PLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFHFNDDGNDRPLARKLGDLADKYGLVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             A+KDCF+TND + + RP F   +Y+GYN A+  L    PYWRK RK  + E+LS+ +L+K
Sbjct  91    AIKDCFSTNDAIFSNRPAFLYGEYIGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLKK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++TS+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQTSIKNLYTRIDRNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM ++ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMIISMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS + +++  G  Y  + +IKAT  S+
Sbjct  261   QNWLEEHINKREKMEVNA----EGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+ +A+K+ +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY I KGT L+ N  K+ RDP++WP P+ F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHENIEDCVVSGYYISKGTRLFANVMKLQRDPKLWPNPDNFDPERFV-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             AA  D   +++EYIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM EG 
Sbjct  435   AAGIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYSTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++V+I  RL P  Y
Sbjct  495   GITIRKVNPVEVIIMSRLAPELY  517



>gb|ABD39477.1| CYP82E4v6 [Nicotiana tabacum]
Length=517

 Score =   492 bits (1267),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 240/503 (48%), Positives = 341/503 (68%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F    YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++ S+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQASIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS + +++  G  Y  + +IKAT  S+
Sbjct  261   QNWLEEHINKREKMEVNA----EGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++WP+P+ F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLLRDPKLWPDPDTFDPERFI-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   + ++YIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM EG 
Sbjct  435   ATDIDFRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++++I PRL P  Y
Sbjct  495   GITIRKVNPVELIIAPRLAPELY  517



>ref|XP_009778755.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana sylvestris]
Length=515

 Score =   492 bits (1267),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 238/503 (47%), Positives = 339/503 (67%), Gaps = 21/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LP ++ G  P++GHL    + G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  32    KPLPTKIPGGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  91

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             A+KDCF+TND + + RP F   +YLGYN  +  L    PYWRK RK  + E+LS+ +LEK
Sbjct  92    AIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEK  151

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              + +R + ++TS+K LY  I  +SS  T+++S+W  +L   LIVK++AGK ++   K D+
Sbjct  152   FKQVRFTRIQTSIKNLYTRINGNSS--TINLSDWLEELNFGLIVKMIAGKNYE-SGKGDE  208

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K A      FK+FM L+ +FV  DAFP  + +WV+FQ  + K M R  K++D++ 
Sbjct  209   QVERFKNA------FKDFMVLSMEFVLWDAFPIPLFKWVDFQGHI-KAMKRTFKDIDSVF  261

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS +  ++     Y  + +IKAT  S+
Sbjct  262   QNWLEEHINKREKMEVGA----EGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSL  316

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+ +A+K+ +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  317   VLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  376

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++WP P+ F PERF+ 
Sbjct  377   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWPNPDNFDPERFVI  436

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
                 D   +++EYIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+ +PLDM EG 
Sbjct  437   ----DFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPTNEPLDMKEGA  492

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +  +++V+I PRL P  Y
Sbjct  493   GITIRKVNSVEVLIKPRLAPELY  515



>gb|ABD39479.1| CYP82E4v8 [Nicotiana tabacum]
Length=517

 Score =   492 bits (1267),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 240/503 (48%), Positives = 341/503 (68%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F    YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++ S+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQASIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRAFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS + +++  G  Y  + +IKAT  S+
Sbjct  261   QNWLEEHINKREKMEVNA----EGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+VN  K+ RDP++W +P+ F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFVNVMKLQRDPKLWSDPDTFDPERFI-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   + ++YIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM EG 
Sbjct  435   ATDIDFRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++++I PRL P  Y
Sbjct  495   GITIRKVNPVELIIAPRLAPELY  517



>ref|XP_007201695.1| hypothetical protein PRUPE_ppa004301mg [Prunus persica]
 gb|EMJ02894.1| hypothetical protein PRUPE_ppa004301mg [Prunus persica]
Length=517

 Score =   492 bits (1266),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 250/518 (48%), Positives = 350/518 (68%), Gaps = 29/518 (6%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR +I  S   K  L P+  GA PI+GHL  L     P+ + LAAMADKYG +FT+ LG 
Sbjct  21    WRLRI-QSHKIKGMLAPQPSGALPIIGHLHKLRG---PIFKTLAAMADKYGPIFTIWLGK  76

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             + +LV+S+++AVK CFT ND V A R    V KYLGYNYA F       YWR MRK  + 
Sbjct  77    HPVLVISNYDAVKQCFTKNDTVFATRSRSTVGKYLGYNYAGFGFSPYGTYWRDMRKMVMV  136

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS----SAKTVDMSEWFGQLTLNLIVKI  1180
             ELLSS++LE L+ +++SEV+  +K L++L  +      +   V +S+W   LTLN+I ++
Sbjct  137   ELLSSRRLETLKRVQISEVDAFIKGLFLLCKTEGHNGLNPTKVVISDWIEHLTLNVITRM  196

Query  1179  VAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVV  1000
             +AGKR+       D+ DE    Q   ++ KEFMY++G  V  D   F    W++F+ +V 
Sbjct  197   IAGKRY---FDSSDEGDE----QRFGKILKEFMYVSGNPVAADVIGF--PSWIDFKGQV-  246

Query  999   KDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA  820
             K M RIMKELD+++  W++EH         A  E+   D  DFIDVM+S+I+D+    L 
Sbjct  247   KAMKRIMKELDSVMGSWVEEHY--------AKKETNSRDEHDFIDVMISVIEDN--STLG  296

Query  819   YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDG  640
             Y  E IIKAT L++I+ GS+TTA++L W+LSL++N+   +K  +E++D KVG++RW+ED 
Sbjct  297   YTRETIIKATSLNLILAGSETTAINLIWILSLLLNNRHVLKLAQEELDLKVGRDRWIEDT  356

Query  639   DIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRI  460
             DI+++ YLQA VKETLRLYPP P   PH A +DC+V G+ I KGT L+VN WK+HRDP +
Sbjct  357   DIENLPYLQAIVKETLRLYPPAPLSVPHEAMQDCQVCGFHIQKGTLLFVNLWKLHRDPSL  416

Query  459   WPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             WP+PE F PERFLT     DA  ++FE+IPFG GRRSC G T+A+QV+HLT+ RL+QGF+
Sbjct  417   WPDPEVFCPERFLTTHVGIDASGQHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGFE  476

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
               TP + P+D++EG+GIT+P++T+L+V++TPRLP  FY
Sbjct  477   LATPMDMPVDLTEGVGITMPKSTSLEVILTPRLPLVFY  514



>ref|XP_009619218.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=517

 Score =   491 bits (1265),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 241/503 (48%), Positives = 341/503 (68%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F   +YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFLTKYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
             L+H+R  +++TS+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   LKHVRFGKIQTSIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +++A      FK+F+ L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFRKA------FKDFIILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EHV  R K    A    + + QDFIDV+LS + +++     Y  + +IKAT  S+
Sbjct  261   QNWLEEHVKKREKMEVNA----QGNEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+K+ +E+ID KVGKERWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHMNWGMALLINNQHALKKAQEEIDKKVGKERWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W  P++F PERF  
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFF-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   +++E+IPFG GRRSC G TYA+QV HLT+A LIQGF+++TP+++PLDM EG 
Sbjct  435   ADDIDYRGQHYEFIPFGSGRRSCPGMTYALQVEHLTIAHLIQGFNYKTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             G+T+ +   ++V IT RL P  Y
Sbjct  495   GLTIRKVNPVEVTITARLAPELY  517



>gb|ABA07804.1| cytochrome P450 monooxygenase CYP82E4v2 [Nicotiana tabacum]
 gb|ABB36475.1| nicotine demethylase [Nicotiana tabacum]
 gb|ABN42695.1| cytochrome P450 CYP82E4v2 nicotine demethylase [Nicotiana tabacum]
Length=517

 Score =   491 bits (1265),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 239/503 (48%), Positives = 340/503 (68%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F    YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++ S+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQASIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS + +++  G  Y  + +IKAT  S+
Sbjct  261   QNWLEEHINKREKMEVNA----EGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W +P+ F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   + ++YIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM EG 
Sbjct  435   ATDIDFRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++++I PRL P  Y
Sbjct  495   GITIRKVNPVELIIAPRLAPELY  517



>gb|ABA07807.1| cytochrome P450 monooxygenase CYP82E3 [Nicotiana tabacum]
Length=518

 Score =   491 bits (1264),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 240/503 (48%), Positives = 340/503 (68%), Gaps = 17/503 (3%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             A+KDCF+TND + + RP F   +YLGY  A+  L     YWRK RK  + E+LS+ +LEK
Sbjct  91    AIKDCFSTNDAIFSNRPAFLYGEYLGYKNAMLFLANYGSYWRKNRKLIIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++TS+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQTSIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH+  R K      E    + QDFIDV+LS + +++  G  Y  + +IKAT  S+
Sbjct  261   QNWLEEHIKKREKIMEVGTEG---NEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSL  316

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+   ++L++N+ +A+K+ +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  317   VLDAADTVALHINCGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  376

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W  P++F PERF+ 
Sbjct  377   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFNPERFI-  435

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   +++EYIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM EG 
Sbjct  436   ARDIDFHGQHYEYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPTDEPLDMKEGA  495

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   + V+ITPRL P  Y
Sbjct  496   GITIRKVNPVKVIITPRLAPELY  518



>gb|KDP26345.1| hypothetical protein JCGZ_17503 [Jatropha curcas]
Length=532

 Score =   491 bits (1265),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 252/513 (49%), Positives = 344/513 (67%), Gaps = 19/513 (4%)
 Frame = -3

Query  1689  HSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVV  1510
             HS   K  L PE  GA PILGHL LLG+    L R LA +ADKYG +FT+ LG++R + V
Sbjct  31    HSHKNKGLLAPEPFGALPILGHLHLLGAEKT-LARTLALLADKYGPIFTIWLGVHRTVEV  89

Query  1509  SSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQ  1330
             SS EA+K+CFT NDKV+A+RP  +  KYL YNYA F   +  PYWR MRK  V +LLSS 
Sbjct  90    SSHEAIKECFTANDKVLASRPKSSHGKYLSYNYAAFGFASYGPYWRDMRKLVVIQLLSSH  149

Query  1329  KLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKV  1150
             +L+ L+H++VSEV T +K+LY+L  +  S+  + +SE+F  LTLN+I +++AGKR+    
Sbjct  150   RLKSLKHVQVSEVNTLIKDLYLLSLNQPSSNKIVISEFFEHLTLNMITRMIAGKRYCNCN  209

Query  1149  KEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKEL  970
               +D+     E   I ++ KEFMY++G FV  D  PF  + W+ F    VK M R+ KEL
Sbjct  210   GGNDE-----EGIRIGKLMKEFMYVSGVFVPSDVIPF--LWWMNFLGP-VKAMKRLSKEL  261

Query  969   DTILQRWLDEH----VDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEII  802
             D++LQ W+DEH    ++ RR       +  KN  +DFIDVMLS+++D+F     +  + I
Sbjct  262   DSLLQTWIDEHKLKGINKRRDGGGGGGDF-KNIEEDFIDVMLSILEDNF---FGHSRDDI  317

Query  801   IKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDME  622
             IK T +++II G+DTT++ LTW+LS ++N+  A++  ++++D KVGKER V+D DI+++ 
Sbjct  318   IKGTVMTLIIAGADTTSITLTWILSNLLNNRHALELAQQELDLKVGKERCVQDSDIENLV  377

Query  621   YLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPER  442
             YLQA VKETLRLYPP P   PH A  DC + GY IPKGT +  N WK+HRDP IW  P++
Sbjct  378   YLQAVVKETLRLYPPGPLAVPHEAINDCYISGYYIPKGTRVLANLWKLHRDPNIWSNPDK  437

Query  441   FMPERFLTA--AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPS  268
             F+PERFL       D   +NFEY+PFG GRRSC G  +A+Q  HLT+ARL+Q F   T  
Sbjct  438   FLPERFLANRDNNVDFSGQNFEYLPFGSGRRSCPGLNFAIQAIHLTLARLLQAFSLTTLF  497

Query  267   EKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              +P+DM+EGLGITLP+AT L++ ITPRL    Y
Sbjct  498   NQPVDMTEGLGITLPKATPLEIQITPRLSSELY  530



>gb|ABA07805.1| cytochrome P450 monooxygenase CYP82E4v1 [Nicotiana tabacum]
Length=517

 Score =   491 bits (1264),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 239/503 (48%), Positives = 340/503 (68%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F    YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++ S+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQASIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS + +++  G  Y  + +IKAT  S+
Sbjct  261   QNWLEEHINKREKMEVNA----EGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W +P+ F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   + ++YIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM EG 
Sbjct  435   ATDIDFRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++++I PRL P  Y
Sbjct  495   GITIRKVNPVELIIAPRLAPELY  517



>ref|XP_002531094.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31308.1| cytochrome P450, putative [Ricinus communis]
Length=525

 Score =   491 bits (1264),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 244/518 (47%), Positives = 342/518 (66%), Gaps = 22/518 (4%)
 Frame = -3

Query  1707  WRSKI---FHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLR  1537
             WR ++    +   K   L PE  GA PI+GHL LLG     L R L  +AD YG +FT+ 
Sbjct  25    WRVRVKRQNYESNKSLLLAPEPSGALPIIGHLHLLGKENT-LARTLGRLADNYGPIFTIW  83

Query  1536  LGMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKF  1357
             LG++R +VVSS+EA+K+CF++ND+++A+RP  +  +YL YNYA F   +  PYW  MRK 
Sbjct  84    LGVHRTVVVSSYEAIKECFSSNDRILASRPRSSHGQYLSYNYAAFGFASYGPYWSHMRKL  143

Query  1356  AVTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIV  1177
                +LLSS +++ L+H+++SEV T +KELY      S+ K +++SE F  LTLN+I +++
Sbjct  144   VAIQLLSSHRIKLLKHVQISEVNTLIKELYE--KQGSNKKIINISECFEHLTLNMITRMI  201

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
             AGKR+        D D  +E + I ++ KEFMY++G FV  D  PF  + W+ F   V K
Sbjct  202   AGKRYF----SSADSDSEQEGKRIGKIMKEFMYISGVFVPSDLIPF--LGWMNFAGPV-K  254

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
              M R+ +ELD++ + W+DEH   R K     +E  KN  +DFIDVMLS+++DDF     +
Sbjct  255   TMKRLSRELDSLTETWIDEHKLKRVK-----SEESKNMEEDFIDVMLSLLEDDF---FGH  306

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
               E IIK T  ++II G+DTT++ LTW+LS ++N+   ++  ++++D KVG+ R V+D D
Sbjct  307   SKEDIIKGTVTNLIIAGADTTSITLTWILSNLLNNRRTLELAQQELDLKVGRNRCVQDSD  366

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIW  457
             I ++ YL A VKETLRLYPP P   PH A+EDC + GY IPKGT ++ N WK+HRDP +W
Sbjct  367   IDNLVYLNAIVKETLRLYPPGPLAVPHEASEDCSIAGYHIPKGTRVFANLWKLHRDPNVW  426

Query  456   PEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDF  280
               P  F+PERFLT+ A  D   +NFEYIPFG GRRSC G  +A+Q  HLT+A+L+Q F F
Sbjct  427   SSPNEFVPERFLTSQANMDVSGQNFEYIPFGSGRRSCPGLNFAIQAIHLTLAKLLQAFSF  486

Query  279   ETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYG  166
              TP   P+DM+EGLGITLP+AT L++ I PRL P  Y 
Sbjct  487   TTPLNVPVDMTEGLGITLPKATPLEIHIIPRLSPELYA  524



>ref|XP_009609539.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
 gb|ABM46920.1| cytochrome P450 monooxygenase CYP82E4 [Nicotiana tomentosiformis]
Length=517

 Score =   491 bits (1263),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 239/503 (48%), Positives = 340/503 (68%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F    YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++ S+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQASIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS + +++  G  Y  + +IKAT  S+
Sbjct  261   QNWLEEHINKREKMEVNA----EGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W +P+ F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   + ++YIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM EG 
Sbjct  435   ATDIDFRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++++I PRL P  Y
Sbjct  495   GITIRKVNPVELIIAPRLAPELY  517



>gb|ABD39476.1| CYP82E4v5 [Nicotiana tabacum]
Length=517

 Score =   491 bits (1263),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 239/503 (48%), Positives = 340/503 (68%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F    YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++ S+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQASIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS + +++  G  Y  + +IKAT  S+
Sbjct  261   QNWLEEHINKREKMEVNA----EGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W +P+ F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVVKLQRDPKLWSDPDTFDPERFI-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   + ++YIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM EG 
Sbjct  435   ATDIDFRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++++I PRL P  Y
Sbjct  495   GITIRKVNPVELIIAPRLAPELY  517



>ref|XP_011030904.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=526

 Score =   490 bits (1262),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 249/500 (50%), Positives = 330/500 (66%), Gaps = 14/500 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA PI+GHL LLG G   L R L AMADK+GS FT+RLG  R  VVSSWE VK+CF
Sbjct  38    PEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKHGSAFTIRLGSRRAFVVSSWEVVKECF  97

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP    AK++GYNYAVF     S +WR+MRK A  ELLS+++LE L+H+R 
Sbjct  98    TINDKALASRPTTVAAKHMGYNYAVFGFAPYSAFWREMRKIATIELLSNRRLEMLKHVRA  157

Query  1299  SEVETSLKELY-MLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
             SEV+  ++ELY     +SSS   V++ +W   LTLN++V++VAGKR+       DD    
Sbjct  158   SEVDIGIRELYNSWANNSSSPVVVELKQWLEDLTLNVVVRMVAGKRYFGSAAASDD----  213

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
              EA+   +   +F  L G F+  DA PF  + W++ Q    + M    KELD IL+ WLD
Sbjct  214   GEARRCQKAINQFFRLIGIFLVSDALPF--LGWLDLQGHE-RAMKNTAKELDAILEGWLD  270

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGS  763
             EH   R++R SA  +    D QDFIDVMLS+ ++       Y     IK+T L++I+ GS
Sbjct  271   EH---RQRRVSAGIKD--EDEQDFIDVMLSLKEEGQLSNFQYDANTSIKSTCLALILGGS  325

Query  762   DTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLY  583
             DTTA  LTW +SL++N+   +K+ +E++D  VGKER VED D+K++ YLQA +KETLRLY
Sbjct  326   DTTAGTLTWAISLLLNNRHMLKKAQEELDLLVGKERQVEDSDVKNLVYLQAIIKETLRLY  385

Query  582   PPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQA  406
             P  P   P  A EDCKV GY +P GT L VN WK+ RDPR+W  P  F+PERFLT+    
Sbjct  386   PAGPLLGPREAMEDCKVAGYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSHGDV  445

Query  405   DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITL  226
             D   + FE IPFG GRRSC G ++A+QV HLT+ARL+  F   TP ++P+D++E  G+T+
Sbjct  446   DVRGQQFELIPFGSGRRSCPGVSFALQVLHLTLARLLHSFQLATPMDQPVDLTESSGLTI  505

Query  225   PRATALDVVITPRLPPSFYG  166
             P+AT L+V++TPRLPP  YG
Sbjct  506   PKATPLEVILTPRLPPKLYG  525



>ref|XP_011101555.1| PREDICTED: cytochrome P450 CYP82D47-like [Sesamum indicum]
Length=519

 Score =   489 bits (1259),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 250/504 (50%), Positives = 337/504 (67%), Gaps = 28/504 (6%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PP+  GA PI+GHL LL    + +   LA +ADKYG VFTL  G  R +VVSS EAV +C
Sbjct  37    PPQPSGAWPIIGHLHLLDPE-LNIAHTLAELADKYGPVFTLWFGAQRAVVVSSREAVFEC  95

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             FT NDK  A RP  +  ++L Y++A F   ++ PYWR+MRK   +E+LS+++LE +R+LR
Sbjct  96    FTRNDKSFANRPITSAGEHLVYDHASFGF-SNGPYWREMRKLVSSEVLSARRLEAMRNLR  154

Query  1302  VSEVETSLKELYMLITSSSSAKT-----VDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
             V+E+ TS+ ELY+  T+ +  +      V MS W  ++TLN+IVK +AGKR+    K   
Sbjct  155   VTEIATSIGELYLETTTKTRGQQPLPSKVVMSSWVEKMTLNIIVKTIAGKRYG---KGAA  211

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
             + + +++      + +EF  L+G+FV  D  P   +RW++  +  +K M R+ KELD I+
Sbjct  212   EVESFRK------LIREFTVLSGEFVPSDVIPIPFLRWID-PKGHIKSMKRVSKELDVII  264

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             ++W++EH+  R K        G  + QDFID MLS IDD FA     P   IIKAT L++
Sbjct  265   EKWVEEHMKRRGK------GEGCTEEQDFIDAMLSTIDDKFA----IPKLTIIKATVLNV  314

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             I+ G DTT+VHLTW+LSL+VN+  AM   R++ID KVG +RWV++ DI ++ YLQA +KE
Sbjct  315   ILGGFDTTSVHLTWVLSLLVNNKHAMNLARQEIDDKVGNQRWVQESDINNLPYLQAIIKE  374

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
             +LRLYPPLP   PH A EDC +  Y IPKGT L+VN WK+H D R WPEP RFMPERFLT
Sbjct  375   SLRLYPPLPLSIPHQAVEDCHLSNYLIPKGTLLFVNIWKLHHDARFWPEPNRFMPERFLT  434

Query  417   A-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEG  241
                Q D   + +EYIPFG GRRSC G T+AMQV+ LTVARLIQGFDF T   + +DM+EG
Sbjct  435   GHTQVDVMGQQYEYIPFGTGRRSCPGTTFAMQVTSLTVARLIQGFDFATEGNEAVDMAEG  494

Query  240   LGITLPRATALDVVITPRLPPSFY  169
             +GIT+PR   L+V++TPRLP   Y
Sbjct  495   IGITMPRKNPLEVLVTPRLPSQLY  518



>gb|ABX56037.1| CYP82E5v2 [Nicotiana tabacum]
Length=517

 Score =   489 bits (1259),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 240/503 (48%), Positives = 341/503 (68%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F   +YLGY+ A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGEYLGYSNAMLFLTKYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
             L+H+R  +++TS+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   LKHVRFGKIQTSIKSLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +++A      FK+F+ L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFRKA------FKDFIILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EHV  R K    A    + + QDFIDV+LS + +++     Y  + +IKAT  S+
Sbjct  261   QNWLEEHVKKREKMEVNA----QGNEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+K+ +E+ID KVGKERWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHMNWGMALLINNQHALKKAQEEIDKKVGKERWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W  P++F PERF  
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFF-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   +++E+IPFG GRRSC G TYA+QV HLT+A LIQGF+++TP+++PLDM EG 
Sbjct  435   ADDIDYRGQHYEFIPFGSGRRSCPGMTYALQVEHLTIAHLIQGFNYKTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             G+T+ +   ++V IT RL P  Y
Sbjct  495   GLTIRKVNPVEVTITARLAPELY  517



>gb|ABC69371.1| CYP82E5 [Nicotiana tabacum]
Length=517

 Score =   489 bits (1259),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 239/503 (48%), Positives = 341/503 (68%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +L+VSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLIVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F   +YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFLTKYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
             L+H+R  +++TS+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   LKHVRFGKIQTSIKSLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +++A      +K+F+ L+ +FV  DAFP  + +WV+FQ   VK M R  K++D++ 
Sbjct  208   QVERFRKA------YKDFIILSMEFVLWDAFPIPLFKWVDFQG-YVKAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EHV  R K    A    + + QDFIDV+LS + +++     Y  + +IKAT  S+
Sbjct  261   QNWLEEHVKKREKMEVNA----QGNEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+K+ +E+ID KVGKERWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHMNWGMALLINNQHALKKAQEEIDKKVGKERWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W  P++F PERF  
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFF-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   +++E+IPFG GRRSC G TYA+QV HLT+A LIQGF+++TP+++PLDM EG 
Sbjct  435   ADDIDYRGQHYEFIPFGSGRRSCPGMTYALQVEHLTIAHLIQGFNYKTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             G+T+ +   ++V IT RL P  Y
Sbjct  495   GLTIRKVNPVEVTITARLAPELY  517



>gb|ABD39478.1| CYP82E4v7 [Nicotiana tabacum]
Length=517

 Score =   489 bits (1258),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 237/503 (47%), Positives = 340/503 (68%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F    YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++ S+K LY  I  +SS  T+++++W  +L   L+VK++AGK ++   K D+
Sbjct  151   FKHVRFARIQASIKNLYTRIDGNSS--TINLTDWLEELNFGLVVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      F++FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FEDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS + +++  G  Y  + +IKAT  S+
Sbjct  261   QNWLEEHINKREKMEVNA----EGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W +P+ F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   + ++YIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM EG 
Sbjct  435   ATDIDFRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++++I PRL P  Y
Sbjct  495   GITIRKVNPVELIIAPRLAPELY  517



>gb|ABD39475.1| CYP82E4v4 [Nicotiana tabacum]
Length=517

 Score =   489 bits (1258),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 238/503 (47%), Positives = 339/503 (67%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG V T RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVLTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F    YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++ S+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQASIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS + +++  G  Y  + +IKAT  S+
Sbjct  261   QNWLEEHINKREKMEVNA----EGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W +P+ F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   + ++YIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM EG 
Sbjct  435   ATDIDFRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++++I PRL P  Y
Sbjct  495   GITIRKVNPVELIIAPRLAPELY  517



>gb|ABD39474.1| CYP82E4v3 [Nicotiana tabacum]
Length=517

 Score =   489 bits (1258),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 238/503 (47%), Positives = 339/503 (67%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F    YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++ S+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQASIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS + +++  G  Y  + +IKAT  S+
Sbjct  261   QNWLEEHINKREKMEVNA----EGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W +P+ F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   + ++YIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++P DM EG 
Sbjct  435   ATDIDFRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPSDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++++I PRL P  Y
Sbjct  495   GITIRKVNPVELIIAPRLAPELY  517



>ref|XP_006375022.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
 gb|ERP52819.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
Length=519

 Score =   489 bits (1258),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 248/500 (50%), Positives = 329/500 (66%), Gaps = 14/500 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA PI+GHL LLG G   L R L AMADK+GS FT+RLG  R  VVSSWE VK+CF
Sbjct  31    PEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKHGSAFTIRLGSRRAFVVSSWEVVKECF  90

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T N K +A+RP    AK++GYNYAVF     S +WR+MRK A  ELLS+++LE L+H+R 
Sbjct  91    TINAKALASRPTTVAAKHMGYNYAVFGFAPYSSFWREMRKIATLELLSNRRLEMLKHVRA  150

Query  1299  SEVETSLKELY-MLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
             SEV+  ++ELY     +SSS   V++ +W   LTLN++V++VAGKR+       DD    
Sbjct  151   SEVDIGIRELYNSWANNSSSPVVVELKQWLEDLTLNVVVRMVAGKRYFGSAAASDD----  206

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
              EA+   +   +F  L G FV  DA PF  + W++ Q    + M    KELD IL+ WLD
Sbjct  207   GEARRCQKAINQFFRLIGIFVVSDALPF--LGWLDLQGHE-RAMKNTAKELDAILEGWLD  263

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGS  763
             EH   R++R SA  +      QDFIDVMLS+ ++       Y     IK+T L++I+ GS
Sbjct  264   EH---RQRRVSAGIKD--EGEQDFIDVMLSLKEEGQLSNFQYDANTSIKSTCLALILGGS  318

Query  762   DTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLY  583
             DTTA  LTW +SL++N+   +K+ +E++D  VGKER VED D+K++ YLQA +KETLRLY
Sbjct  319   DTTAGTLTWAISLLLNNRHMLKKAQEELDLHVGKERQVEDSDVKNLVYLQAIIKETLRLY  378

Query  582   PPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQA  406
             P  P   P  A EDCKV GY +P GT L VN WK+ RDPR+W  P  F+PERFLT+    
Sbjct  379   PAGPLLGPREAMEDCKVAGYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSHGDV  438

Query  405   DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITL  226
             D   + FE IPFG GRRSC G ++A+QV HLT+ARL+  F+  TP ++P+D++E  G+T+
Sbjct  439   DVRGQQFELIPFGSGRRSCPGVSFALQVLHLTLARLLHSFELATPMDQPVDLTESSGLTI  498

Query  225   PRATALDVVITPRLPPSFYG  166
             P+AT L+V++TPRLPP  YG
Sbjct  499   PKATPLEVILTPRLPPKLYG  518



>ref|XP_007136644.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
 gb|ESW08638.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
Length=528

 Score =   488 bits (1256),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 246/495 (50%), Positives = 326/495 (66%), Gaps = 13/495 (3%)
 Frame = -3

Query  1647  GARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCFTTND  1468
             GA P++GHL LLG     L R L  MAD+YG  F + LG  R  VVSSWE  K+CFTTND
Sbjct  45    GAWPLIGHLHLLGGDDQLLYRTLGTMADQYGPAFNIWLGTRRAFVVSSWEVAKECFTTND  104

Query  1467  KVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRVSEVE  1288
             K +A+RP    AK++GYNYAVF     SP+WR+MRK A  ELLS+++LE L+H+RVSE+ 
Sbjct  105   KALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEMLKHVRVSELN  164

Query  1287  TSLKELY-MLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEYKEAQ  1111
             T +KELY   + + S    V+++ W   LTLN++V++VAGKR+ F      D DE +  Q
Sbjct  165   TGIKELYNSWVQNRSQPVVVELNRWLEDLTLNMVVRMVAGKRY-FGASATCDDDEARRCQ  223

Query  1110  HIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLDEHVD  931
               I    +F +L G FV  DA PF  +RW + Q    + M +  KELD+IL+ WL EH  
Sbjct  224   KAI---NQFFHLIGIFVVSDALPF--LRWFDLQGHE-RAMKKTAKELDSILEGWLQEH--  275

Query  930   ARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGSDTTA  751
              R +R     E      QDFIDVML +          Y  +  IK+T L++I+ GSDT+A
Sbjct  276   -RMQRVDG--EVKVEGEQDFIDVMLDLQKTGHLSNFQYDSDTSIKSTCLAIILGGSDTSA  332

Query  750   VHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLYPPLP  571
               LTW +SL++N+  A+K+ +E++D  VG ER VE+ DI+++ YLQA +KETLRLYP  P
Sbjct  333   GTLTWAISLLLNNRQALKKAQEELDLNVGMERQVEESDIRNLAYLQAIIKETLRLYPAGP  392

Query  570   TYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQADAPWR  391
                P  A EDC VGGYD+P GT L VN WK+HRDPR+W EP  F PERFLT+   D   +
Sbjct  393   LLGPREAQEDCNVGGYDVPAGTRLVVNLWKIHRDPRVWEEPSAFRPERFLTSDAVDVRGQ  452

Query  390   NFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITLPRATA  211
             NFE IPFG GRRSC G ++A+QV HLT+ARL+  F+F TPS++P+DM+E  G+T+P+AT 
Sbjct  453   NFELIPFGSGRRSCPGMSFALQVLHLTLARLLHAFEFATPSDEPVDMTESPGLTIPKATP  512

Query  210   LDVVITPRLPPSFYG  166
             L+V++TPRLPP  Y 
Sbjct  513   LEVLLTPRLPPQLYA  527



>gb|AGD93125.1| CYP450 nicotine N-demethylase [Nicotiana tabacum]
Length=517

 Score =   487 bits (1254),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 238/503 (47%), Positives = 339/503 (67%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F    YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++ S+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQASIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS + +++  G  Y  + +IKAT  S+
Sbjct  261   QNWLEEHINKREKMEVNA----EGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+  DP++W +P+ F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQCDPKLWSDPDTFDPERFI-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   + ++YIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM EG 
Sbjct  435   AIDIDFRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++++I PRL P  Y
Sbjct  495   GITIRKVNPVELIIAPRLAPELY  517



>gb|ABD39480.1| CYP82E4v10 [Nicotiana tabacum]
Length=517

 Score =   487 bits (1253),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 238/505 (47%), Positives = 340/505 (67%), Gaps = 22/505 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F    YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++ S+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQASIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  D+FP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDSFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS + +++  G  Y  + +IKAT  S+
Sbjct  261   QNWLEEHINKREKMEVNA----EGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHINWGMALLMNNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W +P+ F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIA  435

Query  417   AAQADAPWRN--FEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSE  244
                 D  +R   ++YIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM E
Sbjct  436   ---TDIGFRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKE  492

Query  243   GLGITLPRATALDVVITPRLPPSFY  169
             G GIT+ +   ++++I PRL P  Y
Sbjct  493   GAGITIRKVNPVELIIAPRLAPELY  517



>gb|ABD39481.1| CYP82E4v11 [Nicotiana tabacum]
Length=517

 Score =   486 bits (1252),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 236/503 (47%), Positives = 339/503 (67%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL +KL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFHFNDDGDDRPLAQKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+T+D + + RP F    YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTDDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++ S+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQASIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS + +++  G  Y  + +IKAT   +
Sbjct  261   QNWLEEHINKREKMEVNA----EGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFGL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W +P+ F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   + ++YIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM EG 
Sbjct  435   ATDIDFRGQYYKYIPFGSGRRSCPGMTYALQVEHLTIAHLIQGFNYRTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++++I PRL P  Y
Sbjct  495   GITIRKVNPVELIIAPRLAPELY  517



>emb|CDP15065.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   486 bits (1251),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 246/513 (48%), Positives = 341/513 (66%), Gaps = 20/513 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR ++  +   K    PE  G  P +GHL  L S  +P+ R L AMADKYG VF+LRLGM
Sbjct  23    WRPRVNPNPRSKAVSAPEAAGGWPFIGHLLQL-SPNVPIARNLGAMADKYGPVFSLRLGM  81

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
              + LVVSSWEAVK+CFTTNDK  + RP  +  +Y+GYNYA        PYWR++RK  + 
Sbjct  82    RQTLVVSSWEAVKECFTTNDKAFSYRPPSSFNEYVGYNYAAIGFAPYGPYWREIRKIVML  141

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSS--AKTVDMSEWFGQLTLNLIVKIVA  1174
             ELLS+++LE+L+H+R+SE+E ++K L+    SSS+     V+M +WF  L LN++V+ ++
Sbjct  142   ELLSNRRLERLKHVRISEIENNIKVLFDGWKSSSNDPPAKVNMGKWFEDLFLNIMVRKIS  201

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             G R+      D +    + AQ    V KEF++  GQFV  D  PF +++W++ Q  + K 
Sbjct  202   GTRYT-----DSEVGSKRNAQ-FRRVVKEFVHFLGQFVVSDVIPFPLLKWIDMQGHL-KS  254

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             + R+ KELD+I+Q W+DEH + R K S   +E      QDFID +LS+  D++  G  + 
Sbjct  255   IKRVSKELDSIIQIWIDEHNERRMKISEQGDE-----QQDFIDALLSVTKDEYLFG--HS  307

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              E +IKAT +S++I   +TT++HLTW LSL++N+   M++ +E+IDS VGKERW E+ DI
Sbjct  308   RETVIKATLMSLVIAAFETTSIHLTWTLSLLLNNKHVMRQAQEEIDSNVGKERWAEESDI  367

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
              ++ YLQA VKE++RLYPP P   P  A EDC V GY I  GT L+VN WK+ RDPRIW 
Sbjct  368   NNLVYLQAIVKESIRLYPPAPLSLPRQAMEDCNVSGYRISMGTQLFVNVWKLQRDPRIWS  427

Query  453   EPERFMPERFLTAAQADAPWRNFE--YIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDF  280
             EP++F+PERFL   + D   +NFE  + PFG GRRSC G   A QV+HLT+ARL+QGFD 
Sbjct  428   EPDQFLPERFLN-GEVDFSGKNFEFSFTPFGSGRRSCPGIPLATQVTHLTLARLLQGFDL  486

Query  279   ETPSEKPLDMSEGLGITLPRATALDVVITPRLP  181
              TPS+ P+DM+E   I++ +AT L+VVI PRLP
Sbjct  487   TTPSDLPVDMTEDTSISMGKATPLEVVILPRLP  519



>ref|XP_010069626.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=542

 Score =   486 bits (1252),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 245/522 (47%), Positives = 352/522 (67%), Gaps = 15/522 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR++   +  K   LPPE+ GA PI+GH+ LLG G  PL R LAAMADK G +F +RLG+
Sbjct  21    WRARSSPNKPKGTALPPELPGAWPIIGHIHLLG-GETPLARTLAAMADKQGPMFRIRLGV  79

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +   ++SS EAV++CFTT+DK +A+RP      +LGY YA F       +WR+MRK  + 
Sbjct  80    HPATIISSREAVRECFTTHDKDLASRPKSKAGIHLGYGYAGFGFVEYGDFWREMRKITML  139

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS------SAKTVDMSEWFGQLTLNLIV  1186
             ELLS+++L+ L+H++ SE++T +K+L+ L  ++S      S+K V +S+    LTLN+I+
Sbjct  140   ELLSTRRLDNLKHVQASEIDTFVKDLHALCRTNSIDAQNGSSKVVVISQLLELLTLNIII  199

Query  1185  KIVAGKRF--KFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQ  1012
             +++A KR+            D+ +EA H+  V KEFMY++G     D  PF    W +  
Sbjct  200   RMIASKRYFGLSSASTGSSADDDEEASHLRRVIKEFMYISGFPAVSDLVPF--TGWTDCV  257

Query  1011  RRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFA  832
                VK M R+ +ELD I+ +W++EH    ++      E   +  +DFIDVMLS+I +D  
Sbjct  258   G-TVKTMKRVARELDEIVGKWVEEH--KLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGL  314

Query  831   RGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERW  652
                 + PE +IKAT +++I+ GSD+T+++LTW+LSL++NH   +KR +E+ID KVGK+RW
Sbjct  315   AQFGHSPETLIKATIVNIIVAGSDSTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDRW  374

Query  651   VEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHR  472
             V+D DI+++ YLQA VKETLRLYPP P   PH A  DC V GY IPKGT ++VNAWK+HR
Sbjct  375   VQDSDIENLLYLQAIVKETLRLYPPGPLLVPHEARADCNVRGYLIPKGTRIFVNAWKLHR  434

Query  471   DPRIWPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLI  295
             DP++W EPE+F+PERFLT  +  DA  ++FE+IPFG GRR C G  +A++ +HLT+ARL+
Sbjct  435   DPQVWSEPEKFLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLL  494

Query  294   QGFDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             QGFD  T  ++ +DM+EGLG+ LP+AT L VV+ PRLP   Y
Sbjct  495   QGFDLATSLDELVDMTEGLGVNLPKATPLRVVLNPRLPSVLY  536



>ref|XP_006473405.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   486 bits (1250),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 245/510 (48%), Positives = 340/510 (67%), Gaps = 14/510 (3%)
 Frame = -3

Query  1686  SFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVS  1507
             S  +K    PE  GA PI+GHL LLG G   L R L AMADK+G  F +RLG     VVS
Sbjct  31    SNVRKTKKAPEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIRLGSRSAFVVS  90

Query  1506  SWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQK  1327
             SWE VK+CFT NDK +A+RP  A AK++GY+YAVF     +P+WR+MRK A  ELLS+++
Sbjct  91    SWEVVKECFTINDKALASRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKIATLELLSNRR  150

Query  1326  LEKLRHLRVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKV  1150
             LE L+H+R+SEVE  L+EL+ L   ++S    V++ +W   +TLN++V++VAGKR+    
Sbjct  151   LEALKHVRISEVEMGLRELHGLWAKNNSRPVLVELKKWLEDMTLNMVVRMVAGKRY---F  207

Query  1149  KEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKEL  970
                  CD+  EA+   +   +F +L G F   DA PF+   W+++Q   +  M +  KEL
Sbjct  208   GASATCDD-SEARQCQKAINQFFHLIGIFTVSDALPFFW--WLDWQGHEMA-MKKTAKEL  263

Query  969   DTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKAT  790
             D IL+ WL+EH   R++R S   ES     QDFIDVMLS+ ++       +  +I IK+T
Sbjct  264   DAILEGWLEEH---RQRRVSGGIES--ESEQDFIDVMLSLQEEGHLSQFQHSADISIKST  318

Query  789   GLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQA  610
              L++I+ GSDTT+  LTW +SL++N+P+ +K+ +E++D ++G +R V+D DIK++ YLQA
Sbjct  319   CLALILGGSDTTSGTLTWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQA  378

Query  609   AVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPE  430
              +KETLRLYP  P   P  A EDC V GY IP GT L VN WK+ RDPR+W  P  F PE
Sbjct  379   IIKETLRLYPAGPLLGPREAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPE  438

Query  429   RFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLD  253
             RFLT+    D   + FE IPFG GRRSC G ++A+QV HLT+ARL+  F+  TPS++P+D
Sbjct  439   RFLTSHTDVDFRGQQFELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVD  498

Query  252   MSEGLGITLPRATALDVVITPRLPPSFYGL  163
             M+E  G+T+P+AT L+VV++PRLPP+ YG 
Sbjct  499   MTESPGLTIPKATPLEVVLSPRLPPNPYGF  528



>ref|XP_002264790.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   485 bits (1249),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 250/516 (48%), Positives = 335/516 (65%), Gaps = 23/516 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR K   +   K   PPE  GA P +GHL LL  G +P+ R L AMADK G VF +RLGM
Sbjct  24    WRGKTL-THKSKGMSPPEPSGAWPFVGHLHLL-QGKVPVFRTLGAMADKVGPVFVIRLGM  81

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             YR LVVS+ EA K+CFTTNDKV A+RP  + +K LGYNY  F L    P WR++RK  + 
Sbjct  82    YRALVVSNHEAAKECFTTNDKVFASRPSSSASKILGYNYVAFGLAPYGPLWREIRKLCML  141

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS--SAKTVDMSEWFGQLTLNLIVKIVA  1174
             E+LS+++L  L H+ VSE+   +K+LY+L    +  + K V +SEWF  L  N+++++VA
Sbjct  142   EILSTRRLSDLMHVHVSELHAGIKDLYILGKDYNWVNPKKVVISEWFEHLNFNVVLRMVA  201

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+   V    +     EA     V K+ + L G FV  D  PF  + WV+ Q  +   
Sbjct  202   GKRYFNNVVHGGE-----EAGSATAVIKKLVPLAGAFVASDVIPF--LEWVDLQGHL-SS  253

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M ++ KE+D++L+ W++EH    R  S A++       QDFID+ML+ + D  A    Y 
Sbjct  254   MKQVAKEMDSVLESWVEEHTG--RLNSEASSR------QDFIDIMLTKLKD--ASLFGYS  303

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              E IIKAT + +I+ GSDTT++  TWLLS ++N+   MK  +E++D KVG++RWVE  DI
Sbjct  304   RETIIKATVMMLIVAGSDTTSITSTWLLSALLNNRHVMKHAQEELDLKVGRDRWVEQSDI  363

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             +++ YL+A VKETLRLYP +P   PH A EDC VGGY IPKGT L VNAWK+HRDP +W 
Sbjct  364   QNLVYLKAIVKETLRLYPAVPLLVPHEAMEDCHVGGYHIPKGTRLLVNAWKLHRDPAVWS  423

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
              PE F PERFLT+ A  D   +NFE IPFG GRRSC G   A+Q+ HLT+A+L+QGFD  
Sbjct  424   NPEEFQPERFLTSHATVDVLGQNFELIPFGSGRRSCPGINMALQMLHLTIAQLLQGFDMA  483

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             TPS  P+DM+E + IT+P+ T L+V++TPRLP   Y
Sbjct  484   TPSNSPVDMAEAISITMPKLTPLEVMLTPRLPAELY  519



>ref|XP_011045172.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
 ref|XP_011045173.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
Length=541

 Score =   486 bits (1251),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 244/516 (47%), Positives = 345/516 (67%), Gaps = 26/516 (5%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             T+K    PE  GA P++GHL LLG+    L R LAA+ADKYG +FT+RLG +  +VVS+ 
Sbjct  36    TEKGLQAPEPSGALPLIGHLHLLGAQKT-LARTLAAIADKYGPIFTIRLGKHPTVVVSNL  94

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             EA+K+CFTT+D+++++RP  +  +YL YNYA F      P+WR+MRK    +LLSS +L+
Sbjct  95    EAIKECFTTHDRILSSRPRSSHGEYLSYNYAAFGFTNSGPFWREMRKIVTIQLLSSHRLK  154

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKE  1144
              LRH++VSEV T + +LY+L  S+    T + +SE F ++T+N+I +++AGKR+ F   E
Sbjct  155   SLRHVQVSEVNTLINDLYLLSKSNKQGSTKIVISECFERMTINMITRMIAGKRY-FSSTE  213

Query  1143  DDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDT  964
                  E +E + I ++ KEFMY++G FV  D  PF  + W+      VK M R+ +ELD+
Sbjct  214   A----EKEEGKRIGKLMKEFMYISGVFVPSDLIPF--LGWINNFLGSVKTMKRLSRELDS  267

Query  963   ILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGL  784
             +++ W+ EH   + KR  +   + K D  DFIDVMLS++DD  +    Y  E IIKAT +
Sbjct  268   LMESWIQEH---KLKRLESTENTNKMDDDDFIDVMLSLLDDSMS---GYSRETIIKATAM  321

Query  783   ----------SMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
                       ++II G+DTT++ LTW+LS ++N+  +++  +E++D KVG+ERW ED DI
Sbjct  322   DQDVLFLHEQTLIIAGADTTSITLTWILSNLLNNRRSLQLAQEELDLKVGRERWAEDSDI  381

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
              ++ Y+QA +KETLRLYPP P   PH ATED  V GY +PKGT L+ N WK+HRDP +W 
Sbjct  382   GNLVYIQAIIKETLRLYPPGPLSVPHEATEDFCVAGYHMPKGTRLFTNLWKLHRDPNLWS  441

Query  453   EPERFMPERFLT-AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
              P+ +MPERFL   A  D    +FE IPFG GRRSC G T+A+QV HLT ARL+QGFD +
Sbjct  442   NPDEYMPERFLNDHANLDVLGHHFELIPFGSGRRSCPGITFALQVLHLTFARLLQGFDMK  501

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             TP  + +DM+EG+ ITLP+AT L++ ITPRL P  Y
Sbjct  502   TPRGESVDMTEGVAITLPKATPLEIHITPRLSPELY  537



>gb|ABD39482.1| CYP82E4v12 [Nicotiana tabacum]
Length=517

 Score =   485 bits (1248),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 237/503 (47%), Positives = 339/503 (67%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K LPP++ G  P++GHL      G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             AVKDCF+TND + + RP F    YLGYN A+  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              +H+R + ++ S+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKHVRFARIQASIKNLYTRIDGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K+A      FK+FM L+ +FV  DAFP  + +WV+FQ  V K M R  K++D++ 
Sbjct  208   QVERFKKA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHV-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS + +++  G  Y  + +I+AT  S+
Sbjct  261   QNWLEEHINKREKMEVNA----EGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIEATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+  A+ + +E+ID+KV K+RWVE+ DIKD+ YLQA VKE
Sbjct  316   VLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVCKDRWVEESDIKDLVYLQAIVKE  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   EDC V GY IPKGT L+ N  K+ RDP++W +P+ F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D   + ++YIPFG GRRSC G TYA+QV HLT+A LIQGF++ TP+++PLDM EG 
Sbjct  435   ATDIDFRGQYYKYIPFGPGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++++I PRL P  Y
Sbjct  495   GITIRKVNPVELIIAPRLAPELY  517



>ref|XP_009758062.1| PREDICTED: cytochrome P450 82C4-like, partial [Nicotiana sylvestris]
Length=485

 Score =   483 bits (1244),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 233/501 (47%), Positives = 338/501 (67%), Gaps = 18/501 (4%)
 Frame = -3

Query  1665  LPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAV  1492
             LP ++ G  P++GHL    + G   PL RKL  +ADKYG VFT RLG+  +LVVSS+EA+
Sbjct  1     LPTKIPGGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAI  60

Query  1491  KDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLR  1312
             KDCF+TND + + RP F   +YLGYN  +  L    PYWRK RK  + E+LS+ +LEK +
Sbjct  61    KDCFSTNDAIFSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFK  120

Query  1311  HLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDC  1132
              +R + ++TS+K LY  I  +SS  T+++S+W  +L   LIVK++AGK ++   K D+  
Sbjct  121   QVRFTRIQTSIKNLYTRINGNSS--TINLSDWLEELNFGLIVKMIAGKNYE-SGKGDEQV  177

Query  1131  DEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQR  952
             + +K A      FK+FM L+ +FV  DAFP  + +WV+FQ  + K M R  K++D++ Q 
Sbjct  178   ERFKNA------FKDFMVLSMEFVLWDAFPIPLFKWVDFQGHI-KAMKRTFKDIDSVFQN  230

Query  951   WLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMII  772
             WL+EH++ R K    A    + + QDFIDV+LS +  ++     Y  + +IKAT  S+++
Sbjct  231   WLEEHINKREKMEVGA----EGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSLVL  285

Query  771   DGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETL  592
             D +DT A+H+ W ++L++N+ +A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE L
Sbjct  286   DAADTVALHINWGMTLLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVL  345

Query  591   RLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAA  412
             RLYPP P   PH   +DC V GY IPKGT L+ N  K+ RDP++W  P++F PERF+ A 
Sbjct  346   RLYPPGPLLVPHENVKDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFI-AG  404

Query  411   QADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
               D    ++E+IPFG GRRSC G TYA+QV HLT+A LIQGF+++TP+++ LDM EG GI
Sbjct  405   DIDFRGHHYEFIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGI  464

Query  231   TLPRATALDVVITPRLPPSFY  169
             T+ +   ++++ITPRL P  Y
Sbjct  465   TIRKVNPVELIITPRLAPELY  485



>ref|XP_006434890.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
 gb|ESR48130.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
Length=521

 Score =   484 bits (1246),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 247/519 (48%), Positives = 342/519 (66%), Gaps = 19/519 (4%)
 Frame = -3

Query  1698  KIFH-----SFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRL  1534
             K FH     S  +K    PE  GA PI+GHL LLG G   L R L AMADK+G  F +RL
Sbjct  15    KTFHDGRKSSNVRKTQKAPEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIRL  74

Query  1533  GMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFA  1354
             G     VVSSWE VK+CFT NDK +A+RP  A AK++GY+YAVF     +P+WR+MRK A
Sbjct  75    GSRSAFVVSSWEVVKECFTINDKALASRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKIA  134

Query  1353  VTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIV  1177
               ELLS+++LE L+H+R+SEV+  L++LY L   + S    V++ +W   +TLN++V++V
Sbjct  135   TLELLSNRRLEALKHVRISEVDMGLRDLYGLWAKNDSRPVLVELKKWLEDMTLNMVVRMV  194

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
             AGKR+         CD+  EA+   +   +F +L G F   DA PF+   W+++Q   + 
Sbjct  195   AGKRY---FGASATCDD-SEARQCQKAINQFFHLIGIFTVSDALPFFW--WLDWQGHEMA  248

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
              M +  KELD IL+ WL+EH   R++R S   ES     QDFIDVMLS+ ++       +
Sbjct  249   -MKKTAKELDAILEGWLEEH---RQRRVSGGIES--ESEQDFIDVMLSLQEEGHLSQFQH  302

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
               +I IK+T L++I+ GSDTT+  LTW +SL++N+P+ +K+ +E++D ++G +R V+D D
Sbjct  303   SADISIKSTCLALILGGSDTTSGTLTWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDSD  362

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIW  457
             IK++ YLQA +KETLRLYP  P   P  A EDC V GY IP GT L VN WK+ RDPR+W
Sbjct  363   IKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRVW  422

Query  456   PEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDF  280
               P  F PERFLT+    D   + FE IPFG GRRSC G ++A+QV HLT+ARL+  F+ 
Sbjct  423   KNPSAFQPERFLTSHTDVDFRGQQFELIPFGSGRRSCPGASFALQVLHLTLARLLHAFEL  482

Query  279   ETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYGL  163
              TPS++P+DM+E  G+T+P+AT L+VV++PRLPP+ YG 
Sbjct  483   ATPSDQPVDMTESPGLTIPKATPLEVVLSPRLPPNPYGF  521



>ref|XP_007227272.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
 gb|EMJ28471.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
Length=518

 Score =   484 bits (1245),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 246/501 (49%), Positives = 334/501 (67%), Gaps = 14/501 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA PI+GHL LLG G   L R L AMADKYGS F +RLG  R  VVSSWE  K+CF
Sbjct  27    PEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKYGSAFNIRLGSRRAFVVSSWEVAKECF  86

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP    AK++GYNYAVF     SP+WR+MRK A  ELLS+++LE L+H+R 
Sbjct  87    TFNDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATIELLSNRRLEMLKHVRT  146

Query  1299  SEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SE++T +KEL  L   + S++   V+++ W  +LTLN++V++VAGKR+     + DD DE
Sbjct  147   SELDTGIKELQNLWVQNGSSRPVVVELNRWLEELTLNVVVRMVAGKRYFGASAKCDDGDE  206

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
              +  Q  I    +F +L G FV  DA PF  + W++ Q    K M +  K+LD IL  WL
Sbjct  207   ARRCQKAI---GQFFHLIGIFVVSDALPF--LWWLDLQGHE-KAMKKTAKDLDAILGGWL  260

Query  945   DEHVDARRKRSSAANESGKNDH-QDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIID  769
             DEH    R+R   ++E GK +  +DFIDVMLS+ ++       +  +  IK+T L++I+ 
Sbjct  261   DEH----RQRRVLSHEKGKTEADEDFIDVMLSLQEEGQLSNFQHSSDTSIKSTCLAIILG  316

Query  768   GSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLR  589
             GSDTTA  LTW +SL++N+P  MK+ +E+++ +VG ER V++ DIK++ YLQA +KETLR
Sbjct  317   GSDTTAGTLTWAISLLLNNPHVMKKAQEELELQVGTERQVDESDIKNLVYLQAIIKETLR  376

Query  588   LYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-A  412
             LYP  P   P  A EDC V GY +P GT L VN WK+ RDP +W  P  F PERFLT+  
Sbjct  377   LYPAGPLLGPREALEDCTVAGYHVPAGTRLVVNVWKIQRDPSVWENPSAFEPERFLTSHG  436

Query  411   QADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
               D   + FE +PFG GRRSC G ++AMQV HLT+ARL+  F+FETP  + +DM+E  G+
Sbjct  437   HVDVRGQQFELMPFGSGRRSCPGVSFAMQVLHLTLARLLHAFEFETPLGQRIDMTESPGL  496

Query  231   TLPRATALDVVITPRLPPSFY  169
             T+P+AT L+V++TPRLP + Y
Sbjct  497   TIPKATPLEVLLTPRLPGNLY  517



>ref|XP_010069627.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW58035.1| hypothetical protein EUGRSUZ_H00764 [Eucalyptus grandis]
Length=539

 Score =   484 bits (1246),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 248/521 (48%), Positives = 349/521 (67%), Gaps = 16/521 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR++      K   LPPE+ GA PI+GHL LL  G  PL R LAAMADK G +F + LG+
Sbjct  21    WRARSSPKMPKGTILPPELPGAWPIIGHLHLL-RGETPLARTLAAMADKQGPMFRIWLGV  79

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +   V+SS EAV++CFTT+DK +A+RP      +LGY + VF        WR+MRK  + 
Sbjct  80    HPTTVISSREAVRECFTTHDKELASRPKSMAGVHLGYGHTVFVFAEYGDLWREMRKITML  139

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS------SAKTVDMSEWFGQLTLNLIV  1186
             ELL +++L+ L+H++ SE+++ +K+L  L  +++      S+K V +SE    LTLN++ 
Sbjct  140   ELLCTRRLDNLKHVQESEIDSFVKDLRTLCMTNTDDAQNGSSKGVVISELLELLTLNIMT  199

Query  1185  KIVAGKRFKFKVKEDDDCD-EYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQR  1009
             +++A KR+  ++        +Y EA H+ E+ K+FMYL G  V  D  PF    W +   
Sbjct  200   RMLASKRYFGQLSASTGSSTDYDEASHLRELIKDFMYLFGLPVVSDFLPF--PEWTDCTG  257

Query  1008  RVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFAR  829
               VK M R+ +ELD I+ +W++EH   + KR     E+  +  +DFIDVMLSMI +D   
Sbjct  258   -TVKTMKRVARELDEIVGKWVEEH---KLKRCDHRGEA-IDVREDFIDVMLSMIGEDSFA  312

Query  828   GLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWV  649
                +PPE +IKAT ++ I+ GSDTT + LTW+LSL++NH   +KR +E++D  VGK++W+
Sbjct  313   KFGHPPERLIKATVVNNIVAGSDTTYLTLTWVLSLLLNHKHILKRAQEEMDLMVGKDKWI  372

Query  648   EDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRD  469
             +D DI+++ YLQA VKETLRLYP  P  APH A  DC V GY IPKGT + VN WK+HRD
Sbjct  373   QDSDIENLPYLQAIVKETLRLYPTAPLVAPHEARADCTVSGYRIPKGTRIIVNVWKLHRD  432

Query  468   PRIWPEPERFMPERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQ  292
             P++W  PE+F+PERFLT     DA  ++FE+IPFG GRRSC G   A++V+HLT+ARL+Q
Sbjct  433   PQVWSNPEKFLPERFLTNHSGMDALGQHFEFIPFGSGRRSCPGAMLALRVTHLTLARLLQ  492

Query  291   GFDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             GFD  TPS KP+DM+EGLG+TLP+A+ L V++TPRLPP+ Y
Sbjct  493   GFDLATPSNKPVDMTEGLGVTLPKASPLRVILTPRLPPTLY  533



>ref|XP_004241385.1| PREDICTED: cytochrome P450 82C2-like [Solanum lycopersicum]
Length=543

 Score =   483 bits (1242),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 249/530 (47%), Positives = 348/530 (66%), Gaps = 31/530 (6%)
 Frame = -3

Query  1704  RSKIFHSFTKKKTLPPEVDGARPILGHL------------RLLGSGGIPLGRKLAAMADK  1561
             ++K + +  K    PP++ GA PI+GHL            R+   G IPL   L A+ADK
Sbjct  27    KAKTWKNSKKFGPAPPQLPGAWPIIGHLPQILSNTLDGRNRINKDGEIPLAHTLGALADK  86

Query  1560  YGSVFTLRLGMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSP  1381
             YG VFT+R GM+ I VVSS+EA+K+CFTT DK +A R      KYLGY++A  +     P
Sbjct  87    YGPVFTVRQGMFPIAVVSSYEAIKECFTTQDKNLANRVATCSCKYLGYDHANLTFANYGP  146

Query  1380  YWRKMRKFAVTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKT---VDMSEWFG  1210
             YWR +RK  V  LLSS+ LE+L+H+R+SEVE+S+KELY L  ++ +      VD+  WF 
Sbjct  147   YWRMVRKLVVNNLLSSKSLERLKHVRISEVESSIKELYTLFVANEAKNVPTKVDIGHWFD  206

Query  1209  QLTLNLIVKIVAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIV  1030
              + LN+ VK++ GKR+    + ++  +E +EA+   + F E MY        DAFPF ++
Sbjct  207   DMMLNITVKMIGGKRYS---QVNNKEEEKEEAERFRKAFNETMYYIAIVGIEDAFPFPLL  263

Query  1029  RWVEFQRRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSM  850
             +W++ Q   +K M RI  E+D ILQRWLD+H + R+      NES  ND QD ID+ML+ 
Sbjct  264   QWLDLQGN-IKVMKRIADEMDVILQRWLDDHTNKRKN-----NES--NDDQDLIDIMLTE  315

Query  849   ID-DDFARGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDS  673
             +D DDF  G  Y  E IIKAT L+++ D + TTAVHL W+++ ++N+   ++++ E+ID+
Sbjct  316   LDKDDFQYG--YSRETIIKATMLTIVSDATHTTAVHLIWIIACLLNNKHVLEKVHEEIDT  373

Query  672   KVGKERWVEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYV  493
             KVGK+RWVED DIK++ Y QA +KE LRLYPP P    H A  DC+V GY I KGT L+V
Sbjct  374   KVGKDRWVEDSDIKNLMYFQATIKEVLRLYPPSPMLV-HEALADCQVLGYHISKGTRLFV  432

Query  492   NAWKVHRDPRIWPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSH  316
             N WK+ +D + WPEPE+F+PERFLT  A+ D   ++ E+IPFG GRRSC G T AMQV++
Sbjct  433   NVWKLQKDSKFWPEPEKFLPERFLTTKAKVDVYGKDLEFIPFGSGRRSCPGITMAMQVTY  492

Query  315   LTVARLIQGFDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYG  166
             L++ARL+Q FDF+ P+  PLDM+EG G T  +   L+VV+ PR+ P +YG
Sbjct  493   LSIARLLQAFDFDLPNNDPLDMTEGPGFTAVKKVPLEVVVKPRMLPMYYG  542



>gb|KDO84376.1| hypothetical protein CISIN_1g036812mg [Citrus sinensis]
Length=499

 Score =   481 bits (1237),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 241/501 (48%), Positives = 337/501 (67%), Gaps = 14/501 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA PI+GHL LLG G   L R L AMADK+G  F +RLG     VVSSWE VK+CF
Sbjct  11    PEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECF  70

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP  A AK++GY+YAVF     +P+WR+MRK A  ELLS+++LE L+H+R+
Sbjct  71    TINDKALASRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKIATLELLSNRRLEALKHVRI  130

Query  1299  SEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
             SEV+  L++L+ L   ++S    V++ +W   +TLN++V++VAGKR+         CD+ 
Sbjct  131   SEVDMGLRDLHGLWAKNNSRPVLVELKKWLEDMTLNMVVRMVAGKRY---FGASATCDD-  186

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
              EA+   +   +F +L G F   DA PF+   W+++Q   +  M +  KELD IL+ WL+
Sbjct  187   SEARQCQKAINQFFHLIGIFTVSDALPFFW--WLDWQGHEMA-MKKTAKELDAILEGWLE  243

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGS  763
             EH   R++R S   ES     QDFIDVMLS+ ++       +  +I IK+T L++I+ GS
Sbjct  244   EH---RQRRVSGGIES--ESEQDFIDVMLSLQEEGHLSQFQHSADISIKSTCLALILGGS  298

Query  762   DTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLY  583
             DTT+  LTW +SL++N+P+ +K+ +E++D ++G +R V+D DIK++ YLQA +KETLRLY
Sbjct  299   DTTSGTLTWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLY  358

Query  582   PPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQA  406
             P  P   P  A EDC V GY IP GT L VN WK+ RDPR+W  P  F PERFLT+    
Sbjct  359   PAGPLLGPREAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHTDV  418

Query  405   DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITL  226
             D   + FE IPFG GRRSC G ++A+QV HLT+ARL+  F+  TPS++P+DM+E  G+T+
Sbjct  419   DFRGQQFELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTI  478

Query  225   PRATALDVVITPRLPPSFYGL  163
             P+AT L+VV++PRLPP+ YG 
Sbjct  479   PKATPLEVVLSPRLPPNPYGF  499



>ref|XP_010106089.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXC07359.1| Cytochrome P450 82C4 [Morus notabilis]
Length=528

 Score =   481 bits (1239),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 246/522 (47%), Positives = 341/522 (65%), Gaps = 25/522 (5%)
 Frame = -3

Query  1695  IFHSFTKKKTLP---------PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFT  1543
             ++++  +KK+ P         PE +GA PI+GHL LLG G   L R L AMAD YG  F 
Sbjct  21    LYYALLRKKSKPTRITPGVQAPEPEGAWPIIGHLHLLGGGDQLLYRTLGAMADNYGPAFN  80

Query  1542  LRLGMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMR  1363
             +RLG  R  VV+SW+  KDCFT NDK +A+RP    AK++GYNYAVF     SP+WR+MR
Sbjct  81    IRLGSRRAFVVNSWDVAKDCFTANDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMR  140

Query  1362  KFAVTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVK  1183
             K A  ELLS+++LE L+H+R+SE++T +++LY  + + +    V++S W  +LTLN++V+
Sbjct  141   KIATLELLSNRRLEMLKHVRISEIDTGIQDLYDRVQNGAHPVVVELSRWLDELTLNMVVR  200

Query  1182  IVAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRV  1003
             +VAGKR+   + E   C+   EAQ   +   EF +L G FV  DA PF  + W++     
Sbjct  201   MVAGKRYFGALAE---CNG-DEAQRCQKAICEFFHLIGIFVVSDALPF--LWWLDLHGH-  253

Query  1002  VKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGL  823
              + M R  KELD IL  WL+EH   RR+R+S   +S     QDFIDVMLS+ +       
Sbjct  254   ERAMKRTAKELDAILGGWLEEH---RRRRASKMADS----DQDFIDVMLSLQEGGELSNF  306

Query  822   AYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVED  643
              Y  +I IK+T L++I+ GSDTTA  LTW +SL++N+  A+K+ ++++D +VG  R V+D
Sbjct  307   QYDADISIKSTCLALILGGSDTTAGTLTWAISLLLNNSHALKKAQQELDIEVGTNRLVDD  366

Query  642   GDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPR  463
              DIK++ YLQA +KETLRLYP  P   P  A EDC V GY +P GT L VN WK+ RDP 
Sbjct  367   SDIKNLVYLQAIIKETLRLYPAGPLLGPREALEDCTVSGYHVPAGTRLVVNVWKIQRDPT  426

Query  462   IWPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGF  286
             +W  PE F PERFLT  A  D   + FE IPFG GRRSC G ++A+QV HLT+ARL+Q F
Sbjct  427   VWSNPEAFEPERFLTTHAHVDVRGQQFELIPFGSGRRSCPGASFALQVLHLTLARLLQAF  486

Query  285   DFETPSE-KPLDMSEGLGITLPRATALDVVITPRLPPSFYGL  163
             +F  P + +P+DM+E  G+T+P+A  L+V+++PRLP   YG+
Sbjct  487   EFSNPLDGRPVDMTENPGLTIPKAHPLEVLLSPRLPRELYGV  528



>ref|XP_003635525.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=518

 Score =   480 bits (1235),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 248/516 (48%), Positives = 342/516 (66%), Gaps = 23/516 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR + F    K ++  PE  GA P +GHL LL SG  P+ R LAAMADK+G VF +RLGM
Sbjct  23    WRVRSFAHGGKGRS-APEPSGAWPFVGHLHLL-SGPTPIFRTLAAMADKHGPVFMIRLGM  80

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +R LVVSS EAVK+C TTNDK  A+RP  +  K LGYNYA F      P WR+MRK +VT
Sbjct  81    HRALVVSSHEAVKECLTTNDKAFASRPSSSAGKLLGYNYAGFGFAPYGPLWREMRKLSVT  140

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS--SAKTVDMSEWFGQLTLNLIVKIVA  1174
             ELLS++ L +L+H+ VSE++  +++LY L   ++  +   V MSEW  QLT N+++++VA
Sbjct  141   ELLSNRPLNELKHVLVSELDVCIRDLYSLGKETNWVNPIKVAMSEWLEQLTFNVVLRMVA  200

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+       +     +EA+H I V K+F++L G FV  DA PF  V W++ Q  +   
Sbjct  201   GKRYF-----GNGVHGNEEARHAIAVIKKFIFLTGVFVASDAIPF--VEWMDLQGHL-GS  252

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M R+ ++LD  ++ W++EHV   +        S  +  QDFIDVMLS++ D+   G  + 
Sbjct  253   MKRVAEQLDPFVEGWVEEHVTKLK--------SDPSSRQDFIDVMLSVLKDNSMFG--HR  302

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              E +IKAT +++I+ GS+TT++   W+LS ++N+   +KR +E++D KVG+ RWVE+ DI
Sbjct  303   RETVIKATVMTLIVGGSETTSIASIWILSALLNNRHTLKRAQEELDLKVGRGRWVEESDI  362

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             +++ YLQAAVKETLRLYPP P   PH A +DC V GY IPKGT L VN WK+HRDP  W 
Sbjct  363   QNLIYLQAAVKETLRLYPPGPLLVPHEAIQDCSVCGYHIPKGTRLLVNVWKLHRDPDAWS  422

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             +PE F PERFLT  A  +   ++ E IPF  GRRSC G   A+Q+ HLTVARL+QG+D  
Sbjct  423   DPEEFQPERFLTTHANLNVFGQHSELIPFSSGRRSCPGIALALQILHLTVARLLQGYDMT  482

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             TP   P+DM+EG+G+ +P+ T L+V++TPRLP   Y
Sbjct  483   TPLNAPVDMTEGIGLAMPKETPLEVMLTPRLPSLLY  518



>gb|ABR57311.1| cytochrome P450 monooxygenase [Nicotiana sylvestris]
Length=517

 Score =   478 bits (1231),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 230/495 (46%), Positives = 334/495 (67%), Gaps = 18/495 (4%)
 Frame = -3

Query  1647  GARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCFTT  1474
             G  P++GHL    + G   PL RKL  +ADKYG VFT RLG+  +LVVSS+EA+KDCF+T
Sbjct  39    GGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFST  98

Query  1473  NDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRVSE  1294
             ND + + RP F   +YLGYN  +  L    PYWRK RK  + E+LS+ +LEK + +R + 
Sbjct  99    NDAIFSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTR  158

Query  1293  VETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEYKEA  1114
             ++TS+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+  + +K A
Sbjct  159   IQTSIKNLYTRINGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDEQVERFKNA  215

Query  1113  QHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLDEHV  934
                   FK+FM L+ +FV  DAFP  + +WV+FQ  + K M R  K++D++ Q WL+EH+
Sbjct  216   ------FKDFMVLSMEFVLWDAFPIPLFKWVDFQGHI-KAMKRTFKDIDSVFQNWLEEHI  268

Query  933   DARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGSDTT  754
             + R K    A    + + QDFIDV+LS +  ++     Y  + +IKAT  S+++D +DT 
Sbjct  269   NKREKMEVGA----EGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSLVLDAADTV  323

Query  753   AVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLYPPL  574
             A+H+ W ++L++N+ +A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VKE LRLYPP 
Sbjct  324   ALHINWGMTLLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPG  383

Query  573   PTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQADAPW  394
             P   PH   +DC V GY IPKGT L+ N  K+ RDP++W  P++F PERF+ A   D   
Sbjct  384   PLLVPHENVKDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFI-AGDIDFRG  442

Query  393   RNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITLPRAT  214
              ++E+IPFG GRRSC G TYA+QV HLT+A LIQGF+++TP+++ LDM EG GIT+ +  
Sbjct  443   HHYEFIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVN  502

Query  213   ALDVVITPRLPPSFY  169
              ++++ITPRL P  Y
Sbjct  503   PVELIITPRLAPELY  517



>ref|XP_004236938.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=530

 Score =   478 bits (1231),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 231/508 (45%), Positives = 341/508 (67%), Gaps = 21/508 (4%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSG-GIPLGRKLAAMADKYGSVFTLRLGMYRILVVSS  1504
             + K  LPPE+ G  P++GHL     G   PL RKL+ +ADKYG VFT RLG++R+LV+SS
Sbjct  36    SSKLPLPPEIAGGWPVIGHLFYFNDGDNRPLARKLSDLADKYGPVFTFRLGLHRMLVISS  95

Query  1503  WEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKL  1324
             ++AVK+C+T ND V A RP     +Y+GYN A+  L     YWR +RK  + E+LS+ +L
Sbjct  96    YDAVKECYTKNDAVFANRPACLYGEYIGYNNAILFLANYGSYWRNIRKLIIQEVLSNSRL  155

Query  1323  EKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKE  1144
             EKL+H+++ ++   +K L   I +S     +++++W  ++   LIVK++AGK ++     
Sbjct  156   EKLKHVKIEKIRNEIKNLNSRIQNSEVKSVINLTDWLEKMNFGLIVKMIAGKNYESGGDG  215

Query  1143  DDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDT  964
             D++ + ++E       FK+F+ L+ +FV  DAFP  + +W++FQ  V K M    K++D+
Sbjct  216   DEEVERFRET------FKKFLVLSMEFVLWDAFPIRLFKWIDFQGHV-KLMKETFKDIDS  268

Query  963   ILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLS-MIDDDFARGLAYPPEIIIKATG  787
             I QRWLDEHV    KR++  NE  K + +DFIDVMLS M D+   +G  +  +  IKAT 
Sbjct  269   ISQRWLDEHV----KRNTEVNEDEKYE-RDFIDVMLSKMSDERLHQG--HSRDNAIKATI  321

Query  786   LSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAA  607
              SM++D +DT   H+ W ++L++N+   +K+ +E+ID+KVGK RW++D DIK++ YLQA 
Sbjct  322   FSMVMDAADTVPHHINWGMTLLINNQHVLKKAQEEIDTKVGKARWIDDNDIKNLVYLQAI  381

Query  606   VKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPER  427
             VKETLRLYPP P   PH  TE+C V GY IPKGT LY N  K+  DP++WP PE+F P+R
Sbjct  382   VKETLRLYPPSPLLVPHENTEECVVSGYRIPKGTRLYANVMKLQLDPKVWPNPEQFNPDR  441

Query  426   FLTAAQADAPWR--NFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLD  253
             FL+    D  +R  ++E+IPFG GRRSC G +YA+Q+ HLT+  LIQGF+++TPS +PLD
Sbjct  442   FLS---TDINFRGQDYEFIPFGSGRRSCPGISYALQMEHLTIGHLIQGFNYQTPSNEPLD  498

Query  252   MSEGLGITLPRATALDVVITPRLPPSFY  169
             + EG+G+T+P+   ++V+ITPRL    Y
Sbjct  499   LQEGIGMTMPKVNPVEVIITPRLATELY  526



>ref|XP_010069621.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Eucalyptus 
grandis]
Length=542

 Score =   479 bits (1232),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 240/522 (46%), Positives = 348/522 (67%), Gaps = 15/522 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR++   +  K   LPPE+ GA PI+GHL LLG G  PL R LAAMADK G +F +RLG+
Sbjct  21    WRARSSPNKPKGTALPPELPGAWPIIGHLHLLG-GETPLARTLAAMADKQGPMFRIRLGV  79

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +   ++SS EAV+ CFTT+DK +A+RP   V  + GY YA F        WR+MRK  + 
Sbjct  80    HPATIISSQEAVRKCFTTHDKDLASRPKSKVGIHFGYGYAGFGFAEYGDLWREMRKITML  139

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS------SAKTVDMSEWFGQLTLNLIV  1186
             ELLS+++L+ L+H++ SE++T +K+L+ L  +++      S+K V +S+    LTLN+I+
Sbjct  140   ELLSTRRLDNLKHVQASEIDTFVKDLHALCRTNAIDAQNGSSKVVVISQLLELLTLNIII  199

Query  1185  KIVAGKRF--KFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQ  1012
             +++A KR+            D+ +EA H+ +V KEFMY++G     +  PF    W +  
Sbjct  200   RMIASKRYFGLLSASTGSSTDDDEEASHLRKVIKEFMYISGFPTVSELVPF--TGWTDCV  257

Query  1011  RRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFA  832
                VK M R+ +E+D I+ +W++EH    ++      E   +  +DFIDVMLS+I +D  
Sbjct  258   G-TVKTMKRVAREMDEIVGKWVEEH--KLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGL  314

Query  831   RGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERW  652
                 + PE +IKAT +++I+ GSDTT+++LTW+LSL++NH   +KR +E+ID KVGK++W
Sbjct  315   AQFGHSPETLIKATVVNIIVAGSDTTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDKW  374

Query  651   VEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHR  472
             V+D DI  + YLQA VKETLRLYPP P   PH A  DC V GY IPKGT ++VN WK+HR
Sbjct  375   VQDSDIGSLHYLQAIVKETLRLYPPGPLSIPHEARADCNVRGYLIPKGTRIFVNVWKLHR  434

Query  471   DPRIWPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLI  295
             DP++W +PE+F+PERFLT  +  DA  ++FE+IPFG GRR C G  +A++ +HLT+ARL+
Sbjct  435   DPQVWSDPEKFLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLL  494

Query  294   QGFDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             QGFD    S++ +DM+EG+G+ LP+AT L VV+ PRLP   Y
Sbjct  495   QGFDLAISSDELVDMTEGIGLNLPKATPLRVVLNPRLPSMLY  536



>gb|KCW58034.1| hypothetical protein EUGRSUZ_H00762, partial [Eucalyptus grandis]
Length=529

 Score =   478 bits (1231),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 241/515 (47%), Positives = 348/515 (68%), Gaps = 15/515 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR++   +  K   LPPE+ GA PI+GH+ LLG G  PL R LAAMADK G +F +RLG+
Sbjct  21    WRARSSPNKPKGTALPPELPGAWPIIGHIHLLG-GETPLARTLAAMADKQGPMFRIRLGV  79

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +   ++SS EAV++CFTT+DK +A+RP      +LGY YA F       +WR+MRK  + 
Sbjct  80    HPATIISSREAVRECFTTHDKDLASRPKSKAGIHLGYGYAGFGFVEYGDFWREMRKITML  139

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS------SAKTVDMSEWFGQLTLNLIV  1186
             ELLS+++L+ L+H++ SE++T +K+L+ L  ++S      S+K V +S+    LTLN+I+
Sbjct  140   ELLSTRRLDNLKHVQASEIDTFVKDLHALCRTNSIDAQNGSSKVVVISQLLELLTLNIII  199

Query  1185  KIVAGKRF--KFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQ  1012
             +++A KR+            D+ +EA H+  V KEFMY++G     D  PF    W +  
Sbjct  200   RMIASKRYFGLSSASTGSSADDDEEASHLRRVIKEFMYISGFPAVSDLVPF--TGWTDCV  257

Query  1011  RRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFA  832
                VK M R+ +ELD I+ +W++EH    ++      E   +  +DFIDVMLS+I +D  
Sbjct  258   G-TVKTMKRVARELDEIVGKWVEEH--KLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGL  314

Query  831   RGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERW  652
                 + PE +IKAT +++I+ GSD+T+++LTW+LSL++NH   +KR +E+ID KVGK+RW
Sbjct  315   AQFGHSPETLIKATIVNIIVAGSDSTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDRW  374

Query  651   VEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHR  472
             V+D DI+++ YLQA VKETLRLYPP P   PH A  DC V GY IPKGT ++VNAWK+HR
Sbjct  375   VQDSDIENLLYLQAIVKETLRLYPPGPLLVPHEARADCNVRGYLIPKGTRIFVNAWKLHR  434

Query  471   DPRIWPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLI  295
             DP++W EPE+F+PERFLT  +  DA  ++FE+IPFG GRR C G  +A++ +HLT+ARL+
Sbjct  435   DPQVWSEPEKFLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLL  494

Query  294   QGFDFETPSEKPLDMSEGLGITLPRATALDVVITP  190
             QGFD  T  ++ +DM+EGLG+ LP+AT L VV+ P
Sbjct  495   QGFDLATSLDELVDMTEGLGVNLPKATPLRVVLNP  529



>ref|XP_008378409.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=529

 Score =   478 bits (1229),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 246/518 (47%), Positives = 330/518 (64%), Gaps = 17/518 (3%)
 Frame = -3

Query  1695  IFHSFTKKKTL------PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRL  1534
             +  SF KKK         PE  G  PI+GHL LLG G   L R L AMADKYG  F +RL
Sbjct  19    LIRSFLKKKVQDSKSREAPEPAGGWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRL  78

Query  1533  GMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFA  1354
             G  R  VVSSWE  KDCFT ND+ +A+RP    AK++GYNYAVF     SP+WR+MRK A
Sbjct  79    GSRRAFVVSSWEVAKDCFTVNDRALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIA  138

Query  1353  VTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKI  1180
               ELLS+++L+ LRH+R SE++  +KELY L   +   +   V+++ W  +LTLN++V++
Sbjct  139   TLELLSNRRLDMLRHVRTSELDMGIKELYSLWVQNGGLRPAVVELNHWLEELTLNVVVRM  198

Query  1179  VAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVV  1000
             VAGKR+     + +D DE +  Q  I    +F +L G FV  DA PF  + W++ Q    
Sbjct  199   VAGKRYFGASAKCEDGDEARRCQKAI---GQFFHLIGIFVVADALPF--LWWLDLQGHE-  252

Query  999   KDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA  820
             K M +  KELD IL  WL+EH   R      A + G +  +DFIDVMLS+ ++       
Sbjct  253   KAMKKTAKELDGILGGWLEEHRQRRGASHGEAEDEGGD--EDFIDVMLSLEEEGQLSNFQ  310

Query  819   YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDG  640
             Y  +  IK+T L++I+ GSDTTA  LTW +SL++N+PDAMK  +E++D  VG ER VE+ 
Sbjct  311   YSSDTSIKSTCLALILGGSDTTAGTLTWAISLLLNNPDAMKMAQEELDLHVGTERQVEES  370

Query  639   DIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRI  460
             DI ++ YLQA +KETLRLYP  P   P  A EDC V GY +P GT L VN WK+ RDPR+
Sbjct  371   DITNLVYLQAIIKETLRLYPAGPLLGPREALEDCTVAGYRVPAGTRLVVNVWKIQRDPRV  430

Query  459   WPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             W  P  F+PERFL + +  D   + F  +PFG GRRSC G ++AMQV HLT+ARL+ GF 
Sbjct  431   WENPSAFVPERFLESHSHVDVRGQQFNLMPFGFGRRSCPGVSFAMQVLHLTLARLLHGFK  490

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              ET S + +D++E  G+T+P+AT L+V+++PRLP   Y
Sbjct  491   IETASGQSVDLTESPGLTIPKATPLEVLLSPRLPSELY  528



>ref|XP_002264464.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   477 bits (1228),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 244/516 (47%), Positives = 333/516 (65%), Gaps = 23/516 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR K   +   K   PPE  GA P +GHL LL  G +P+ R L AMADK G VF +RLGM
Sbjct  24    WRGKTL-THKSKGMSPPEPSGAWPFVGHLHLL-HGKVPVFRTLGAMADKVGPVFVIRLGM  81

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             YR LVVS+ EA K+CFTTNDK+ A+RP+ + AK LGYNYA F+     PYWR+MRK ++ 
Sbjct  82    YRTLVVSNREAAKECFTTNDKIFASRPNSSAAKILGYNYAAFAFAPHGPYWREMRKLSML  141

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS--SAKTVDMSEWFGQLTLNLIVKIVA  1174
             E+LS+++L  L H++VSE+   +K+LY+L   ++  + K V +SEWF  LT N+++++VA
Sbjct  142   EILSTRRLGDLMHVQVSELHAGIKDLYILGKDNNWVNPKKVVISEWFEHLTFNVVLRMVA  201

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+   V    +     EA+  I   K+ + L G  V  D  PF  + WV+ Q  +   
Sbjct  202   GKRYFNNVVHGGE-----EARSAIAAIKKVLLLVGASVASDVIPF--LEWVDLQGHL-SS  253

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M  + KE+D++++ W+ EH       +S++         DFID+ML+ + D  A    Y 
Sbjct  254   MKLVAKEMDSLIESWVKEHTGRLNSEASSS--------LDFIDIMLTKLKD--ASLFGYS  303

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              E IIKAT L+MI+ GSDTT++  TWLLS ++N+   MK  +E++D KVG++RWVE  DI
Sbjct  304   RETIIKATVLTMIVAGSDTTSLTSTWLLSALLNNKHVMKHAQEELDLKVGRDRWVEQSDI  363

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             +++ Y++A VKETLRLY   P   PH A EDC VGGY I KGT L VNAWK+HRDP +W 
Sbjct  364   QNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCHVGGYHISKGTRLLVNAWKLHRDPAVWS  423

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
              PE F PERFLT+ A  D   ++FE IPFG GRRSC G    +Q+ HLT+ARL+QGFD  
Sbjct  424   NPEEFQPERFLTSHANVDVFGQHFELIPFGSGRRSCPGLNMGLQMLHLTIARLLQGFDMT  483

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              PS  P+DM+EG+ + L + T L+V++TPRLP   Y
Sbjct  484   KPSNSPVDMTEGISVALSKLTPLEVMLTPRLPAELY  519



>emb|CAN77159.1| hypothetical protein VITISV_019026 [Vitis vinifera]
Length=604

 Score =   480 bits (1235),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 250/516 (48%), Positives = 341/516 (66%), Gaps = 23/516 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR K F    K ++  PE  GA P +GHL LL S  +P+ R L AMAD +G VF +RLGM
Sbjct  109   WRVKSFAHRGKGRS-APEPSGAWPFIGHLHLLNSP-MPIFRTLTAMADXHGPVFMIRLGM  166

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
              R LVVSS +AVK+C TTNDK  A+RP  +  K LGYNYA F      P WR+MRK +VT
Sbjct  167   XRALVVSSHKAVKECLTTNDKAFASRPISSAGKLLGYNYAGFGFAPYGPLWREMRKLSVT  226

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS--SAKTVDMSEWFGQLTLNLIVKIVA  1174
             ELLS+++L++L+H+ VSE++  +++LY L   ++  +   V MSEW  Q T N+++++VA
Sbjct  227   ELLSNRRLDELKHVLVSELDVCIRDLYSLGKETNWVNPIKVAMSEWLEQXTFNVVLRMVA  286

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+       +     +EA+H I V K+F+ L G FV  D  PF  V W++ Q  +   
Sbjct  287   GKRYF-----GNGVHGNEEARHAIAVIKKFLSLTGAFVASDVIPF--VEWMDLQGHL-GS  338

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M R+  +LD  ++ W++EHV            S  +  QDFIDVMLS++ D+   G  + 
Sbjct  339   MKRVAGQLDPFVEGWVEEHVTKL--------NSDPSSRQDFIDVMLSVLKDNSIFG--HT  388

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              E +IKAT +++I+ GS+TT++  TW+LS ++N+  A+KR +E+ID KVG+ RWVE+ DI
Sbjct  389   RETVIKATVMTLIVGGSETTSIVSTWILSALLNNRHALKRAQEEIDLKVGRGRWVEESDI  448

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             +++ YLQA VKETLRLYPP P   PH A EDC V  Y IPKGT L+VN WK+HRDP +W 
Sbjct  449   ZNLIYLQAVVKETLRLYPPAPLSIPHEAVEDCNVCEYHIPKGTRLFVNVWKLHRDPGVWS  508

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             +PE F PERFLT  A  +   ++FE IPF  GRRSC G   A+Q+ HLTVARL+QG+D  
Sbjct  509   DPEEFQPERFLTTNANLNVFGQHFELIPFSSGRRSCPGIALALQILHLTVARLLQGYDMT  568

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             TP   P+DM+EG+GIT+PRAT L+V++TPRLP   Y
Sbjct  569   TPLNAPVDMTEGIGITMPRATPLEVMLTPRLPSLLY  604



>ref|XP_003523888.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
 gb|KHN04535.1| Cytochrome P450 82C4 [Glycine soja]
Length=526

 Score =   475 bits (1222),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 239/516 (46%), Positives = 327/516 (63%), Gaps = 13/516 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTL-PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLG  1531
             W +K     +K K+   P   GA P++GHL LLG     L R L  MAD+YG  F + LG
Sbjct  21    WHTKRNRGGSKNKSKEAPIPAGAWPLIGHLHLLGGDDQLLYRTLGTMADQYGPAFNIWLG  80

Query  1530  MYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAV  1351
               R  VVSSWE  K+CFT+NDK +A+RP    AK++GYNYAVF     SP+WR+MRK A 
Sbjct  81    TRRAFVVSSWEVAKECFTSNDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIAT  140

Query  1350  TELLSSQKLEKLRHLRVSEVETSLKELY-MLITSSSSAKTVDMSEWFGQLTLNLIVKIVA  1174
              ELLS+++LE L+H+ VSE+   +++LY   + + S    V+++ W   LTLN++V++VA
Sbjct  141   LELLSNRRLEMLKHVMVSELNMVMRDLYNSWVQNRSRPVLVELNRWLEDLTLNMVVRMVA  200

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+         CD   EA+   +   +F +L G FV  DA PF  +RW + Q    + 
Sbjct  201   GKRY---FGASASCDNDDEARRCQKAINQFFHLIGIFVVSDALPF--LRWFDVQGHE-RA  254

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M +  KELD IL+ WL EH + R        E      QDFID+MLS+          Y 
Sbjct  255   MKKTAKELDAILEGWLKEHREQR-----VDGEIKAEGEQDFIDIMLSLQKGGHLSNFQYD  309

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              +  IK+T L++I+ GSDTTA  +TW +SL++N+  A+K+ +E++D  VG ER VE+ DI
Sbjct  310   SDTSIKSTCLALILGGSDTTAGTVTWAISLLLNNRQALKKAQEELDLNVGMERQVEESDI  369

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             +++ Y+QA +KETLRLYP  P   P  A EDC V GY +P GT L VN WK+HRDPR+W 
Sbjct  370   RNLAYVQAIIKETLRLYPAGPLLGPREAQEDCNVAGYHVPAGTRLVVNLWKIHRDPRVWQ  429

Query  453   EPERFMPERFLTAAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFET  274
             EP  F PERFLT+   D   +NFE IPFG GRRSC G ++A+QV HLT+ARL+  F+F T
Sbjct  430   EPSAFRPERFLTSDAVDVRGQNFELIPFGSGRRSCPGMSFALQVLHLTLARLLHAFEFAT  489

Query  273   PSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYG  166
             PS++P+DM+E  G+T+P+AT L+V++TPRLP   Y 
Sbjct  490   PSDQPVDMTESPGLTIPKATPLEVLLTPRLPAKLYA  525



>gb|ABD39485.1| CYP82E2v4 [Nicotiana tabacum]
Length=517

 Score =   474 bits (1221),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 231/503 (46%), Positives = 337/503 (67%), Gaps = 18/503 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K L P++ G  P++GHL    + G   PL RKL  +ADKYG VFT RLG+  +LVVSS+E
Sbjct  31    KPLLPKIPGGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYE  90

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             A+KDCF+TND + + RP F   +YLGYN  +  L    PYWRK RK  + E+LS+ +LEK
Sbjct  91    AIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEK  150

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
              + +R + ++TS+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+
Sbjct  151   FKQVRFTRIQTSIKNLYTRINGNSS--TINLTDWLEELDFGLIVKMIAGKNYE-SGKGDE  207

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
               + +K A      FK+FM L+ +FV  DAFP  + +WV+FQ  + K M R  K++D++ 
Sbjct  208   QVERFKNA------FKDFMVLSMEFVLWDAFPIPLFKWVDFQGHI-KAMKRTFKDIDSVF  260

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             Q WL+EH++ R K    A    + + QDFIDV+LS +  ++     Y  + +IKAT  S+
Sbjct  261   QNWLEEHINKREKMEVGA----EGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSL  315

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             ++D +DT A+H+ W ++L++N+ +A+ + +E+ID+KVGK RWVE+ DIKD+ YLQA VK+
Sbjct  316   VLDAADTVALHINWGMTLLINNQNALMKAQEEIDTKVGKYRWVEESDIKDLVYLQAIVKK  375

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
              LRLYPP P   PH   +DC V GY IPKGT L+ N  K+ RDP++   P++F PERF+ 
Sbjct  376   VLRLYPPGPLLVPHEYVKDCVVSGYHIPKGTRLFANVMKLQRDPKLLSNPDKFDPERFI-  434

Query  417   AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             A   D    ++E+IPFG GRRSC G TYA+QV HLT+A LIQGF+++TP+++ LDM EG 
Sbjct  435   AGDIDFRGHHYEFIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGA  494

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT+ +   ++++ITPRL P  Y
Sbjct  495   GITIRKVNPVELIITPRLAPELY  517



>ref|XP_008235430.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=517

 Score =   474 bits (1220),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 250/518 (48%), Positives = 350/518 (68%), Gaps = 29/518 (6%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR +I  S   K  L P+  GA PI+GHL  L     P+ + LAAMADKYG +FT+ LG 
Sbjct  21    WRLRI-QSHKIKGMLAPQPSGALPIIGHLHKLRG---PIFKTLAAMADKYGPIFTIWLGK  76

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             + +LV+S+++AVK CFT ND V A RP     KYLGYNYA F       YWR MRK  + 
Sbjct  77    HPVLVISNYDAVKQCFTKNDTVFATRPRSTTGKYLGYNYAGFGFSPYGTYWRDMRKMVMV  136

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS----SAKTVDMSEWFGQLTLNLIVKI  1180
             ELLSS++LE L+H+++SEV+  +K L++L  +      +   V +S+W  +LTLN+I ++
Sbjct  137   ELLSSRRLETLKHVQISEVDAFIKGLFLLCKTEGHNGLNPTKVVISDWIERLTLNVITRM  196

Query  1179  VAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVV  1000
             +AGKR+       D+ DE    Q   ++ KEFMY++G+ V  D   F    W++F+ ++ 
Sbjct  197   IAGKRY---FDSSDEGDE----QRFGKILKEFMYVSGKPVASDVIGF--PSWIDFKGQI-  246

Query  999   KDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA  820
             K M RIMKELD+ +   ++EH         A  E+   D  DFIDVM+S+I+D+    L 
Sbjct  247   KAMKRIMKELDSFMGNLVEEHY--------AKKETNSRDEHDFIDVMISVIEDN--STLG  296

Query  819   YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDG  640
             Y  E IIKAT L++I+ GS+TTA+ L W+LSL++N+   +K  +E++D KVG++RW+ED 
Sbjct  297   YTRETIIKATSLNLILAGSETTAISLIWILSLLLNNRHVLKLAQEELDLKVGRDRWIEDT  356

Query  639   DIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRI  460
             DI+++ YLQA VKETLRLYPP P   PH A +DC+V G+ I KGT L+VN WK+HRDP +
Sbjct  357   DIENLPYLQAIVKETLRLYPPAPLSVPHEAMQDCQVCGFHIQKGTLLFVNLWKLHRDPSL  416

Query  459   WPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             WP+PE F PERFLT     DA  ++FE+IPFG GRRSC G T+A+QV+HLT+ RL+QGF+
Sbjct  417   WPDPEVFCPERFLTTHVGIDASGQHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGFE  476

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
               TP + P+D++EGLGIT+P++T+L+V++TPRLP  FY
Sbjct  477   LATPMDMPVDLTEGLGITMPKSTSLEVILTPRLPFEFY  514



>ref|XP_002323130.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
 gb|EEF04891.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
Length=499

 Score =   473 bits (1218),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 248/512 (48%), Positives = 333/512 (65%), Gaps = 30/512 (6%)
 Frame = -3

Query  1686  SFTKKKTLPP-EVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVV  1510
             S  + KTLPP E  GA P++GHLR+L S  IP  R L  +A K+G VF++RLGM R LV+
Sbjct  10    SHKRNKTLPPPEPSGAWPLIGHLRILNSQ-IPFFRILGDLAVKHGPVFSIRLGMRRTLVI  68

Query  1509  SSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQ  1330
             SSWE+VK+CF TND+    RP FA +KY+GY+ A F       YW +MRK A  ELLS++
Sbjct  69    SSWESVKECFKTNDRKFLNRPSFAASKYMGYDDAFFGFHPYGEYWLEMRKIATQELLSNR  128

Query  1329  KLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKV  1150
             +LE L+H+RVSE+ET +KEL+   T S+ +  VDMS+WF  +  N++ +++AGKR+   +
Sbjct  129   RLELLKHVRVSEIETCIKELH--TTCSNGSVLVDMSQWFSCVVANVMFRLIAGKRYCSGI  186

Query  1149  KEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKEL  970
              +D              + +EF YL G  V  D  PF    W++ Q  V K M R+ KEL
Sbjct  187   GKDSGA--------FGRLVREFFYLGGVLVISDLIPF--TEWMDLQGHV-KSMKRVAKEL  235

Query  969   DTILQRWLDEHVDARRKRSSAANESGK--NDHQDFIDVMLS--MIDDDFARGLAYPPEII  802
             D ++  WL EH+  R        E G+   + +DF+DVML    + DD   G  Y  E I
Sbjct  236   DHVVSGWLVEHLQRR--------EEGRVRKEEKDFMDVMLESLAVGDDPIFG--YKRETI  285

Query  801   IKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDME  622
             +KAT L++I+ G+DTT+V LTW LSL++NH + +KR +++ID  VG  RWVE+ DIK++ 
Sbjct  286   VKATALNLILAGTDTTSVTLTWALSLLLNHTEVLKRAQKEIDVHVGTTRWVEESDIKNLV  345

Query  621   YLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPER  442
             YLQA VKETLRLYPP P   P  + EDC V GY +P+GT L VNAWK+HRD RIW  P  
Sbjct  346   YLQAIVKETLRLYPPGPLLVPRESLEDCYVDGYLVPRGTQLLVNAWKLHRDARIWENPYE  405

Query  441   FMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSE  265
             F PERFLT+    D   + FEY+PFG GRR C G + ++Q+ HLT++RL+QGF+F TP  
Sbjct  406   FHPERFLTSHGSTDVRGQQFEYVPFGSGRRLCPGISSSLQMLHLTLSRLLQGFNFSTPMN  465

Query  264   KPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
               +DMSEGLG+TLP+AT L+VV+TPRL    Y
Sbjct  466   AQVDMSEGLGLTLPKATPLEVVLTPRLENEIY  497



>gb|KDP26346.1| hypothetical protein JCGZ_17504 [Jatropha curcas]
Length=515

 Score =   473 bits (1216),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 238/506 (47%), Positives = 337/506 (67%), Gaps = 26/506 (5%)
 Frame = -3

Query  1680  TKKKTLP-PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSS  1504
             TK K L  PE  GA PI+GHL  LG G   L R +  +ADK G +FT+RLG ++ +++S+
Sbjct  30    TKNKGLSVPEAPGALPIIGHLHRLG-GEKTLARTMGDLADKCGPIFTVRLGAHKAIIISN  88

Query  1503  WEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKL  1324
             +EA+K+ FTTND + ++RP  + AKY+GYNYA F       YWR MRK  + ELLS Q++
Sbjct  89    YEAMKETFTTNDILFSSRPPSSQAKYIGYNYAAFGFAPYGTYWRNMRKLIMIELLSVQRI  148

Query  1323  EKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKE  1144
             + +RH++VSEV   +K+LY     S S K +DMSE    L LN+I ++VAGKR+     E
Sbjct  149   KLMRHVQVSEVNNMIKDLY-----SDSKKKIDMSEMLEHLILNIITRMVAGKRYFDGNSE  203

Query  1143  DDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDT  964
               D    +  + I ++ +EFM++ G  V GD  PF  + W + Q  + K M ++ KELD 
Sbjct  204   GRD----EHGRPIGKIMREFMFVVGALVPGDLIPF--LGWWDIQG-IKKTMKKVSKELDV  256

Query  963   ILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGL  784
             I+  W++EH   + K  S         ++DFIDVMLS+I+DD   G  +  ++IIK+T +
Sbjct  257   IMSTWIEEHKTKKNKTDS---------NKDFIDVMLSVIEDDTTFG--HKCDVIIKSTAM  305

Query  783   SMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAV  604
             S+I+ GSDTT++ +TW LS ++N+   ++R++E++D KVG++RWV+D DI+ ++Y  A +
Sbjct  306   SLIVAGSDTTSITMTWALSSLLNNRKTLERLQEELDQKVGRDRWVDDSDIEKLDYFSAVI  365

Query  603   KETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERF  424
             KETLRLYPP P   P  ATEDC + GY IPKGT L+ N WK+HRDP +W +PE F PERF
Sbjct  366   KETLRLYPPGPLGVPREATEDCTIAGYHIPKGTRLFTNLWKLHRDPNVWADPEEFKPERF  425

Query  423   LT-AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMS  247
             LT  A  D   ++FEY+PFG GRRSC G  +AMQV ++T+ARL+Q +DF TP  +P+DM+
Sbjct  426   LTDNANLDVSGQHFEYLPFGAGRRSCPGLNFAMQVMNITLARLLQAYDFRTPGNEPVDMT  485

Query  246   EGLGITLPRATALDVVITPRLPPSFY  169
             EG GI LP+ T L+VV+TPRL P  Y
Sbjct  486   EGKGIALPKITPLEVVLTPRLAPELY  511



>gb|ABA07806.2| cytochrome P450 monooxygenase CYP82E2 [Nicotiana tabacum]
Length=517

 Score =   473 bits (1217),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 228/495 (46%), Positives = 333/495 (67%), Gaps = 18/495 (4%)
 Frame = -3

Query  1647  GARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCFTT  1474
             G  P++GHL    + G   PL RKL  +ADKYG VFT RLG+  +LVVSS+EA+KDCF+T
Sbjct  39    GGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFST  98

Query  1473  NDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRVSE  1294
             ND + + RP F   +YLGYN  +  L    PYWRK RK  + E+LS+ +LEK + +R + 
Sbjct  99    NDAIFSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTR  158

Query  1293  VETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEYKEA  1114
             ++TS+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+  + +K A
Sbjct  159   IQTSIKNLYTRINGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDEQVERFKNA  215

Query  1113  QHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLDEHV  934
                   FK+FM L+ +FV  DAFP  + +WV+FQ  + K M R  K++D++ Q WL+EH+
Sbjct  216   ------FKDFMVLSMEFVLWDAFPIPLFKWVDFQGHI-KAMKRTFKDIDSVFQNWLEEHI  268

Query  933   DARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGSDTT  754
             + R K    A    + + QDFIDV+LS +  ++     Y  + +IKAT  S+++D +DT 
Sbjct  269   NKREKMEVGA----EGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSLVLDAADTV  323

Query  753   AVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLYPPL  574
             A+H+ W ++L++N+ +A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VK+ LRLYPP 
Sbjct  324   ALHINWGMTLLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPG  383

Query  573   PTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQADAPW  394
             P   PH   +DC V GY IPKGT L+ N  K+ RDP++   P++F PERF+ A   D   
Sbjct  384   PLLVPHENVKDCVVSGYHIPKGTRLFANVMKLQRDPKLLSNPDKFDPERFI-AGDIDFRG  442

Query  393   RNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITLPRAT  214
              ++E+IPFG GRRSC G TYA+QV HLT+A LIQGF+++TP+++ LDM EG GIT+ +  
Sbjct  443   HHYEFIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVN  502

Query  213   ALDVVITPRLPPSFY  169
              ++++ITPRL P  Y
Sbjct  503   PVELIITPRLAPELY  517



>ref|XP_009364162.1| PREDICTED: cytochrome P450 82C4-like [Pyrus x bretschneideri]
Length=529

 Score =   473 bits (1217),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 238/500 (48%), Positives = 323/500 (65%), Gaps = 11/500 (2%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  G  PI+GHL LLG G   L R L AMADKYG  F +RLG  R  VVSSWE  KDCF
Sbjct  37    PEPAGGWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSSWEVAKDCF  96

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T ND+ +A+RP    AK++GYNYAVF     SP+WR+MRK A  ELLS+++L+ L+H+R 
Sbjct  97    TVNDRALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLDMLKHVRT  156

Query  1299  SEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SE++  +KELY L   +   +   V+++ W  +LTLN++V++VAGKR+     + +D DE
Sbjct  157   SELDMGIKELYNLGVQNGGLRPAVVELNHWLEELTLNVVVRMVAGKRYFGASAKCEDGDE  216

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
              +  Q  I    +F +L G FV  DA PF  + W++ Q    K M +  KELD IL  WL
Sbjct  217   ARRCQKAI---GQFFHLIGIFVVADALPF--LWWLDLQGHE-KAMKKTAKELDGILGGWL  270

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
             +EH   R      A + G +  +DFIDVMLS+ ++       Y  +  IK+T L++I+ G
Sbjct  271   EEHRQRRGASHGKAEDEGGD--EDFIDVMLSLEEEGQLSNFQYSSDTSIKSTCLALILGG  328

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             SDTTA  LTW +SL++N+P AMK+ +E++D  VG ER VE+ DI ++ YLQA +KETLRL
Sbjct  329   SDTTAGTLTWAISLLINNPHAMKKAQEELDLHVGTERQVEESDITNLVYLQAIIKETLRL  388

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQ  409
             YP  P   P  A EDC V GY +P GT L VN WK+ RDPR+W  P  F+PERFL + + 
Sbjct  389   YPAGPLLGPREALEDCTVAGYRVPAGTRLVVNVWKIQRDPRVWESPSAFVPERFLESHSH  448

Query  408   ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGIT  229
              D   + F  +PFG GRRSC G ++AMQV HLT+ARL+ GF  ET S + +D++E  G+T
Sbjct  449   VDVRGQQFNLMPFGFGRRSCPGVSFAMQVLHLTLARLLHGFKIETASGQAIDLTESPGLT  508

Query  228   LPRATALDVVITPRLPPSFY  169
             +P+AT L+ +++PRLP   Y
Sbjct  509   IPKATPLEALLSPRLPSELY  528



>ref|XP_004292356.1| PREDICTED: cytochrome P450 82C4-like [Fragaria vesca subsp. vesca]
Length=492

 Score =   471 bits (1213),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 250/505 (50%), Positives = 335/505 (66%), Gaps = 19/505 (4%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
             K  + PE  GA PILGHL  LG G  PL + LA MADKYG +FT+ LG  R LV+S++EA
Sbjct  2     KGLMSPEPYGALPILGHLHQLG-GRNPLFQTLANMADKYGPIFTIWLGKNRALVISNYEA  60

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKL  1315
              K+CFTTND+V A RP  A  KYLGYNYA F +     YWR  RK  V ELLSS++LE L
Sbjct  61    AKECFTTNDRVFATRPSSAQGKYLGYNYAAFGVSPYGKYWRDTRKLVVMELLSSRRLETL  120

Query  1314  RHLRVSEVETSLKELYMLITSSS--SAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
             +H+++SEV+  +  LY +  +        V +S     LT N++ KI+AGKR+ F VK D
Sbjct  121   KHVQISEVDAFVIGLYSVWKNKGHDGPSKVVISTGIEHLTCNVMTKIIAGKRY-FGVKSD  179

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
             +   E K+   I ++ KEFMY     V   ++   I  W++F+  + + M  +  +LD++
Sbjct  180   EFDGEVKK---IRKLMKEFMYAAVNRVV--SYVVGIPEWIDFKGHL-RTMKNVGGQLDSL  233

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLS  781
             +  W++EH   +RK  S+      N+ QDFIDV+LS I+D     L +  + IIK+T L 
Sbjct  234   MTSWVEEHNTKKRKNDSS------NEEQDFIDVLLSEIED--GSMLGHTRDTIIKSTALI  285

Query  780   MIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVK  601
             +++ GS+TT+V LTW+LSL++N+   +K  +E++D  VG+ RWVED DIK++ YLQA  K
Sbjct  286   LVLAGSETTSVSLTWMLSLLLNNRRTLKLAQEELDRIVGRHRWVEDTDIKNLVYLQAIAK  345

Query  600   ETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL  421
             ETLRLYPP P   PH A EDCKVGG+ +PKGTHLYVN WK+HRDP +WP+PE F PERFL
Sbjct  346   ETLRLYPPGPLSVPHEAMEDCKVGGFHVPKGTHLYVNLWKLHRDPNVWPDPEVFSPERFL  405

Query  420   TA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSE  244
             T  A  DA  ++FE+IPFG GRR C G T A Q+ HLTVARLIQGF+  TP +K +DM+E
Sbjct  406   TTQASVDAFGQHFEFIPFGAGRRICPGITLAFQLMHLTVARLIQGFELATPLDKAVDMTE  465

Query  243   GLGITLPRATALDVVITPRLPPSFY  169
             G G+++ RATAL+VV+T RL    Y
Sbjct  466   GSGLSMARATALEVVLTARLAYELY  490



>ref|XP_011040244.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=544

 Score =   473 bits (1218),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 246/512 (48%), Positives = 333/512 (65%), Gaps = 33/512 (6%)
 Frame = -3

Query  1677  KKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
              K  LPPE  GA P++GHLR+L S  IPL R L  +ADK+G VF++RLGM R LV+SSWE
Sbjct  55    NKTLLPPEPSGAWPLIGHLRILNSQ-IPLFRTLGDLADKHGPVFSIRLGMRRTLVISSWE  113

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
             +VK+CF TND+    RP  A +KY+GY+ A F       YW +MRK A  ELLS+ +LE 
Sbjct  114   SVKECFKTNDRKFLNRPSVAASKYMGYDDAFFGFHPYGEYWLEMRKIATQELLSNSRLEL  173

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
             L+H+RVSE+ET +KEL+   T S+ +  +DMS+WF  +  N++ +++AGKR+     +D 
Sbjct  174   LKHVRVSEIETCIKELH--TTCSNGSVLLDMSQWFSCIVANVMFRLIAGKRYCGGTGKDS  231

Query  1137  D-CDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
               C           + KEF YL+G  V  D  PF    W++FQ  + K M R+ KELD +
Sbjct  232   GACGR---------LIKEFFYLSGVLVTSDLIPF--TEWMDFQGHL-KSMKRVAKELDDV  279

Query  960   LQ-RWLDEHVDARRKRSSAANESG--KNDHQDFIDVMLSMIDDDFARG----LAYPPEII  802
             +  +WL EH+  R        E G  + + +DF+DVML  +D   A G      Y  E I
Sbjct  280   VSGQWLVEHLQRR--------EEGLVRKEEKDFMDVMLESLDS-LAIGEEPIFVYKRETI  330

Query  801   IKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDME  622
             +KAT L++++ G DTT++ LTW LSL++NH + +KR +++ID  VG  RWVE+ DIK++ 
Sbjct  331   VKATALNLLLAGIDTTSITLTWALSLLLNHTEVLKRAQKEIDIHVGTTRWVEESDIKNLV  390

Query  621   YLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPER  442
             YLQA VKETLRLYPP P   P  + EDC V GY +P+GT L VNAWK+HRD RIW  P  
Sbjct  391   YLQAIVKETLRLYPPGPLLVPRESLEDCYVDGYLVPRGTQLLVNAWKLHRDARIWENPYE  450

Query  441   FMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSE  265
             F PERFLT+    D   + FEY+PFG GRRSC G + ++Q+ HLT++RL+QGF+F TP  
Sbjct  451   FHPERFLTSHGSTDVRGQQFEYVPFGSGRRSCPGISSSLQMLHLTLSRLLQGFNFSTPMN  510

Query  264   KPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
               +DMSEGLG+T+P+AT L+VV+TPRL    Y
Sbjct  511   AQVDMSEGLGLTMPKATPLEVVLTPRLENEIY  542



>ref|XP_004517185.1| PREDICTED: cytochrome P450 82C4-like [Cicer arietinum]
Length=522

 Score =   472 bits (1214),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 234/516 (45%), Positives = 345/516 (67%), Gaps = 19/516 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR K   +   K   PP+   A P +GHL LLG+   PL R  A+ ADKYG +F + LG 
Sbjct  24    WRIKKHSNNKLKGKQPPQPSYALPFIGHLHLLGNQ-TPLARIFASFADKYGPIFQIYLGS  82

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             Y  LV+S+ E++K+CFTTNDK++A+RP  +   YLGYNYA F       Y+ K+RK  + 
Sbjct  83    YPALVISNQESIKECFTTNDKILASRPKSSHGIYLGYNYAGFGFAPYGTYFTKLRKLTML  142

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSA-KTVDMSEWFGQLTLNLIVKIVAG  1171
             ELLSS+++E LRHL  SE++T + +L++ +  ++   K V +S+W  +LT N+I K+++G
Sbjct  143   ELLSSRRIESLRHLYESEIDTLVNDLWLYVKDNNKVTKAVVISKWLEKLTFNIITKMISG  202

Query  1170  KRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDM  991
             KR+   +++ DD     EA  I+++ KEFM+++G+FV  D  P  I+ W  F+ +V+K M
Sbjct  203   KRYFEYLQDVDDV----EAHGIVKLIKEFMHISGEFVPSDLIP--IIGWFGFEGQVLKSM  256

Query  990   GRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPP  811
              R+ ++LD ++ RW+DEHV           + G N+  DFIDVMLS+I+DD + G  +  
Sbjct  257   KRVGRDLDKVVGRWVDEHVQKI--------DDGVNEKHDFIDVMLSVIEDDPSSG--HDR  306

Query  810   EIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIK  631
             + IIKA  +++++ GSDTT+  +TW+L++++N+ +A+KR +E+I+  +GK+R VE  DIK
Sbjct  307   DTIIKANIMNLMLAGSDTTSTTMTWILAILLNNTNALKRAQEEINHHIGKKRRVESSDIK  366

Query  630   DMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPE  451
             ++ YLQA +KETLRLYPP P   PH AT+DC + GY++PKGT ++ N WK+HRDP IW E
Sbjct  367   NLVYLQAIMKETLRLYPPGPLLVPHEATKDCYIQGYNVPKGTRVFANVWKLHRDPSIWLE  426

Query  450   PERFMPERFLTAAQADA-PWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFET  274
              E+F PERF+     +     NFEY+PFG GRR+C G+ +A QV  +T+ARLI GFD E 
Sbjct  427   AEKFSPERFINEKNGELYEGHNFEYLPFGLGRRACPGSMFATQVCLITLARLIHGFDLEV  486

Query  273   PSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYG  166
             P  + +DM EGLGITLP+ T L+V++TPRL    Y 
Sbjct  487   PMGEDVDMREGLGITLPKLTPLNVILTPRLTYELYN  522



>gb|ABD39483.1| CYP82E2v2 [Nicotiana tabacum]
Length=517

 Score =   470 bits (1209),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 227/495 (46%), Positives = 332/495 (67%), Gaps = 18/495 (4%)
 Frame = -3

Query  1647  GARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCFTT  1474
             G  P++GHL    + G   PL RKL  +ADKYG VFT RLG+  +LVVSS+EA+KDCF+T
Sbjct  39    GGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFST  98

Query  1473  NDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRVSE  1294
             ND + + RP     +YLGYN  +  L    PYWRK RK  + E+LS+ +LEK + +R + 
Sbjct  99    NDAIFSNRPALLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTR  158

Query  1293  VETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEYKEA  1114
             ++TS+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+  + +K A
Sbjct  159   IQTSIKNLYTRINGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDEQVERFKNA  215

Query  1113  QHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLDEHV  934
                   FK+FM L+ +FV  DAFP  + +WV+FQ  + K M R  K++D++ Q WL+EH+
Sbjct  216   ------FKDFMVLSMEFVLWDAFPIPLFKWVDFQGHI-KAMKRTFKDIDSVFQNWLEEHI  268

Query  933   DARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGSDTT  754
             + R K    A    + + QDFIDV+LS +  ++     Y  + +IKAT  S+++D +DT 
Sbjct  269   NKREKIEVGA----EGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSLVLDAADTV  323

Query  753   AVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLYPPL  574
             A+H+ W ++L++N+ +A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VK+ LRLYPP 
Sbjct  324   ALHINWGMTLLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPG  383

Query  573   PTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQADAPW  394
             P   PH   +DC V GY IPKGT L+ N  K+ RDP++   P++F PERF+ A   D   
Sbjct  384   PLLVPHENVKDCVVSGYHIPKGTRLFANVMKLQRDPKLLSNPDKFDPERFI-AGDIDFRG  442

Query  393   RNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITLPRAT  214
              ++E+IPFG GRRSC G TYA+QV HLT+A LIQGF+++TP+++ LDM EG GIT+ +  
Sbjct  443   HHYEFIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVN  502

Query  213   ALDVVITPRLPPSFY  169
              ++++ITPRL P  Y
Sbjct  503   PVELIITPRLAPELY  517



>ref|XP_006432712.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
 ref|XP_006471502.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45952.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
Length=537

 Score =   470 bits (1210),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 242/520 (47%), Positives = 337/520 (65%), Gaps = 32/520 (6%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
              KKK  PPE  GA P++GHL LLG    PL R L  MADKYG +FT+R+G++R LVVS+W
Sbjct  35    NKKKRGPPEAGGAWPVIGHLHLLGR--FPLHRVLGDMADKYGPIFTIRMGVHRALVVSNW  92

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             E  K+C TT+D+V A+RP   VA+ LG+N+++F      P+WR++RK A  ELLS+ +LE
Sbjct  93    EMAKECLTTHDRVFASRPKALVAEILGFNFSMFGFSPYGPHWRQIRKIATLELLSNHRLE  152

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAKT----------VDMSEWFGQLTLNLIVKIVAG  1171
             KL+H+R  EV+T LKELY     +++ K+          V+M++WF  +TLN I+++  G
Sbjct  153   KLKHVREGEVKTCLKELYEFWERTNNYKSSDHNNNKKVLVEMNKWFEDVTLNTILRVTVG  212

Query  1170  KRFKFKVKEDDDCDE--YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEF--QRRV  1003
             +R      ++D   E  +KE         +F   +G+FV  D+ PF  +RW +     R 
Sbjct  213   QRCNSSSSQEDTDHEGAWKEE------LTKFFAFSGKFVVSDSLPF--LRWFDIGGDERA  264

Query  1002  VKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGL  823
             +K   R   ELD + Q WLDEH   +RKR S      K  H+DF+DVMLS++ DD  +  
Sbjct  265   MKKNAR---ELDVLAQGWLDEH---KRKRESG-QMINKEGHEDFMDVMLSILRDDAQQLP  317

Query  822   AYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVED  643
                 + I KAT L++I+  SDT+ + LTW+LSL++NH D +K+ + ++D  +GK R V +
Sbjct  318   GDDADTINKATCLALILAASDTSKITLTWILSLLLNHRDVLKKAQNELDVHIGKRRQVNE  377

Query  642   GDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPR  463
              DIK++ YLQA +KE +RLYP  P  APHA+TEDC V  Y +P GT LYVN WK+HRDPR
Sbjct  378   LDIKNLVYLQAIIKEAMRLYPAGPLAAPHASTEDCTVNDYFVPAGTVLYVNVWKIHRDPR  437

Query  462   IWPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGF  286
             +WPEP +F PERFLT     D   +NFE +PF  GRR C G ++A+ V+HLT+A L+ GF
Sbjct  438   VWPEPYKFKPERFLTTHKHIDVRGQNFELLPFSSGRRMCPGPSFAIPVTHLTLATLLHGF  497

Query  285   DFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYG  166
             DFETP ++P+DMSEG+ +TL + T + V+ITPRL  S YG
Sbjct  498   DFETPLDEPVDMSEGMSLTLVKTTPVKVLITPRLSASLYG  537



>emb|CDP03915.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   468 bits (1203),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 236/448 (53%), Positives = 313/448 (70%), Gaps = 18/448 (4%)
 Frame = -3

Query  1689  HSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVV  1510
             +SF  +K  PPE  GA P++GHL  L S    L R   A+ADKYG VF++RLGM R LVV
Sbjct  33    NSFKARKQ-PPEPSGAWPVIGHLLQLNSHDT-LARTFGALADKYGPVFSIRLGMTRALVV  90

Query  1509  SSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQ  1330
             S+WEAVK+CFTTNDKV+A+RPD     YLGYN A F       +WR+MRK  + ++LS++
Sbjct  91    SNWEAVKECFTTNDKVLASRPDSNAGVYLGYNNAAFGFAPYGHFWRQMRKLVLLQVLSNR  150

Query  1329  KLEKLRHLRVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFK  1153
             +LE LRH+RVSE++TS +EL+ +I    +A   V +SEW  QLTLN+IV+ VAGKR+   
Sbjct  151   RLETLRHVRVSEIQTSTRELFSVINREENAPAKVVISEWVEQLTLNIIVRTVAGKRYS--  208

Query  1152  VKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKE  973
                D +     +AQ+  +V KE+MY+ GQ    D  PF  +RW++    + K M R+ KE
Sbjct  209   ---DSEAGNRIDAQYFKKVVKEYMYVTGQLDLSDVIPFPPLRWLDPLGHI-KSMKRLFKE  264

Query  972   LDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKA  793
             LD I+Q W+DEHV+ RR +S + +E      Q FIDV+LS+I+DDFA  L  P E +IKA
Sbjct  265   LDAIMQIWIDEHVEKRRTKSISGDE------QSFIDVLLSVIEDDFA--LGQPRETLIKA  316

Query  792   TGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQ  613
             T  ++I+ GSDTT+VHLTWLLSL+VN+   M++ +E+IDS VGKERWV + DIK++ YLQ
Sbjct  317   TINNLILAGSDTTSVHLTWLLSLLVNNRQVMEQAQEEIDSSVGKERWVNESDIKNLVYLQ  376

Query  612   AAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMP  433
             A VKE LRLYPP P   PH A EDC+V GY +PKGT ++VN WK+HRDPRIW EP++F P
Sbjct  377   AIVKEALRLYPPGPLSVPHLAREDCEVSGYHVPKGTRVFVNVWKLHRDPRIWSEPDKFCP  436

Query  432   ERFLTA-AQADAPWRNFEYIPFGGGRRS  352
             ERF+T+ A+ D   ++FE+ PFG GRRS
Sbjct  437   ERFMTSHAEVDVSGQHFEFTPFGSGRRS  464



>gb|KDO40892.1| hypothetical protein CISIN_1g009347mg [Citrus sinensis]
Length=537

 Score =   469 bits (1208),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 242/523 (46%), Positives = 339/523 (65%), Gaps = 32/523 (6%)
 Frame = -3

Query  1689  HSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVV  1510
             ++  KKK  PPE  GA P++GHL LLG    PL R L  MADKYG +FT+R+G++R LVV
Sbjct  32    YASNKKKRGPPEAGGAWPVIGHLHLLGR--FPLHRVLGDMADKYGPIFTIRMGVHRALVV  89

Query  1509  SSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQ  1330
             S+WE  K+C TT+D+V A+RP   VA+ LG+N+++F      P+WR++RK A  ELLS+ 
Sbjct  90    SNWEMAKECLTTHDRVFASRPKALVAEILGFNFSMFGFSPYGPHWRQIRKIATLELLSNH  149

Query  1329  KLEKLRHLRVSEVETSLKELYMLITSSSSAKT----------VDMSEWFGQLTLNLIVKI  1180
             +LEKL+H+R  EV+T LKELY     +++ K+          V+M++WF  +TLN I+++
Sbjct  150   RLEKLKHVREGEVKTCLKELYDFWERTNNYKSSDHNNNKKVLVEMNKWFEDVTLNAILRV  209

Query  1179  VAGKRFKFKVKEDDDCDE--YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEF--Q  1012
               G+R      ++D   E  +KE         +F   +G+FV  D+ PF  +RW +    
Sbjct  210   TVGQRCNSSSSQEDTDHEGAWKEE------LTKFFAFSGKFVVSDSLPF--LRWFDIGGD  261

Query  1011  RRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFA  832
              R +K   R   ELD + Q WLDEH   +RKR S      K  H+DF+DVMLS++ DD  
Sbjct  262   ERAMKKNAR---ELDVLAQGWLDEH---KRKRESG-QMINKEGHEDFMDVMLSILRDDAQ  314

Query  831   RGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERW  652
             +      + I KAT L++I+  SDT+ + LTW+LSL++NH D +K+ + ++D  +GK R 
Sbjct  315   QLPGDDADTINKATCLALILAASDTSKITLTWILSLLLNHRDVLKKAQNELDVHIGKRRQ  374

Query  651   VEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHR  472
             V + DIK++ YLQA +KE +RLYP  P  APHA+TEDC V  Y +P GT LYVN WK+HR
Sbjct  375   VNELDIKNLVYLQAIIKEAMRLYPAGPLAAPHASTEDCTVNDYFVPAGTVLYVNVWKIHR  434

Query  471   DPRIWPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLI  295
             DPR+WPEP +F PERFLT     D   +NFE +PF  GRR C G ++A+ V+HLT+A L+
Sbjct  435   DPRVWPEPYKFKPERFLTTHKHIDVRGQNFELLPFSSGRRMCPGPSFAIPVTHLTLATLL  494

Query  294   QGFDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYG  166
              GFDFETP ++P+DMSEG+ +TL + T + V+ITPRL  S YG
Sbjct  495   HGFDFETPLDEPVDMSEGMSLTLVKTTPVKVLITPRLSASLYG  537



>gb|ABD39484.1| CYP82E2v3 [Nicotiana tabacum]
Length=517

 Score =   468 bits (1204),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 227/495 (46%), Positives = 331/495 (67%), Gaps = 18/495 (4%)
 Frame = -3

Query  1647  GARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCFTT  1474
             G  P++GHL    + G   PL RKL  +ADKYG VFT RLG+  +LVVSS+EA KDCF+T
Sbjct  39    GGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEATKDCFST  98

Query  1473  NDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRVSE  1294
             ND + + RP F   +YLGYN  +  L    PYWRK RK  + E+LS+ +LEK + +R + 
Sbjct  99    NDAIFSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTR  158

Query  1293  VETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEYKEA  1114
             ++TS+K LY  I  +SS  T+++++W  +L   LIVK++AGK ++   K D+  + +K A
Sbjct  159   IQTSIKNLYTRINGNSS--TINLTDWLEELNFGLIVKMIAGKNYE-SGKGDEQVERFKNA  215

Query  1113  QHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLDEHV  934
                   FK+FM L+ +FV  DAFP  + +WV+FQ  + K M R  K++D++ Q WL+EH+
Sbjct  216   ------FKDFMVLSMEFVLWDAFPIPLFKWVDFQGHI-KTMKRTFKDIDSVFQNWLEEHI  268

Query  933   DARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGSDTT  754
             + R K    A    + + QDFIDV+LS +  ++     Y  + +IKAT  S+++D +DT 
Sbjct  269   NKREKMEVGA----EGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSLVLDAADTV  323

Query  753   AVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLYPPL  574
             A+H+ W ++L++N+ +A+ + +E+ID+KVGK+RWVE+ DIKD+ YLQA VK+ LRLYPP 
Sbjct  324   ALHINWGMTLLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPG  383

Query  573   PTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQADAPW  394
             P   PH   +DC V GY IPKGT L+ N  K+ RDP++   P++F PERF+ A   D   
Sbjct  384   PLLVPHENVKDCVVSGYHIPKGTRLFANVMKLQRDPKLLSNPDKFDPERFI-AGDIDFRG  442

Query  393   RNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITLPRAT  214
              ++E+IP G GRRSC G TYA+QV HLT+A LIQGF+++TP+++ LDM EG GIT+ +  
Sbjct  443   HHYEFIPSGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEVLDMKEGAGITIRKVN  502

Query  213   ALDVVITPRLPPSFY  169
              ++++ITPRL P  Y
Sbjct  503   PVELIITPRLAPELY  517



>ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
 emb|CBI19595.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   466 bits (1199),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 248/516 (48%), Positives = 331/516 (64%), Gaps = 16/516 (3%)
 Frame = -3

Query  1704  RSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMY  1525
             R KI  S   +    PE  GA PI+GHL LLG G   L R L AMADKYG  F +RLG  
Sbjct  26    RKKIIKSSKSRDA--PEPGGAWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSR  83

Query  1524  RILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTE  1345
             R  VVSSWE  K+CFT NDK +A RP    AK++GYNYAVF     SP+WR+MRK A  E
Sbjct  84    RAFVVSSWEVAKECFTINDKALATRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLE  143

Query  1344  LLSSQKLEKLRHLRVSEVETSLKELYML-ITSSSSAKTVDMSEWFGQLTLNLIVKIVAGK  1168
             LLS+++LE L+H+R SEV+  ++ELY L + +SS    V+++ W   +TLN+IV++VAGK
Sbjct  144   LLSNRRLEILKHVRTSEVDMGIRELYGLWVKNSSRPLLVELNRWLEDMTLNVIVRMVAGK  203

Query  1167  RFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMG  988
             R+ F      D  E +  Q  I    +F  L G FV  DA PF  + W++ Q    + M 
Sbjct  204   RY-FGAAAASDSSEARRCQKAIS---QFFRLIGIFVVSDALPF--LWWLDLQGHE-RAMK  256

Query  987   RIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPE  808
                KELD+IL+ WL+EH   +R+ SS     G+   QDFIDVMLS+ ++    G  Y  E
Sbjct  257   TTAKELDSILEGWLEEH--RQRRVSSLIKAEGE---QDFIDVMLSLQEEGRLSGFQYDSE  311

Query  807   IIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKD  628
               IK+T L++I+ GSDTTA  LTW +SL++N+  A+K+ +E++D  VG ER VE+ D+K+
Sbjct  312   TSIKSTCLALILGGSDTTAGTLTWAISLLLNNRHALKKAQEELDLCVGMERQVEESDVKN  371

Query  627   MEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEP  448
             + YLQA +KETLRLYP  P   P  A +DC V GY++P GT L VN WK+ RDP +W  P
Sbjct  372   LVYLQAIIKETLRLYPAGPLLGPREALDDCTVAGYNVPAGTRLIVNIWKLQRDPSVWTNP  431

Query  447   ERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETP  271
               F PERFL A A  D   + FE +PFG GRRSC G ++A+QV HLT+ARL+  F+  TP
Sbjct  432   CAFQPERFLNAHADVDVKGQQFELMPFGSGRRSCPGVSFALQVLHLTLARLLHAFELSTP  491

Query  270   SEKPLDMSEGLGITLPRATALDVVITPRLPPSFYGL  163
              ++P+DM+E  G+T+P+AT L+V++TPRL    Y  
Sbjct  492   VDQPVDMTESSGLTIPKATPLEVLLTPRLNSKLYAF  527



>ref|XP_002274740.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=518

 Score =   465 bits (1196),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 245/516 (47%), Positives = 334/516 (65%), Gaps = 23/516 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR       +K ++  PE  GA P LGHL LL  G  P+ R L AMADK+G VF +RLG+
Sbjct  23    WRVMTLAGKSKGRS-APEPSGAWPFLGHLPLL-RGQTPIFRTLGAMADKHGPVFMIRLGV  80

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +R LVVSS EAVK+CFTTNDKV A+RP  +  K LGYNYA F        WR+MRK ++ 
Sbjct  81    HRALVVSSREAVKECFTTNDKVFASRPSSSAGKLLGYNYAGFGFAPYGALWREMRKLSMM  140

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVD--MSEWFGQLTLNLIVKIVA  1174
             E+LS+++L+ L+H+++SE++ S+K+LY L   S     V   MSEWF  L+ N+++K++A
Sbjct  141   EILSARRLDALKHVQISELDLSIKDLYSLGKGSDWVHPVKVVMSEWFQHLSFNIVLKMIA  200

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+      +      +EA+  I   +EF+ L+G FV  DA P   V W++ Q   +  
Sbjct  201   GKRYF-----NTSGHGIEEARRAIATIQEFLSLSGAFVLSDAIPG--VEWMDLQG-YLGS  252

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M R+ KE+D+++  W++EH           N  G    QDFIDVMLS+++D    G  + 
Sbjct  253   MKRVAKEVDSLVGGWVEEH-------EIRLNSEGSR-MQDFIDVMLSVLEDTSMFG--HS  302

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              E +IKAT + +I+ G++T A   TWLLS ++N+  A+KR +E++D KVG+ RWVE+ DI
Sbjct  303   RETVIKATIVILIVGGTETVATTSTWLLSALLNNKHALKRAQEELDLKVGRGRWVEESDI  362

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
              ++ YLQA +KETLRLY   P   PH A EDC V GY IPKGT L+VNAWK+HRDP +W 
Sbjct  363   PNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPKGTRLFVNAWKLHRDPSVWS  422

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             +PE F PERFLT+ A  D   ++FE IPFG GRRSC G T A+++  L + RL+QGFD  
Sbjct  423   DPEDFQPERFLTSHADLDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIGRLLQGFDLS  482

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             TP   P+DM EGL ITL + T L+V++TPRLP  FY
Sbjct  483   TPLNAPVDMREGLSITLAKLTPLEVILTPRLPSQFY  518



>ref|XP_009599169.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=523

 Score =   464 bits (1195),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 244/510 (48%), Positives = 334/510 (65%), Gaps = 17/510 (3%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             +  K   PE  GA PI+GHL LLG     L R L AMAD YG  F++RLG  R  VVSSW
Sbjct  25    STSKKHAPEPAGAWPIIGHLHLLGGAEQLLYRTLGAMADNYGPAFSIRLGSRRAFVVSSW  84

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             E  K+CFT NDK +A+RP    AK++GY YAVF     S +WR+MRK A+ ELLS+++L+
Sbjct  85    EMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFAPYSTFWREMRKIAMYELLSNRRLD  144

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAK---TVDMSEWFGQLTLNLIVKIVAGKRFKFKV  1150
              L+H++VSEVE  ++ELY L  +++S      V++  WF  LTLN+IV++VAGKR+ F  
Sbjct  145   TLKHVQVSEVEMGIQELYKLWVNNNSGYRPILVELKHWFEDLTLNVIVRMVAGKRY-FGA  203

Query  1149  KEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKEL  970
                 D DE +  Q  I    +F +L G FV  DAFP  I+ W + Q    K M R  KEL
Sbjct  204   GASCDDDEARRCQKAI---NQFFHLIGIFVPSDAFP--ILGWFDIQGHE-KAMKRTAKEL  257

Query  969   DTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKAT  790
             D+IL+ WL EH + RR  S   NE      QDFIDVMLS+ ++       Y  +  IK+T
Sbjct  258   DSILESWLQEHREKRR-LSEGKNEGA----QDFIDVMLSLQEEGRLSNFQYDADTSIKST  312

Query  789   GLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQA  610
              L++I+ GSDTTA  LTW +SL++N+P+ +++ +E+ID  VGK+R V++ DI+++ Y+QA
Sbjct  313   CLALILGGSDTTAGTLTWAISLLLNNPEILRKAQEEIDVHVGKDRQVDESDIQNLAYIQA  372

Query  609   AVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPE  430
              +KETLRLYP  P   P  A ++C+VGGY I  GT L VN WK+ RDPRIW +P+ F P+
Sbjct  373   IIKETLRLYPAGPLLGPREAMDECEVGGYKITPGTRLIVNVWKIQRDPRIWEDPDSFKPD  432

Query  429   RFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETP-SEKPL  256
             RFL + +  D   ++FE IPFG GRRSC G + A+QV HLT+AR +Q F+F  P  ++ +
Sbjct  433   RFLMSNSNVDVKGQDFELIPFGSGRRSCPGVSLALQVLHLTLARFLQAFEFSKPVGDQLI  492

Query  255   DMSEGLGITLPRATALDVVITPRLPPSFYG  166
             D++E  G+T+P+AT LDV+ITPRL  + YG
Sbjct  493   DLTESPGLTIPKATPLDVLITPRLNANLYG  522



>ref|XP_007134137.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris]
 gb|ESW06131.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris]
Length=526

 Score =   464 bits (1194),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 225/498 (45%), Positives = 338/498 (68%), Gaps = 16/498 (3%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PPE  GA P++GHL LLG+   PL R  AA+ADKYG +F +RLG Y  LV+ + EA+K+C
Sbjct  38    PPEPSGALPLIGHLHLLGAQ-TPLARTFAALADKYGPMFQIRLGAYPALVICNQEAIKEC  96

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             FTTNDKV+A+RP  +   +LGYN+A F       YW K+RK  + ELLS+++L+ L H+ 
Sbjct  97    FTTNDKVLASRPKSSHGVHLGYNFAGFGFAPYGTYWTKIRKLTMLELLSARRLQFLSHVY  156

Query  1302  VSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
              SE++T +K+L++ +   +  K V +SEW  + T N+I+K++AGKR+   +++ DD    
Sbjct  157   ESEIDTLVKDLWLYLGGKTHVK-VTISEWLERFTFNIIIKMIAGKRYFSYLEDVDDA---  212

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
              EA  ++++ KEFM+++G+FV  D  P  ++ W     +V+K M RI K+LD+++  W++
Sbjct  213   -EAHGVVKLIKEFMHISGEFVPSDLIP--VLGWFGVHGKVLKSMKRIAKDLDSLVGGWVE  269

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGS  763
             EH ++   R+ +       +  DFIDVMLS+I DD   G  +  + IIKA   ++++ GS
Sbjct  270   EHKNSDPLRNKSL------EKHDFIDVMLSVIQDDPLSG--HDRDTIIKANVTNLVLAGS  321

Query  762   DTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLY  583
             DTT+  +TW+L++++ +P+A+KR +E+I+ +VG+ER VE  D+K++ YLQA VKETLRLY
Sbjct  322   DTTSTTMTWILAMLMKNPEALKRAQEEIEDEVGRERKVEACDLKNLIYLQAVVKETLRLY  381

Query  582   PPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQAD  403
             PP P   PH A EDC + GY +PKGT ++ N WK+HRDPR+W E E+F PERFL      
Sbjct  382   PPGPLLVPHEAREDCCIQGYRVPKGTRVFANVWKLHRDPRVWSEAEKFSPERFLNENGEV  441

Query  402   APWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITLP  223
                + FEY+PFG GRR+C G+T+A Q++ +T+ARL+Q F  + P ++P+D+ EGLGITLP
Sbjct  442   DEGQRFEYLPFGSGRRACPGSTFATQLTLITLARLLQAFHLDEPLDEPVDLEEGLGITLP  501

Query  222   RATALDVVITPRLPPSFY  169
             +   L ++ T RLP  FY
Sbjct  502   KINPLQILFTSRLPNQFY  519



>ref|XP_007017403.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
 gb|EOY14628.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
Length=527

 Score =   464 bits (1193),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 236/506 (47%), Positives = 329/506 (65%), Gaps = 14/506 (3%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
             K    P+  GA PILGHL LLG     L R L AMAD+YG  FT+RLG     VVSSWE 
Sbjct  34    KTRTAPQPKGAWPILGHLHLLGGSDQLLYRTLGAMADEYGPAFTIRLGSRCAFVVSSWEL  93

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKL  1315
              K+CFT NDK +A+RP    AK++GYNYAVF     SP+WR+MRK A  ELLS+++LE L
Sbjct  94    AKECFTINDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEML  153

Query  1314  RHLRVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
             +H+R+SEV+  ++ELY L   + S    V++ +W   LTLN++V++VAGKR+        
Sbjct  154   KHVRISEVDMGIRELYSLRHDNGSIPVLVELKQWLEDLTLNVVVRMVAGKRY---FGASA  210

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
              C +  EA+   +  KEF  L G FV  DA P  ++ W++      K M    KELD +L
Sbjct  211   VCVD-GEARRCQKAIKEFFRLIGMFVVSDALP--LLWWLDVHGHE-KAMKMTAKELDDLL  266

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
             + WL EH   R++R S   ++     QDFIDVMLS+ ++       Y  +I IK+T L++
Sbjct  267   EAWLKEH---RQRRISGGIKA--EGEQDFIDVMLSLQEEGHLANFQYDADISIKSTCLAL  321

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             I+ G+DTTA  LTW +SL++N+P+ +K+ +E++D +VG+ER V++ DI+++ YLQA +KE
Sbjct  322   ILGGTDTTAGTLTWAISLLLNNPELLKKAQEELDLQVGRERLVDESDIQNLVYLQAIIKE  381

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
             TLRLYP  P   P  A  DC V GY +P GT L VN WK+ RDPR+W  P  F+PERFLT
Sbjct  382   TLRLYPAGPLLGPREAMNDCTVAGYHVPAGTRLIVNVWKIQRDPRVWSNPSAFVPERFLT  441

Query  417   A-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEG  241
             + A  D   + FE IPFG GRRSC G ++A+Q+ HLT+AR +  F+  TP ++P+DM+E 
Sbjct  442   SHANVDVRGQQFELIPFGSGRRSCPGASFALQLLHLTLARFLHAFELSTPLDQPVDMTES  501

Query  240   LGITLPRATALDVVITPRLPPSFYGL  163
              G+T+P+AT L+V++ PR+P + Y L
Sbjct  502   PGLTIPKATPLEVLLKPRVPANVYAL  527



>ref|XP_007049687.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOX93844.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=527

 Score =   462 bits (1190),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 239/504 (47%), Positives = 336/504 (67%), Gaps = 21/504 (4%)
 Frame = -3

Query  1665  LPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKD  1486
             L PE  GA PI+GH+ LLG G   L + L AMADKYG +F++R G +  L++S+ EAVK+
Sbjct  37    LAPEPPGALPIIGHIHLLG-GKRTLAQTLGAMADKYGPIFSIRFGAFPALIISNHEAVKE  95

Query  1485  CFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHL  1306
             CFTTND+V+A+RP      YLGY++A F       YWR+ RK AV ELLSS +LE  +H+
Sbjct  96    CFTTNDRVLASRPKSNAGTYLGYDHAGFGFAPYGEYWRETRKLAVVELLSSHRLETSKHV  155

Query  1305  RVSEVETSLKELYMLITSS---SSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDD  1135
                EV   +K LY+    +   ++ K V +S  F  LTLN I +++AGKR+     E+DD
Sbjct  156   LDFEVNAFIKNLYLFCKKNGPDANPKAV-ISHKFEALTLNTITRMIAGKRYISDGDEEDD  214

Query  1134  CDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVE-FQRRVVKDMGRIMKELDTIL  958
                  EA+H+I+V K+FMY++G     +A PF  + W+E      VK M R+ KE+D+I+
Sbjct  215   V----EARHVIKVIKDFMYVSGLIAPSEAMPF--LGWMESIFGGPVKSMKRVAKEIDSII  268

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
              RW+DEH   +R  S A      +++QDFID++LS I +D   G  Y  E IIKAT +++
Sbjct  269   GRWVDEH-KLKRLMSEA-----DHNNQDFIDLLLSAIGEDSMFG--YTRETIIKATVMNL  320

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
              + G+DTT++ LTW+LS ++N+   +K  +E++D  VG+++WV+D DI+ + YLQA +KE
Sbjct  321   FLAGADTTSIALTWILSNLMNNRHTLKTAQEELDLTVGRDKWVQDSDIEKLVYLQAVIKE  380

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
             TLRLYPP P   PH A EDC + GY + KGT + VN  ++HRDPRIW  P+ F PERFLT
Sbjct  381   TLRLYPPGPISVPHEAREDCSISGYHVQKGTRVIVNLRRLHRDPRIWSNPDEFQPERFLT  440

Query  417   A-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEG  241
             + A  D   ++FE IPFG GRRSC G   A+Q++HLT+AR +QGFD  TP  + +DM+EG
Sbjct  441   SHANVDVLGQHFELIPFGSGRRSCPGMPLALQITHLTIARTLQGFDLTTPFNESVDMTEG  500

Query  240   LGITLPRATALDVVITPRLPPSFY  169
             LGIT+P+AT LDV+++PRLP + Y
Sbjct  501   LGITMPKATPLDVLLSPRLPAALY  524



>ref|XP_007049681.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX93838.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   462 bits (1189),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 240/515 (47%), Positives = 331/515 (64%), Gaps = 21/515 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR   + +    K+  PE  G+ P++GHL LLG G   L +KL AMADKYG +++L+LG 
Sbjct  24    WR---YIARNSNKSRIPEPSGSWPLIGHLHLLG-GKETLCKKLGAMADKYGPLYSLKLGH  79

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
              R+LVVSSWE  KDC T ND+ +A RP  A  +++GYN A+F+L     YWR +RK    
Sbjct  80    RRVLVVSSWEIAKDCLTNNDRALATRPSIAAGRHIGYNNAIFALAPYGEYWRNIRKIVTI  139

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYML-ITSSSSAKTVDMSEWFGQLTLNLIVKIVAG  1171
             ELLSS +LEKL+H+R SE++  +KEL+ L + ++ +   V MSE   +LT N+ ++++ G
Sbjct  140   ELLSSYRLEKLKHIRFSEMDLFIKELFRLCVENADNCAQVTMSEVLERLTFNINLRMLVG  199

Query  1170  KRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDM  991
             KRF            ++  + I    K+ +YL+G FV  DA PF  + W++ Q  V + M
Sbjct  200   KRFASSSYAQAHSQPWRYEKAI----KQTLYLSGIFVLADALPF--LEWMDIQGHV-RSM  252

Query  990   GRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPP  811
              +  KELD+I+  WL+ H+  RRKR     ES  +   DF+DVML+ +  D A    +  
Sbjct  253   KQTAKELDSIISVWLENHL--RRKR-----ESQGSCESDFMDVMLANLPQD-AVISGHTR  304

Query  810   EIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIK  631
             + I+KAT L + + G ++T+V +TW+LSL++NHP  +K  ++++D  VG +RWVE+ DIK
Sbjct  305   DTIVKATTLILTMTGGESTSVTMTWVLSLLLNHPSVLKAAQQELDLHVGIDRWVEESDIK  364

Query  630   DMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPE  451
              ++YLQA VKETLRLYPP P      A EDC + GY +PKGT L VN WK+ RDPR+W  
Sbjct  365   SLKYLQAIVKETLRLYPPGPLTGIREAMEDCCIAGYHVPKGTRLIVNLWKLQRDPRVWEN  424

Query  450   PERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFET  274
             P  F PERFLT  A  D   +NFEYIPF  GRRSC   T+ +QV HLT+A+L+QGFD  T
Sbjct  425   PGEFQPERFLTTHADFDVRGQNFEYIPFSSGRRSCPAITFGLQVVHLTLAKLLQGFDIRT  484

Query  273   PSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             P  KP+DM EGLG+ LP+ T LDVV+TPRL   FY
Sbjct  485   PDGKPVDMGEGLGLALPKRTPLDVVLTPRLAHEFY  519



>gb|KEH25406.1| cytochrome P450 family protein [Medicago truncatula]
Length=516

 Score =   461 bits (1187),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 231/499 (46%), Positives = 334/499 (67%), Gaps = 22/499 (4%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PPE   A P++GHL LLG   IPL R  A+ +DKYG VF +RLG Y  L++S+ EA+K+C
Sbjct  38    PPEPLFALPLIGHLHLLGKQ-IPLARIFASFSDKYGPVFQIRLGAYPALIISNKEAIKEC  96

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             FTTNDK++A+RP  +   +LGYNYA FS     PY+ K++K  + ELLSS++LE LRH+ 
Sbjct  97    FTTNDKILASRPKSSHGIHLGYNYAGFSFAPSGPYFSKLKKITMVELLSSRRLESLRHVY  156

Query  1302  VSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
              SE+ T +K+L   +  +++ K V +SEW  +L+ N I K++ GKR+     E+ + ++ 
Sbjct  157   ESEIHTWIKDLSFYVKGNNNVKVV-ISEWLKRLSFNTITKMIGGKRYF----ENLNVEDV  211

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
             +   +I+ + +EFM + G FV  D  P  I+ W  F+ +V+K M R+ K+L+T++  W++
Sbjct  212   EAHGNIVNLIREFMLIAGDFVPKDLIP--IIGWFGFEGQVLKSMKRVGKDLETLVGSWIE  269

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGS  763
             EH+          N S  N+  DFIDVMLS+I+DD  R   +  + IIKA    +++ GS
Sbjct  270   EHI---------VNNS--NEKHDFIDVMLSVIEDD--RVYGHNRDTIIKANITDLMLAGS  316

Query  762   DTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLY  583
             D+T+  LTW+++L++N+ + +KR +E+ID  +GK R VE  DIK++ YLQA +KETLRLY
Sbjct  317   DSTSTTLTWIVALLLNNRNVLKRAQEEIDHHIGKGRRVESSDIKNLVYLQAILKETLRLY  376

Query  582   PPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQA  406
             P  P  APH ATEDC + GY +PKGT ++ N WK+HRDP IW EPE+F+PERF+    + 
Sbjct  377   PAAPLLAPHEATEDCNIQGYYVPKGTRVFFNVWKLHRDPSIWSEPEKFLPERFINENGEI  436

Query  405   DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITL  226
             D    +FEY+PFG GRR+C G+ +A Q S +T+A L+ GFD E P ++ +DM EGLGITL
Sbjct  437   DHESHHFEYLPFGLGRRACPGSLFATQNSLITLACLLHGFDLEVPMDEVVDMREGLGITL  496

Query  225   PRATALDVVITPRLPPSFY  169
             P+ T L VV+TPRLP   Y
Sbjct  497   PKLTPLQVVLTPRLPFELY  515



>ref|XP_010264712.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   461 bits (1187),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 241/511 (47%), Positives = 323/511 (63%), Gaps = 24/511 (5%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
              KK+ + PE  GA P++GHL LLG   +P    L AMADKYG  FT+RLG+ R LVVS W
Sbjct  34    VKKRKMAPEAAGAWPVIGHLPLLGGPELP-HITLGAMADKYGPAFTIRLGVRRALVVSDW  92

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             E  K+CFT ND+ +A RP     K++GYNYA+F+     PYWR++RK A  ELLS+++LE
Sbjct  93    EVAKECFTINDRALATRPSGVAMKHMGYNYAMFAFAPYGPYWREVRKIATLELLSNRRLE  152

Query  1320  KLRHLRVSEVETSLKELYML------ITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFK  1159
              L+H+RVSEV  S++ELY L       T + S K V+M  WFG LTLN ++++VAGKR+ 
Sbjct  153   MLKHVRVSEVNMSVRELYGLWLKNKNATGADSVK-VEMKRWFGDLTLNNVLRMVAGKRY-  210

Query  1158  FKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIM  979
                     C    EA     V + F  L GQFV  DA PF  + W++ Q    K M R  
Sbjct  211   --FGATAACGS-AEAVRCQTVMRSFFRLVGQFVIADAIPF--LGWLDMQGHE-KAMKRTA  264

Query  978   KELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIII  799
             KELD+IL+ W++EH   R     A      N  QDF+DVMLS++ D    G  Y  + I 
Sbjct  265   KELDSILEGWMEEHRKMRLSNDEA------NGEQDFMDVMLSILKDSKLSG--YDADTIN  316

Query  798   KATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEY  619
             KAT +++I+ G+DT  V LTW LSL+VN+ + +KR+++++D  VGK+R VE+ D+K +EY
Sbjct  317   KATCMNLILGGNDTIKVCLTWALSLLVNNQEVLKRVQDELDRHVGKDRNVEESDMKKLEY  376

Query  618   LQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERF  439
             LQA VKE LRLYPP P   PH A E+C V GY +P GT + VN  K+ RDPR+W +P  F
Sbjct  377   LQAVVKEALRLYPPAPLSGPHEAMEECTVAGYHVPVGTRILVNLSKIQRDPRVWSDPLEF  436

Query  438   MPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEK  262
              PERFLT+    D   ++FE IPFG GRR+C G +  ++V HL +ARL+  F   TPS  
Sbjct  437   RPERFLTSHVGVDVLGQHFELIPFGSGRRACPGTSLGLKVVHLALARLLHAFHLHTPSGA  496

Query  261   PLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             P+DM+E  G+T  +AT L+V++ PRLP   Y
Sbjct  497   PVDMTESFGLTNLKATPLEVLLLPRLPSHLY  527



>ref|XP_010253830.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   461 bits (1186),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 239/503 (48%), Positives = 329/503 (65%), Gaps = 17/503 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             P+  GA PI+GHL L  +  + L  KL AMADKYG  F LRLGM R LVVSSW+A K CF
Sbjct  38    PQPSGAWPIIGHLHLFRASEL-LHPKLGAMADKYGPAFMLRLGMRRALVVSSWDAAKQCF  96

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             TTNDKV + RP     K++GYNYA+       PYWR+MRK +  ELLS ++L+  +H+R 
Sbjct  97    TTNDKVFSTRPRTVAIKHMGYNYALPGFAPYGPYWREMRKISTVELLSHRRLDMFKHIRT  156

Query  1299  SEVETSLKELYM--LITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SE++ S+K+LY   +     S   V+M +WF  LT+N++ +++AGKR+ F      D  E
Sbjct  157   SEIDLSMKDLYTRWVKNGHGSPVLVEMKQWFSDLTMNIVTRMIAGKRY-FGAANYTDFSE  215

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
              +E Q   +   EFM+L G FV  DA PF  + W++ Q    + M R  K+LD +L+ WL
Sbjct  216   -EEVQKCKKAITEFMHLVGIFVVSDALPF--LGWLDLQGHE-RAMKRTAKQLDHMLESWL  271

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
              EH    R +  A+      D +DF+DV+LS++DD   + + Y  + ++KAT L +I+ G
Sbjct  272   KEH----RCKKRASEGIATADERDFMDVLLSILDDH--QCIGYGTDTVVKATCLGLILGG  325

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             SDTT+V LTW LSL++N+  A+K+ ++++D+KVG++  VE+ DI+++ YLQA VKETLRL
Sbjct  326   SDTTSVTLTWALSLLLNNRQALKKAQDELDTKVGRDGLVEESDIRNLVYLQAIVKETLRL  385

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT--AA  412
             YP     AP  A EDC V G+ IP GT L VN WK+ RDP IWP P  F PERFLT  AA
Sbjct  386   YPAAAVSAPREAMEDCTVAGFHIPAGTQLLVNIWKLQRDPSIWPHPCEFSPERFLTSHAA  445

Query  411   QADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETP-SEKPLDMSEGLG  235
               D   ++FE +PFG GRR+C G ++A+QV HLT+ARLIQGFD  TP  +  +DM++G+G
Sbjct  446   DIDVRGQHFELLPFGSGRRACPGISFAIQVLHLTLARLIQGFDLGTPCCDAMVDMTQGIG  505

Query  234   ITLPRATALDVVITPRLPPSFYG  166
             +T  + T LDV++TPRL P  YG
Sbjct  506   LTNHKKTPLDVLLTPRLHPLLYG  528



>ref|XP_003548652.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
Length=521

 Score =   461 bits (1185),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 238/514 (46%), Positives = 344/514 (67%), Gaps = 17/514 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR K       K   PPE   A P++GHL LLG+   PL R  A++ADKYG +F + LG 
Sbjct  23    WRKKSSTIHKIKGLQPPEPSFALPLIGHLHLLGAK-TPLARIFASLADKYGPIFQIHLGA  81

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             Y  LV+ + EA+K+CFTTNDKV+A+RP  +   +L YN+A F       YW K+RK  + 
Sbjct  82    YPALVICNQEAIKECFTTNDKVLASRPKSSHGVHLSYNFAGFGFAPYGSYWIKLRKLTML  141

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGK  1168
             ELLS+++LE LR +  SE++T +++L+M +   S  K V +SEW  +LT N+I K++AGK
Sbjct  142   ELLSARRLEFLRPVYESEIDTLIRDLWMYLGGKSDVK-VTISEWLERLTFNMITKMIAGK  200

Query  1167  RFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMG  988
             R+   +++ DD     EA  I+++ KEFM+++G+FV  D  P  ++ W+     V+K+M 
Sbjct  201   RYFSYLQDVDDV----EAHGIVKLIKEFMHISGEFVLSDLIP--LLGWLGVHGTVLKNMK  254

Query  987   RIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPE  808
             RI K+LDT++  W++EH+    K  +  N+S +    DFIDVMLS+I+DD   G  +  +
Sbjct  255   RIAKDLDTLVGGWVEEHM----KSDTLTNKSWEK--HDFIDVMLSVIEDDSVSG--HTRD  306

Query  807   IIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERW-VEDGDIK  631
              IIKA  +++++ GSDTT+  +TW L++++ +P A+KR +E+ID +VG+ER  VE  DIK
Sbjct  307   TIIKANVMNLMLAGSDTTSTTMTWTLAMLMKNPHALKRAQEEIDHQVGRERRRVEARDIK  366

Query  630   DMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPE  451
             D+ YLQA VKETLRLYPP P   PH A EDC + GY +PKGT ++ N WK+HRDP +W E
Sbjct  367   DLIYLQAIVKETLRLYPPGPVLVPHEAREDCNIQGYHVPKGTRVFANVWKLHRDPSLWSE  426

Query  450   PERFMPERFLTAAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETP  271
             PE+F PERF++         +FEY+PFG GRR+C G+T+A QV  LT++RL+QGFD   P
Sbjct  427   PEKFSPERFISENGELDEVHHFEYLPFGSGRRACPGSTFATQVCLLTLSRLLQGFDLHVP  486

Query  270   SEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              ++P+D+ EGLGITLP+   L +V++PRLP  FY
Sbjct  487   MDEPVDLEEGLGITLPKMNPLQIVLSPRLPSEFY  520



>ref|XP_006355071.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=525

 Score =   461 bits (1185),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 226/503 (45%), Positives = 334/503 (66%), Gaps = 20/503 (4%)
 Frame = -3

Query  1695  IFHSF--TKKKT---LPPEVDGARPILGHLRLLGSGG--IPLGRKLAAMADKYGSVFTLR  1537
             IF+ F  TKK +   LPPE+ G  P++GHL    + G   PL RKL+ +ADKYG VFT R
Sbjct  23    IFYFFLSTKKSSKPPLPPEIAGGWPVIGHLFYFDNDGDDRPLARKLSDLADKYGPVFTFR  82

Query  1536  LGMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKF  1357
             LG+ R+LV+SS +AVKDC++ ND V A RP     +YLGYN A+  L    PYWR +RK 
Sbjct  83    LGLPRVLVISSSDAVKDCYSKNDAVFANRPACLYGEYLGYNNAMLFLANYGPYWRNIRKL  142

Query  1356  AVTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIV  1177
              + E+LS+ +LEKL+ +++ ++  ++K L+  I ++     V++++W  +L   LIV+++
Sbjct  143   VIQEVLSNTRLEKLKQIKLCKIRNNIKNLHSRIQNTEEKSVVNLTDWLEELNFGLIVQMI  202

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
             AGK   ++   D + + +KEA      F++F+ L+ +FV  DAFP  + +W++FQ  V K
Sbjct  203   AGK--NYESGGDGEMERFKEA------FRKFLVLSMEFVLWDAFPIPLFKWIDFQGHV-K  253

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
              M +  K++D+I QRWLDEHV  R   +S    +G  + +DFIDVMLS + ++      Y
Sbjct  254   LMKKTFKDIDSIFQRWLDEHVKTRE--TSLMEVNGGGNERDFIDVMLSKMSNEHLHE-GY  310

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
               + +IKAT  S+++D +DT ++H+ W ++L++N+   +K+ +E+ID K+GK+RW++D D
Sbjct  311   SRDTVIKATVFSLVLDAADTVSLHINWGMTLLINNQHVLKKAQEEIDMKIGKDRWIDDND  370

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIW  457
             IKD+ YLQA +KE LRLYPP P   PH  TEDC V GY IPKGT LY N  K+ RD +IW
Sbjct  371   IKDLVYLQAIIKEVLRLYPPGPLLVPHENTEDCVVSGYHIPKGTRLYTNVMKLQRDLKIW  430

Query  456   PEPERFMPERFLTAAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
               P++F P+RF T    D   +++E+IPFG GRRSC G TYA+QV +LT+  LIQGFD++
Sbjct  431   SNPDQFNPDRFFT-TDIDFRGQDYEFIPFGSGRRSCPGMTYALQVEYLTIGHLIQGFDYK  489

Query  276   TPSEKPLDMSEGLGITLPRATAL  208
             TPS++PLDM EG G+T+ +   L
Sbjct  490   TPSDEPLDMKEGPGMTMRKVMVL  512



>ref|XP_002264520.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=567

 Score =   461 bits (1187),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 242/520 (47%), Positives = 339/520 (65%), Gaps = 31/520 (6%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR +   +   K    P+  GA PI+GHL LL SG +P+ R L AMADK+G VF ++LGM
Sbjct  72    WRVRTL-THNSKGISAPKPPGAWPIIGHLHLL-SGQVPIFRTLGAMADKHGPVFMIQLGM  129

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +  +VVSS EAVK+CFTTNDKV A+RP  +V+K LGYNYA F      P+WR+MRK +V 
Sbjct  130   HPAVVVSSHEAVKECFTTNDKVFASRPRSSVSKLLGYNYAGFGFAPYGPFWREMRKLSVV  189

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS--SAKTVDMSEWFGQLTLNLIVKIVA  1174
             E+LS+++L +L+ +R+SE++  +++LY L   ++  S   V MSEWF  LT N +++++A
Sbjct  190   EILSARRLNELKDVRISELDACIQDLYSLGKDNNWISPIEVVMSEWFEHLTFNFVLRMIA  249

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK-  997
             GKR+      D+     +EA+  I   K+F+ L+G FV  D FPF        +R  +K 
Sbjct  250   GKRYF-----DNAVHGNEEARGAIIAIKKFLSLSGAFVPSDVFPF-------LERLDLKG  297

Query  996   ---DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARG  826
                 M  + +ELD ++  W++EHV   R +S   +        DFIDV+LS + D    G
Sbjct  298   YLGSMKHVAEELDCLVGSWVEEHV--MRLKSEPGSR------HDFIDVLLSAVQDTSMFG  349

Query  825   LAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVE  646
               +  E +IKAT  ++I+ GSD+T++  TW+LS ++N+ +AMKR +E++D KVG+ RWVE
Sbjct  350   --HSRETVIKATIGNLIVGGSDSTSITSTWILSALLNNREAMKRAQEELDLKVGRSRWVE  407

Query  645   DGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDP  466
             + DI+ ++YL+A +KE+LRLY   P   PH AT+DC V GY IPKGT L+VNAWK+HRDP
Sbjct  408   ESDIQKLDYLRAIIKESLRLYSAAPLLVPHEATQDCHVCGYHIPKGTRLFVNAWKLHRDP  467

Query  465   RIWPEPERFMPERFL-TAAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQG  289
             R+W  PE F PERFL + A  D     FE IPFG GRR+C G   A+Q+ HLT ARL+QG
Sbjct  468   RVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINMALQMLHLTFARLLQG  527

Query  288   FDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             FD  TPS  P+DM+EG+  T+P+ T L V++TPRLP   Y
Sbjct  528   FDMATPSNAPVDMTEGISFTMPKLTPLCVMLTPRLPSHLY  567



>ref|XP_010091295.1| Cytochrome P450 82G1 [Morus notabilis]
 gb|EXC36851.1| Cytochrome P450 82G1 [Morus notabilis]
Length=546

 Score =   461 bits (1185),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 237/510 (46%), Positives = 327/510 (64%), Gaps = 21/510 (4%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
              K   PE  GA PI+GHL LLG G +P+   L AMADKYG +++LRLG +R LV+SSWE 
Sbjct  47    NKICVPEPSGALPIIGHLHLLG-GQVPVALILGAMADKYGPIYSLRLGQHRALVLSSWEL  105

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKL  1315
             VK+CFTTND++ A RP  AV KY+ Y+ A F++ +   YWR +RK     LLSS +LE L
Sbjct  106   VKECFTTNDRLFANRPSIAVGKYILYDSAAFAISSYGNYWRDVRKMVTLRLLSSHRLESL  165

Query  1314  RHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDD  1135
             +H+R SE  + +K LY   T         +SE   QLT NL  +++ GKRF      D D
Sbjct  166   QHIRTSEFGSFIKGLYFEYTKL--GPLAPLSELLEQLTFNLNARLIVGKRFIKSAVGDAD  223

Query  1134  CDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQ--RRVVKDMGRIMKELDTI  961
              D    A+   +  KE +YL+G FV+ DA P     WVE       V  M R+ KE+D +
Sbjct  224   TD----ARRFKKAIKEALYLSGVFVWSDAIP-----WVECLDIHGHVSSMKRVFKEIDLV  274

Query  960   LQRWLDEHVDARR----KRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKA  793
             L +WL+EH  AR     +RS+  + S  +  +D +DVMLS I++D A    Y  + IIKA
Sbjct  275   LGKWLEEHRQAREVLDDQRSNDKSSSNGDVERDLMDVMLSSIEEDDAMLSCYSRDTIIKA  334

Query  792   TGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQ  613
             T L +I+ G+++TAV L W +SL++N+P  MK  + ++D+ VG++RWV++ D+ ++++L+
Sbjct  335   TALILILTGTESTAVTLIWAISLLLNNPSVMKAAQRELDTHVGRDRWVQESDLSNLKFLE  394

Query  612   AAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMP  433
             A VKET+RLYPP P   P  ATE+C VGG+ +PKGT L VN WK+HRDPR+W +P  F P
Sbjct  395   AIVKETIRLYPPGPITGPREATEECFVGGHHVPKGTRLIVNIWKLHRDPRMWADPCEFRP  454

Query  432   ERFLTAAQADAPWR--NFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKP  259
             ERF+T  + D  +R  NF+YIPF  GRRSC G T+ + V  L +A L+QGF+F+T  +KP
Sbjct  455   ERFMTTHE-DLNFRGQNFQYIPFSSGRRSCPGMTFGLLVVELMLASLVQGFEFKTKDDKP  513

Query  258   LDMSEGLGITLPRATALDVVITPRLPPSFY  169
             +DM EGLGI LP+  +LDV + PRLP   Y
Sbjct  514   VDMREGLGIALPKLNSLDVFLYPRLPTKLY  543



>emb|CAN81014.1| hypothetical protein VITISV_025152 [Vitis vinifera]
Length=519

 Score =   459 bits (1180),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 241/520 (46%), Positives = 338/520 (65%), Gaps = 31/520 (6%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR +   +   K    P+  GA PI+GHL LL SG +P+ R L AMADK+G VF ++LGM
Sbjct  24    WRVRXL-THNSKGISAPKPPGAWPIIGHLHLL-SGQVPIFRTLGAMADKHGPVFMIQLGM  81

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +  +VVSS EAVK+CFTTNDKV A+RP  +V+K LGYNYA F      P+WR+MRK +V 
Sbjct  82    HPAVVVSSHEAVKECFTTNDKVFASRPRSSVSKLLGYNYAGFGFAPYGPFWREMRKLSVV  141

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS--SAKTVDMSEWFGQLTLNLIVKIVA  1174
             E+LS+++L +L+ +R+SE++  +++LY L   ++  S   V MSEWF  LT N +++++A
Sbjct  142   EILSARRLNELKDVRISELDACIQDLYSLGKDNNWISPIEVVMSEWFEHLTFNFVLRMIA  201

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK-  997
             GKR+      D+     +EA+  I   K+F+ L+G FV  D FPF        +R  +K 
Sbjct  202   GKRYF-----DNAVHGNEEARGAIIAIKKFLSLSGAFVPSDVFPF-------LERLDLKG  249

Query  996   ---DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARG  826
                 M  + +ELD ++  W++EHV   R +S   +        DFIDV+LS + D    G
Sbjct  250   YLGSMKHVAEELDCLVGSWVEEHV--MRLKSEPGSR------HDFIDVLLSAVQDTSMFG  301

Query  825   LAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVE  646
               +  E +IKAT  ++I+ GSD+T++  TW+LS ++N+ +AMK  +E++D KVG+ RWVE
Sbjct  302   --HSRETVIKATIGNLIVGGSDSTSITSTWILSALLNNREAMKXAQEELDLKVGRSRWVE  359

Query  645   DGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDP  466
             + DI+ ++YL+A +KE+LRLY   P   PH AT+DC V GY IPKGT L+VNAWK+HRDP
Sbjct  360   ESDIQKLDYLRAIIKESLRLYXAAPLLVPHEATQDCHVCGYHIPKGTRLFVNAWKLHRDP  419

Query  465   RIWPEPERFMPERFL-TAAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQG  289
             R+W  PE F PERFL + A  D     FE IPFG GRR+C G   A+Q+ HLT ARL+QG
Sbjct  420   RVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINMALQMLHLTFARLLQG  479

Query  288   FDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             FD  TPS  P+DM+EG+  T+P+ T L V++TPRLP   Y
Sbjct  480   FDMATPSNAPVDMTEGISFTMPKLTPLXVMLTPRLPSHLY  519



>ref|XP_002264473.1| PREDICTED: cytochrome P450 82C4-like [Vitis vinifera]
Length=519

 Score =   458 bits (1179),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 237/500 (47%), Positives = 333/500 (67%), Gaps = 22/500 (4%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             P+  GA PI+GHL LL SG +P+ R L AMADK+G VF ++LGM+  +VVSS EAVK+CF
Sbjct  39    PKPPGAWPIIGHLHLL-SGQVPIFRTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECF  97

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             TTNDKV A+RP  +V+K LGYNYA+F       +WR+MRK +V E+LS+++L +L+ +R+
Sbjct  98    TTNDKVFASRPRSSVSKLLGYNYAMFGSAPYGLFWREMRKLSVVEILSARRLNELKDVRI  157

Query  1299  SEVETSLKELYMLITSSS--SAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SE++  +K+LY L   ++  S   V MSEWF  LT N  ++++AGKR+      D+    
Sbjct  158   SELDACIKDLYSLGKDNNWISPIKVVMSEWFEHLTFNFALRMIAGKRYF-----DNAVHG  212

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
              +EA+  I   K+++ L+G FV  D FPF  +  ++ Q   +  M  + +ELD ++  W+
Sbjct  213   NEEARGAIITIKKYLSLSGAFVPSDVFPF--LERLDLQG-YLGSMKHVTEELDCLVGSWV  269

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
             +EHV  R K              DFIDV+LS + D    G  +  E +IKAT +++I+ G
Sbjct  270   EEHV-MRLKSEPGCR-------HDFIDVLLSTVQDTSMFG--HTRETVIKATIVNLIVGG  319

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             SD+T++  TW+LS ++N+ +AMK  +E++D KVG+ RWVE+ DI+ ++YL+A +KE+LRL
Sbjct  320   SDSTSITSTWILSALLNNREAMKHAQEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRL  379

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL-TAAQ  409
             YP  P   PH AT+DC V GY IPKGT L+VNAWK+HRDPR+W  PE F PERFL + A 
Sbjct  380   YPAAPLLVPHEATQDCHVCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHAN  439

Query  408   ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGIT  229
              D     FE IPFG GRR+C G   A+Q+ HLT ARL+QGFD  TPS  P+DM+EG+  T
Sbjct  440   LDVFGHQFELIPFGSGRRACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFT  499

Query  228   LPRATALDVVITPRLPPSFY  169
             +P+ T L V++TPRLP   Y
Sbjct  500   MPKLTPLRVMLTPRLPSHLY  519



>ref|XP_002274509.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=543

 Score =   459 bits (1181),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 243/516 (47%), Positives = 335/516 (65%), Gaps = 23/516 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR  I    +K ++  PE  GA P LGHL +L  G  P+ R L AMADK+G VF +RLG+
Sbjct  48    WRVMILAGKSKGRS-APEPFGAWPFLGHLPIL-RGQTPIFRTLGAMADKHGPVFMIRLGV  105

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +R LVVSS EAVK+CFTTNDKV A+RP  +  K LGYN+A F        WR+MRK ++ 
Sbjct  106   HRALVVSSREAVKECFTTNDKVFASRPSSSAGKILGYNHAGFGFAPYGALWREMRKLSMM  165

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS--SAKTVDMSEWFGQLTLNLIVKIVA  1174
             E+LS+++L+ L+H+++SE++ S+K+LY L   S       V MSEWF  L+ N+++K++A
Sbjct  166   EILSARRLDALKHVQISELDLSIKDLYSLGKGSDWFHPVKVVMSEWFQHLSFNIVLKMIA  225

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+ F      +    +EA+  I   ++ ++L G FV  DA P   V W++ Q   +  
Sbjct  226   GKRY-FNTSGHGN----EEARRAIATIQKLLFLTGAFVLSDAIPG--VEWMDSQG-YLGS  277

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M ++ KE+D+++  W++EH           N  G N  QDFIDVMLS+++D    G  + 
Sbjct  278   MKQVAKEVDSLVGGWVEEH-------EMRLNSEG-NKRQDFIDVMLSVLEDTSMFG--HS  327

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              E +IKAT + +I+ G+DT +   TWLLS ++N+  A+K  +E++D KVG+ RWVE+ DI
Sbjct  328   RETVIKATIMILIVGGTDTVSTTSTWLLSALLNNKHALKCAQEELDLKVGRGRWVEESDI  387

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
              ++ YLQA +KETLRLY   P  APH A EDC V GY IPKGT L+VNAWK+HRDP +W 
Sbjct  388   PNLLYLQAVIKETLRLYTATPLSAPHEAMEDCHVAGYHIPKGTRLFVNAWKLHRDPSVWS  447

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             +PE F PERFLT  A  D   ++FE IPFG GRRSC G T A+++  L + RL+QGFD  
Sbjct  448   DPEDFQPERFLTTHADLDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIGRLLQGFDLS  507

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             TP   P+DM EGL ITL + T L+V++TPRLP  FY
Sbjct  508   TPLNAPVDMREGLSITLAKLTPLEVMLTPRLPSQFY  543



>emb|CDP00859.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   456 bits (1174),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 241/521 (46%), Positives = 340/521 (65%), Gaps = 31/521 (6%)
 Frame = -3

Query  1710  SWRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLG  1531
              W+ +   S  K+K+ PPE +GA P++GHL L  +  I +   LAAMADK G VF++RLG
Sbjct  22    QWKPRSQISDEKRKS-PPEPEGAWPVIGHL-LQMNPKIHVAETLAAMADKNGPVFSIRLG  79

Query  1530  MYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAV  1351
             M  +LVV++WE+VK+CFTTNDK  A+RP  + AKYL Y+YA F +    PYWR +RK  +
Sbjct  80    MLPVLVVNNWESVKECFTTNDKTFASRPPSSFAKYLCYDYAAFGIAPYGPYWRDVRKMVL  139

Query  1350  TELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS-------SAKTVDMSEWFGQLTLNL  1192
              ELLS+Q+LEKL+ +R+SEV+TS+KE+++ I+  +       +   VD+ + F +LTLN+
Sbjct  140   RELLSTQRLEKLKQVRISEVQTSIKEIFLNISEVNKHGNEIKAPARVDLGDVFEKLTLNI  199

Query  1191  IVKIVAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQ  1012
             +++ +AG R+      D D  + ++A+    V KEF       V  D  PF  ++W++ Q
Sbjct  200   VLRKIAGGRYT-----DSDVGKERDAE-FRRVLKEFEAFARILVVSDIIPFRFLKWLDPQ  253

Query  1011  RRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFA  832
               + K M R+ KELD  +Q W+DEH + R K     N    +D  DFIDV+LS I D+  
Sbjct  254   GNI-KSMKRLAKELDKYMQIWVDEHKEGRMK-----NSGDGDDELDFIDVLLSTIKDESI  307

Query  831   RGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERW  652
              G  +  E++IK+T L +I+ G+ TT+  L+W++SL++NH   +++ +E+IDS VGKERW
Sbjct  308   CG--FSKEVVIKSTILVLIVAGTSTTSRALSWVISLLLNHRHVLQKAQEEIDSFVGKERW  365

Query  651   VEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHR  472
             VE+ DIK++ YLQA VKET+RL+PP P   P  A EDC V GY IPKGT LYVN WK+ R
Sbjct  366   VEESDIKNLVYLQAIVKETMRLHPPAPVPMPRQADEDCNVAGYFIPKGTQLYVNVWKIQR  425

Query  471   DPRIWPEPERFMPERFLT----AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVA  304
             DPRIWPEPE+F PERFL+     AQ D   +NFE  PFG GRR C G ++A+QV HLT+A
Sbjct  426   DPRIWPEPEKFFPERFLSGDHAGAQLDFSSQNFELNPFGNGRRICPGMSFALQVMHLTLA  485

Query  303   RLIQGFDFETPSEKPLDMSEGLGITLPRATALDVVITPRLP  181
             RL+Q FD    S+ P+D +   G    +A  L+ ++ PRLP
Sbjct  486   RLLQAFDISRVSDLPVDTAGYEG----KAPPLEALMMPRLP  522



>ref|XP_007047111.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91268.1| Cytochrome P450 [Theobroma cacao]
Length=529

 Score =   456 bits (1173),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 237/519 (46%), Positives = 344/519 (66%), Gaps = 22/519 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             ++SK   +  K+   PP+  GA P++GH+ LLG G     + L AMADKYG VF++RLG 
Sbjct  25    YQSKKASTHGKRCCTPPQAGGALPVIGHMHLLG-GQQLTHKTLGAMADKYGPVFSIRLGS  83

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +R+LV++SWE  K+CFT +DKV + RP  A +K+LGY++A+F       YWR+MRK A  
Sbjct  84    HRVLVLNSWEMAKECFTVHDKVFSTRPSIAASKHLGYDFAMFGFAPYGSYWREMRKIATI  143

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKT---VDMSEWFGQLTLNLIVKIV  1177
             ELLSS +++ L+H+R SEV+T+++ELY    S  SA+T   VDM +WFG LT N+ +++V
Sbjct  144   ELLSSHRIDMLKHIRASEVKTAIRELYKSWLSKGSAETEVFVDMKQWFGDLTHNIALRMV  203

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
              G+R+      + DC+E  +A+   +V ++F+YL G FV  DA PF  + W++FQ    K
Sbjct  204   GGRRY---FGPNADCEE-ADARRCQKVMRDFVYLFGVFVLSDAIPF--LGWLDFQ-GYEK  256

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
              M R  K+LD++++RWL+EH   ++KR S     G  + QDF+DVML++++D    G  +
Sbjct  257   SMKRTAKQLDSLVERWLEEH---KQKRLSGG---GVIEEQDFMDVMLNILEDGKITG--F  308

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
               + I KAT L++I+ GSDTT V LTW LSL++N+P  +KR ++++D  VGK+R +E+ D
Sbjct  309   DADTINKATCLNLILAGSDTTMVTLTWALSLLLNNPRVLKRAQDELDMHVGKDRPLEESD  368

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVG-GYDIPKGTHLYVNAWKVHRDPRI  460
             I ++ YLQ+ VKETLRLYPP P     AA EDC +  GY IP GT L VNAWK+ RD R+
Sbjct  369   ISNLVYLQSIVKETLRLYPPSPIIGLRAALEDCTLSTGYHIPSGTRLMVNAWKIQRDERV  428

Query  459   WPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             WP+P  F PERFLT+ +  D   + FE IPFG GRRSC G + A+++ H  + R +  FD
Sbjct  429   WPDPHDFQPERFLTSHKDMDFRGQTFELIPFGSGRRSCPGTSLALKMVHFILGRFLHSFD  488

Query  282   FETPSE-KPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
                PS+ + +DM+E  G+T  +AT L+V++TPRL    Y
Sbjct  489   VAKPSKLEDVDMTESAGLTNLKATPLEVLVTPRLNSQLY  527



>ref|XP_004510285.1| PREDICTED: uncharacterized protein LOC101505071 [Cicer arietinum]
Length=1052

 Score =   472 bits (1215),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 234/516 (45%), Positives = 345/516 (67%), Gaps = 19/516 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR K   +   K   PP+   A P +GHL LLG+   PL R  A+ ADKYG +F + LG 
Sbjct  554   WRIKKHSNNKLKGKQPPQPSYALPFIGHLHLLGNQ-TPLARIFASFADKYGPIFQIYLGS  612

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             Y  LV+S+ E++K+CFTTNDK++A+RP  +   YLGYNYA F       Y+ K+RK  + 
Sbjct  613   YPALVISNQESIKECFTTNDKILASRPKSSHGIYLGYNYAGFGFAPYGTYFTKLRKLTML  672

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSA-KTVDMSEWFGQLTLNLIVKIVAG  1171
             ELLSS+++E LRHL  SE++T + +L++ +  ++   K V +S+W  +LT N+I K+++G
Sbjct  673   ELLSSRRIESLRHLYESEIDTLVNDLWLYVKDNNKVTKAVVISKWLEKLTFNIITKMISG  732

Query  1170  KRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDM  991
             KR+   +++ DD     EA  I+++ KEFM+++G+FV  D  P  I+ W  F+ +V+K M
Sbjct  733   KRYFEYLQDVDDV----EAHGIVKLIKEFMHISGEFVPSDLIP--IIGWFGFEGQVLKSM  786

Query  990   GRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPP  811
              R+ ++LD ++ RW+DEHV           + G N+  DFIDVMLS+I+DD + G  +  
Sbjct  787   KRVGRDLDKVVGRWVDEHVQKI--------DDGVNEKHDFIDVMLSVIEDDPSSG--HDR  836

Query  810   EIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIK  631
             + IIKA  +++++ GSDTT+  +TW+L++++N+ +A+KR +E+I+  +GK+R VE  DIK
Sbjct  837   DTIIKANIMNLMLAGSDTTSTTMTWILAILLNNTNALKRAQEEINHHIGKKRRVESSDIK  896

Query  630   DMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPE  451
             ++ YLQA +KETLRLYPP P   PH AT+DC + GY++PKGT ++ N WK+HRDP IW E
Sbjct  897   NLVYLQAIMKETLRLYPPGPLLVPHEATKDCYIQGYNVPKGTRVFANVWKLHRDPSIWLE  956

Query  450   PERFMPERFLTAAQADA-PWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFET  274
              E+F PERF+     +     NFEY+PFG GRR+C G+ +A QV  +T+ARLI GFD E 
Sbjct  957   AEKFSPERFINEKNGELYEGHNFEYLPFGLGRRACPGSMFATQVCLITLARLIHGFDLEV  1016

Query  273   PSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYG  166
             P  + +DM EGLGITLP+ T L+V++TPRL    Y 
Sbjct  1017  PMGEDVDMREGLGITLPKLTPLNVILTPRLTYELYN  1052


 Score =   448 bits (1153),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 232/538 (43%), Positives = 342/538 (64%), Gaps = 22/538 (4%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  G+ P +GHL LL S  +P  R  + MA+KYGS+F+LRLG ++ LVVSS E  ++C 
Sbjct  24    PEPCGSLPFIGHLHLL-STQVPYFRTFSTMAEKYGSIFSLRLGCHKTLVVSSREIARECL  82

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             TTNDKV A+RP+ +  +YLGYN A+ +L     YWR MRK +  ELLSS +LEKL H+R 
Sbjct  83    TTNDKVFASRPNISAGRYLGYNNAILALAPYGNYWRDMRKISTLELLSSHRLEKLMHVRD  142

Query  1299  SEVETSLKELYMLITSSSSAKTVD--MSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SE+ + +K+LY  + +++S   ++  +S++   +T N+IV+++AGKRF+ +    +D   
Sbjct  143   SEIFSLVKDLYTFLKNNNSNGLIEVPISKFLDHMTFNIIVRMIAGKRFRGETIYQEDS--  200

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
               EA  +    K+  YL+G FV GDA PF  + W +FQ  V   M R  KE+D IL +W+
Sbjct  201   --EAWRLRNAIKDTTYLSGVFVVGDAIPF--LSWFDFQGHV-GFMKRTFKEMDFILDKWM  255

Query  945   DEHVDARRKRSSAANESGKNDHQ-DFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIID  769
              EH        +  NE     ++ DF+DV++SM D  +     +  EI+IKAT + +I+ 
Sbjct  256   REHY-------TKINEGQHGKYENDFMDVLISMFDG-YDEICGHKREIVIKATTMILILT  307

Query  768   GSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLR  589
              S +TA+ LTW LSL++N+P  +K+ ++++D+ +GK +WV++ +IK+++YLQA +KETLR
Sbjct  308   ASGSTAITLTWALSLLLNNPRVLKQAQQELDNNIGKHKWVQESNIKNLKYLQAIIKETLR  367

Query  588   LYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-A  412
             LYPP P      + +DC V GY +PKGT L +N WK+ RDP IWP P  F PERFLT+  
Sbjct  368   LYPPAPLTGLRESIDDCHVAGYHVPKGTRLLINIWKLQRDPHIWPNPNEFQPERFLTSNG  427

Query  411   QADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
             Q D+   +F ++PF  GRRSC+G+T+ +QV HLT+ARLIQGFD  T     +DMSEG+G+
Sbjct  428   QIDSQHYDFGFVPFSYGRRSCVGSTFGLQVLHLTLARLIQGFDIYTKDGGVVDMSEGVGL  487

Query  231   TLPRATALDVVITPRLPPSFYGL*SSGVNSWPYQWRAVRSSLICVMLFLVSPNKIILL  58
              LP+   L +++ PRLP   Y +  +  NS+ Y  +  R  L   M +  S    I+L
Sbjct  488   ALPKENPLSLMLQPRLPLDLYEI-LNNRNSF-YGPKKTRILLFTKMEYFPSQQTTIVL  543



>ref|XP_007049686.1| Cytochrome P450, family 82, subfamily C, polypeptide 2, putative 
[Theobroma cacao]
 gb|EOX93843.1| Cytochrome P450, family 82, subfamily C, polypeptide 2, putative 
[Theobroma cacao]
Length=590

 Score =   457 bits (1176),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 243/504 (48%), Positives = 326/504 (65%), Gaps = 22/504 (4%)
 Frame = -3

Query  1665  LPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKD  1486
             LP  V G    LG L +L +  + L R LAAMADKYG VFT+R+G+YR L+VS+ EAVK+
Sbjct  106   LPAVVAG---FLG-LLILYNLTVTLARTLAAMADKYGPVFTIRIGIYRTLIVSNHEAVKE  161

Query  1485  CFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHL  1306
             CFTTNDK++A RP      YL Y++A F       YWR+MRK AV ELLS  +L  L H+
Sbjct  162   CFTTNDKILANRPRSNAGTYLAYDHAGFGFAPYGTYWRQMRKLAVLELLSVHRLATLTHV  221

Query  1305  RVSEVETSLKELYMLITSS--SSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDC  1132
             RVSEV+  +K L      S  S  + + +S+    L LN++++ +AG R+      D D 
Sbjct  222   RVSEVDAFIKNLCFFCKKSEQSPNQKISISQRLEVLNLNMMLRTIAGTRYF----SDADG  277

Query  1131  DEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQR  952
             +  KEAQ  +++ KEF YL G     +  PF  ++W++F    VK M RI KE+D++++ 
Sbjct  278   ENDKEAQRAMKLIKEFSYLLGVTALSEVVPF--LKWIDFWGHQVKSMKRISKEMDSLIES  335

Query  951   WLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMII  772
             W+DEH   R K        G  ++QDFIDV+LS I+DD   G  +  E IIKAT   +I 
Sbjct  336   WVDEHKLRRFK-------IGAKNNQDFIDVLLSAIEDDSMFG--HTRETIIKATVTVLIS  386

Query  771   DGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETL  592
              GSD+T+  LTW+LS ++N+ +AMKR +E++D K+G++RWVED DI+ + YLQA +KET 
Sbjct  387   AGSDSTSRTLTWILSNLMNNRNAMKRAQEELDLKIGRDRWVEDCDIEKLVYLQAIIKETF  446

Query  591   RLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAA  412
             RLYP  P   PH A E C++ GY IPKGT L+VN WK+ RDPRIW  PE F PERFLT+ 
Sbjct  447   RLYPAAPLSVPHQAMEYCRISGYHIPKGTRLFVNVWKLQRDPRIWSNPEEFEPERFLTSY  506

Query  411   Q-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLG  235
             Q  D   ++FE IPFG GRRSC G ++A+QV  LT+ARL+QGFD  TP   P+DM+E  G
Sbjct  507   QNVDILGQHFELIPFGSGRRSCPGMSWALQVIRLTIARLLQGFDLATPLNAPVDMTEEPG  566

Query  234   ITLPRATALDVVITPRLPPSFYGL  163
              T+ +AT L +V+TPRLP   Y L
Sbjct  567   GTMSKATPLQLVLTPRLPDHLYQL  590



>ref|XP_010104162.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXB99094.1| Cytochrome P450 82C4 [Morus notabilis]
Length=482

 Score =   453 bits (1166),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 238/500 (48%), Positives = 322/500 (64%), Gaps = 49/500 (10%)
 Frame = -3

Query  1581  LAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCFTTNDKVMAARPDFAV-----------  1435
             +A +ADKYG +F  RLGM  +LV+S++EAVK+CFTTND   A+RP F             
Sbjct  1     MADIADKYGPIFLFRLGMNPVLVISNYEAVKECFTTNDITFASRPSFCAKPSTIRAGAPC  60

Query  1434  ----------------AKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
                               +LGY++A F      PYWR MRK  + ELLS+++LE LRH++
Sbjct  61    GPVQPTPAFMRSWSTHGTHLGYDFAAFGFAPYGPYWRTMRKLVMIELLSNRRLETLRHVQ  120

Query  1302  VSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             VSEVET +  LY     +    T V +SEW    TLN+I +++AGKR+     +      
Sbjct  121   VSEVETLVNGLYGQCKKNGFGPTEVVISEWIEHFTLNIITEMIAGKRYF----DSSGKVV  176

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
               EA+ I +V KE+M ++G F+  D  P  + +WV+F   + K M RI +E+D ++Q W+
Sbjct  177   GGEAERIGKVIKEYMCISGAFIVSDLIP--VPKWVDFNGNL-KAMKRIGREIDVLIQSWV  233

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
             +EH     KRS A+      D QDFID+MLS+I+++    L Y  + IIK T  ++II G
Sbjct  234   EEH-----KRSEAS------DKQDFIDIMLSLIEENHE--LGYARDTIIKGTVSTLIIAG  280

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             SDTTA++LTW+L+L++N+  A+ R +E++D  VGKERWVE  DIK++ YLQA VKETLRL
Sbjct  281   SDTTAINLTWILALLLNNRRALNRAQEELDLIVGKERWVEGSDIKNLVYLQAIVKETLRL  340

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQ  409
             YPP P   PH A EDC V G+ + KGT L+VN WK+HRDP  WP+PE F PERFLT+ A 
Sbjct  341   YPPGPLAVPHQAREDCTVCGFHVRKGTRLFVNLWKLHRDPNTWPDPEAFSPERFLTSHAG  400

Query  408   ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGIT  229
              D   ++FE IPFG GRRSC G  +A+QV+HL +ARL+QGF F T  ++P+DMSEGLGIT
Sbjct  401   IDVLGQHFELIPFGSGRRSCPGMAFALQVTHLALARLLQGFVFATKLDEPVDMSEGLGIT  460

Query  228   LPRATALDVVITPRLPPSFY  169
             LPRAT ++ V+TPRLP   Y
Sbjct  461   LPRATPVEAVLTPRLPAELY  480



>gb|AJD25202.1| cytochrome P450 CYP82U4 [Salvia miltiorrhiza]
Length=522

 Score =   454 bits (1167),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 229/512 (45%), Positives = 327/512 (64%), Gaps = 22/512 (4%)
 Frame = -3

Query  1692  FHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILV  1513
             + S TKK T PPE  GA P++GHL LL  G  P+ R L AMAD++G VF+LRLG +R LV
Sbjct  26    YFSSTKKVTTPPEPPGAWPLIGHLHLL-DGLSPVARTLGAMADRHGPVFSLRLGSHRGLV  84

Query  1512  VSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSS  1333
             VSSWEA+K+C T ND+V A RP  AVAKYLGY  A F L    PYWR +RK    +LL++
Sbjct  85    VSSWEAIKECLTANDRVFATRPSIAVAKYLGYGGASFGLAPYGPYWRDVRKMVTVDLLTA  144

Query  1332  QKLEKLRHLRVSEVETSLKELYMLITSSSSAKT---VDMSEWFGQLTLNLIVKIVAGKRF  1162
             + L+   H+R +EV+  +K+L+ +    +  ++   V +S     LT N+I++++ GKRF
Sbjct  145   RHLDDFSHVRTAEVDGFVKDLHSMCGGGNGGESKMVVALSGRIELLTFNIILRMLVGKRF  204

Query  1161  KFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRI  982
              F   +DD    ++EA       K+ +YL G FVF DA P   + W++     +K M + 
Sbjct  205   SFSKGDDDKNWRFQEA------IKKVLYLGGVFVFSDAIP--SLEWLDIGG-YIKSMKQT  255

Query  981   MKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEII  802
              K++D +L+ W+ E +  R+++ +  +        DF+DVMLS ID +      Y  E +
Sbjct  256   FKQVDNVLEDWVQERIQTRKQKDAQTDS-------DFMDVMLSTIDKNEMMA-GYTRETV  307

Query  801   IKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDME  622
             IKAT L +I+ GS++T+  + W +SL++N+P  MK  +++ID+ +G++R+V++ DI ++ 
Sbjct  308   IKATILMLIMTGSESTSETIIWAISLLLNNPHTMKTAQDEIDNNIGRDRFVQESDINNLT  367

Query  621   YLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPER  442
             YLQA  KETLRLYPP P   P  A EDC +GGY +P+GT L +N WK+HRDP IW  P+ 
Sbjct  368   YLQAIFKETLRLYPPGPLSGPREALEDCHIGGYHVPRGTRLVLNLWKLHRDPNIWFNPDE  427

Query  441   FMPERFLT-AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSE  265
             F PERFL   +Q +   + FE+IPF  GRR C G T+ +QV HLT+ARL+Q FDF  P+ 
Sbjct  428   FRPERFLNEKSQMNFKGQYFEFIPFSSGRRMCPGMTFGLQVIHLTLARLLQSFDFSMPNG  487

Query  264   KPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             + +DM EGLGI LP+   LDVV+TPRLP   Y
Sbjct  488   ETVDMGEGLGIALPKLKPLDVVLTPRLPKKLY  519



>ref|XP_007222622.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
 gb|EMJ23821.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
Length=525

 Score =   453 bits (1166),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 238/510 (47%), Positives = 319/510 (63%), Gaps = 25/510 (5%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAV  1492
             K +P E  GA PI GHL LLG G  P   KLAAMADKYG +FT+RLG+Y  LV+SS E  
Sbjct  33    KLVPTEAKGAWPIFGHLPLLG-GSTPPHIKLAAMADKYGPLFTIRLGVYPSLVISSSEIA  91

Query  1491  KDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLR  1312
             K+CFTTND V+ +RP  AV  ++GYN A+F      P+WR+MRK    ELLS+++LE LR
Sbjct  92    KECFTTNDLVLNSRPKLAVVDHIGYNCAMFGFAPSGPFWREMRKITTLELLSNRRLELLR  151

Query  1311  HLRVSEVETSLKELYMLITSS-------SSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFK  1153
             H+RVSEV T L+EL+   +++       S    V++ +WFG +TLN+I+++VAGKR+   
Sbjct  152   HIRVSEVTTFLQELFKTWSTAEKRESNNSDGVLVELKQWFGDMTLNVILRMVAGKRYSVA  211

Query  1152  VKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKE  973
               ED    E  EA+ +    KEF Y  G FV GDA P+  +RW++      K M RI KE
Sbjct  212   ADED----EKTEARRVQSALKEFFYYVGLFVVGDAVPY--LRWLDLGGHE-KAMKRIAKE  264

Query  972   LDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKA  793
             LD I+  W++EH   RR R  A  E       DFID MLS++D     G  +  + + KA
Sbjct  265   LDAIVGGWVEEH-KRRRARGDAKGEP------DFIDAMLSVLDGADLGG--FDADTVNKA  315

Query  792   TGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQ  613
             T L+MI  GSDTT V L W +SL++N+P  +K  + ++D+++G++R V + DI  + Y+Q
Sbjct  316   TSLNMIAGGSDTTMVTLIWAISLLLNNPHVLKSAQNELDTEIGRQRVVSESDISKLVYIQ  375

Query  612   AAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMP  433
             A VKETLRLYP  P   P   T+DC +GGY + KGT L  N WK+  DPRIWP+P  F P
Sbjct  376   AIVKETLRLYPAAPLSGPREFTKDCTIGGYHVSKGTRLITNLWKIQTDPRIWPDPLEFKP  435

Query  432   ERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPL  256
             ERFLT+ +  D    +FE IPFG GRR+C G  +A+Q+   T+A  +  FD   PS  P+
Sbjct  436   ERFLTSHRDVDVKGLHFELIPFGSGRRACPGLAFALQMVQFTLASFVHAFDISNPSNSPI  495

Query  255   DMSEGLGITLPRATALDVVITPRLPPSFYG  166
             DM+E  G+T  +AT L V+I PRLP   YG
Sbjct  496   DMTESFGLTNIKATPLQVLIKPRLPSQLYG  525



>emb|CDP15728.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   452 bits (1163),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 232/503 (46%), Positives = 323/503 (64%), Gaps = 20/503 (4%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA P +GHL  LG G +PL R L +MADK+G +F+LRLG    +VVSSWE VKDCF
Sbjct  40    PEPPGALPFIGHLHHLG-GQLPLARILGSMADKHGPIFSLRLGSRPAIVVSSWEMVKDCF  98

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             TTNDK  A+RP+ AVAKY+G N A+FSL    PYWR +RK    ELL++Q+LEKL+H+R 
Sbjct  99    TTNDKTFASRPNMAVAKYMGNNNAIFSLAPYGPYWRDVRKMVTLELLTNQRLEKLKHVRA  158

Query  1299  SEVETSLKELYMLITSSSSAKT-----VDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDD  1135
             SE    +++LY L + +          V ++EWF  LT NLI++++ G+ F    + +D+
Sbjct  159   SEFNKWIRDLYSLCSKNDRPDVDVPTKVVLNEWFELLTFNLILRMLVGRPFSTSSQGNDN  218

Query  1134  CDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQ  955
                  E + + E  K+ +YL+G FVF D  P WI  W++    + K M +  KELD +L 
Sbjct  219   S----EDRRLKEAIKKALYLSGVFVFSDVIP-WI-EWLDIGGHI-KSMKKAGKELDEVLG  271

Query  954   RWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMI  775
             +WL EH+  + K+S   +E+      DF+DVMLS I +       +  + IIK+T  ++I
Sbjct  272   QWLQEHIQ-KAKQSHPESEAV----HDFMDVMLSTIPE-IGEISGHKRDAIIKSTTATLI  325

Query  774   IDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKET  595
             + GS++TA  L W LSL++NHP+ +K  + ++D +VGK+RW+E+ DIK++ +LQA VKET
Sbjct  326   LTGSESTAETLIWALSLLLNHPNILKIAQNELDVQVGKQRWIEEADIKNLSFLQAIVKET  385

Query  594   LRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA  415
              RLYPP P   P  ATEDC +G + +PKG  L VN WK+HRDPRIW +P  F PERF+ +
Sbjct  386   FRLYPPGPLSGPREATEDCYLGNFFVPKGARLIVNLWKLHRDPRIWSDPLEFKPERFMNS  445

Query  414   AQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
              +      ++FEYIPF  GRR C    Y M V  LT+AR++Q FD  TP   P+DM EGL
Sbjct  446   HENISLKGQSFEYIPFSSGRRMCPAVNYGMNVVQLTLARMLQAFDITTPMGMPVDMGEGL  505

Query  237   GITLPRATALDVVITPRLPPSFY  169
             G+ LP+   L+V++TPRLP   Y
Sbjct  506   GVALPKLKPLEVLLTPRLPVELY  528



>ref|XP_006342717.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=527

 Score =   452 bits (1162),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 232/501 (46%), Positives = 323/501 (64%), Gaps = 10/501 (2%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA PI+GHL LLG     L R L AMAD YG  F LRLG  R  VVSSWE  K+CF
Sbjct  33    PEPAGAWPIIGHLHLLGGTEQLLYRTLGAMADNYGPAFNLRLGTRRAFVVSSWEMAKECF  92

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP    AK++GY YAVF     SP+WR+MRK A+ ELLS+++L+ L++++V
Sbjct  93    TLNDKALASRPTTVAAKHMGYGYAVFGFAPYSPFWREMRKIAMFELLSNRRLDALKYVQV  152

Query  1299  SEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SEV+  ++ELY L   ++S +   V++  WF  LTLN+IV++VAGKR+         CD 
Sbjct  153   SEVDIGIQELYKLWVDNNSDRPILVELKRWFEDLTLNVIVRMVAGKRY---FGAGATCDN  209

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
               EA+   +   +F +L G FV  DAFP  I+ W +      K M +  KELD IL+ WL
Sbjct  210   DDEARRCQKAINQFFHLIGIFVPSDAFP--ILGWFDINGHE-KAMKKTAKELDFILEGWL  266

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
              EH + R+  S     +  +  QDFIDVMLS+ ++       Y  +  IK+T L++I+ G
Sbjct  267   KEHREKRKCTSIEVKSTTDSAVQDFIDVMLSLEEEGRLSNFPYDADTSIKSTCLALILGG  326

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             SDTTA  LTW +SL++N+P  + + +E+ID  VGK R +++ DI ++ Y+QA +KETLRL
Sbjct  327   SDTTAGTLTWAISLLLNNPKILTKAQEEIDLHVGKNRQIDESDINNLIYIQAIIKETLRL  386

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQA  406
             YP  P   P  A ++C++ GY I  GT L VN WK+ RDPRIW +P+ F P+RFL  +  
Sbjct  387   YPAGPLLGPREAMDNCEISGYKITPGTRLIVNVWKIQRDPRIWEDPDCFNPDRFLM-SNV  445

Query  405   DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSE-KPLDMSEGLGIT  229
             D   ++FE IPFG GRRSC G + A+QV HLT+AR++  F+F  P + +P+D++E  G+T
Sbjct  446   DVKGKDFELIPFGSGRRSCPGASLALQVLHLTLARILHAFEFTKPIDGQPIDLTESPGLT  505

Query  228   LPRATALDVVITPRLPPSFYG  166
             +P+AT LDV+I PRL  + YG
Sbjct  506   IPKATPLDVLIAPRLSANLYG  526



>ref|XP_004252778.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=527

 Score =   451 bits (1161),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 230/501 (46%), Positives = 325/501 (65%), Gaps = 10/501 (2%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA PI+GHL LLG     L R L AMAD YG  F LRLG  R  VVSSWE  K+CF
Sbjct  33    PEPAGAWPIIGHLPLLGGTDQLLYRTLGAMADNYGPAFNLRLGTRRAFVVSSWEMAKECF  92

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP    AK++GY YAVF     SP+WR+MRK A+ ELLS+++L+ L++++V
Sbjct  93    TLNDKALASRPTTVAAKHMGYGYAVFGFAPYSPFWREMRKIAMFELLSNRRLDTLKYVQV  152

Query  1299  SEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SEV+  ++ LY L   ++S +   V++  WF  LTLN+IV++VAGKR+         CD 
Sbjct  153   SEVDMGIQALYKLWVDNNSDRPILVELKRWFEDLTLNVIVRMVAGKRY---FGAGATCDN  209

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
               EA+   +   +F +L G FV  DAFP  I+ +++      K M +  KELD IL+ WL
Sbjct  210   DDEARRCQKAINQFFHLIGIFVPSDAFP--ILGFLDINGHE-KAMKKTAKELDFILEGWL  266

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
              EH + R+  S  A  +  +  QDFIDVMLS+ ++       Y  +  IK+T L++I+ G
Sbjct  267   KEHREKRKCTSIEAKSTTDSAVQDFIDVMLSLEEEGRLSNFPYDADTSIKSTCLALILGG  326

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             SDTTA  LTW +SL++N+P  +++ +E+ID+ +GK R +++ DI ++ Y+QA +KETLRL
Sbjct  327   SDTTAGTLTWAISLLLNNPKILRKAQEEIDNHIGKNRQIDESDINNLIYIQAIIKETLRL  386

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQA  406
             YP  P   P  A ++C++ GY I  GT L VN WK+ RDPRIW  P  F P+RFLT +  
Sbjct  387   YPAGPLLGPREAMDNCEISGYKITPGTRLIVNVWKIQRDPRIWENPNCFNPDRFLT-SNV  445

Query  405   DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETP-SEKPLDMSEGLGIT  229
             D   ++FE IPFG GRRSC G + A+QV HLT+AR++  F+F  P  ++P+D++E  G+T
Sbjct  446   DVKGKDFELIPFGSGRRSCPGASLALQVLHLTLARILHAFEFTKPIDDQPIDLTESPGLT  505

Query  228   LPRATALDVVITPRLPPSFYG  166
             +P+AT LDV++ PRL  + YG
Sbjct  506   IPKATPLDVLVAPRLSANLYG  526



>ref|XP_010547839.1| PREDICTED: cytochrome P450 82C4-like [Tarenaya hassleriana]
Length=501

 Score =   450 bits (1158),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 234/503 (47%), Positives = 319/503 (63%), Gaps = 17/503 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  G+ P++GHL LLG     L R L AMAD +G     R+G  R  VVSSWE  K+CF
Sbjct  12    PEPAGSWPVIGHLHLLGGKEQLLYRTLGAMADDHGPASPRRVGSRRAFVVSSWEVAKECF  71

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP    +K++GYNYAVF     S +WRKMRK A  ELLS+++L+ L+H+R+
Sbjct  72    TVNDKALASRPMTVASKHMGYNYAVFGFAPYSSFWRKMRKIATVELLSNRRLQMLKHVRI  131

Query  1299  SEVETSLKELYMLIT--SSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SE+ T +K+L+ L +    SS   VD+  W   + LN+IVK+VAGKR+     + +D +E
Sbjct  132   SEISTGIKDLHGLWSKKGGSSPVLVDLKRWLEDMNLNMIVKMVAGKRYFGSSAKMEDAEE  191

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
              ++ Q  I     F +L G FV  DA PF  + W + Q    K+M +   ELD IL+RW+
Sbjct  192   ARQCQRAI---ARFFHLIGIFVVSDALPF--LGWFDLQGHE-KEMRKTASELDGILERWI  245

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
             DEH   +R+R S  +E       DFIDVMLS+  +     L Y P   IK+T L++I+ G
Sbjct  246   DEH---QRRRVSGQSEG----DSDFIDVMLSLEGEGKLSDLQYDPRTSIKSTCLALILGG  298

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             SDTTA  LTW ++L++N+ + +K+ +E+ID  VGK R VED DI+++ YLQA +KETLRL
Sbjct  299   SDTTAGTLTWAIALLLNNREMLKKAQEEIDIHVGKNRQVEDSDIENLVYLQAIIKETLRL  358

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQA  406
             YP  P   P  A EDC V GY +  GT L VN WK+ RDP++W  PE F PERFLT  + 
Sbjct  359   YPAGPLLGPREAMEDCTVAGYQVAAGTRLIVNVWKIQRDPKVWRNPEEFRPERFLTGKET  418

Query  405   --DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
               D   +NFE +PFG GRRSC G + A+QV HL++AR++  FD  T S+  +DM E  G+
Sbjct  419   EYDVRGQNFELMPFGSGRRSCPGASLALQVLHLSLARVLHSFDLLTVSDSEVDMRESPGL  478

Query  231   TLPRATALDVVITPRLPPSFYGL  163
             T+P+AT L+V++TPRL    Y L
Sbjct  479   TIPKATPLEVLLTPRLEQELYEL  501



>emb|CAN61061.1| hypothetical protein VITISV_018742 [Vitis vinifera]
Length=542

 Score =   451 bits (1160),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 245/540 (45%), Positives = 334/540 (62%), Gaps = 47/540 (9%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR       +K ++  PE  GA P LGHL LL  G  P+ R L AMADK+G VF +RLG+
Sbjct  23    WRVMTLAGKSKGRS-APEPSGAWPFLGHLPLL-RGQTPIFRTLGAMADKHGPVFMIRLGV  80

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +R LVVSS EAVK+CFTTNDKV A+RP  +  K LGYNYA F        WR+MRK ++ 
Sbjct  81    HRALVVSSREAVKECFTTNDKVFASRPSSSAGKLLGYNYAGFGFAPYGALWREMRKLSMM  140

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVD--MSEWFGQLTLNLIVKIVA  1174
             E+LS+++L+ L+H+++SE++ S+K+LY L   S     V   MSEWF  L+ N+++K++A
Sbjct  141   EILSARRLDALKHVQISELDLSIKDLYSLGKGSDWVHPVKVVMSEWFQHLSFNIVLKMIA  200

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+      +      +EA+  I   +EF+ L+G FV  DA P   V W++ Q   +  
Sbjct  201   GKRYF-----NTSGHGIEEARRAIATIQEFLSLSGAFVLSDAIPG--VEWMDLQG-YLGS  252

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M R+ KE+D+++  W++EH           N  G    QDFIDVMLS+++D    G  + 
Sbjct  253   MKRVAKEVDSLVGGWVEEH-------EIRLNSEGSR-MQDFIDVMLSVLEDTSMFG--HS  302

Query  813   PEIIIKATGLS------------------------MIIDGSDTTAVHLTWLLSLIVNHPD  706
              E +IKAT +                         +I+ G++T A   TWLLS ++N+  
Sbjct  303   RETVIKATIVVRSSPIHELLLLSWKSVFLQPTLKILIVGGTETVATTSTWLLSALLNNKH  362

Query  705   AMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGG  526
             A+KR +E++D KVG+ RWVE+ DI ++ YLQA +KETLRLY   P   PH A EDC V G
Sbjct  363   ALKRAQEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAG  422

Query  525   YDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSC  349
             Y IPKGT L+VNAWK+HRDP +W +PE F PERFLT+ A  D   ++FE IPFG GRRSC
Sbjct  423   YHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPERFLTSHADFDVLGQHFELIPFGSGRRSC  482

Query  348   IGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              G T A+++  L + RL+QGFD  TP   P+DM EGL ITL + T L+V++TPRLP  FY
Sbjct  483   PGITMALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVILTPRLPSQFY  542



>gb|KHG07864.1| Cytochrome P450 protein [Gossypium arboreum]
Length=515

 Score =   450 bits (1157),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 229/503 (46%), Positives = 324/503 (64%), Gaps = 20/503 (4%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
             KK   PE  G+ P++GHL LLG G  P+ + LA MADK+G +++L+LG +RILVVSSWE 
Sbjct  29    KKNCIPEPTGSLPLIGHLHLLG-GKEPICKNLATMADKHGPLYSLKLGTHRILVVSSWEI  87

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKL  1315
              KDCFT ND+ +A R +    +Y+GY+ A+FSL     YWR +RK A  ELLSS +LEKL
Sbjct  88    AKDCFTNNDRTLATRANIVAGRYMGYDNAIFSLAPYGEYWRNIRKMATVELLSSHRLEKL  147

Query  1314  RHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDD  1135
             +H+R SE+++ +KELY L   S +   V +SE   +LT N+ ++++ GKRF      + D
Sbjct  148   KHIRFSEMDSFIKELYGL---SRNGDKVTISEALERLTFNINLRMLFGKRFSGNDYGEVD  204

Query  1134  CDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQ  955
              + ++     ++  K  +YL G FV  DA   W+ R+ + Q  V + M    KELD+I+ 
Sbjct  205   SEPWR----FMKAIKRALYLFGIFVLPDALQ-WLERF-DIQGHV-RSMKENAKELDSIIN  257

Query  954   RWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMI  775
              WL+EH+  +R+   A+         DF+DVML+ + +D      +  + I+KAT L + 
Sbjct  258   VWLEEHLKKKRENQGASE-------SDFMDVMLTHLREDTVIS-GHTRDTIVKATTLVLS  309

Query  774   IDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKET  595
             + G ++T+V +TW+LSL++NHP+ +   +E+ID  VGK+RWVE+ DIK+++YLQA VKET
Sbjct  310   LTGGESTSVTITWVLSLLLNHPNVLITAQEEIDHHVGKQRWVEESDIKNLKYLQAIVKET  369

Query  594   LRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA  415
             LRLYPP P      A +DC + GYD+PKGT L VN WK+HRDPR+W     F PERF+T 
Sbjct  370   LRLYPPGPITGIREAMQDCCIAGYDVPKGTRLIVNIWKLHRDPRVWENANEFHPERFMTT  429

Query  414   -AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
                 D   +NFEY+PF  GRRSC G T+ +QV HLTV++LIQGFD        +DM EGL
Sbjct  430   HVDFDVKGQNFEYMPFSSGRRSCPGMTFGLQVVHLTVSKLIQGFDIRVAEGTAVDMEEGL  489

Query  237   GITLPRATALDVVITPRLPPSFY  169
             G+ LP+   L+VV++PRL   FY
Sbjct  490   GLALPKLNPLEVVLSPRLGTEFY  512



>emb|CBI29738.3| unnamed protein product [Vitis vinifera]
Length=727

 Score =   457 bits (1175),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 235/495 (47%), Positives = 319/495 (64%), Gaps = 23/495 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR K   +   K   PPE  GA P +GHL LL  G +P+ R L AMADK G VF +RLGM
Sbjct  24    WRGKTL-THKSKGMSPPEPSGAWPFVGHLHLL-HGKVPVFRTLGAMADKVGPVFVIRLGM  81

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             YR LVVS+ EA K+CFTTNDK+ A+RP+ + AK LGYNYA F+     PYWR+MRK ++ 
Sbjct  82    YRTLVVSNREAAKECFTTNDKIFASRPNSSAAKILGYNYAAFAFAPHGPYWREMRKLSML  141

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS--SAKTVDMSEWFGQLTLNLIVKIVA  1174
             E+LS+++L  L H++VSE+   +K+LY+L   ++  + K V +SEWF  LT N+++++VA
Sbjct  142   EILSTRRLGDLMHVQVSELHAGIKDLYILGKDNNWVNPKKVVISEWFEHLTFNVVLRMVA  201

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+   V    +     EA+  I   K+ + L G  V  D  PF  + WV+ Q  +   
Sbjct  202   GKRYFNNVVHGGE-----EARSAIAAIKKVLLLVGASVASDVIPF--LEWVDLQGHL-SS  253

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M  + KE+D++++ W+ EH       +S++         DFID+ML+ + D  A    Y 
Sbjct  254   MKLVAKEMDSLIESWVKEHTGRLNSEASSS--------LDFIDIMLTKLKD--ASLFGYS  303

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              E IIKAT L+MI+ GSDTT++  TWLLS ++N+   MK  +E++D KVG++RWVE  DI
Sbjct  304   RETIIKATVLTMIVAGSDTTSLTSTWLLSALLNNKHVMKHAQEELDLKVGRDRWVEQSDI  363

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             +++ Y++A VKETLRLY   P   PH A EDC VGGY I KGT L VNAWK+HRDP +W 
Sbjct  364   QNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCHVGGYHISKGTRLLVNAWKLHRDPAVWS  423

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
              PE F PERFLT+ A  D   ++FE IPFG GRRSC G    +Q+ HLT+ARL+QGFD  
Sbjct  424   NPEEFQPERFLTSHANVDVFGQHFELIPFGSGRRSCPGLNMGLQMLHLTIARLLQGFDMT  483

Query  276   TPSEKPLDMSEGLGI  232
              PS  P+DM+EG+ I
Sbjct  484   KPSNSPVDMTEGITI  498


 Score =   159 bits (402),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 127/215 (59%), Gaps = 21/215 (10%)
 Frame = -3

Query  1095  FKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLDEHVDARRKR  916
              K+ + L G FV  D  PF  + WV+ Q  +   M ++ KE+D++L+ W++EH       
Sbjct  498   IKKLVPLAGAFVASDLIPF--LEWVDLQGHL-SSMKQVAKEMDSVLESWVEEHTGRLNTE  554

Query  915   SSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGSDTTAVHLTW  736
             +S+         QDFID+ML+ + D  A    Y  E IIKAT L +I+ GSDTT++  TW
Sbjct  555   ASS--------RQDFIDIMLTKLKD--ASLFGYSRETIIKATVLILIVVGSDTTSITSTW  604

Query  735   LLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLYPPLPTYAPH  556
             LLS ++N+   MK  +E++D KVG++RWVE  DI+++ YL+A VKETLRL P +P   P 
Sbjct  605   LLSALLNNRHVMKHAQEELDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLCPAIPLLVPL  664

Query  555   AATEDCKVG------GYDIPKGTHLYVN--AWKVH  475
              A ED  VG      GY IPKGT L  +   W VH
Sbjct  665   EAMEDYHVGYHSNSPGYHIPKGTRLLSHFLLWNVH  699



>ref|XP_007017417.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
 gb|EOY14642.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
Length=528

 Score =   450 bits (1157),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 239/503 (48%), Positives = 322/503 (64%), Gaps = 22/503 (4%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GARP LGHL LLG G  P    L  +AD YG +FT+RLG+   LVVS+WE  K+CF
Sbjct  42    PEASGARPFLGHLHLLG-GSKPAHVVLGDLADTYGPIFTIRLGVRLTLVVSNWEIAKECF  100

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             TTNDK  A RP    A+ LGYNYA+F      PYWR++RK    E+LS+ +LEKL+H+R 
Sbjct  101   TTNDKAFANRPRTLAAELLGYNYAMFGFSPYGPYWRQIRKIVTLEVLSNHRLEKLKHIRE  160

Query  1299  SEVETSLKELYML----ITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDD  1135
             SEV TS+KELY L    +++SSS K  V+M  WF  L +N++ K+V GKR+     E + 
Sbjct  161   SEVRTSIKELYKLGVEGVSNSSSGKVLVEMKRWFWTLNINMVFKMVVGKRYS----EAET  216

Query  1134  CDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQ  955
                  E     +  ++F  L G F  GD+ PF  +RW++      K M +  KELD IL+
Sbjct  217   SHGKDENDRRRKALRDFFELTGTFTVGDSLPF--LRWLDLGGHE-KAMKKTAKELDHILE  273

Query  954   RWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMI  775
              WL+EH   ++KR+S   ES      DF+ +MLS+++D  A   +Y  + I KAT LS+I
Sbjct  274   EWLEEH---KQKRNSGNAES----EHDFMGMMLSLLNDA-AELPSYDADTINKATCLSLI  325

Query  774   IDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKET  595
             +  SDTT V LTW LSL++N+ +A+K+ +E++D  VG+++ VE+ DIK + YLQA +KET
Sbjct  326   LAASDTTMVTLTWALSLLLNNRNALKKAQEELDIHVGRDKLVEESDIKKLVYLQAIIKET  385

Query  594   LRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA  415
             LRLYP  P   PH + EDC V GY IP GT L +N +K+HRDP  W +P  F PERFLT 
Sbjct  386   LRLYPAAPLSVPHESMEDCVVSGYHIPAGTRLLINLYKIHRDPHAWSDPCEFQPERFLTT  445

Query  414   AQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
              +  D   +NFE IPFG GRR C G + A+QV  LT+A L+QGF+  TP ++P+DM E +
Sbjct  446   YKDFDVRGQNFELIPFGSGRRMCPGVSLALQVLELTLANLLQGFELGTPLDEPVDMGEAI  505

Query  237   GITLPRATALDVVITPRLPPSFY  169
             GIT  + + L+V+ITPRLP   Y
Sbjct  506   GITNLKVSPLEVLITPRLPAVCY  528



>ref|XP_002531093.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31307.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 231/516 (45%), Positives = 335/516 (65%), Gaps = 19/516 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WRS    S +K   +P E  GA P++GH  LL     P  R L  +ADK G +++LRLG+
Sbjct  21    WRSLARKSKSKNINVP-EPTGAWPLIGHFHLLARQE-PACRILGDIADKTGPLYSLRLGI  78

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
              RI+V S WE VK+CFTTND++ A R   A  KY+GYN A+F+L     YWR +RK A  
Sbjct  79    NRIMVASGWEVVKECFTTNDRIFATRASIAAGKYIGYNNAIFALAPYGQYWRDVRKLATL  138

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSS--SSAKTVDMSEWFGQLTLNLIVKIVA  1174
             +LLSS +LEKL+H+R+SEV+T LK+L+ L   S  S+   V ++  F +LT N+ ++++ 
Sbjct  139   KLLSSNRLEKLKHVRLSEVDTFLKDLHNLYVESADSNHAKVIINTLFERLTFNISLRMIV  198

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GK+F      +++ + ++  + I    +E +YL+G FV  DA P+  + W++ Q  +   
Sbjct  199   GKQFSSSTYGEENSEPWRYKKAI----EEAVYLSGTFVMSDAIPW--LEWIDHQGHI-SA  251

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M R  KELD +++ WL+EH+   +KRSS     G+ND   F+DVMLS +D+D      + 
Sbjct  252   MKRTAKELDAVIETWLEEHI---KKRSSDECHKGEND---FMDVMLSDLDEDAVMS-GHS  304

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              + +IKAT + + + GS +TAV LTW LSL++N+P  +K  +E++D  VG+E+WV++ DI
Sbjct  305   RDTVIKATAMILTLTGSGSTAVTLTWALSLLLNNPGVLKAAQEELDIHVGREKWVQESDI  364

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             ++++YLQA VKETLRLYPP P      A+EDC +GGY +PKGT L +N W++ RDPR+W 
Sbjct  365   ENLKYLQAIVKETLRLYPPGPLTGIREASEDCNLGGYFVPKGTRLIINIWQLQRDPRVWK  424

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             +P  F PERFLT  +  D   +NFE+IPF  GRRSC   T+ +QV HLT+AR++QGFD  
Sbjct  425   DPGEFQPERFLTTHSDVDFRGQNFEFIPFSSGRRSCPAITFGLQVVHLTLARVLQGFDLT  484

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             T    P+DM+EGLGI LP+   ++V+I PRL    Y
Sbjct  485   TIGGLPVDMTEGLGIALPKVNPVEVIIKPRLGLELY  520



>ref|XP_011008137.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
Length=516

 Score =   449 bits (1154),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 230/515 (45%), Positives = 325/515 (63%), Gaps = 15/515 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             W+    +S +KK T  PE  GA P+ GHL  L  G  P  + L A+ADKYG +++L+ G+
Sbjct  15    WKILARNSESKKSTRAPEPSGAWPLFGHLPSL-VGKDPACKTLGAIADKYGPIYSLKFGI  73

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +R LVVSSWE VKDC  TND+V+A R   A  K++ YN A F+L T   YWR +RK A  
Sbjct  74    HRTLVVSSWETVKDCLNTNDRVLATRAGIAAGKHMFYNNAAFALATYGQYWRDVRKLATL  133

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSS-SSAKTVDMSEWFGQLTLNLIVKIVAG  1171
             +LLS+Q+LE L+H+RVSEV+T +K L+     S  S   V++S+    LT N+ ++ + G
Sbjct  134   QLLSNQRLEMLKHVRVSEVDTFIKGLHSFYAGSVDSPAKVNISKLLESLTFNINLRTIVG  193

Query  1170  KRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDM  991
             KR+     + ++ + ++  + I    K+ +YL+G FV  DA PF  + W+++Q  V   M
Sbjct  194   KRYCSSTYDKENSEPWRYKKAI----KKALYLSGIFVMSDAIPF--LEWLDYQGHV-SAM  246

Query  990   GRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPP  811
              +  KELD +++ WLDEH+     +     E G +   DF+DVM+S + +   +   Y  
Sbjct  247   KKTAKELDAVIRNWLDEHL-----KKKIDGELGSDRESDFMDVMISNLAEGPDKISGYSR  301

Query  810   EIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIK  631
             +++IKAT L + + G+ +TA  L W LSL++N+P  +K  +E++D +VG+ERWVE+ DI+
Sbjct  302   DVVIKATALILTLTGAGSTATTLVWTLSLLLNNPTVLKAAQEELDKQVGRERWVEESDIQ  361

Query  630   DMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPE  451
             D++YLQA VKETLRLYPP P      A EDC +GGYD+PKGT L VN WK+HRDPR+W  
Sbjct  362   DLKYLQAIVKETLRLYPPGPLTGIREAMEDCSIGGYDVPKGTRLVVNIWKLHRDPRVWKN  421

Query  450   PERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFET  274
             P  F P+RFLT  A  D   +N E+IPF  GRRSC      + V HLT+AR++QGFD  T
Sbjct  422   PNEFKPDRFLTTHADLDFRGQNMEFIPFSSGRRSCPAINLGLIVVHLTLARILQGFDLTT  481

Query  273   PSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              +  P+DM EG GI LP+ T L+VVI PRL    Y
Sbjct  482   VAGLPVDMIEGPGIALPKETPLEVVIKPRLGLELY  516



>gb|KHG29587.1| Cytochrome P450 protein [Gossypium arboreum]
Length=521

 Score =   449 bits (1154),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 226/503 (45%), Positives = 330/503 (66%), Gaps = 20/503 (4%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
             KK+  PE  G+ P++GHL LLG G  P+ +KLA MADK+G +++L+LG +R+LVVSSWE 
Sbjct  29    KKSCIPEPSGSLPLIGHLHLLG-GKEPICKKLATMADKHGPLYSLKLGTHRVLVVSSWEI  87

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKL  1315
              KDCFT ND+ +A R   A  +++GYN AV +L     YWR +RK A  ELLSS +LEKL
Sbjct  88    AKDCFTDNDRTLATRASIAAGRHMGYNNAVMALAPYGEYWRNIRKIATVELLSSHRLEKL  147

Query  1314  RHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDD  1135
             +H+R SE+++ +KELY L   S +   V ++E   +LT N+ ++++ GKRF     E+ +
Sbjct  148   KHIRFSEMDSFIKELYGL---SRNGAKVTINEALERLTFNINLRLLVGKRFSGCDYEEVN  204

Query  1134  CDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQ  955
              + ++  + I    K  ++L+G FV  DA P+  + W++ Q  V + M +  KELD+++ 
Sbjct  205   SEPWRYGKAI----KRALHLSGVFVLADALPY--LEWLDIQGHV-RSMKKTAKELDSVIS  257

Query  954   RWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMI  775
              WL+EH+    K+  A   + +ND   F+DVML+ + +D      +  + I+KAT L + 
Sbjct  258   VWLEEHL----KKKKANQGTSEND---FMDVMLNHLPEDTVIS-GHNRDNIVKATTLILS  309

Query  774   IDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKET  595
             + G ++T+V +TW+LSL++NHP  +   ++++D  VGK+RWVE+ DIK+++YLQA VKET
Sbjct  310   LTGGESTSVTITWVLSLLLNHPKILMAAQQELDLHVGKQRWVEESDIKNLKYLQAIVKET  369

Query  594   LRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA  415
             LRLYPP P      AT+DC++ GYD+ KGT L VN WK+ RDPR+W   + F PERF+T 
Sbjct  370   LRLYPPGPITGIREATKDCRIAGYDVSKGTRLIVNLWKLQRDPRVWENADEFRPERFMTT  429

Query  414   -AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
                 D   +NFEY+PF  GRRSC G T+ +QV HL VA+LIQGFD +T     +DM EGL
Sbjct  430   HVDFDVRGQNFEYMPFSSGRRSCPGITFGLQVVHLMVAKLIQGFDIKTAEGTAVDMEEGL  489

Query  237   GITLPRATALDVVITPRLPPSFY  169
             G+ LP+   +DVV+ PRL   FY
Sbjct  490   GLALPKLNPIDVVLRPRLRTEFY  512



>emb|CDP15727.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   451 bits (1159),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 230/503 (46%), Positives = 321/503 (64%), Gaps = 20/503 (4%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA P +GHL  LG G +PL R L +MADKYG  F+LRLG    +VVSSWE VK+CF
Sbjct  87    PEAPGALPFIGHLHHLG-GQLPLARILGSMADKYGPTFSLRLGSRPAIVVSSWEMVKECF  145

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK  A+RP+ A+AKY+G N A+F+L    PYWR +RK    ELL++Q+LEKL+H+R 
Sbjct  146   TINDKTFASRPNTALAKYMGNNNAIFALAPYGPYWRDVRKMVTLELLTNQRLEKLKHVRA  205

Query  1299  SEVETSLKELYMLITSSSSAKT-----VDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDD  1135
             SE    +++LY L + +          V ++EWF  LT NLI++++ G+ F    + +D+
Sbjct  206   SEFNKWIRDLYSLCSKNDRPDVDVPTKVVLNEWFELLTFNLILRMLVGRPFSTSSQGNDN  265

Query  1134  CDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQ  955
              ++    + + E  K+ +YL G FVF D  P WI  W++    + K M +  KELD +L 
Sbjct  266   SED----RRMKEAIKKMLYLGGVFVFSDVIP-WI-EWLDIGGHI-KSMKKAGKELDEVLG  318

Query  954   RWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMI  775
             +WL EH+  + K+S   +E+      DF+DVMLS I +       +  + IIK+T  ++I
Sbjct  319   QWLQEHIQ-KAKQSHPESEAV----HDFMDVMLSTIPET-GEISGHKRDAIIKSTTATLI  372

Query  774   IDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKET  595
             + GS++TA  L W LSL++NHP+ +K  + ++D +VGK+RW+E+ DIK++ +LQA VKET
Sbjct  373   MTGSESTAETLIWALSLLLNHPNILKIAQNELDVQVGKQRWIEEADIKNLSFLQAIVKET  432

Query  594   LRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA  415
              RLYPP P   P  ATEDC +G + +PKG  L VN WK+HRDPRIW +P  F PERFL +
Sbjct  433   FRLYPPGPLSGPREATEDCYLGNFFVPKGARLIVNLWKLHRDPRIWSDPLEFKPERFLNS  492

Query  414   -AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
              A      ++FEYIPF  GRR C    Y M V  LT+AR++Q FD  TP   P+DM EGL
Sbjct  493   HANISLKGQSFEYIPFSSGRRMCPAVNYGMNVVQLTLARMLQAFDIATPMGMPVDMGEGL  552

Query  237   GITLPRATALDVVITPRLPPSFY  169
             G+ LP+   L+V++TPRLP   Y
Sbjct  553   GVALPKLKPLEVLLTPRLPVELY  575



>ref|XP_008796321.1| PREDICTED: cytochrome P450 CYP82D47-like [Phoenix dactylifera]
Length=527

 Score =   449 bits (1154),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 230/506 (45%), Positives = 318/506 (63%), Gaps = 15/506 (3%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
              K++   P+  GA P+LGHL LLGS    +GR L A+AD  G VF LRLG +  LVVS+W
Sbjct  34    AKRRNKAPQPGGAWPVLGHLHLLGSHN-NIGRSLKAVADAVGPVFALRLGAHPALVVSTW  92

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             EA K+CFT NDK +A RP    +K + YN A+        YWR++R+    ELLS  +L 
Sbjct  93    EAAKECFTANDKALAGRPPSTASKLMCYNNAMVGFSPYGSYWRQVRRILTLELLSHARLA  152

Query  1320  KLRHLRVSEVETSLKELYMLITS-SSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKE  1144
              L H+R SEV    K L+ +       A  V+M++WF +LT N++V++VAGKR  F    
Sbjct  153   SLAHVRASEVGAFAKSLFGVCRKVEGGAARVEMNKWFQELTFNVVVRMVAGKRC-FGCGA  211

Query  1143  DDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDT  964
              DD    +EA+         M L G FV  D  PF  +RW++      + M R   E+D 
Sbjct  212   VDDGGS-REARRFTGAMHRMMELLGAFVVSDVVPF--LRWMDLGG-YERAMRRTAAEMDG  267

Query  963   ILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGL  784
             I+  WL EH    R+R S     GK   +DF+DVMLS I+ +      + P+ +IKA  L
Sbjct  268   IIGGWLREH----RERRSEGRGEGK---EDFMDVMLSTIEKEGELFSDHDPDTVIKANSL  320

Query  783   SMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAV  604
             ++II G+DTT+V +TW+L+L++NHP+ +++ RE++DS+VGKER V++ D++ + YLQA V
Sbjct  321   ALIIGGTDTTSVTMTWVLALLLNHPNVLRKAREELDSRVGKERNVDESDVEKLVYLQAIV  380

Query  603   KETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERF  424
             KETLRLYPP P   PH A E+C+V G+D+P GT + VNAW +  DP +WP+P  F PERF
Sbjct  381   KETLRLYPPGPVLIPHQAMEECQVRGFDVPAGTRVLVNAWAIQHDPEVWPDPSAFRPERF  440

Query  423   LTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMS  247
             LT+ +  D   R+FE +PFG GRR+C G ++A+QV HLT+AR+I GF   TP   P+DM+
Sbjct  441   LTSHKDVDIRGRHFELLPFGSGRRACPGASFALQVLHLTLARVIHGFHMRTPGGGPVDMT  500

Query  246   EGLGITLPRATALDVVITPRLPPSFY  169
             EG G TLP+AT L V++ PRL P  Y
Sbjct  501   EGKGATLPKATPLHVLVAPRLSPELY  526



>ref|XP_008464765.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=523

 Score =   448 bits (1153),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 232/506 (46%), Positives = 322/506 (64%), Gaps = 25/506 (5%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
             +K LPPEV GA P++GHL LL     P  +  A MAD YG +FTLRLG+Y  L+VS+WE 
Sbjct  38    RKRLPPEVGGALPLIGHLHLLAKNE-PAHKTFAKMADAYGPIFTLRLGLYTNLIVSNWEI  96

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKL  1315
              ++CFTTNDK+ A+RP    +K LGY+YA+F L    P+WR +RK A+ ELLS+ +LEKL
Sbjct  97    ARECFTTNDKIFASRPKLVASKLLGYDYAMFGLSPYGPHWRHVRKLAMLELLSNYRLEKL  156

Query  1314  RHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKV-KEDD  1138
             +H+RVSEV+TS+K LY L   +     V+M  WFG +TLN I +IV GK+F   V   ++
Sbjct  157   QHIRVSEVQTSMKNLYELCLKNKKNALVEMKTWFGDITLNTISRIVVGKKFSTAVDASNN  216

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
             + +EY++A       ++F    G FV  D+FPF  ++W++      K M +  K LD + 
Sbjct  217   ENEEYRKA------LRDFFEWFGVFVPSDSFPF--LKWLDLGGH-EKAMKKTAKVLDEVF  267

Query  957   QRWLDEHVDARRKRSSAANESG--KNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGL  784
              +W+ +H           N  G  K +  DF+DVMLS + DD  +   Y    + KAT L
Sbjct  268   DKWIQDH----------KNNLGEVKMEEHDFMDVMLSNVRDD-GQLSKYDAHTVTKATCL  316

Query  783   SMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAV  604
             S+I+ GSDTT V + W LSL++N+ + +KR + ++D +VG++R V++ D+K++ YLQA V
Sbjct  317   SLILAGSDTTTVTMIWALSLLLNNQEVLKRAQLELDERVGRQRQVKESDVKNLLYLQAIV  376

Query  603   KETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERF  424
             KETLRLYP  P   PH + +DC V GY IP GT L VN  K+ RDP+IW +P  F PERF
Sbjct  377   KETLRLYPAAPILVPHESVDDCVVAGYHIPVGTRLIVNVQKLQRDPQIWEDPCEFRPERF  436

Query  423   LTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMS  247
             LT+A+  D   +N   IPFG GRR C G ++A+QV HL +A L+ GF+   PS++ LDM 
Sbjct  437   LTSAKDFDVRGQNPRLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPSKEFLDME  496

Query  246   EGLGITLPRATALDVVITPRLPPSFY  169
             E  G+T  R   L+VV+TPRLPP  Y
Sbjct  497   ESAGMTSIRKNPLEVVLTPRLPPHVY  522



>ref|XP_006443549.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
 ref|XP_006479223.1| PREDICTED: cytochrome P450 82G1-like [Citrus sinensis]
 gb|ESR56789.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
Length=525

 Score =   448 bits (1153),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 226/505 (45%), Positives = 326/505 (65%), Gaps = 17/505 (3%)
 Frame = -3

Query  1677  KKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             ++K   PE  GA P++GHL LL +G  P+ + L A+ADKYG +++LRLG + IL+VSSWE
Sbjct  33    REKNTAPEPSGAWPLIGHLPLL-NGQEPICKILGALADKYGPIYSLRLGKHPILIVSSWE  91

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
              VKDCFTTND+++A R      K +GY+ A+F+L    PYWR +RK A TELLSS +LE 
Sbjct  92    IVKDCFTTNDRILATRAKIVAGKLMGYDNAIFALAPYGPYWRDIRKIATTELLSSHRLEL  151

Query  1317  LRHLRVSEVETSLKELYMLITSSS-SAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
             L+H+R SEV+T +K+LY L + ++ +   V +S+   QLT N+ +K++AGKRF  K  E+
Sbjct  152   LKHVRYSEVDTFIKDLYSLCSENAFNPAKVVISKLIEQLTFNISLKLIAGKRFSAKDYEE  211

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
                 +  EA  I    KE  +L G F+ GDA P+  + W++FQ  V   M    KE+D +
Sbjct  212   ----QGSEAWRINRAIKEATHLFGVFILGDAIPW--LEWIDFQGHV-GSMKSTAKEIDDV  264

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLS  781
             +  WL E +  + +        G N   D IDV+LS + +D   G  +  + ++KAT L 
Sbjct  265   IGNWLKERLQNKLQ------GEGHNGKGDLIDVLLSKLQEDAVMG-GHTRDTVVKATALI  317

Query  780   MIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVK  601
             +I+ GS++T + + W +SL++NHP  +K+ +E++D  VG++RWV + D+K ++YL+A VK
Sbjct  318   LILTGSESTYLGIIWTMSLLLNHPKELKKAQEELDVHVGRDRWVNESDMKKLKYLRAIVK  377

Query  600   ETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL  421
             ETLR+YPP P      A EDC++GGY +PKGT L VN WK+HRDPR+W  P  F PERFL
Sbjct  378   ETLRIYPPGPVTGIREAMEDCEIGGYHVPKGTRLIVNIWKLHRDPRMWENPCEFRPERFL  437

Query  420   TA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSE  244
             T  A  D   ++FEY+PF  GRRSC G T  +Q+  LT+AR++QGFD  T    P+DM  
Sbjct  438   TTHADVDVNTQHFEYVPFSFGRRSCPGMTSGLQIVQLTLARILQGFDLATVGGTPVDMQI  497

Query  243   GLGITLPRATALDVVITPRLPPSFY  169
             GLG+ LP++  L+V+I PRL    +
Sbjct  498   GLGLALPKSNPLEVIIKPRLAEDLF  522



>ref|XP_009365841.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=537

 Score =   448 bits (1153),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 231/512 (45%), Positives = 322/512 (63%), Gaps = 21/512 (4%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAV  1492
             K+ PPE  G+ P++GH+ ++G G  P    L  MADKYG +FT+ LG ++ L+VSSWE  
Sbjct  33    KSGPPEAPGSWPVIGHIPVIGRGPQPPHVILGNMADKYGPIFTINLGQHKALIVSSWEMA  92

Query  1491  KDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLR  1312
             K CFTTNDKV A RP     K LGYNY++F      PYWR +RK A  ELLS+ +LE LR
Sbjct  93    KQCFTTNDKVFATRPKHLAGKLLGYNYSMFGFSPYGPYWRHVRKIATVELLSNHRLELLR  152

Query  1311  HLRVSEVETSLKELY---MLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
             H+R SEV    K+LY         S    V+M+ WF  +TLN++ ++V GKRF       
Sbjct  153   HVRESEVNACTKDLYDKWERNGGESDWVLVEMNRWFADVTLNIMYRVVVGKRFLGAAT--  210

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
                +E +E +   +  ++F+ L+ +FV  D  PF  ++W++F   + K M    K+LD  
Sbjct  211   --VEEKEENERCRKALRDFLRLSSEFVVSDKIPF--LKWLDFG-GIGKAMKATAKDLDVA  265

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEII----IKA  793
             LQ WL+EH   R  RS   N     D +DF+D MLS++ D  A G  +P   I    IKA
Sbjct  266   LQGWLEEHKQKRNSRSE-LNSGNVKDERDFMDTMLSVLGDVSAEG--FPSTTIADTTIKA  322

Query  792   TGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQ  613
             T L+ I+ G+D T   LTW+LSL++N+ +A+K+ +E++D++VG+ER V++ D+K++ YLQ
Sbjct  323   TCLAAILGGTDPTTAVLTWVLSLLLNNREALKKAQEELDNQVGRERQVKESDVKNLVYLQ  382

Query  612   AAVKETLRLYPPLPTYAPHAATEDCKVG---GYDIPKGTHLYVNAWKVHRDPRIWPEPER  442
             A VKETLRLYPP P   PH   EDC VG    Y +  GT L VN WK+HR+P +W +P R
Sbjct  383   AIVKETLRLYPPSPLSIPHECIEDCNVGNGTNYHVKTGTRLLVNIWKIHRNPNVWLDPFR  442

Query  441   FMPERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSE  265
             F PERFLT  +  D   +NFE+IPFG GRR C G +  +QV  LT+A+L+ GF+  TPS+
Sbjct  443   FQPERFLTTHKDFDVRGQNFEFIPFGSGRRMCPGVSLGLQVVQLTLAQLLHGFEIATPSD  502

Query  264   KPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             +P+DM+E  G+T  +AT L+V++TPRLP   Y
Sbjct  503   EPVDMTESTGVTNMKATPLEVLLTPRLPAKLY  534



>ref|XP_010437977.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=525

 Score =   448 bits (1152),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 226/501 (45%), Positives = 323/501 (64%), Gaps = 13/501 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             P++ GA PI+GHL LL      L R L  MAD+YG V +LRLG     VVSS+E  KDCF
Sbjct  33    PKLSGAWPIIGHLHLLVGKEQLLYRTLGRMADRYGPVMSLRLGSSEAFVVSSFEVAKDCF  92

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP  A AK++GYNYAVF     + +WR+MRK A  ELLS+++L+ L+H+ V
Sbjct  93    TVNDKALASRPMTAAAKHMGYNYAVFGFAPYNAFWREMRKIATIELLSNRRLQMLKHVSV  152

Query  1299  SEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SE+   +K+LY L   +  ++   VD+  W   +TLN+IV++VAGKR+   V   +  ++
Sbjct  153   SEISMGVKDLYSLWVKNGGSEPVMVDLKRWLDNMTLNMIVRMVAGKRYFGGVVGSESSED  212

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
              +EA+       +F +L G F   DAFP   +RW +FQ    K+M +   ELD IL+RW+
Sbjct  213   TEEARQCKMAISKFFHLIGIFTVSDAFPR--LRWFDFQGHE-KEMKQTGSELDVILERWI  269

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
             D H   R+   +  N+S      DFIDVMLS+ +      L Y   I IK+T L++I+ G
Sbjct  270   DNHRQERKVSGTKENDS------DFIDVMLSLAEQGKLSHLQYDANISIKSTCLALILGG  323

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             S+TT+  LTW ++L++N+ + +K+ +++ID  VG++R VED DI ++ YLQA +KETLRL
Sbjct  324   SETTSSTLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRL  383

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT--AA  412
             YP  P   P  A EDC V GY++  GT L VN WK+ RDP+++ EP  F PERF+T  A 
Sbjct  384   YPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYKEPNEFRPERFITGEAK  443

Query  411   QADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
             + D   +NFE +PFG GRRSC G++ AMQV HL +AR +  F+ +T  + P+DM+E  G+
Sbjct  444   EFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMTESPGL  503

Query  231   TLPRATALDVVITPRLPPSFY  169
             T+P+AT L+V+I+PRL   F+
Sbjct  504   TIPKATPLEVLISPRLNEHFF  524



>ref|XP_006423133.1| hypothetical protein CICLE_v10028201mg [Citrus clementina]
 ref|XP_006479370.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR36373.1| hypothetical protein CICLE_v10028201mg [Citrus clementina]
Length=524

 Score =   448 bits (1152),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 229/504 (45%), Positives = 319/504 (63%), Gaps = 16/504 (3%)
 Frame = -3

Query  1677  KKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K+ + PPE +GA P +GHL LL    + L + L  MADKYG  F +RLG+ + LV+SSWE
Sbjct  35    KRGSRPPEPEGAWPFIGHLHLLEKNQL-LHQTLGKMADKYGKAFMIRLGIRQALVISSWE  93

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
               K+CFTTNDK+ ++RP F   K +GY++A+       PYWR +RK A  ELLS+ +LE 
Sbjct  94    VAKECFTTNDKLFSSRPKFLAVKLMGYDHAMLGFAPYGPYWRNIRKLATVELLSNHQLEL  153

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
             ++H+R  E +  +KELY L   +     V+M E FG L +N+I++++AGKRF  +    D
Sbjct  154   IKHVRDIETKIFIKELYELCVKNGGLVDVEMKERFGDLAMNIILRVIAGKRFFGRDTNAD  213

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
             D D    ++   +    F YL G  +  D  PF  + W++        M +  KELDT+ 
Sbjct  214   DQD----SRQCQKALGNFFYLVGLLLPSDNIPF--LGWLDVVNGYTGQMKKTAKELDTLF  267

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
              R + EH   R KR    NES K + +DFIDVMLS++DD   +  A   + +IK+T LS+
Sbjct  268   GRLVHEH---RHKR---LNESIKEEEKDFIDVMLSVLDD--GKTSAEDADTVIKSTCLSL  319

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             I+ G+DTT V LTW LSL++N+   +K+ ++++   VG  R VE+ DIK++ YLQA VKE
Sbjct  320   ILGGNDTTVVTLTWALSLLLNNHHVLKKAQDELSIHVGNNRQVEESDIKNLIYLQAIVKE  379

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
             TLRLYP LP  AP  A EDC +GG+ IP GT L VN WK+HRDP IW  P  F+PERFL 
Sbjct  380   TLRLYPALPLSAPREAMEDCIIGGFHIPAGTRLIVNLWKMHRDPSIWANPSEFIPERFLN  439

Query  417   A-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEG  241
               A  +   ++FE++PFG GRR C G ++A+QV HLT+ARL+  F+  T S+  +DM E 
Sbjct  440   ENANLEVKGQDFEFLPFGSGRRKCPGISFALQVLHLTLARLLHAFELGTVSDTLVDMRES  499

Query  240   LGITLPRATALDVVITPRLPPSFY  169
              G+T+P+ATAL+V +TPRLP   Y
Sbjct  500   PGMTVPKATALEVTLTPRLPSKLY  523



>emb|CBI36491.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   447 bits (1149),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 238/505 (47%), Positives = 325/505 (64%), Gaps = 23/505 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR       +K ++  PE  GA P LGHL LL  G  P+ R L AMADK+G VF +RLG+
Sbjct  49    WRVMTLAGKSKGRS-APEPSGAWPFLGHLPLL-RGQTPIFRTLGAMADKHGPVFMIRLGV  106

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +R LVVSS EAVK+CFTTNDKV A+RP  +  K LGYNYA F        WR+MRK ++ 
Sbjct  107   HRALVVSSREAVKECFTTNDKVFASRPSSSAGKLLGYNYAGFGFAPYGALWREMRKLSMM  166

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVD--MSEWFGQLTLNLIVKIVA  1174
             E+LS+++L+ L+H+++SE++ S+K+LY L   S     V   MSEWF  L+ N+++K++A
Sbjct  167   EILSARRLDALKHVQISELDLSIKDLYSLGKGSDWVHPVKVVMSEWFQHLSFNIVLKMIA  226

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR+      +      +EA+  I   +EF+ L+G FV  DA P   V W++ Q   +  
Sbjct  227   GKRYF-----NTSGHGIEEARRAIATIQEFLSLSGAFVLSDAIPG--VEWMDLQG-YLGS  278

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M R+ KE+D+++  W++EH           N  G    QDFIDVMLS+++D    G  + 
Sbjct  279   MKRVAKEVDSLVGGWVEEH-------EIRLNSEGSR-MQDFIDVMLSVLEDTSMFG--HS  328

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              E +IKAT + +I+ G++T A   TWLLS ++N+  A+KR +E++D KVG+ RWVE+ DI
Sbjct  329   RETVIKATIVILIVGGTETVATTSTWLLSALLNNKHALKRAQEELDLKVGRGRWVEESDI  388

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
              ++ YLQA +KETLRLY   P   PH A EDC V GY IPKGT L+VNAWK+HRDP +W 
Sbjct  389   PNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPKGTRLFVNAWKLHRDPSVWS  448

Query  453   EPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             +PE F PERFLT+ A  D   ++FE IPFG GRRSC G T A+++  L + RL+QGFD  
Sbjct  449   DPEDFQPERFLTSHADLDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIGRLLQGFDLS  508

Query  276   TPSEKPLDMSEGLGITLPRATALDV  202
             TP   P+DM EGL ITL + T L+V
Sbjct  509   TPLNAPVDMREGLSITLAKLTPLEV  533



>ref|XP_011039260.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=528

 Score =   445 bits (1145),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 231/504 (46%), Positives = 330/504 (65%), Gaps = 23/504 (5%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRK-LAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             P+  GA PI+GH+ L G  G  L  K L AMADKYG VFT++LG +R+LVV+SWE  +DC
Sbjct  42    PQAGGAWPIIGHMHLFG--GKQLTHKILGAMADKYGPVFTIKLGSHRVLVVNSWEMARDC  99

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             FT +D+  ++RP  A +K LGY+ A+F      PYWR+MRK    ELLSS +++ LRH+R
Sbjct  100   FTVHDRAFSSRPSIAASKLLGYDLAMFGFAPYGPYWREMRKITTIELLSSHRIDMLRHIR  159

Query  1302  VSEVETSLKELYMLITSSSSAK---TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDC  1132
              SEVET++++L+ +  S  SA+   TVDM +WFG+LTLN+++++V GKR+ F    D + 
Sbjct  160   ASEVETAIRDLHKMWVSKGSAESGVTVDMKQWFGELTLNIVLRMVGGKRY-FGPSADGEE  218

Query  1131  DEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQR  952
              E +  Q   +V ++F+ L G FV  DA PF  + W++F     K M R  KELD +   
Sbjct  219   AEARRNQ---KVMRDFVRLFGVFVLSDAIPF--LGWLDFN-GYEKAMKRTAKELDILAGG  272

Query  951   WLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMII  772
             WL+EH   +++R     E      QDF+DVML++++     G  +  + I KAT L++I+
Sbjct  273   WLEEH---KQRRLLGGKE---KQEQDFMDVMLNILEKANIGG--FDADTINKATCLNVIL  324

Query  771   DGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETL  592
              GSDTT V LTW LSL++N+P  +K+ ++++D  VGK+R V++ DI ++ YLQA +KETL
Sbjct  325   AGSDTTMVTLTWALSLLLNNPQVLKKAKDELDIHVGKDRLVDESDINNLVYLQAIIKETL  384

Query  591   RLYPPLPTYAPHAATEDCKVG-GYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA  415
             RLYPP P  A  +A EDC +  GY +P GT L  NAWK+ RD R+WP P+ F PERFLT+
Sbjct  385   RLYPPSPLIAHRSAKEDCTLSVGYHVPSGTRLMANAWKIQRDERVWPNPDEFHPERFLTS  444

Query  414   A-QADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
               + D   +NFE IPFG GRRSC G   A+++ H T+ARL+  F+   PS + +DM+E  
Sbjct  445   QKEIDLKGQNFELIPFGSGRRSCPGIALALRIVHFTLARLLHSFEVTKPSREDVDMTESH  504

Query  237   GITLPRATALDVVITPRLPPSFYG  166
             G+T  +AT L++++ PRL P  YG
Sbjct  505   GLTNLKATPLEILLIPRLNPRLYG  528



>ref|XP_010436299.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   445 bits (1144),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 227/506 (45%), Positives = 320/506 (63%), Gaps = 14/506 (3%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
             K    P+  GA PI+GHL LLG     L R L  MAD YG+  +L+LG     VVSS+E 
Sbjct  28    KHVKAPKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEV  87

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKL  1315
              K+CFT NDK +A+RP  A AK++GYN+AVF     S +WR+MRK A  ELLS+++L+ L
Sbjct  88    AKNCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQML  147

Query  1314  RHLRVSEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
             +H+RVSE+   +K+LY L   +  ++   VD+  W   +TLN+IV++VAGKR+ F     
Sbjct  148   KHVRVSEISMGVKDLYSLWVKNGGSEPVIVDLKSWLEDMTLNMIVRMVAGKRY-FGGAGS  206

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
             +  ++ +EA        +F +L G F   DAFP   +RW + Q    K+M +   ELD I
Sbjct  207   ESSEDTEEASQCKRAISKFFHLIGIFTVSDAFP--ALRWFDLQGHE-KEMKQTGSELDVI  263

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLS  781
             L+RW++ H   R+   +  N+S      DFIDVMLS+        L Y     IK+T L+
Sbjct  264   LERWIENHRQERKVSGTKENDS------DFIDVMLSLAKQGKLSHLQYDATTSIKSTCLA  317

Query  780   MIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVK  601
             +I+ GSDTTA  LTW ++L++N+ + +K  +++ID  VG++R VED DIK++ YLQA +K
Sbjct  318   LILGGSDTTASTLTWAIALLLNNKEMLKNAQDEIDLHVGRDRNVEDSDIKNLVYLQAIIK  377

Query  600   ETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL  421
             ETLRLYP  P   P  A EDC V GY++  GT L VN WK+ RDP+++ EP  F PERF+
Sbjct  378   ETLRLYPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYVEPNEFRPERFI  437

Query  420   T--AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMS  247
             T  A + D   +NFE +PFG GRRSC G++ AMQV HL +AR +  F+ +T  + P+DMS
Sbjct  438   TGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMS  497

Query  246   EGLGITLPRATALDVVITPRLPPSFY  169
             E  G+T+P+AT L+V+I+PRL   F+
Sbjct  498   ESPGLTIPKATPLEVLISPRLNEQFF  523



>ref|XP_006443550.1| hypothetical protein CICLE_v10019727mg [Citrus clementina]
 ref|XP_006479221.1| PREDICTED: cytochrome P450 82G1-like isoform X1 [Citrus sinensis]
 ref|XP_006479222.1| PREDICTED: cytochrome P450 82G1-like isoform X2 [Citrus sinensis]
 gb|ESR56790.1| hypothetical protein CICLE_v10019727mg [Citrus clementina]
Length=520

 Score =   444 bits (1141),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 231/499 (46%), Positives = 324/499 (65%), Gaps = 22/499 (4%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA P++GHL LL +   P+ + L A+ADKYG +++LRLG +  L+VSSWE VKDCF
Sbjct  39    PEPFGAWPLIGHLPLLIAEE-PVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCF  97

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             TTND+V+A RP  A  KYLGY+ AVF+L     YWR +RK A T+LLSS +LE L+H+R 
Sbjct  98    TTNDRVLATRPSIAAGKYLGYDNAVFALAPYGRYWRDIRKIATTDLLSSHRLELLKHVRY  157

Query  1299  SEVETSLKELYMLITSSS-SAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
             SEV+T +K+LY   + ++ +   V +S+   QLT N+ ++++AGKRF  +    +  ++ 
Sbjct  158   SEVDTFIKDLYSRCSENAFNPAKVVISKLIEQLTFNISLRLIAGKRFSAR----EFGEQG  213

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
              E   I    KE  YL G FV GDA P+  + W++FQ  +   M R  K++D ++  WL+
Sbjct  214   SEGWRINRAIKEATYLTGVFVLGDAIPW--LEWIDFQGHI-GSMRRTAKKIDDVIGNWLE  270

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGS  763
             EH  A+RK              DF+DV+LS I+D+      +  + +IKAT L +I  GS
Sbjct  271   EH--AQRKLQGEG---------DFMDVLLSKIEDNTVMS-GHTRDTVIKATALILIFTGS  318

Query  762   DTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLY  583
             ++T + + W LSL++NHP  +K+ +E++D  VG++RWV + D+K+++YL+A VKETLR+Y
Sbjct  319   ESTYLGIIWTLSLLLNHPKELKKAQEELDVHVGRDRWVNESDMKNLKYLRAIVKETLRIY  378

Query  582   PPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQA  406
             PP P      A EDC++GGY +PKGT L VN WK+HRDPR+W  P  F PERFLT  A  
Sbjct  379   PPGPVTGIREAMEDCEIGGYHVPKGTRLIVNVWKLHRDPRMWENPCEFRPERFLTTHADV  438

Query  405   DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITL  226
             D   ++FEYIPF  GRRSC G T  +Q+  LT+AR++QGFD  T    P+DM EGLGI L
Sbjct  439   DVNTQHFEYIPFSFGRRSCPGMTSGLQIVQLTLARILQGFDLATVGGIPVDMKEGLGIAL  498

Query  225   PRATALDVVITPRLPPSFY  169
             P+   ++VVI PRL    Y
Sbjct  499   PKLNPVEVVIKPRLSDDLY  517



>ref|XP_009109920.1| PREDICTED: cytochrome P450 82C4 [Brassica rapa]
Length=525

 Score =   444 bits (1141),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 232/497 (47%), Positives = 318/497 (64%), Gaps = 17/497 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA PI+GHL LLG     L R L  MA++YG   +LRLG     VVSS+E  K+CF
Sbjct  33    PEPSGAWPIIGHLHLLGGKEQLLYRTLGEMANRYGPAMSLRLGSNEAFVVSSFEVAKECF  92

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP  A AK++GYNYAVF     S +WR+MRK A  ELLS+++L+ L+H+RV
Sbjct  93    TVNDKALASRPMTAAAKHMGYNYAVFGFAPYSSFWREMRKIATVELLSNRRLQMLKHVRV  152

Query  1299  SEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKR-FKFKVKEDDDCD  1129
             SE+   +K+LY L      ++   VD+  W   +TLN+IV++VAGKR F       +D +
Sbjct  153   SEISMGVKDLYSLWVKKGGSEPIIVDLKRWLEDMTLNMIVRMVAGKRYFGGGSTTPEDTE  212

Query  1128  EYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRW  949
             E ++ Q  I    +F +L G F   DAFP   + W + Q    K+M +   ELD IL+RW
Sbjct  213   EARQCQKAI---TKFFHLIGIFTMSDAFP--TLGWFDLQGHE-KEMKKTGSELDVILERW  266

Query  948   LDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIID  769
             ++ H   R++R  + N   K +  DFIDVMLS+ +      L Y     IK+T L++I+ 
Sbjct  267   IENH---RQQRKVSGN---KENDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILG  320

Query  768   GSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLR  589
             GSDTTA  LTW ++L++N+ D +K+ +++ID +VG +R VED DI+++ YLQA +KETLR
Sbjct  321   GSDTTASTLTWAIALLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLR  380

Query  588   LYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT--A  415
             LYP  P   P  A EDC V GY +  GT L VN WK+ RDP++W EP  F PERFLT  A
Sbjct  381   LYPAGPLLGPREAMEDCTVAGYHVACGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEA  440

Query  414   AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLG  235
              + D   +NFE IPFG GRRSC G++ AMQV HL +AR +  FD +T  +  +DMSE  G
Sbjct  441   KEFDVRGQNFELIPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPG  500

Query  234   ITLPRATALDVVITPRL  184
             +T+P+AT L+V+I+PRL
Sbjct  501   LTIPKATPLEVMISPRL  517



>ref|XP_007017416.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
 gb|EOY14641.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
Length=798

 Score =   451 bits (1161),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 243/515 (47%), Positives = 327/515 (63%), Gaps = 24/515 (5%)
 Frame = -3

Query  1695  IFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRIL  1516
             I  S  K+K   PE  GARP LGHL LLG G  P    L  +AD YG +FT+RLG+   L
Sbjct  302   IIGSGMKRKA--PEASGARPFLGHLHLLG-GSKPAHVVLGDLADTYGPIFTIRLGVRLTL  358

Query  1515  VVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLS  1336
             VVS+WE  K+CFTTNDK  A RP    A+ LGYNYA+F      PYWR++RK    E+LS
Sbjct  359   VVSNWEIAKECFTTNDKAFANRPRTLAAELLGYNYAMFGFSPYGPYWRQIRKIVTLEVLS  418

Query  1335  SQKLEKLRHLRVSEVETSLKELYML----ITSSSSAKT-VDMSEWFGQLTLNLIVKIVAG  1171
             + +LEKL+H+R SEV TS+KELY L    +++SSS K  V+M  WF  L +N++ K+V G
Sbjct  419   NHRLEKLKHIRESEVRTSIKELYKLGVEGVSNSSSGKVLVEMKRWFWTLNINMVFKMVVG  478

Query  1170  KRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDM  991
             KR+     E +      E     +  ++F  L G F  GD+ PF  +RW++      K M
Sbjct  479   KRYS----EAETSHGKDENDRRRKALRDFFELTGTFTVGDSLPF--LRWLDLGGHE-KAM  531

Query  990   GRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPP  811
              +  KELD IL+ WL+EH   ++KR+S   ES      DF+ +MLS+++D  A   +Y  
Sbjct  532   KKTAKELDHILEEWLEEH---KQKRNSGNAES----EHDFMGMMLSLLNDA-AELPSYDA  583

Query  810   EIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIK  631
             + I KAT LS+I+  SDTT V LTW LSL++N+ +A+K+ +E++D  VG+++ VE+ DIK
Sbjct  584   DTINKATCLSLILAASDTTMVTLTWALSLLLNNRNALKKAQEELDIHVGRDKLVEESDIK  643

Query  630   DMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPE  451
              + YLQA +KETLRLYP  P   PH + EDC V GY IP GT L +N +K+HRDP  W +
Sbjct  644   KLVYLQAIIKETLRLYPAAPLSVPHESMEDCVVSGYHIPAGTRLLINLYKIHRDPHAWSD  703

Query  450   PERFMPERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFET  274
             P  F PERFLT  +  D   +NFE IPFG GRR C G + A+QV  LT+A L+QGF+  T
Sbjct  704   PCEFQPERFLTTYKDFDVRGQNFELIPFGSGRRMCPGVSLALQVLELTLANLLQGFELGT  763

Query  273   PSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             P ++P+DM E +GIT  + + L+V+ITPRLP   Y
Sbjct  764   PLDEPVDMGEAIGITNLKVSPLEVLITPRLPAVCY  798


 Score =   100 bits (249),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PEV GARP LGHL+LLG G  P    L  +AD YG +FT+RLGM   LVVS+WE  K+CF
Sbjct  6     PEVSGARPFLGHLQLLG-GSKPAQVVLGDLADTYGPIFTIRLGMQSTLVVSNWEMAKECF  64

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVF  1402
             TTN K    RP    A+ LGYNYA+ 
Sbjct  65    TTNHKAFVNRPRTLAAELLGYNYAMM  90


 Score = 88.6 bits (218),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
             KK   PE   + P++GHL LLG G  P    L  MA+KYGS+FT+++G+YR LVV++WE 
Sbjct  181   KKRAAPEAGSSWPVIGHLHLLG-GPQPPHIVLGDMAEKYGSIFTIKMGVYRALVVNNWET  239

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAV  1405
              K+C TTNDK  A+RP     ++L + + +
Sbjct  240   AKECLTTNDKAFASRPKTLAMEFLSFEHTM  269


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 55/98 (56%), Gaps = 10/98 (10%)
 Frame = -3

Query  1182  IVAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRV  1003
             +V GKR+  +V+     D+    ++ +   + F+ L G F  GD+ PF  +RW++     
Sbjct  90    MVIGKRYS-EVEASHGKDDNDRCRNAV---RNFLELTGTFTVGDSLPF--LRWLDLGGHE  143

Query  1002  VKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGK  889
              K M +  KELD IL++WL+EH   ++KR+S   ES K
Sbjct  144   -KAMKKTAKELDQILEKWLEEH---KQKRNSGNVESVK  177



>ref|XP_010445016.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   442 bits (1136),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 224/501 (45%), Positives = 318/501 (63%), Gaps = 14/501 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             P+  GA PI+GHL LLG     L R L  MAD YG+  +L+LG     VVSS+E  K+CF
Sbjct  33    PKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNCF  92

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP  A AK++GYN+AVF     S +WR+MRK A  ELLS+++L+ L+H+RV
Sbjct  93    TVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1299  SEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SE+   +K+LY L   +  ++   VD+  W   +TLN+IV++VAGKR+ F     +  ++
Sbjct  153   SEISMGVKDLYSLWVKNGGSEPVIVDLKSWLEDMTLNMIVRMVAGKRY-FGGAGSESSED  211

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
              +EA        +F +L G F   DAFP   +RW + Q    K+M +   ELD IL+RW+
Sbjct  212   TEEASQCKRAISKFFHLIGIFTVSDAFP--SLRWFDLQGHE-KEMKQTGSELDVILERWI  268

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
             + H   R+   +  N+S      DFIDVMLS+ +      L Y     IK+T L++I+ G
Sbjct  269   ENHRQERKVSGTKENDS------DFIDVMLSLAEQGKLSHLQYDATTSIKSTCLALILGG  322

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             SDTTA  LTW ++L++N+ + +K  +++ID  VG++R VED DI ++ YLQA +KETLRL
Sbjct  323   SDTTASTLTWAIALLLNNKEMLKNAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRL  382

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT--AA  412
             YP  P   P  A EDC V GY++  GT L VN WK+ RDP+++ EP  F PERF+T  A 
Sbjct  383   YPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYEEPNEFRPERFITGEAK  442

Query  411   QADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
             + D   +NFE +PFG GRRSC G++ AMQV HL +AR +  F+ +T  + P+DMSE  G+
Sbjct  443   EFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSESPGL  502

Query  231   TLPRATALDVVITPRLPPSFY  169
             T+P+AT L+V+I+PRL    +
Sbjct  503   TIPKATPLEVLISPRLNEQLF  523



>ref|XP_009364189.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   442 bits (1136),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 232/509 (46%), Positives = 314/509 (62%), Gaps = 23/509 (5%)
 Frame = -3

Query  1677  KKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K K  PPE  GA PILGHL LLG G  P    L AMADKYG ++T+RLG+Y  LV+SS E
Sbjct  34    KGKLSPPEAKGAWPILGHLPLLG-GSTPPHITLGAMADKYGPLYTIRLGVYPSLVISSSE  92

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
               K+CFTTND  + +RP  AV  ++GYNYA+F      PYWR++RK    ELLS++++E 
Sbjct  93    IAKECFTTNDLSVNSRPKMAVVDHIGYNYAMFGFAPSGPYWREIRKITTLELLSNRRVEL  152

Query  1317  LRHLRVSEVETSLKELYMLITS-----SSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFK  1153
             L+H+RVSEV T LKEL+   ++     S+    V++ +WFG +TLN+IV++VAGKR+   
Sbjct  153   LKHIRVSEVTTFLKELHKTWSTRQKEGSNDGVVVELKQWFGDMTLNVIVRMVAGKRYSVA  212

Query  1152  VKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKE  973
               ED    E KEA  +    +EF    G F+ GDA P+  +RW++      K M +  K+
Sbjct  213   ADED----EKKEALRVQNALREFFNFVGMFLVGDAVPY--LRWLDLGGHE-KAMKKTAKD  265

Query  972   LDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKA  793
             LD ++  W++EH   R K        G    QDFID MLS++D     G  +  + I KA
Sbjct  266   LDAMVGEWVEEHKQRRAK-------GGAKGEQDFIDAMLSVLDGADLGG--FDADTINKA  316

Query  792   TGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQ  613
             T L+MI  GSDTT V LTW +SL+VN+P  +KR   ++D+K+G++R V + DI ++ Y+Q
Sbjct  317   TSLNMIAGGSDTTMVTLTWAISLLVNNPHVLKRALNELDTKIGRQRVVSEEDISNLVYIQ  376

Query  612   AAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMP  433
             A VKETLRLYP  P   P   TEDC + G  I KGT L +N WK+  DP+IWP+P  F P
Sbjct  377   AIVKETLRLYPAAPLSGPREFTEDCTIAGCHIRKGTRLIMNLWKLQTDPKIWPDPLEFKP  436

Query  432   ERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPL  256
             ERFLT  +  D    +FE IPFG GRR+C G  +A+Q+   T+A  +  F+   PS  P+
Sbjct  437   ERFLTTHKDVDVKGHHFELIPFGSGRRACPGLAFALQMVQFTLASFLHAFEISNPSSAPI  496

Query  255   DMSEGLGITLPRATALDVVITPRLPPSFY  169
             DM+E  G+T  + T L V+I PRL   FY
Sbjct  497   DMTESFGLTNMKVTPLKVLIKPRLSFEFY  525



>ref|XP_002284806.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=527

 Score =   442 bits (1136),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 232/500 (46%), Positives = 322/500 (64%), Gaps = 19/500 (4%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             P E  G  PI+GHL LLG+  +P  R L  MADKYG +F + LG+ + LVVSSWE  K+C
Sbjct  40    PQEPSGRWPIIGHLHLLGADKLP-HRTLGDMADKYGPIFCIHLGLRKALVVSSWEVAKEC  98

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             +TTNDKV A RP     K +GY++A+       PYWR +RK A+ ELLS+++LE L+H++
Sbjct  99    YTTNDKVFATRPRSLAVKLMGYDHAMLGFAPYGPYWRDVRKLAMVELLSNRQLEMLKHVQ  158

Query  1302  VSEVETSLKELY-MLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
              SEVE  +KELY     +  S   V+M E FG L +N++V+ +AGKR+      DD+   
Sbjct  159   DSEVEFLIKELYGQWARNKDSPALVEMKERFGNLVMNVMVRAIAGKRYFGTHACDDEPKR  218

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
              K+A        +FM L G F+  DA PF  + W++  +    DM +I KELD +L RW+
Sbjct  219   GKKA------LDDFMLLVGLFMVSDAIPF--LGWLDTVKGYTTDMKKIAKELDYLLGRWV  270

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
             +EH   R++R SA N   +    DF+ VMLS+IDD    G    P+ +IKAT L++I+ G
Sbjct  271   EEH---RQQRLSANNNRAE---VDFLHVMLSVIDDGQFSG--RDPDTVIKATCLNLILAG  322

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
              DTT++ LTW LSL++N+  A+K+ + +++  VGK R V+  DIK++ YLQA VKETLRL
Sbjct  323   YDTTSITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRL  382

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQ  409
             YPP P   PH A EDC V G+ I  GT L VN WK+HRDPR+W +P  F PERFLT  A 
Sbjct  383   YPPGPLSVPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTNHAG  442

Query  408   ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGIT  229
              D   +N+E +PFG GRR C G ++A++++HL +ARL+ GF+    ++ P+DM+EG G++
Sbjct  443   LDVRGKNYELLPFGSGRRVCPGISFALELTHLALARLLHGFELGVVADSPVDMTEGPGLS  502

Query  228   LPRATALDVVITPRLPPSFY  169
              P+AT L+V I PRLP   Y
Sbjct  503   APKATPLEVTIVPRLPFELY  522



>emb|CDY53704.1| BnaC03g67210D [Brassica napus]
Length=523

 Score =   441 bits (1135),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 230/503 (46%), Positives = 319/503 (63%), Gaps = 17/503 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA PI+GHL LLG     L R L  MA++YG   +LRLG     VVSS+E  K+CF
Sbjct  33    PEPSGAWPIIGHLHLLGGKEQLLYRTLGEMANRYGPAMSLRLGSSEAFVVSSFEVAKECF  92

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP  A AK++GYNYAVF     S +WR+MRK A  ELLS+++L+ L+H+RV
Sbjct  93    TVNDKALASRPMTAAAKHMGYNYAVFGFAPYSSFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1299  SEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKR-FKFKVKEDDDCD  1129
             SE+   +K+LY L      ++   V++  W   +TLN+IV++VAGKR F       +D +
Sbjct  153   SEISMGVKDLYSLWVKKGGSEPVMVNLKRWLEDMTLNMIVRMVAGKRYFGGGSTTPEDTE  212

Query  1128  EYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRW  949
             E ++ Q  I    +F +L G F   DAFP   + W + Q    K+M +   ELD IL+RW
Sbjct  213   EARQCQKAI---TKFFHLIGIFTMSDAFP--TLGWFDLQGHE-KEMKKTGSELDVILERW  266

Query  948   LDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIID  769
             ++ H   R++R  + N   K +  DFIDVMLS+ +      L Y     IK+T L++I+ 
Sbjct  267   IENH---RQQRKVSGN---KENDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILG  320

Query  768   GSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLR  589
             GSDTTA  LTW ++L++N+ D +K+ +++ID +VG +R VED DI+++ YLQA +KETLR
Sbjct  321   GSDTTASTLTWAIALLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLR  380

Query  588   LYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT--A  415
             LYP  P   P  A EDC + GY +  GT L VN WK+ RDP++W EP  F PERFLT  A
Sbjct  381   LYPAGPLLGPREAMEDCTIAGYHVSCGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEA  440

Query  414   AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLG  235
              + D   +NFE IPFG GRRSC G++ AMQV HL +AR +  FD +T  +  +DMSE  G
Sbjct  441   KEFDVRGQNFELIPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPG  500

Query  234   ITLPRATALDVVITPRLPPSFYG  166
             +T+P+AT L+V+I+PRL    + 
Sbjct  501   LTIPKATPLEVMISPRLEKHLFA  523



>ref|XP_002305292.2| hypothetical protein POPTR_0004s10630g [Populus trichocarpa]
 gb|EEE85803.2| hypothetical protein POPTR_0004s10630g [Populus trichocarpa]
Length=516

 Score =   441 bits (1133),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 226/515 (44%), Positives = 323/515 (63%), Gaps = 15/515 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             W+    +S  KK T  PE  GA P+ GHL  L  G  P  + L A+ADKYG +++L+ G+
Sbjct  15    WKILARNSEGKKSTRAPEPSGAWPLFGHLPSL-VGKDPACKTLGAIADKYGPIYSLKFGI  73

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +R LVVSSWE VKDC  TND+V+A R   A  K++ YN A F+L     YWR +RK A  
Sbjct  74    HRTLVVSSWETVKDCLNTNDRVLATRAGIAAGKHMFYNNAAFALAPYGQYWRDVRKLATL  133

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSS-SSAKTVDMSEWFGQLTLNLIVKIVAG  1171
             +LLS+Q+LE L+H+RVSEV+T +K L+     +  S   V++S+    LT N+ ++ + G
Sbjct  134   QLLSNQRLEMLKHVRVSEVDTFIKGLHSFYAGNVDSPAKVNISKLLESLTFNINLRTIVG  193

Query  1170  KRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDM  991
             KR+     + ++ + ++  + I    K+ +YL+G FV  DA PF  + W+++Q  V   M
Sbjct  194   KRYCSSTYDKENSEPWRYKKAI----KKALYLSGIFVMSDAIPF--LEWLDYQGHV-SAM  246

Query  990   GRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPP  811
              +  KELD +++ WL+EH+     +     E G +   DF+DVM+S + +   +   Y  
Sbjct  247   KKTAKELDAVIRNWLEEHL-----KKKIDGELGSDRESDFMDVMISNLAEGPDKISGYSR  301

Query  810   EIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIK  631
             +++IKAT L + + G+ +TA  L W LSL++N+P  +K  +E++D +VG+ERWVE+ DI+
Sbjct  302   DVVIKATALILTLTGAGSTATTLVWTLSLLLNNPTVLKAAQEELDKQVGRERWVEESDIQ  361

Query  630   DMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPE  451
             +++YLQA VKETLRLYPP P      A EDC +GGYD+PKGT L VN WK+HRDPR+W  
Sbjct  362   NLKYLQAIVKETLRLYPPGPLTGIREAMEDCSIGGYDVPKGTRLVVNIWKLHRDPRVWKN  421

Query  450   PERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFET  274
             P  F P+RFLT  A  D   +N E+IPF  GRRSC      + V HLT+AR++QGFD  T
Sbjct  422   PNEFKPDRFLTTHADLDFRGQNMEFIPFSSGRRSCPAINLGLIVVHLTLARILQGFDLTT  481

Query  273   PSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              +  P+DM EG GI LP+ T L+VVI PRL    Y
Sbjct  482   VAGLPVDMIEGPGIALPKETPLEVVIKPRLGLELY  516



>ref|XP_010069622.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Eucalyptus 
grandis]
Length=478

 Score =   439 bits (1130),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 216/477 (45%), Positives = 319/477 (67%), Gaps = 14/477 (3%)
 Frame = -3

Query  1572  MADKYGSVFTLRLGMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLD  1393
             MADK G +F +RLG++   ++SS EAV+ CFTT+DK +A+RP   V  + GY YA F   
Sbjct  1     MADKQGPMFRIRLGVHPATIISSQEAVRKCFTTHDKDLASRPKSKVGIHFGYGYAGFGFA  60

Query  1392  TDSPYWRKMRKFAVTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS------SAKTV  1231
                  WR+MRK  + ELLS+++L+ L+H++ SE++T +K+L+ L  +++      S+K V
Sbjct  61    EYGDLWREMRKITMLELLSTRRLDNLKHVQASEIDTFVKDLHALCRTNAIDAQNGSSKVV  120

Query  1230  DMSEWFGQLTLNLIVKIVAGKRF--KFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVF  1057
              +S+    LTLN+I++++A KR+            D+ +EA H+ +V KEFMY++G    
Sbjct  121   VISQLLELLTLNIIIRMIASKRYFGLLSASTGSSTDDDEEASHLRKVIKEFMYISGFPTV  180

Query  1056  GDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQ  877
              +  PF    W +     VK M R+ +E+D I+ +W++EH    ++      E   +  +
Sbjct  181   SELVPF--TGWTDCVG-TVKTMKRVAREMDEIVGKWVEEH--KLKREGDQRGEVIGDVKE  235

Query  876   DFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMK  697
             DFIDVMLS+I +D      + PE +IKAT +++I+ GSDTT+++LTW+LSL++NH   +K
Sbjct  236   DFIDVMLSVIGEDGLAQFGHSPETLIKATVVNIIVAGSDTTSLNLTWVLSLLLNHKHVLK  295

Query  696   RIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDI  517
             R +E+ID KVGK++WV+D DI  + YLQA VKETLRLYPP P   PH A  DC V GY I
Sbjct  296   RAQEEIDLKVGKDKWVQDSDIGSLHYLQAIVKETLRLYPPGPLSIPHEARADCNVRGYLI  355

Query  516   PKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGN  340
             PKGT ++VN WK+HRDP++W +PE+F+PERFLT  +  DA  ++FE+IPFG GRR C G 
Sbjct  356   PKGTRIFVNVWKLHRDPQVWSDPEKFLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGA  415

Query  339   TYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              +A++ +HLT+ARL+QGFD    S++ +DM+EG+G+ LP+AT L VV+ PRLP   Y
Sbjct  416   AFALRATHLTLARLLQGFDLAISSDELVDMTEGIGLNLPKATPLRVVLNPRLPSMLY  472



>ref|XP_010451089.1| PREDICTED: cytochrome P450 82C4 [Camelina sativa]
Length=524

 Score =   441 bits (1133),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 223/501 (45%), Positives = 321/501 (64%), Gaps = 14/501 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             P+  GA PI+GHL LLG     L R L  MAD YG+  +L+LG     VVSS+E  K+CF
Sbjct  33    PKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNCF  92

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP  A AK++GYN+AVF     S +WR+MRK A  ELLS+++L+ L+H+RV
Sbjct  93    TVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1299  SEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SE+   +K+LY L   +  ++   VD+  W   +TLN+IV++VAGKR+ F     +  ++
Sbjct  153   SEISMGVKDLYSLWVKNGGSEPVIVDLKSWLEDMTLNMIVRMVAGKRY-FGGTGSETSED  211

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
              +EA+       +F +L G F   DAFP   +RW + Q    K+M +   ELD IL++W+
Sbjct  212   TEEARQCKIAISKFFHLIGIFTVSDAFP--ALRWFDLQGHE-KEMKQTGSELDVILEKWI  268

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
             + H   R+   +  N+S      DFIDVMLS+ +      L Y     IK+T L++I+ G
Sbjct  269   ENHRQQRKVSGTKENDS------DFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGG  322

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             SDTTA  LTW ++L++N+ + +K+ +++ID  VG++R VED DIK++ YLQA +KETLRL
Sbjct  323   SDTTASTLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDIKNLVYLQAIIKETLRL  382

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT--AA  412
             YP  P   P  A EDC V GY++  GT L VN WK+ RDP+++ EP  F PERF+T  A 
Sbjct  383   YPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYMEPNEFRPERFVTGEAK  442

Query  411   QADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
             + D   +NFE +PFG GRRSC G++ AMQV HL +AR +  F+ +T  + P+DMSE  G+
Sbjct  443   EFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSESPGL  502

Query  231   TLPRATALDVVITPRLPPSFY  169
             T+P+AT L+V+++PRL    +
Sbjct  503   TIPKATPLEVLMSPRLNEQLF  523



>emb|CDY23316.1| BnaA08g12300D [Brassica napus]
Length=523

 Score =   441 bits (1133),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 230/503 (46%), Positives = 319/503 (63%), Gaps = 17/503 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  G+ PI+GHL LLG     L R L  MA++YG   +LRLG     VVSS+E  K+CF
Sbjct  33    PEPSGSWPIIGHLHLLGGKEQLLYRTLGEMANRYGPAMSLRLGSSEAFVVSSFEVAKECF  92

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP  A AK++GYNYAVF     S +WR+MRK A  ELLS+++L+ L+H+RV
Sbjct  93    TVNDKALASRPMTAAAKHMGYNYAVFGFAPYSSFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1299  SEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKR-FKFKVKEDDDCD  1129
             SE+   +K+LY L      ++   V++  W   +TLN+IV++VAGKR F       +D +
Sbjct  153   SEISMGVKDLYSLWVKKGGSEPVMVNLKRWLEDMTLNMIVRMVAGKRYFGGGSTTPEDTE  212

Query  1128  EYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRW  949
             E ++ Q  I    +F +L G F   DAFP   + W + Q    K+M +   ELD IL+RW
Sbjct  213   EARQCQKAI---TKFFHLIGIFTMSDAFP--TLGWFDLQGHE-KEMKKTGSELDVILERW  266

Query  948   LDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIID  769
             ++ H   R++R  + N   K +  DFIDVMLS+ +      L Y     IK+T L++I+ 
Sbjct  267   IENH---RQQRKVSGN---KENDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILG  320

Query  768   GSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLR  589
             GSDTTA  LTW ++L++N+ D +K+ +++ID +VG +R VED DI+++ YLQA +KETLR
Sbjct  321   GSDTTASTLTWAIALLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLR  380

Query  588   LYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT--A  415
             LYP  P   P  A EDC V GY +  GT L VN WK+ RDP++W EP  F PERFLT  A
Sbjct  381   LYPAGPLLGPREAMEDCTVAGYHVACGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEA  440

Query  414   AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLG  235
              + D   +NFE IPFG GRRSC G++ AMQV HL +AR +  FD +T  +  +DMSE  G
Sbjct  441   KEFDVRGQNFELIPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPG  500

Query  234   ITLPRATALDVVITPRLPPSFYG  166
             +T+P+AT L+V+I+PRL    + 
Sbjct  501   LTIPKATPLEVMISPRLEKHLFA  523



>ref|XP_007134140.1| hypothetical protein PHAVU_010G022700g [Phaseolus vulgaris]
 gb|ESW06134.1| hypothetical protein PHAVU_010G022700g [Phaseolus vulgaris]
Length=530

 Score =   441 bits (1133),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 233/509 (46%), Positives = 317/509 (62%), Gaps = 23/509 (5%)
 Frame = -3

Query  1677  KKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             KK T  PE   A P +GHL LL +  IP  R  +AMA+KYG +F ++LG +  +VV+S E
Sbjct  36    KKGTKVPEPGVALPFIGHLHLL-NARIPYFRTFSAMAEKYGPIFCVKLGCHPTIVVNSRE  94

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
               K+C T ND+V A+RP+ +  + LGYN+AVF L     YWR++RK AV E+ SS +LEK
Sbjct  95    IAKECLTKNDRVFASRPNTSAGRILGYNHAVFGLAPYGNYWREIRKMAVLEIFSSYRLEK  154

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAK---TVDMSEWFGQLTLNLIVKIVAGKRFKFKVK  1147
             L+H+R SE  + +KELY  I+S  + K    V MS     +T N+IV+++AGKRF     
Sbjct  155   LKHVRDSETLSLVKELYSSISSIKNVKGSTEVAMSNLLEHMTFNIIVRMIAGKRFGGDTV  214

Query  1146  EDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELD  967
              ++D     EA  + +  K+  YL G FV  DA P   + W +FQ  +   M R  K+LD
Sbjct  215   NEED----NEAWKLRKAIKDATYLCGIFVVADAIP--SLSWFDFQGHL-SFMKRTAKKLD  267

Query  966   TILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMID--DDFARGLAYPPEIIIKA  793
              ILQ+WL+EHV  R    +   E      +DF+DVMLS  +  +DF     Y  EI+IKA
Sbjct  268   FILQKWLEEHVKTRGDNMNGGCE------RDFMDVMLSSFEGQEDFC---GYNREIVIKA  318

Query  792   TGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQ  613
             T + +++ GS +TA+ LTW LSL++NHP  +K  ++++D+ VGKERWV++ DIK++ YL 
Sbjct  319   TSVLLVLTGSGSTAITLTWALSLLLNHPRVLKAAQQELDNSVGKERWVQESDIKNLNYLH  378

Query  612   AAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMP  433
             A +KETLRLYPP P      A EDC V GY +PKG  L +N W++ RDP +W  P  F P
Sbjct  379   AIIKETLRLYPPAPLTGIREAMEDCCVAGYHVPKGARLLINLWELQRDPEVWSNPNEFNP  438

Query  432   ERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPL  256
             ERFLT  +  D   +NFE IPF  GRRSC G T+ +QV HLT+ARLIQGFD  T     +
Sbjct  439   ERFLTTHRDIDFMSQNFELIPFSFGRRSCPGVTFGLQVLHLTLARLIQGFDMSTKDGAEV  498

Query  255   DMSEGLGITLPRATALDVVITPRLPPSFY  169
             DM+EGLG+ LP+   L + + PRLP   Y
Sbjct  499   DMTEGLGVALPKENELQLTLAPRLPLMLY  527



>ref|XP_010664626.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=534

 Score =   440 bits (1132),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 233/519 (45%), Positives = 332/519 (64%), Gaps = 31/519 (6%)
 Frame = -3

Query  1701  SKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYR  1522
             SKI  S  +K+T  PE  GA P++GHL LLG   +P  + L AMADKYG VF ++LG+ R
Sbjct  38    SKIAKSSERKRT-APEAAGAWPVIGHLHLLGGPELP-HKTLGAMADKYGPVFLIKLGVQR  95

Query  1521  ILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTEL  1342
             +L++S+WE  K+CFTTNDKV A RP     + LGYNYA+F       YWR++RK   T L
Sbjct  96    VLMLSNWEMAKECFTTNDKVFANRPKSIAVEVLGYNYAMFGFGPYGSYWRQVRKIVTTGL  155

Query  1341  LSSQKLEKLRHLRVSEVETSLKELYMLIT---SSSSAKTVDMSEWFGQLTLNLIVKIVAG  1171
             LS+++LE ++H+ +SEV+ S++ELY L     S S+   V+M +WFG L+LN+++++++G
Sbjct  156   LSNRRLEIVKHVWISEVKASIRELYELWINKRSDSNMVLVEMKDWFGDLSLNMVLRMLSG  215

Query  1170  KRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDM  991
              R         D    +E     ++ ++F    G F+  DA P  ++RW +F     K M
Sbjct  216   GR---------DSSSKEERMRCHKLVRDFFQSMGTFLVSDALP--LLRWFDFGG-YEKAM  263

Query  990   GRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDD----DFARGL  823
              +  K+LD +L+ WL +H   + KRSS   +     +QDF+DVMLSM+DD    +  +G 
Sbjct  264   RKTAKDLDHLLESWLQQH---KSKRSSEQADG----NQDFMDVMLSMLDDMATDEDLKG-  315

Query  822   AYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVED  643
              +  + I KAT L+++  G+DT  V L W LSL++N P  +K  RE++DS VG+ER VE+
Sbjct  316   -FDADTINKATCLTILAGGTDTVTVSLIWALSLLLNKPQVLKTAREELDSHVGRERQVEE  374

Query  642   GDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPR  463
              D+K++ YL A VKETLRLYP  P  APH +TEDC +GGY IP GT L  N WK+HRDP 
Sbjct  375   RDMKNLAYLNAIVKETLRLYPAGPLTAPHESTEDCLLGGYHIPAGTRLLANLWKIHRDPS  434

Query  462   IWPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGF  286
             IW +P+ F PERFLT  +  D   ++FE IPFG GRR C G ++ +Q    T+A LIQGF
Sbjct  435   IWSDPDEFRPERFLTTHKDVDVKGQHFELIPFGSGRRICPGISFGLQFMQFTLASLIQGF  494

Query  285   DFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             +F T S++P+DM+E +G+T  +AT L+V++ PRL    Y
Sbjct  495   EFATMSDEPVDMTESIGLTNLKATPLEVLVAPRLSSDLY  533



>ref|XP_002282111.2| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera]
Length=525

 Score =   439 bits (1130),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 239/513 (47%), Positives = 320/513 (62%), Gaps = 20/513 (4%)
 Frame = -3

Query  1710  SWRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLG  1531
             S+   ++ S   K  + PE  GA PI+GHL LLG            MADKYG VF++RLG
Sbjct  22    SYHLLLWRSGAGKSRMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLG  81

Query  1530  MYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAV  1351
             + R +VVSSWE  K+CFTT+D  +A+RP+   AKYLGYNYA+F L     YWR++RK A 
Sbjct  82    LKRAVVVSSWEMAKECFTTHDLALASRPELVAAKYLGYNYAMFGLSPHGAYWREVRKIAT  141

Query  1350  TELLSSQKLEKLRHLRVSEVETSLKELYMLIT---SSSSAKTVDMSEWFGQLTLNLIVKI  1180
              ELLS+++LE L+++R+SEVET +KELY L     S +    VDM +WFG L+LN+I+K+
Sbjct  142   LELLSNRRLELLKNVRISEVETCMKELYELWAKKKSEAGVVLVDMKQWFGHLSLNVILKM  201

Query  1179  VAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVV  1000
             V GKR+     E  +    KEAQ   +  +EF  L G FV  DA PF  + W++     V
Sbjct  202   VVGKRYFGYAAESKE----KEAQQFQKAIREFFRLMGLFVVSDAIPF--LGWLDVGGH-V  254

Query  999   KDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA  820
             K M +  KELD I Q WL+EH   RRK S  A     +  QDF+DVMLS++         
Sbjct  255   KAMKKTAKELDGITQEWLEEH--RRRKDSGEA-----DGDQDFMDVMLSILGGRDTTD--  305

Query  819   YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDG  640
             Y  + I KAT L MI  G+DTT+  LTW +SL++N+P  +++ +E++D+ VGKER V + 
Sbjct  306   YDADTINKATSLVMIGGGADTTSGTLTWAVSLLLNNPHILRKAQEELDAHVGKERLVNEM  365

Query  639   DIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRI  460
             DI  + YLQA VKETLRL P  P   P    +D  +GGY I KGT L +N  K+ RDPR+
Sbjct  366   DISKLVYLQAIVKETLRLNPIAPLSGPRQFIQDSILGGYHISKGTRLILNLTKIQRDPRV  425

Query  459   WPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             W  P  F P+RFLT  +  D   ++FE  PFGGGRR C G  +A+QV HLT+A  +  F 
Sbjct  426   WLNPMEFQPDRFLTTHKDVDVRGKHFELTPFGGGRRICPGIVFALQVLHLTLANFLHRFQ  485

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRL  184
               TPS+ P+DMSEG G+T  ++T L+V+I+PRL
Sbjct  486   LSTPSDAPVDMSEGFGLTNIKSTPLEVLISPRL  518



>ref|XP_002869304.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45563.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   439 bits (1129),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 229/518 (44%), Positives = 322/518 (62%), Gaps = 19/518 (4%)
 Frame = -3

Query  1695  IFHSFTKKKTLP-----PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLG  1531
             +F +  KK   P     P   GA PI+GHL LLG     L R L  MAD YG   +LRLG
Sbjct  16    VFIALFKKSKKPNHVKAPAPSGAWPIIGHLHLLGGKEHLLYRTLGKMADHYGPAMSLRLG  75

Query  1530  MYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAV  1351
                  VVSS+E  KDCFT NDK +A+RP  A AK++GYN+AVF     S +WR+MRK A 
Sbjct  76    SSEAFVVSSFEVAKDCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIAT  135

Query  1350  TELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIV  1177
              ELLS+++L+ L+H+RVSE+   +K+LY L       +   VD+  W   +TLN+IV++V
Sbjct  136   IELLSNRRLQMLKHVRVSEISMGVKDLYSLWVKKGGTEPVMVDLKSWLEDMTLNMIVRMV  195

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
             AGKR+ F        ++ +EA    +   +F +L G F   DAFP   + W + Q    K
Sbjct  196   AGKRY-FGGGGSQSSEDTEEAMQCKKAIAKFFHLIGIFTVSDAFPR--LGWFDLQGHE-K  251

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
             +M +   ELD IL+RW++ H   R+   +  N+S      DFIDVMLS+ +      L Y
Sbjct  252   EMKQTGSELDVILERWIENHRQQRQVSGTKENDS------DFIDVMLSLAEQGKLSHLQY  305

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
                  IK+T L++I+ GSDT+A  LTW +SL++N+ + +K+ +++ID  VG ++ VED D
Sbjct  306   DANTSIKSTCLALILGGSDTSASTLTWAISLLLNNKEMLKKAQDEIDLHVGTDKNVEDSD  365

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIW  457
             I+++ YLQA +KETLRLYP  P   P  A EDC+V GY++P GT L VN WK+ RDP+++
Sbjct  366   IENLVYLQAIIKETLRLYPAGPLLGPREAMEDCRVAGYNVPCGTRLIVNVWKIQRDPKVY  425

Query  456   PEPERFMPERFLT--AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
              EP  F PERF+T  A + D   +NFE +PFG GRRSC G++ AMQV HL +AR +  F+
Sbjct  426   TEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFE  485

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              +T  + P+DMSE  G+T+P+AT L+V+I+PRL    +
Sbjct  486   AKTVLDLPVDMSESPGLTIPKATPLEVLISPRLNEELF  523



>gb|KFK29809.1| hypothetical protein AALP_AA7G181800 [Arabis alpina]
Length=524

 Score =   439 bits (1129),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 228/504 (45%), Positives = 320/504 (63%), Gaps = 20/504 (4%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA PI+GHL LLG     L R L  MAD YG   +LRLG     VVSS+E  KDCF
Sbjct  33    PEPSGAWPIIGHLHLLGGKDQLLYRTLGEMADHYGPAMSLRLGSSEAFVVSSFEVAKDCF  92

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             TTNDK +A+RP  A AK++GYN+AVF     S +WR+MRK A  ELLS+++L+ L+H+RV
Sbjct  93    TTNDKALASRPMTAAAKHMGYNFAVFGFAPYSSFWREMRKIATVELLSNRRLQMLKHVRV  152

Query  1299  SEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKR-FKFKVKEDDDCD  1129
             SE+   +++LY L      ++   VD+  W   +TLN+IV++VAGKR F       +D D
Sbjct  153   SEIAMGVQDLYSLWVKKGGSEPVMVDLKTWLEDMTLNMIVRMVAGKRYFGCGSVSSEDTD  212

Query  1128  EYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRW  949
             E ++ +  I    +F +L G F   DAFP   + W + Q    K M R   ELD IL+RW
Sbjct  213   EARQCKKAI---AKFFHLIGIFTVSDAFP--TLTWFDLQGHE-KKMKRTGSELDVILERW  266

Query  948   LDEHVDARRKRSSAANESG--KNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMI  775
             ++ H   R       N+SG  +N+  DFIDVMLS+ +      L Y  +  IK+T L++I
Sbjct  267   IENHKQQR-------NDSGTKENNDSDFIDVMLSLAEQGKLSHLQYDADTSIKSTCLALI  319

Query  774   IDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKET  595
             + GSDTTA  LTW ++L++N+ + +K+ +++ID +VG +R VED DI+++ YLQA +KET
Sbjct  320   LGGSDTTASTLTWAIALLLNNKEMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKET  379

Query  594   LRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT-  418
             LRLYP  P   P  A E+C V GY++ +G  L VN WK+ RDP+++ EP  F PERF+T 
Sbjct  380   LRLYPAGPLLGPREALENCTVAGYNVSRGKRLIVNVWKIQRDPKVYMEPNEFRPERFITG  439

Query  417   -AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEG  241
              A + D   +NFE IPFG GRRSC G++ A+QV HL +AR +  F+ +T  + P+DMSE 
Sbjct  440   EAKEFDVRGKNFELIPFGSGRRSCPGSSLALQVLHLGLARFLHSFEVKTILDLPVDMSES  499

Query  240   LGITLPRATALDVVITPRLPPSFY  169
              G+T+P+AT  +V+I+PRL    +
Sbjct  500   PGLTIPKATPFEVLISPRLEKQLF  523



>ref|XP_006340061.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=511

 Score =   438 bits (1127),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 225/501 (45%), Positives = 315/501 (63%), Gaps = 33/501 (7%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             P+  GA P +GHL LL +G +P+ R L  MADKYG +F L+LG +  +VVS+WE VKDCF
Sbjct  37    PKAPGAWPFIGHLHLL-NGHLPVCRTLGLMADKYGPIFQLQLGDHPAIVVSNWEIVKDCF  95

Query  1479  T-TNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             T  NDK+ ++RP+ AV+KYLGYN AVF++    PYWR +RK    ELL+  +LEKL+H+R
Sbjct  96    TANNDKIFSSRPNMAVSKYLGYNGAVFAMAPYGPYWRDIRKMVTVELLTHSRLEKLKHVR  155

Query  1302  VSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
              SEV   +KELY     S+    V++S WF  +T N+IV+++AGKRF    +E +    +
Sbjct  156   TSEVNCCIKELY-----SNCPSQVNLSSWFENITCNIIVRMLAGKRFTGCAEEMN----F  206

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
             KE+       K+ +YL G FVF DA P+  + W++    + K M    KE+D++   WL 
Sbjct  207   KES------IKKALYLGGAFVFSDAIPW--LEWMDIGGHI-KAMKETYKEVDSVFDSWLK  257

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMI-DDDFARGLAYPPEIIIKATGLSMIIDG  766
             +H+          N  G  +  DFID+MLS + ++      AY    IIKAT L +I+  
Sbjct  258   QHI----------NSIGDGEQSDFIDIMLSTLPEETNMESAAYNRHAIIKATTLILIMTA  307

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             S++TA  L W LSL++N+  ++K  + ++D ++G+ +WVE+ DIK++ YLQA VKETLRL
Sbjct  308   SESTAETLIWALSLLMNNTHSLKLAQNELDEQIGRNKWVEESDIKNLPYLQAIVKETLRL  367

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQA  406
             YPP P   P  A EDC +G Y I KGT L VN WK+ RD RIW +P  F PER+      
Sbjct  368   YPPGPLAGPREAIEDCYIGKYHIKKGTRLIVNLWKLQRDSRIWEDPNEFKPERWFLNEHT  427

Query  405   DAPWR--NFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
             +  +R  +FEYIPF  GRR C G T+A QV HLT+A+L+ GF+   P E+P+D+SEGLGI
Sbjct  428   NINFRGQHFEYIPFSSGRRMCPGLTFATQVVHLTLAKLLHGFNISMPKEEPVDVSEGLGI  487

Query  231   TLPRATALDVVITPRLPPSFY  169
              LP+   L  +++PRL    Y
Sbjct  488   ALPKVKPLQPLLSPRLAVELY  508



>ref|XP_010934114.1| PREDICTED: cytochrome P450 82C4-like [Elaeis guineensis]
Length=527

 Score =   439 bits (1128),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 229/515 (44%), Positives = 319/515 (62%), Gaps = 16/515 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             W +K   S  K++   P   GA P+LGHL LLGS    +GR L A+AD  G VF+LRLG 
Sbjct  26    WMAKKSKS-AKRRNQAPRPAGAWPVLGHLPLLGSHN-NIGRALKALADASGPVFSLRLGA  83

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
                LVV + EA K+CFT +DK +A RP    +K + YN A+    +  PYWR++RK    
Sbjct  84    SPALVVGTREAAKECFTVHDKALAGRPRSTASKLMCYNNAMVGFSSYGPYWREVRKILTI  143

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAG  1171
             ELLS  +L  L H+R SEV+   K LY L          V++S+WF +LT N++VK+VAG
Sbjct  144   ELLSHARLGSLAHVRASEVDAFAKTLYGLCRRGDEGPARVEISKWFQELTFNVVVKMVAG  203

Query  1170  KRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDM  991
             KR       DD      E++  I   +  M L   FV  D  PF  ++W++F     K M
Sbjct  204   KRCFVYGAVDDGGSS--ESRRFIGAIQRMMELLRAFVISDVVPF--LKWMDFGG-YEKAM  258

Query  990   GRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPP  811
              R    +D I+  WL EH    R+R       GK   QDF+DVML++++ +      + P
Sbjct  259   KRNAAVMDCIIGGWLREH----RERRMEGRGDGK---QDFMDVMLAIMEKEGELLSDHDP  311

Query  810   EIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIK  631
             + +IKA  L++II G+DTT+V +TW L+L++NHP  +++ +E++++ VG+ R V + D++
Sbjct  312   DTVIKANSLALIIGGTDTTSVTMTWALALMLNHPHVLRKAQEELEAHVGRARNVNESDVE  371

Query  630   DMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPE  451
              + YLQA VKETLRLYPP P   PH A EDC+V G+D+P GT + VNAW + RDP++WPE
Sbjct  372   KLVYLQAIVKETLRLYPPGPILLPHQAMEDCQVAGFDVPAGTQVLVNAWAIQRDPQVWPE  431

Query  450   PERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFET  274
             P  F PERFLT+        R  E +PFG GRR+C G ++A+QV HLT+AR+I GFD ET
Sbjct  432   PSAFRPERFLTSHGDVGVRGRQLELLPFGSGRRACPGASFALQVVHLTLARIIHGFDLET  491

Query  273   PSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             P+ +P+DM+EG G TLP+AT L+V++TPRL P  Y
Sbjct  492   PTGEPVDMTEGKGATLPKATPLEVLVTPRLAPVLY  526



>emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera]
Length=528

 Score =   439 bits (1128),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 231/518 (45%), Positives = 327/518 (63%), Gaps = 21/518 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             +R KI  +   K+   P   GA PI+GHL L G+  +   + L AMADKYG VFT+RLG+
Sbjct  25    YRLKIKAASNAKRCTAPRAGGAWPIIGHLHLFGAQQLT-HKTLGAMADKYGPVFTIRLGL  83

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
               ILV+SS E  ++CFTT+D+V + RP    +K LGY++A+F       YWR+MRK    
Sbjct  84    NEILVLSSSEMARECFTTHDRVFSTRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTI  143

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKT---VDMSEWFGQLTLNLIVKIV  1177
             ELLS+ +L+ L+H+R SEV TS++ELY +  S         VDM  WFG LTLNL V++V
Sbjct  144   ELLSNHRLDMLKHIRASEVGTSIRELYEMWVSERGTDGRVFVDMKRWFGDLTLNLAVRLV  203

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
              GKR+ F    D    E +  Q +I   ++F +L G FV  DA PF  + W++  +   K
Sbjct  204   GGKRY-FGAGADTKEGEGRTCQKVI---RDFAHLFGVFVLSDAIPF--LSWLDL-KGYKK  256

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
              M R  KELD++   WL EH + R          GK+D QDF+DVML++++D    G  +
Sbjct  257   AMKRTAKELDSLFGGWLQEHKEKR-----LLGGEGKDD-QDFMDVMLTVLEDVNFSG--F  308

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
               + + KAT L++I+ GSDTT V LTW LSL++NHP  +K+ + ++D +VGK+R V++ D
Sbjct  309   DADTVNKATCLNLILAGSDTTKVTLTWALSLLLNHPHVLKKAQAELDIQVGKDRQVDESD  368

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKV-GGYDIPKGTHLYVNAWKVHRDPRI  460
             +K++ YLQA +KETLRLYP  P    HAA EDC +  GY+I  GT + VNAWK+HRD R+
Sbjct  369   VKNLVYLQAIIKETLRLYPASPIITLHAAMEDCTLAAGYNISAGTQIMVNAWKIHRDERV  428

Query  459   WPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             W  P+ F PERF+T+ +  D   ++FE IPFG GRRSC G + A+QV H  +A L+  ++
Sbjct  429   WCNPKEFQPERFMTSHKDTDVRGQHFELIPFGSGRRSCPGISLALQVVHFALASLLHSYE  488

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
                PS+  +DM+E LG+T  +AT L+V+++PRL    Y
Sbjct  489   VTKPSDGDVDMTESLGLTNLKATPLEVLLSPRLKAELY  526



>gb|KEH18125.1| cytochrome P450 family protein [Medicago truncatula]
Length=506

 Score =   437 bits (1125),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 223/501 (45%), Positives = 325/501 (65%), Gaps = 33/501 (7%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PPE   A P++GHL LLG+  IPL R  A+ +DKYG +F +  G Y  L++S+ EA+K+C
Sbjct  38    PPEPSYALPLIGHLHLLGNQ-IPLARIFASFSDKYGPIFQIHFGAYPALIISNKEAIKEC  96

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             FTTNDK++A+RP  +   +LGYNYA F      PYW K+RK  + ELLSS++LE LRH+ 
Sbjct  97    FTTNDKILASRPKSSHGIHLGYNYAGFGFAPYGPYWTKLRKLTMLELLSSRRLESLRHVY  156

Query  1302  VSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
              SE++T +K+L + +        +  SEW               +R+   +K+ DD + +
Sbjct  157   ESEIDTLIKDLSLYVKVGKVKVVI--SEWL--------------ERYFEYLKDVDDVEAH  200

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
                 +I+++ KEFM+++G+FV  D  P  I+ W  F+ +V+K M RI ++LD ++  W++
Sbjct  201   G---NIVKLIKEFMHISGEFVPKDLIP--ILGWFGFEGKVLKSMKRIARDLDAVVGSWVE  255

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGS  763
             EH            ES  N+  DFIDVMLS+I+DD   G  +  + IIKA  +++++ GS
Sbjct  256   EH--------DVEIESKSNEKYDFIDVMLSVIEDDPTSG--HNRDTIIKANVMNLMLAGS  305

Query  762   DTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLY  583
             DTT+  +TW+L++++N+ +A+K  +E+ID  +G++R VE  DIK++ YLQA VKETLRLY
Sbjct  306   DTTSTTMTWILAILMNNMNALKHAQEEIDHHIGRDRRVESSDIKNLVYLQAIVKETLRLY  365

Query  582   PPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQA  406
             PP P   PH  TEDC +  Y +PKGT ++ N WK+HRDP IW EPE+F+PERF+    + 
Sbjct  366   PPGPLLVPHEVTEDCYIQDYYVPKGTRVFANVWKLHRDPSIWLEPEKFLPERFINENGEI  425

Query  405   DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITL  226
             D    +FEY+PFG GRR+C G+ +A QV  +T+ARL+ GFD E P ++ +DM EGLGITL
Sbjct  426   DHESHHFEYLPFGLGRRACPGSLFATQVILITLARLLHGFDLEVPMDEVVDMREGLGITL  485

Query  225   PRATALDVVITPRLPPSFYGL  163
             P+ T L VV+TPRL    Y L
Sbjct  486   PKLTPLQVVLTPRLSCELYRL  506



>emb|CAN74205.1| hypothetical protein VITISV_031127 [Vitis vinifera]
Length=525

 Score =   438 bits (1126),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 237/513 (46%), Positives = 316/513 (62%), Gaps = 20/513 (4%)
 Frame = -3

Query  1710  SWRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLG  1531
             S+   ++ S   K  + PE  GA PI+GHL LLG            MADKYG VF++RLG
Sbjct  22    SYHLLLWRSGAGKSRMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLG  81

Query  1530  MYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAV  1351
               R +VVSSWE  K+CFTT+D  +A+RP+   AKYLGYNYA+F+      YWR++RK A 
Sbjct  82    XKRAVVVSSWEMAKECFTTHDLALASRPEVVAAKYLGYNYAMFAFSPHGAYWREVRKIAT  141

Query  1350  TELLSSQKLEKLRHLRVSEVETSLKELYMLIT---SSSSAKTVDMSEWFGQLTLNLIVKI  1180
              ELLS+++LE L+++R+SEVET +KELY L     S +    VDM +WFG L+LN+I+K+
Sbjct  142   LELLSNRRLELLKNVRISEVETCMKELYKLWAEKKSEAGVVLVDMKQWFGHLSLNVILKM  201

Query  1179  VAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVV  1000
             V GKR+     E  +    KEAQ   +  +EF  L G FV  DA PF  + W++    V 
Sbjct  202   VVGKRYFGYAAESKE----KEAQQCQKAIREFFRLLGLFVVSDALPF--LGWLDVGGHV-  254

Query  999   KDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA  820
             K M +  KELD I Q WL+EH   RRK S  A+       QDF+DVMLS++      G  
Sbjct  255   KAMKKTAKELDGIAQEWLEEH--RRRKDSGEAD-----GDQDFMDVMLSILGATDPNG--  305

Query  819   YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDG  640
             Y  + I KAT L +I  G+DTT+  LTW +SL++N+P  +++ +E++D+ VGKER V + 
Sbjct  306   YDADXINKATSLILIAGGTDTTSXTLTWAISLLLNNPHVLRKAQEELDTHVGKERLVNEM  365

Query  639   DIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRI  460
             DI  + YLQA VKETLRLYP  P        +D  +GGY IPKGT L +N  K+ RDPR+
Sbjct  366   DISKLVYLQAIVKETLRLYPAAPLSGQRQFIQDSVLGGYHIPKGTRLLLNLTKIQRDPRV  425

Query  459   WPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             W  P  F P RFLT  +  D   ++F   PFGGGRR C G  +A+QV  LT+A  +  F 
Sbjct  426   WLNPTXFQPSRFLTTYKDVDVKGKHFVLTPFGGGRRICPGAAFALQVLPLTLANFLHKFQ  485

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRL  184
               TPS  P+DMSE  GIT  ++T L+V+I+PRL
Sbjct  486   LSTPSNSPIDMSESFGITNIKSTPLEVLISPRL  518



>ref|XP_007017415.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14640.1| Cytochrome P450, putative [Theobroma cacao]
Length=529

 Score =   438 bits (1126),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 235/505 (47%), Positives = 327/505 (65%), Gaps = 26/505 (5%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PEV GARP LGHL LLG G  P    L  +AD  G +FT+RLGM+  LVVS+WE  K+CF
Sbjct  42    PEVSGARPFLGHLHLLG-GSKPAHVVLGDLADTNGPIFTIRLGMHPTLVVSNWEIAKECF  100

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             TTNDK  A RP    A+ LGYNYA+F      PYWR++RK A  E+LS+ +LEKL+H+R 
Sbjct  101   TTNDKAFANRPRTIAAELLGYNYAMFGFSPYGPYWRQIRKIATLEVLSNHRLEKLKHIRE  160

Query  1299  SEVETSLKELYML----ITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKED--  1141
             SEV TS+KELY L    +++SSS K  V+M  WF  L +N++ K+V GKR+         
Sbjct  161   SEVRTSIKELYELGVEGVSNSSSGKVLVEMKRWFWTLNINMVFKMVVGKRYSEAETSHGK  220

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
             D+ D +++A       ++F  L G F  GD+ PF  +RW++      K M +  KELD I
Sbjct  221   DENDGHRKA------LRDFFELTGTFTVGDSLPF--LRWLDLGGHE-KAMKKTAKELDHI  271

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLS  781
             L+ WL+EH   ++KR+S   ES      DF+ +MLS+++D  A   +Y  + IIKAT L+
Sbjct  272   LEEWLEEH---KQKRNSGNAES----EHDFMGMMLSLLNDA-AELPSYNADTIIKATCLA  323

Query  780   MIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVK  601
             +I+ G+DTT V +TW LSL++NH D +++ + ++D+ VG+ER V++ D+K++ YLQA +K
Sbjct  324   IILGGTDTTTVTITWALSLLLNHHDVLEKAQHELDTYVGRERPVQESDVKNLVYLQAIIK  383

Query  600   ETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL  421
             ET RLYP  P    H + EDC   GY IP GT L VN  K+ RDP+ W  P+ F PERFL
Sbjct  384   ETTRLYPAAPLSVMHESVEDCTTAGYFIPAGTRLLVNLSKLQRDPKAWSNPDEFRPERFL  443

Query  420   TAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSE  244
             T  +  D   +N+E +PFG GRR C G ++A+QV   ++A L+Q F+  TPS++P+DM E
Sbjct  444   TTHKHFDVRGQNYELVPFGSGRRVCPGISFALQVLQFSLASLLQAFEITTPSDEPVDMGE  503

Query  243   GLGITLPRATALDVVITPRLPPSFY  169
             G G+T  +AT L+V++TPRLPP  Y
Sbjct  504   GAGLTNLKATPLEVILTPRLPPHLY  528



>ref|XP_010028533.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW55288.1| hypothetical protein EUGRSUZ_I01215 [Eucalyptus grandis]
Length=524

 Score =   437 bits (1125),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 225/506 (44%), Positives = 323/506 (64%), Gaps = 16/506 (3%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
              K+    PE  GA P+ GHL LLG   + L R LAAMA++YG  F++RLG++++LVVS+W
Sbjct  33    NKRGQTLPEAAGAWPLFGHLHLLGPNKL-LHRILAAMANQYGPAFSIRLGIHQVLVVSNW  91

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             E  K+CFT+ND+V   RP     K +GY++A+F      PYWR MRK AV ELLS+ +L+
Sbjct  92    EVAKECFTSNDRVFPTRPRSLSVKLMGYDHAMFGFAPYGPYWRGMRKLAVVELLSNHRLD  151

Query  1320  KLRHLRVSEVETSLKELY-MLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKE  1144
              L+H+R +E    +K LY   +++  +  TV+M + FG + +N+ V++VAGKR+    + 
Sbjct  152   LLKHVRDAETNLFVKGLYEKWLSNGENPVTVEMEKNFGHVAMNITVRMVAGKRYLSGNEG  211

Query  1143  DDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDT  964
             D++     E+    +   +F +L G+F+  DA PF  + W++  R  V +M R  KELD 
Sbjct  212   DEE-----ESSRCRKALGDFFHLVGEFMVSDAIPF--LGWLDVLRGRVAEMKRTAKELDW  264

Query  963   ILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGL  784
             +L RW++EH   R++R+ A  E   +D QDFI  MLS  + +  +      + I+KAT L
Sbjct  265   VLGRWVEEH---RKRRAVAKVE---DDEQDFIHFMLSATELEEGKYSVQEADTIVKATCL  318

Query  783   SMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAV  604
             S+I+ G+DTT + LTW LSL++N+P +++R ++++D +VGK R VE+ DIK++ YLQA V
Sbjct  319   SVILGGNDTTVLTLTWALSLLLNNPHSLERAQDELDVQVGKHRQVEESDIKNLTYLQAVV  378

Query  603   KETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERF  424
             KETLRLYP LP      A EDC V G+ +P GT L VN WK+ RDPR+W     F PERF
Sbjct  379   KETLRLYPVLPLSVQREAMEDCIVAGFHVPAGTRLMVNLWKLQRDPRVWSRASEFQPERF  438

Query  423   LT-AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMS  247
             LT     D   ++FEYIPFG GRR C G ++ +QV  L +ARL+  F  E  S   +DMS
Sbjct  439   LTDHVHVDVRGQSFEYIPFGTGRRMCPGVSFGLQVVQLILARLLHAFKLERVSGAEVDMS  498

Query  246   EGLGITLPRATALDVVITPRLPPSFY  169
             E  G+T+PRAT L+ V+TPRLP + Y
Sbjct  499   ESPGLTMPRATPLEAVLTPRLPATCY  524



>ref|XP_004291926.1| PREDICTED: cytochrome P450 82A3-like [Fragaria vesca subsp. vesca]
Length=538

 Score =   438 bits (1126),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 235/517 (45%), Positives = 331/517 (64%), Gaps = 14/517 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             W +K  ++    K   PE  GA P++GHL LLG G +P    L  MADKYG VFT++LG+
Sbjct  28    WITKASNTNVATKKGAPEAAGAWPLVGHLPLLG-GSLPPHITLGNMADKYGPVFTIKLGV  86

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +R L+VSSW+  K+C TTND+V A RP   V++ +GYNYA+F      PYWR+MRK A  
Sbjct  87    HRSLIVSSWDMAKECLTTNDRVFANRPKLLVSEVMGYNYAMFGFSPYGPYWRQMRKVATL  146

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYML--ITSSSSAKTVDMSEWFGQLTLNLIVKIVA  1174
             ELLS+ +LE L H+R SEV+T +K +Y L     +S    VDM  WFG +T++ + ++V 
Sbjct  147   ELLSNHRLESLNHVRESEVKTCIKNIYNLWKQNKNSDHVLVDMKRWFGDVTVSTMFRMVV  206

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR   ++ E     E +E +   +  +EF  L G+FV  DA PF  +RW++      K 
Sbjct  207   GKR---RLLETSSEREKEENERYRKATREFFRLTGEFVTADAVPF--LRWLDLGGHE-KA  260

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M +  KELD +L+RWL+EH   + KRSS  + S  ++  DF+D+MLS++DD       Y 
Sbjct  261   MKKTAKELDDVLERWLEEH---KLKRSSINSTSTSHEPDDFMDMMLSVLDDSILEFRGYT  317

Query  813   -PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
               + I KAT L++I+ G+DTT V LTW LSL+VN+P  +K+ + ++D+KVG+ R V + D
Sbjct  318   TADTINKATCLALILGGTDTTTVTLTWALSLLVNNPAVLKKAQNELDAKVGRNRQVNESD  377

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIW  457
             +K++ YLQA +KETLRLYP +P  APH +TEDC VG Y +P  T L VN WK+HRDP +W
Sbjct  378   VKNLMYLQAVIKETLRLYPAVPLLAPHESTEDCTVGNYRVPAKTRLIVNVWKLHRDPNVW  437

Query  456   PEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDF  280
              +P  F PERFL+     D   +NFE +PFG GRR C G + A+QV  LT+A L+ G++ 
Sbjct  438   QDPCIFRPERFLSCLGDFDVRGQNFELMPFGSGRRICPGISLALQVIELTLAHLLHGYEI  497

Query  279   ETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
               P ++P+DMSE +G+T  +AT L V++ PRL    Y
Sbjct  498   TAPLDEPVDMSETVGLTNMKATPLQVLLKPRLHADIY  534



>ref|XP_006376421.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP54218.1| cytochrome P450 family protein [Populus trichocarpa]
Length=511

 Score =   437 bits (1123),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 229/517 (44%), Positives = 322/517 (62%), Gaps = 25/517 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             W++      +KK    PE  GA P++GHL  L  G  P  + LAA+ADKYG +++LRLG 
Sbjct  15    WKTLARERESKKLARAPEPSGAWPVIGHLPRL-RGQDPACKTLAAIADKYGPIYSLRLGS  73

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +RI+VVSSWE VKDC TTND+++A R + A  K++GYN A F+L     YWR +RK    
Sbjct  74    HRIVVVSSWETVKDCLTTNDRILATRANIAAGKHMGYNNAAFALSPYGKYWRDVRKLVTL  133

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSS-AKTVDMSEWFGQLTLNLIVKIVAG  1171
             +LLS+ +LE L+H+RV EV+  +K L+     ++     V MS+ F  LT N+ ++ + G
Sbjct  134   QLLSNHRLEMLKHVRVLEVDAFIKGLHNSYAETAEYPAKVTMSKLFESLTFNISLRTIVG  193

Query  1170  KRFKFKV--KEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
             KR+   +  KE+ +   YK+A       ++ +YL+G FV  DA P+  + W++FQ  +  
Sbjct  194   KRYCSSLYDKENSEPWRYKKA------IEKALYLSGIFVMSDAIPW--LEWIDFQGHI-S  244

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
              M R  KELD ++  WL+EH+    +  S           DF+DV++S + D  A    Y
Sbjct  245   AMKRTAKELDAVIGSWLEEHLKKEIQGES-----------DFMDVIISNLADGAAEMSGY  293

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
               +++IKAT L + + G+ +TAV LTW LSL++NHP  +K  +E++D +VG+E+WVE+ D
Sbjct  294   SRDVVIKATTLILTLTGAGSTAVTLTWALSLLLNHPSVLKAAQEELDKQVGREKWVEESD  353

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIW  457
             I+++ YLQA VKETLRLYPP P      A EDC + GY +PKGT L VN WK+HRDPR+W
Sbjct  354   IQNLMYLQAIVKETLRLYPPGPLTGIREAMEDCHICGYYVPKGTRLVVNIWKLHRDPRVW  413

Query  456   PEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDF  280
               P+ F PERFLT  A  D   ++FE+IPF  GRRSC      M V HLT+ARL+QGFD 
Sbjct  414   KNPDDFQPERFLTTHADLDFRGQDFEFIPFSSGRRSCPAINLGMAVVHLTLARLLQGFDL  473

Query  279   ETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              T +  P+DM+EG GI LP+   L+ VI PRL    Y
Sbjct  474   TTVAGLPVDMNEGPGIALPKLIPLEAVIKPRLGLPLY  510



>ref|XP_004154826.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 82C4-like [Cucumis 
sativus]
Length=532

 Score =   437 bits (1123),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 226/511 (44%), Positives = 320/511 (63%), Gaps = 23/511 (5%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
             +K LPPEV GA P++GHL LL     P     A MAD YG +FTLRLG+Y  L+VS+WE 
Sbjct  38    RKRLPPEVGGALPLIGHLHLLDKNE-PAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEI  96

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKL  1315
              ++CFTTNDK+ A+RP    +K LGY+YA+  L    P+WR +RK  + ELL+S +L+KL
Sbjct  97    ARECFTTNDKIFASRPKLVASKLLGYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKL  156

Query  1314  RHLRVSEVETSLKELYMLI----TSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFK--FK  1153
             +H+RVSEV+TS+K LY L      ++     V+M  WFG +TLN I +IV GK+F     
Sbjct  157   QHIRVSEVQTSIKNLYELCLKNKKNNEKNALVEMKTWFGDITLNTISRIVVGKQFSTAVD  216

Query  1152  VKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKE  973
             V   ++ +EY++A       ++F    G FV  D+FPF  ++W++      K M +  + 
Sbjct  217   VSNTNENEEYRKA------LRDFSNXFGVFVPSDSFPF--LKWLDLGGHE-KAMKKTAQV  267

Query  972   LDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKA  793
             LD +  +W+ EH   +    +      K +  DF+DVMLS + DD  +   Y   I+ KA
Sbjct  268   LDEVFDKWIQEHQQKKNNLGAV-----KMEEHDFMDVMLSNVRDD-GQLSKYDAHIVTKA  321

Query  792   TGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQ  613
             T L++I+ GSDTT V + W LSL++N+ + +KR + ++D  VG++R V++ D+K++ YLQ
Sbjct  322   TCLALILAGSDTTTVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQ  381

Query  612   AAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMP  433
             A VKETLRLYP  P   PH + EDC V GY IP GT L VN  K+ RDP+IW +P  F P
Sbjct  382   AVVKETLRLYPAAPILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFRP  441

Query  432   ERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPL  256
             ERFLT+ +  D   ++ + IPFG GRR C G ++A+QV HL +A L+ GF+   P+++ L
Sbjct  442   ERFLTSEKDFDVRGQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELL  501

Query  255   DMSEGLGITLPRATALDVVITPRLPPSFYGL  163
             DM E  G+T  R   L+VV+TPRLPP  Y L
Sbjct  502   DMEESAGMTSIRKNPLEVVLTPRLPPQVYEL  532



>ref|XP_002282085.3| PREDICTED: cytochrome P450 82A1-like [Vitis vinifera]
Length=1053

 Score =   452 bits (1164),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 241/513 (47%), Positives = 329/513 (64%), Gaps = 26/513 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGR-KLAAMADKYGSVFTLRLG  1531
             WRS+        K + PE   A PI+GHL LL  G   L    L  MADKYG VFT+R+G
Sbjct  28    WRSR-----AGNKKIAPEAAAAWPIIGHLHLLAGGSHQLPHITLGNMADKYGPVFTIRIG  82

Query  1530  MYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAV  1351
             ++R +VVSSWE  K+C T ND+V ++RP+   +K LGYNYA+F       YWR+MRK   
Sbjct  83    LHRAVVVSSWEMAKECSTANDQVSSSRPELLASKLLGYNYAMFGFSPYGSYWREMRKIIS  142

Query  1350  TELLSSQKLEKLRHLRVSEVETSLKELYMLIT---SSSSAKTVDMSEWFGQLTLNLIVKI  1180
              ELLS+ +LE L+ +R SEV TS+KELY L     + S   +V+M +WFG LTLN+I+++
Sbjct  143   LELLSNSRLELLKDVRASEVVTSIKELYKLWAEKKNESGLVSVEMKQWFGDLTLNVILRM  202

Query  1179  VAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVV  1000
             VAGKR+        D  E K+AQ    VF+EF +L+G FV  DA PF  + W+++ R   
Sbjct  203   VAGKRYF----SASDASENKQAQRCRRVFREFFHLSGLFVVADAIPF--LGWLDWGRHE-  255

Query  999   KDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA  820
             K + +   E+D+I Q WL+EH   RR++ S  +    N  QDF+DVM S++D     G  
Sbjct  256   KTLKKTAIEMDSIAQEWLEEH---RRRKDSGDD----NSTQDFMDVMQSVLDGKNLGG--  306

Query  819   YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDG  640
             Y  + I KAT L++I  GSDTT V LTW LSL++N+ D +K+ +E++D +VGKER V + 
Sbjct  307   YDADTINKATCLTLISGGSDTTVVSLTWALSLVLNNRDTLKKAQEELDIQVGKERLVNEQ  366

Query  639   DIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRI  460
             DI  + YLQA VKETLRLYPP P       TEDC +GGY + KGT L +N  K+ +DPRI
Sbjct  367   DISKLVYLQAIVKETLRLYPPGPLGGLRQFTEDCTLGGYHVSKGTRLIMNLSKIQKDPRI  426

Query  459   WPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             W +P  F PERFLT  +  D   ++FE+IPFG GRR+C G T+ +QV HLT+A  +  F+
Sbjct  427   WSDPTEFQPERFLTTHKDVDPRGKHFEFIPFGAGRRACPGITFGLQVLHLTLASFLHAFE  486

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRL  184
             F TPS + ++M E LG+T  ++T L+V+I+PRL
Sbjct  487   FSTPSNEQVNMRESLGLTNMKSTPLEVLISPRL  519


 Score =   443 bits (1139),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 238/513 (46%), Positives = 319/513 (62%), Gaps = 20/513 (4%)
 Frame = -3

Query  1710  SWRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLG  1531
             S+   ++ S   K  + PE  GA PI+GHL LLG            MADKYG VF++RLG
Sbjct  550   SYHLLLWRSGAGKSRMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLG  609

Query  1530  MYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAV  1351
             + R +VVSSWE  K+CFTT+D  +A+RP+   AKYLGYNYA+F+      YWR++RK A 
Sbjct  610   LKRAVVVSSWEMAKECFTTHDLALASRPELVAAKYLGYNYAMFAFSPHGAYWREVRKIAT  669

Query  1350  TELLSSQKLEKLRHLRVSEVETSLKELYMLIT---SSSSAKTVDMSEWFGQLTLNLIVKI  1180
              ELLS+++LE L+++R+SEVET +KELY L     S +    VDM +WFG L+LN+I+K+
Sbjct  670   LELLSNRRLELLKNVRISEVETCMKELYKLWAEKKSEAGVVLVDMKQWFGHLSLNVILKM  729

Query  1179  VAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVV  1000
             V GKR+     E  +    KEAQ   +  +EF  L G FV  DA PF  + W++    V 
Sbjct  730   VVGKRYFGYAAESKE----KEAQQCQKAIREFFRLLGLFVVSDALPF--LGWLDVGGHV-  782

Query  999   KDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA  820
             K M +  KELD I Q WL+EH   RRK S  A+       QDF+DVMLS++      G  
Sbjct  783   KAMKKTAKELDGIAQEWLEEH--RRRKDSGEAD-----GDQDFMDVMLSILGATDPNG--  833

Query  819   YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDG  640
             Y  + I KAT L +I  G+DTT+V LTW +SL++N+P  +++ +E++D+ VGKER V + 
Sbjct  834   YDADTINKATSLILIAGGTDTTSVTLTWAISLLLNNPHVLRKAQEELDTHVGKERLVNEM  893

Query  639   DIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRI  460
             DI  + YLQA VKETLRLYP  P        +D  +GGY IPKGT L +N  K+ RDPR+
Sbjct  894   DISKLVYLQAIVKETLRLYPAAPLSGQRQFIQDSVLGGYHIPKGTRLLLNLTKIQRDPRV  953

Query  459   WPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             W  P +F P RFLT  +  D   ++F   PFGGGRR C G  +A+QV  LT+A  +  F 
Sbjct  954   WLNPTKFQPSRFLTTYKDVDVKGKHFVLTPFGGGRRICPGAAFALQVLPLTLANFLHKFQ  1013

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRL  184
               TPS  P+DMSE  GIT  ++T L+V+I+PRL
Sbjct  1014  LSTPSNSPIDMSESFGITNIKSTPLEVLISPRL  1046



>ref|XP_010919967.1| PREDICTED: cytochrome P450 CYP82D47-like [Elaeis guineensis]
Length=518

 Score =   436 bits (1121),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 228/502 (45%), Positives = 312/502 (62%), Gaps = 24/502 (5%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             P+  GA P+LGHL LLGS    +GR L A+AD  G VF LRLG    LVVS+WEA ++CF
Sbjct  35    PQPAGAWPVLGHLHLLGSHN-NIGRALKAVADAVGPVFALRLGARPALVVSTWEAARECF  93

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             TTNDK +A RP    +K + YN A+       PYWR++RK    ELLS  +L    H+R 
Sbjct  94    TTNDKALAGRPTSTASKLMCYNNAMVGFSPYGPYWRQVRKIFTVELLSHARLCSHAHVRA  153

Query  1299  SEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
             SEV+   K LY L          V+MS+WF +LT N++ ++VAGKR       DD  +  
Sbjct  154   SEVDAFAKTLYGLCRKVDGGPARVEMSKWFQELTFNVVARMVAGKRCFVYGAVDDGGN--  211

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVE---FQRRVVKDMGRIMKELDTILQR  952
             +EA+         M L G F+  D  PF  +RW++   +QR     M R   E+D I+  
Sbjct  212   REARRFTGAMHRMMELLGAFMVSDVVPF--LRWLDLGGYQRA----MKRTAAEMDGIIGG  265

Query  951   WLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMII  772
             WL EH    R R S     GK   +DF+DVMLS ++ +      + P+ +IKA  L++II
Sbjct  266   WLREH----RDRRSEGRAEGK---EDFMDVMLSTMEKEGELFSDHDPDTVIKANSLALII  318

Query  771   DGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETL  592
              G+DTT+V + W L+L++NHP+ ++  +E++DS VGK+R V++ D++ + YLQA VKETL
Sbjct  319   AGTDTTSVTMIWALALLLNHPNVLRTAQEELDSHVGKDRNVKESDVEKLVYLQAIVKETL  378

Query  591   RLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAA  412
             RLYPP PT  PH   EDC+V G+D+P GT + VNAW +  DP +WP+P  F PERFLT+ 
Sbjct  379   RLYPPGPTLIPHQTMEDCQVSGFDVPAGTQVLVNAWAIQHDPEVWPDPSAFRPERFLTSH  438

Query  411   Q-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLG  235
             +  D   R+FE +PFG GRR+C G ++A+QV HL +AR+I GFD    +  P+DM+EG G
Sbjct  439   KDVDIRGRHFELLPFGSGRRACPGASFALQVVHLALARIIHGFDM---AGGPVDMTEGKG  495

Query  234   ITLPRATALDVVITPRLPPSFY  169
              TLP+AT L V++TPRLPP  Y
Sbjct  496   ATLPKATPLQVLVTPRLPPGLY  517



>gb|KGN59914.1| hypothetical protein Csa_3G852630 [Cucumis sativus]
Length=538

 Score =   437 bits (1123),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 226/511 (44%), Positives = 319/511 (62%), Gaps = 23/511 (5%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
             +K LPPEV GA P++GHL LL     P     A MAD YG +FTLRLG+Y  L+VS+WE 
Sbjct  44    RKRLPPEVGGALPLIGHLHLLDKNE-PAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEI  102

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKL  1315
              ++CFTTNDK+ A+RP    +K LGY+YA+  L    P+WR +RK  + ELL+S +L+KL
Sbjct  103   ARECFTTNDKIFASRPKLVASKLLGYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKL  162

Query  1314  RHLRVSEVETSLKELYMLITSSSSAKT----VDMSEWFGQLTLNLIVKIVAGKRFK--FK  1153
             +H+RVSEV+TS+K LY L   +         V+M  WFG +TLN I +IV GK+F     
Sbjct  163   QHIRVSEVQTSIKNLYELCLKNKKNNEKNALVEMKTWFGDITLNTISRIVVGKQFSTAVD  222

Query  1152  VKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKE  973
             V   ++ +EY++A       ++F    G FV  D+FPF  ++W++      K M +  + 
Sbjct  223   VSNTNENEEYRKA------LRDFFEWFGVFVPSDSFPF--LKWLDLGGHE-KAMKKTAQV  273

Query  972   LDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKA  793
             LD +  +W+ EH   +    +      K +  DF+DVMLS + DD  +   Y   I+ KA
Sbjct  274   LDEVFDKWIQEHQQKKNNLGAV-----KMEEHDFMDVMLSNVRDD-GQLSKYDAHIVTKA  327

Query  792   TGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQ  613
             T L++I+ GSDTT V + W LSL++N+ + +KR + ++D  VG++R V++ D+K++ YLQ
Sbjct  328   TCLALILAGSDTTTVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQ  387

Query  612   AAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMP  433
             A VKETLRLYP  P   PH + EDC V GY IP GT L VN  K+ RDP+IW +P  F P
Sbjct  388   AVVKETLRLYPAAPILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFHP  447

Query  432   ERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPL  256
             ERFLT+ +  D   ++ + IPFG GRR C G ++A+QV HL +A L+ GF+   P+++ L
Sbjct  448   ERFLTSEKDFDVRGQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELL  507

Query  255   DMSEGLGITLPRATALDVVITPRLPPSFYGL  163
             DM E  G+T  R   L+VV+TPRLPP  Y L
Sbjct  508   DMEESAGMTSIRKNPLEVVLTPRLPPQVYEL  538



>ref|XP_004147803.1| PREDICTED: cytochrome P450 82C4-like [Cucumis sativus]
Length=532

 Score =   436 bits (1122),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 226/511 (44%), Positives = 319/511 (62%), Gaps = 23/511 (5%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
             +K LPPEV GA P++GHL LL     P     A MAD YG +FTLRLG+Y  L+VS+WE 
Sbjct  38    RKRLPPEVGGALPLIGHLHLLDKNE-PAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEI  96

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKL  1315
              ++CFTTNDK+ A+RP    +K LGY+YA+  L    P+WR +RK  + ELL+S +L+KL
Sbjct  97    ARECFTTNDKIFASRPKLVASKLLGYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKL  156

Query  1314  RHLRVSEVETSLKELYMLITSSSSAKT----VDMSEWFGQLTLNLIVKIVAGKRFK--FK  1153
             +H+RVSEV+TS+K LY L   +         V+M  WFG +TLN I +IV GK+F     
Sbjct  157   QHIRVSEVQTSIKNLYELCLKNKKNNEKNALVEMKTWFGDITLNTISRIVVGKQFSTAVD  216

Query  1152  VKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKE  973
             V   ++ +EY++A       ++F    G FV  D+FPF  ++W++      K M +  + 
Sbjct  217   VSNTNENEEYRKA------LRDFFEWFGVFVPSDSFPF--LKWLDLGGHE-KAMKKTAQV  267

Query  972   LDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKA  793
             LD +  +W+ EH   +    +      K +  DF+DVMLS + DD  +   Y   I+ KA
Sbjct  268   LDEVFDKWIQEHQQKKNNLGAV-----KMEEHDFMDVMLSNVRDD-GQLSKYDAHIVTKA  321

Query  792   TGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQ  613
             T L++I+ GSDTT V + W LSL++N+ + +KR + ++D  VG++R V++ D+K++ YLQ
Sbjct  322   TCLALILAGSDTTTVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQ  381

Query  612   AAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMP  433
             A VKETLRLYP  P   PH + EDC V GY IP GT L VN  K+ RDP+IW +P  F P
Sbjct  382   AVVKETLRLYPAAPILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFHP  441

Query  432   ERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPL  256
             ERFLT+ +  D   ++ + IPFG GRR C G ++A+QV HL +A L+ GF+   P+++ L
Sbjct  442   ERFLTSEKDFDVRGQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELL  501

Query  255   DMSEGLGITLPRATALDVVITPRLPPSFYGL  163
             DM E  G+T  R   L+VV+TPRLPP  Y L
Sbjct  502   DMEESAGMTSIRKNPLEVVLTPRLPPQVYEL  532



>ref|XP_010432796.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   436 bits (1121),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 223/506 (44%), Positives = 318/506 (63%), Gaps = 14/506 (3%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
             K    P+  GA PI+GHL LLG     L R L  MAD YG+  +L+LG     VVSS+E 
Sbjct  28    KHVKAPKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEV  87

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKL  1315
              K+CFT NDK +A+RP  A AK++GYN+AVF     S +WR+MRK A  ELLS+++L+ L
Sbjct  88    AKNCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQML  147

Query  1314  RHLRVSEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
             +H+RVSE+   +K+LY L   +  ++   VD+  W   +T N+IV++VAGKR+       
Sbjct  148   KHVRVSEISMGVKDLYSLWVKNGGSEPVIVDLKRWSEDMTQNVIVRMVAGKRY-LGGAVS  206

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
             +  ++  EA+       +F +L G F   DAFP   +RW +FQ    K+M +   ELD I
Sbjct  207   ESSEDAAEARQCKRAISKFFHLIGIFTVSDAFP--ALRWFDFQGHE-KEMKQTGSELDVI  263

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLS  781
             L+RW + H   R+   +  N+S      DFIDVMLS+ +      L Y     IK+T LS
Sbjct  264   LERWTENHRQERKVSGTKENDS------DFIDVMLSLEEQGKLSHLQYDANTSIKSTCLS  317

Query  780   MIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVK  601
             +I+ GSDTT+  LTW ++L++N+ + +K+ +++ID  VG++R VED DI ++ YLQA +K
Sbjct  318   LILGGSDTTSSTLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDINNLVYLQAIIK  377

Query  600   ETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL  421
             ETLRLYP  P   P  A EDC V GY++  GT L VN WK+ RDP+++ EP  F PERF+
Sbjct  378   ETLRLYPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYKEPNEFRPERFI  437

Query  420   T--AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMS  247
             T  A + D   +NFE +PFG GRRSC G++ AMQV HL +AR +  F+ +T  + P+DM+
Sbjct  438   TGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMT  497

Query  246   EGLGITLPRATALDVVITPRLPPSFY  169
             E  G+T+P+AT L+V+I+PRL    +
Sbjct  498   ESPGLTIPKATPLEVLISPRLKEHLF  523



>ref|XP_006346673.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=518

 Score =   435 bits (1119),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 230/506 (45%), Positives = 320/506 (63%), Gaps = 21/506 (4%)
 Frame = -3

Query  1677  KKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
              ++T+ P+  GA P +GHL LL SG +P+ R L  M DKYG +F L+LG +  LVVSSWE
Sbjct  28    NRETVAPKAPGALPFIGHLYLL-SGDLPVCRILGLMTDKYGPIFQLQLGSHPALVVSSWE  86

Query  1497  AVKDCFTT-NDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
              VKDCFT  NDK+ A+RP  A++KYLGYN A+F+L     YWR +RK    ELL++ +LE
Sbjct  87    MVKDCFTAGNDKIFASRPSMALSKYLGYNGAIFALAPYGQYWRDIRKMVTVELLTNSRLE  146

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
             KL+H+R SEV  S+K+LY    SS++   V++S WF  +T N+I++++ GKRF       
Sbjct  147   KLKHVRTSEVNCSIKDLYS-NCSSNNNSEVNLSSWFENITFNIIIRMLVGKRFT------  199

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
               C  ++   +  E  K+ +YL G FVF DA P   + W++    + K M +  KE+D++
Sbjct  200   -GC--FEAEMNFKESIKKVLYLGGTFVFSDAIP--SIEWMDIGGHI-KSMKQTYKEVDSV  253

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLS  781
             L  WL +H++ R+   S  N SG +D  DF DVMLS + ++      Y    IIKAT L 
Sbjct  254   LDSWLKQHIEKRKDCDS--NSSG-SDQSDFFDVMLSTLPEETMES-GYDRNAIIKATALI  309

Query  780   MIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVK  601
             +I+  S++TA  L W LS+++N   ++K  +++++  VG+ RWVE+ DIK++ YLQA VK
Sbjct  310   LIMTASESTAETLIWALSMLINGTRSLKLAQDELEEHVGRNRWVEESDIKNLPYLQAIVK  369

Query  600   ETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL  421
             ETLRLYPP P   P  A EDC VG Y I KGT L VN WK+ RD RIW +P  F PER+ 
Sbjct  370   ETLRLYPPGPLAGPREAIEDCYVGNYHIKKGTRLIVNLWKLQRDSRIWEDPNEFKPERWF  429

Query  420   TAAQADAPWR--NFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMS  247
                 ++  +R  NFEYIPF  GRR C G T+  QV HLT+A+L+ GF+  T  E+P+D+S
Sbjct  430   LKEHSEFNFRGQNFEYIPFSSGRRMCPGLTFGSQVVHLTLAKLLHGFNISTTREEPIDLS  489

Query  246   EGLGITLPRATALDVVITPRLPPSFY  169
             EGLGI LP+   L   ++PRL    Y
Sbjct  490   EGLGIALPKVKPLQPFVSPRLAVELY  515



>ref|XP_004247061.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=518

 Score =   435 bits (1119),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 222/500 (44%), Positives = 315/500 (63%), Gaps = 31/500 (6%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             P+  GA P +GHL LL SG +P+ R L  MADKYG +F L+LG +  +VVS+WE VKDCF
Sbjct  44    PKAPGAWPFIGHLHLL-SGHLPVCRTLGLMADKYGPIFQLQLGDHPAIVVSNWEMVKDCF  102

Query  1479  TT-NDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             T  NDK+ A+RP+ A++KYLGYN A+F+L    PYWR +RK    ELL++ +LEKL+H+R
Sbjct  103   TAKNDKIFASRPNMAISKYLGYNGAIFALAPYGPYWRNIRKMVTLELLTNSRLEKLKHVR  162

Query  1302  VSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
              SEV + +KELY    S++    V++S WF  +T N+I++++AGKRF    +E +    +
Sbjct  163   TSEVNSCIKELY----SNNCPGQVNLSSWFENITCNIIIRMLAGKRFTGSAEEMN----F  214

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
             KE+       K+ +YL G FVF D+ P++   W++    + K M    KE+D++   WL 
Sbjct  215   KES------IKKALYLGGTFVFSDSIPWF--EWMDIGGHI-KAMKDTYKEVDSVFDSWLK  265

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGS  763
             +H+          N  G  +  DFID+MLS + ++      Y  + IIKAT L +I+  S
Sbjct  266   QHI----------NSIGDGEQSDFIDIMLSTLPEETNMESGYNRDAIIKATTLILIMTAS  315

Query  762   DTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLY  583
             ++TA  L W LSL++N+  ++K  ++++D  +G+ +WVE+ DIK++ YLQA VKETLRLY
Sbjct  316   ESTAETLIWALSLLLNNTHSLKLAQDELDEHIGRNKWVEESDIKNLPYLQAIVKETLRLY  375

Query  582   PPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQAD  403
             PP P   P  A EDC V  Y I KGT L VN WK+ RD RIW +P  F PER+      +
Sbjct  376   PPGPLAGPREALEDCYVDKYHIKKGTRLIVNLWKLQRDSRIWKDPNEFKPERWFLKEHTN  435

Query  402   APWR--NFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGIT  229
               +R  NFEYIPF  GRR C G T+  QV HLT+A+L+ GF+     E+P+D+SEGLGI 
Sbjct  436   INFRGQNFEYIPFSSGRRMCPGLTFGSQVVHLTLAKLLHGFNVSMLKEEPVDLSEGLGIA  495

Query  228   LPRATALDVVITPRLPPSFY  169
             LP+   L  +++PRL    Y
Sbjct  496   LPKVKPLQPLLSPRLAVELY  515



>dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=511

 Score =   435 bits (1118),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 233/522 (45%), Positives = 332/522 (64%), Gaps = 28/522 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTL--PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRL  1534
             WR++   S +K  T    PE  GA PI+GHL LLG G     + L AMADKYG +F +R+
Sbjct  11    WRTR---SSSKTNTCKEAPEAPGAWPIIGHLHLLG-GSELRHKTLGAMADKYGPIFKIRI  66

Query  1533  GMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFA  1354
             G+   LVVS+ +  K+CFTTNDK  A+RP    +K LGY+Y +F +     YW ++RK  
Sbjct  67    GVNHALVVSNSDIAKECFTTNDKAFASRPTSTASKILGYDYVMFGMAPYGQYWVELRKIT  126

Query  1353  VTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAK---TVDMSEWFGQLTLNLIVK  1183
             ++ELLS+++LE L+H+R SE++ S+++LY +  +   AK    VDM +WFG LTLN+I++
Sbjct  127   MSELLSNRRLELLKHVRDSEIDASIQDLYKVWKNHDKAKGPVLVDMKQWFGDLTLNVILR  186

Query  1182  IVAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRV  1003
             ++AGKR+   +     CDE  EA+   +  ++F  L G F+  DA P+  + W + Q   
Sbjct  187   MIAGKRYSGSMSS---CDE-TEARTCQKGMRDFFRLLGLFIIEDALPY--LSWFDLQG-Y  239

Query  1002  VKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGK-NDHQDFIDVMLSMIDDDFARG  826
              K+M    KELD++ QRWL+EH   R        ++G+ N  QDF+DV++S+++D   R 
Sbjct  240   KKEMKNTAKELDSVFQRWLEEHNRMR--------QTGELNREQDFMDVLMSILED--TRI  289

Query  825   LAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVE  646
               Y  + IIK+T LS++  G DTT V LTW+LSL++N+  A+K+ ++++DS VGK+R VE
Sbjct  290   SEYDNDTIIKSTCLSIVTGGGDTTMVTLTWILSLLLNNKHALKKAQDELDSHVGKDRQVE  349

Query  645   DGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDP  466
             + DIK++ YLQA  KE LRLYP  P   P  A  DC V GY +P GT L VN +K+ RDP
Sbjct  350   ESDIKNLVYLQAITKEALRLYPAGPLSGPRVADADCTVAGYHVPAGTRLIVNTYKIQRDP  409

Query  465   RIWPEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQG  289
              +W EP  F PERFLT+    D    ++E IPFG GRRSC G ++ +QV  L +AR +  
Sbjct  410   LVWSEPSEFRPERFLTSHVNMDVKGLHYELIPFGAGRRSCPGMSFTLQVVPLVLARFLHE  469

Query  288   FDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYGL  163
             FD +T  + P+DM+E  G+T  +AT L+VVITPRL P  YGL
Sbjct  470   FDSKTEMDMPVDMTETAGLTNAKATPLEVVITPRLHPEIYGL  511



>gb|KDP38438.1| hypothetical protein JCGZ_04363 [Jatropha curcas]
Length=526

 Score =   436 bits (1120),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 231/514 (45%), Positives = 324/514 (63%), Gaps = 29/514 (6%)
 Frame = -3

Query  1686  SFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVS  1507
             S TK++   PE  GA P++GHL L   G  PL   L  MADK G +F ++LGM+  LVVS
Sbjct  33    SSTKRERKVPEAGGAWPLIGHLHLF-RGSKPLHIILGKMADKMGPIFKIKLGMHPTLVVS  91

Query  1506  SWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQK  1327
             +WE  K C TTND+V A RP    +  +GYN A+       PYWR+MRK A+ ELLS+Q+
Sbjct  92    NWEMAKQCLTTNDQVFATRPKTLASVLVGYNRAMLPFSPYGPYWRQMRKIAILELLSNQR  151

Query  1326  LEKLRHLRVSEVETSLKELYMLITSSSSAKT---VDMSEWFGQLTLNLIVKIVAGKRFKF  1156
             ++    +R SEV T LKELY     + +++    V+M  WFG +TLNLI +I+ GK   +
Sbjct  152   IQTQSRVRESEVRTFLKELYKFWDKNKNSQNKVLVEMVRWFGDMTLNLICEIIVGKSVGY  211

Query  1155  KVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVE---FQRRVVKDMGR  985
                E        E++   +  ++   L G+FV  DA PF  +RW +   F++ ++K    
Sbjct  212   VTTEGGG-----ESKIWKQGLRDLFDLIGKFVAADAIPF--LRWFDIGGFEKAMIKTA--  262

Query  984   IMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDD-DFARGLAYPPE  808
               KELD + + WL EH   ++KR+S      K   + F+ +ML+++D    A+G    P 
Sbjct  263   --KELDLVAEGWLKEH---KKKRASGF----KQGEEHFMGLMLNILDHTQVAQGPHSDP-  312

Query  807   IIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKD  628
              I KA  LS+I+  SDTTAV L W LSL+VN+P+A+K+ ++++D  VG+ER +++ DIK+
Sbjct  313   -INKAVSLSLILVASDTTAVTLNWALSLLVNNPNALKKAQDELDMHVGRERQIQESDIKN  371

Query  627   MEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEP  448
             +EYLQA +KETLRLYP  P   PH +TEDC VGGYDIP GT L +N WK+H DPR+W  P
Sbjct  372   LEYLQAILKETLRLYPAGPLSLPHESTEDCTVGGYDIPAGTKLVINIWKIHHDPRVWENP  431

Query  447   ERFMPERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETP  271
               F PERFLT+ +  D   +NFE+IPFG GRR C G ++ +QV  LT+A L+  FD ETP
Sbjct  432   FEFRPERFLTSHKDFDVRGQNFEFIPFGSGRRRCPGISFGLQVMQLTLANLLHSFDIETP  491

Query  270   SEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             S +P+DM+E +G+T  RAT L++++ PRLPP  Y
Sbjct  492   SNEPVDMTENIGLTNLRATPLEILMHPRLPPHLY  525



>gb|ABK55756.1| P450 monooxygenase-like protein [Stylosanthes guianensis]
Length=521

 Score =   435 bits (1119),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 214/471 (45%), Positives = 315/471 (67%), Gaps = 9/471 (2%)
 Frame = -3

Query  1596  PLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGY  1417
             PL + LA+ AD +G +F +RLG Y  LV+S+ +A+K CFTTND V+A+RP  +   +LGY
Sbjct  60    PLAKILASFADNHGPIFRIRLGAYPALVISNKKAIKKCFTTNDVVLASRPKSSHGIHLGY  119

Query  1416  NYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAK  1237
             N+A F      PYW K+RK A+ ELLS +++E LR +  SE++T + +L   +   S  K
Sbjct  120   NFAGFGFAPYGPYWTKLRKLAMLELLSPRRIESLRDVYESEIDTMINDLLSYLGGDSGVK  179

Query  1236  TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVF  1057
              V +SEW  +LT N+I+K++AGKR+   +K+ DD    +E+  I+++ KEFM+++G+ V 
Sbjct  180   VV-ISEWLERLTFNIIIKMIAGKRYFSYLKDADD----EESNRIVKLIKEFMHISGELVP  234

Query  1056  GDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQ  877
              D  P  IV WV  Q +V+K+M RI K+LD I+  W++EH     +     N S  ++ Q
Sbjct  235   SDLIP--IVGWVPIQGQVLKNMKRIAKDLDAIVGSWVEEHDVKSDEDQKNKNNSSSSEKQ  292

Query  876   DFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMK  697
              FID MLS+I+DD   G  +  + IIKA  +++++ GSDTT+  +TW+LS+++ +  A+K
Sbjct  293   YFIDFMLSVIEDDPTSG--HTRDNIIKANIMNLMLAGSDTTSTTMTWILSMLLTNKHALK  350

Query  696   RIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDI  517
             R +E+ID +VGK++ V+  DIK++ YLQA  KETLRLYPP P   PH A EDC + GY +
Sbjct  351   RAQEEIDLRVGKDKSVKASDIKNLVYLQAIFKETLRLYPPGPLLVPHEAREDCYIQGYYV  410

Query  516   PKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQADAPWRNFEYIPFGGGRRSCIGNT  337
             PKGT ++ N WK+HRDP IW EPE+F PERF+          NFEY+PFG GRR+C  +T
Sbjct  411   PKGTRVFANVWKLHRDPSIWSEPEKFSPERFINGNGELNEDHNFEYLPFGSGRRACPEST  470

Query  336   YAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITLPRATALDVVITPRL  184
             +A+QVS +T+A L+Q FD + P  + +D+ EGLGITLP+ T L + +T R+
Sbjct  471   FAIQVSFITLALLLQKFDLDVPMCETVDLREGLGITLPKLTPLQITLTSRI  521



>ref|XP_009768110.1| PREDICTED: cytochrome P450 82A4-like [Nicotiana sylvestris]
Length=520

 Score =   435 bits (1118),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 219/505 (43%), Positives = 323/505 (64%), Gaps = 27/505 (5%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG---IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             KTLPPE+ G  P++GHL    + G     L +KL  +ADK+G VFT +LG  R LVVSS+
Sbjct  37    KTLPPEIPGGWPVIGHLFYFKNDGDHDRTLAQKLGDLADKHGPVFTYKLGFRRFLVVSSY  96

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             EA+K+CFTTND   + RP      +L YN A+  +    PYWRK+RK    E+LS  +LE
Sbjct  97    EAIKECFTTNDIRFSNRPALLYGDHLCYNNAMLFIAKYGPYWRKIRKLVNQEVLSVNRLE  156

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
             K + +R S V+ ++KELY          T+++++W  +L+ ++I+K++AGK +       
Sbjct  157   KFKCIRFSIVQKNVKELY-----DHCDSTINLTDWIDKLSFDIILKMIAGKSYN------  205

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
                + + E   I   F++FM +  +F   D FP  + +WV+F   + K +    K++DT+
Sbjct  206   ---NGHGEILKI--AFQKFMVIAMEFELYDIFPIPLFKWVDFSGNI-KVVKETFKDIDTV  259

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLS  781
              Q WLDEH+  R +     NE+   + +DFID MLS   ++   G  + P   IKAT  S
Sbjct  260   FQGWLDEHIKKRER-----NETLDENEEDFIDSMLSKTSNEHL-GDTHSPNTTIKATIFS  313

Query  780   MIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVK  601
             +++D ++T A+H+ W+++L++N+   MK+ +++ID+ VGK+RWVE+ DIK++ YLQA VK
Sbjct  314   LVLDATETLALHIKWVMALLINNKLEMKKAQKEIDTIVGKDRWVEESDIKNLVYLQAIVK  373

Query  600   ETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL  421
             E LRLYPP P   PH + EDC V GY IPKGT L  N  K+ RDP+IW +P++F PERFL
Sbjct  374   EALRLYPPAPLSVPHESVEDCVVNGYHIPKGTVLLPNVMKLQRDPKIWSDPDKFDPERFL  433

Query  420   TA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSE  244
             T  A+ D   +++E+IPFG GRR+C   TYA+QV +L++A LIQGF+F TPS + LDM E
Sbjct  434   TTHAKIDYRGQHYEFIPFGTGRRACPAMTYALQVEYLSIAHLIQGFNFNTPSNESLDMKE  493

Query  243   GLGITLPRATALDVVITPRLPPSFY  169
             G+GIT P+   ++V+ITPRL  + Y
Sbjct  494   GVGITSPKKNPIEVLITPRLSTTLY  518



>ref|XP_002282118.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   435 bits (1118),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 234/508 (46%), Positives = 319/508 (63%), Gaps = 20/508 (4%)
 Frame = -3

Query  1695  IFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRIL  1516
             ++ S   K  + PE  GA PI+GHL LLG         L  MADKYG+VF++RLG+ R +
Sbjct  27    LWRSGAGKGRMAPEAAGAWPIIGHLHLLGGSKNLPHLLLGTMADKYGAVFSVRLGLERAV  86

Query  1515  VVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLS  1336
             VVSSW+  K+CFTT+D  +A+RP   ++K LGYN A+F+      YWR++RK A  ELLS
Sbjct  87    VVSSWQMAKECFTTHDLALASRPQLVISKQLGYNDAMFAFSPHGAYWREVRKIATLELLS  146

Query  1335  SQKLEKLRHLRVSEVETSLKELYMLIT---SSSSAKTVDMSEWFGQLTLNLIVKIVAGKR  1165
             +++LE L+++R+SEVET +KELY L     + +    VDM +WFG LTLN+I+ +VAGKR
Sbjct  147   NRRLELLKNVRISEVETCMKELYKLWAEKKNEAGVVLVDMKQWFGDLTLNVILMMVAGKR  206

Query  1164  FKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGR  985
             +     E  +    KE Q   +  +EF  L G FV  DA PF  + W++    + K   +
Sbjct  207   YFGYTAESQE----KETQRCQKSIREFFRLLGLFVVSDALPF--LGWLDVGGHL-KATKK  259

Query  984   IMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEI  805
               KE+D I Q WL+EH   +RK S  AN      +QD +DVMLS++      G  Y  + 
Sbjct  260   TAKEMDGIAQEWLEEH--RQRKDSGEAN-----GNQDLMDVMLSILAGTDPTG--YDADT  310

Query  804   IIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDM  625
             I KAT L +I  GSDTT+V LTW +SL++N+P  +++ +E++D+ VGK R V + D+  +
Sbjct  311   INKATSLILIAGGSDTTSVTLTWAISLLLNNPCMLRKAQEELDTHVGKGRLVNEVDLSKL  370

Query  624   EYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPE  445
              YLQA VKETLRLYP  P   P    +D  +GGY IPKGT L +N  K+ RDP IW  P 
Sbjct  371   VYLQAIVKETLRLYPAFPLSGPRQFNQDSILGGYRIPKGTRLVLNLTKIQRDPSIWLNPT  430

Query  444   RFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPS  268
              F PERFLT  +  D   +NFE+ PFGGGRR C G T+A+QV HLT+A  +  F   TPS
Sbjct  431   EFQPERFLTTHKDIDMRVKNFEFTPFGGGRRICPGATFALQVLHLTLANFLHKFQLSTPS  490

Query  267   EKPLDMSEGLGITLPRATALDVVITPRL  184
             +  +DMSE LGIT  ++T L+V+I+PRL
Sbjct  491   DATVDMSESLGITNIKSTPLEVLISPRL  518



>ref|XP_002282133.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=525

 Score =   435 bits (1118),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 231/508 (45%), Positives = 318/508 (63%), Gaps = 20/508 (4%)
 Frame = -3

Query  1695  IFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRIL  1516
             ++ S   K  + PE  GA PI+GHL LLG         L  MADKYG+VF++RLG+ R +
Sbjct  27    LWRSGAGKGRMAPEAAGAWPIIGHLHLLGGSKNLPHLLLGTMADKYGAVFSVRLGLKRAV  86

Query  1515  VVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLS  1336
             VVSSW+  K+CFTT+D  +A+RP   ++K LGYN A+F+      YWR++RK A  ELLS
Sbjct  87    VVSSWQMAKECFTTHDLALASRPQLVISKQLGYNDAMFAFSPHGAYWREVRKIATLELLS  146

Query  1335  SQKLEKLRHLRVSEVETSLKELYMLIT---SSSSAKTVDMSEWFGQLTLNLIVKIVAGKR  1165
             +++LE L+++R+SEVET +KELY L     + +    VDM +WFG LTLN+I+ +V GKR
Sbjct  147   NRRLELLKNVRISEVETCMKELYKLWAEKKNEAGVVLVDMKQWFGDLTLNVILMMVVGKR  206

Query  1164  FKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGR  985
             +     E  +    KE Q   +  +EF  L G FV  DA PF  + W++    + K   +
Sbjct  207   YFGYTAESQE----KETQRCQKSIREFFRLLGLFVVSDALPF--LGWLDVGGHL-KATKK  259

Query  984   IMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEI  805
               KE+D I Q WL+EH    R+R  +   SG   +QD +DVMLS++      G  Y  + 
Sbjct  260   TAKEMDGIAQEWLEEH----RRRKDSGEASG---NQDLMDVMLSILAGTDPTG--YDADT  310

Query  804   IIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDM  625
             I KAT L +I  GSDTT+V LTW++SL++N+P  +++ +E++D+ VGK R V + D+  +
Sbjct  311   INKATSLILIAGGSDTTSVTLTWVISLLLNNPCMLRKAQEELDTHVGKGRLVNEVDLSKL  370

Query  624   EYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPE  445
              YLQA VKETLRLYP LP   P    +D  +GGY IP GT L +N  K+ RDP +W  P 
Sbjct  371   VYLQAIVKETLRLYPALPLSGPRQFNQDSILGGYRIPNGTRLVLNLTKIQRDPSVWLNPT  430

Query  444   RFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPS  268
              F PERFLT  +  D   +NFE+ PFGGGRR C G T+A+QV HLT+A  +  F   TPS
Sbjct  431   EFQPERFLTTHKDVDMRGKNFEFTPFGGGRRICPGATFALQVLHLTLANFLHKFQLSTPS  490

Query  267   EKPLDMSEGLGITLPRATALDVVITPRL  184
                +DMSE LGIT  ++T L+V+I+PRL
Sbjct  491   NATVDMSESLGITNIKSTPLEVLISPRL  518



>ref|XP_009595933.1| PREDICTED: cytochrome P450 82A4-like [Nicotiana tomentosiformis]
Length=523

 Score =   434 bits (1117),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 221/505 (44%), Positives = 321/505 (64%), Gaps = 26/505 (5%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGG---IPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             KTL PE+ G  P++GHL    +       L +KL  +ADK+G VFT +LG  R LVVSS+
Sbjct  39    KTLAPEIPGGWPVIGHLFYFKNDADHDRTLAQKLGDLADKHGPVFTYKLGFRRFLVVSSY  98

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             +A+K+CFTTND   + RP      +L YN A+  +    PYWRK+RK    E+LS  +LE
Sbjct  99    DAIKECFTTNDIRFSNRPALLYGDHLCYNNAMLFIAKYGPYWRKIRKLVNQEVLSVNRLE  158

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
             K +++R S V+ ++KELY          T+++++W  +L+ ++I+K++AGK +       
Sbjct  159   KFKYIRFSIVQENVKELY-----DHCDSTINLTDWIDKLSFDIILKMIAGKSYN------  207

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
                + + E   I   F++FM +  +F   D FP  + +WV+F   V K +    K++DT+
Sbjct  208   ---NGHGEILKI--AFQKFMVIAMEFELYDIFPIPLFKWVDFSGNV-KVVKETFKDIDTV  261

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLS  781
              Q WLDEH+    K+  + NE    + QDFID MLS   ++   G  Y P   IKAT  S
Sbjct  262   FQGWLDEHI----KKRESNNEVLDENEQDFIDSMLSKTSNE-RLGDTYSPSTTIKATIFS  316

Query  780   MIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVK  601
             +++D ++T A+H+ W+++L++N+   MK+ +E+ID+ VGK+RWVE+ DIK++ YLQA VK
Sbjct  317   LVLDATETLALHIKWVMALLINNKLEMKKAQEEIDTIVGKDRWVEESDIKNLVYLQAIVK  376

Query  600   ETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL  421
             E LRLYPP P   PH + EDC V GY IPKGT L  N  K+ RDP++W +P +F PERFL
Sbjct  377   EALRLYPPAPLSVPHESVEDCVVNGYHIPKGTVLLPNVMKLQRDPKMWLDPNKFDPERFL  436

Query  420   TA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSE  244
             T  A+ D   +++E IPFG GRR+C   TYA+QV +L++A LIQGF+F TPS +PLDM E
Sbjct  437   TTHAKIDYRGQHYELIPFGTGRRACPAMTYALQVEYLSIAHLIQGFNFNTPSNEPLDMKE  496

Query  243   GLGITLPRATALDVVITPRLPPSFY  169
             G+GIT P+   ++V+ITPRLP   Y
Sbjct  497   GVGITSPKKNPIEVLITPRLPTMLY  521



>ref|NP_194922.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
 sp|Q9SZ46.1|C82C4_ARATH RecName: Full=Cytochrome P450 82C4 [Arabidopsis thaliana]
 emb|CAA16595.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79912.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE85981.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
Length=524

 Score =   434 bits (1117),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 224/501 (45%), Positives = 316/501 (63%), Gaps = 14/501 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             P   GA PI+GHL LLG     L R L  MAD YG   +L+LG     VVSS+E  KDCF
Sbjct  33    PAPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGPAMSLQLGSNEAFVVSSFEVAKDCF  92

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP  A AK++GYN+AVF     S +WR+MRK A  ELLS+++L+ L+H+RV
Sbjct  93    TVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1299  SEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SE+   +K+LY L   +   K   VD+  W   +TLN+IV++VAGKR+ F        ++
Sbjct  153   SEITMGVKDLYSLWFKNGGTKPVMVDLKSWLEDMTLNMIVRMVAGKRY-FGGGGSVSSED  211

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
              +EA    +   +F +L G F   DAFP   + + + Q    K+M +   ELD IL+RW+
Sbjct  212   TEEAMQCKKAIAKFFHLIGIFTVSDAFP--TLSFFDLQGHE-KEMKQTGSELDVILERWI  268

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
             + H   R+   +  N+S      DFIDVM+S+ +      L Y     IK+T L++I+ G
Sbjct  269   ENHRQQRKFSGTKENDS------DFIDVMMSLAEQGKLSHLQYDANTSIKSTCLALILGG  322

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             SDT+A  LTW +SL++N+ + +K+ +++ID  VG++R VED DI+++ YLQA +KETLRL
Sbjct  323   SDTSASTLTWAISLLLNNKEMLKKAQDEIDIHVGRDRNVEDSDIENLVYLQAIIKETLRL  382

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT--AA  412
             YP  P   P  A EDC V GY +P GT L VN WK+ RDP+++ EP  F PERF+T  A 
Sbjct  383   YPAGPLLGPREAMEDCTVAGYYVPCGTRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAK  442

Query  411   QADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
             + D   +NFE +PFG GRRSC G++ AMQV HL +AR +  FD +T  + P+DMSE  G+
Sbjct  443   EFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTVMDMPVDMSENPGL  502

Query  231   TLPRATALDVVITPRLPPSFY  169
             T+P+AT L+V+I+PR+    +
Sbjct  503   TIPKATPLEVLISPRIKEELF  523



>ref|XP_009801068.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana sylvestris]
Length=468

 Score =   432 bits (1110),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 223/476 (47%), Positives = 313/476 (66%), Gaps = 16/476 (3%)
 Frame = -3

Query  1572  MADKYGSVFTLRLGMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLD  1393
             MAD YG  F LRLG     VVSSWE  K+CFT NDK +A+RP    AK++GY YAVF   
Sbjct  1     MADNYGPAFNLRLGSRGAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFA  60

Query  1392  TDSPYWRKMRKFAVTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKT-----VD  1228
               S +WR+MRK A+ ELLS+++L+ L+H++VSEVE  ++ELY L  +++S  +     V+
Sbjct  61    PYSTFWREMRKIAMYELLSNRRLDTLKHVQVSEVEMGIQELYKLWVNNNSGHSCRPVLVE  120

Query  1227  MSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDA  1048
             +  WF  LTLN+IV++VAGKR+ F      D DE +  Q  I    +F +L G FV  DA
Sbjct  121   LKGWFEDLTLNVIVRMVAGKRY-FGAGATCDDDEARRCQKAI---NQFFHLIGIFVPSDA  176

Query  1047  FPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFI  868
             FP  I+ W + Q    K M R  KELD+IL+ WL EH    R+++  ++E+     QDFI
Sbjct  177   FP--ILGWFDIQGHE-KAMKRTAKELDSILEGWLQEH--RHREKTRFSHEAKNEGAQDFI  231

Query  867   DVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIR  688
             DVMLS+  +       Y  +  IK+T L++I+ GSDTTA  LTW +SL++N+P  +++ +
Sbjct  232   DVMLSLQQEGRLSNFQYDADTSIKSTCLALILGGSDTTAGTLTWAISLLLNNPQILRKAQ  291

Query  687   EDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKG  508
             ++ID  VGK+R V++ DI+++ Y+QA +KETLRLYP  P   P  A ++C+VGGY I  G
Sbjct  292   KEIDLHVGKDRQVDESDIQNLAYIQAIIKETLRLYPAGPLLGPREAMDECEVGGYKIIPG  351

Query  507   THLYVNAWKVHRDPRIWPEPERFMPER-FLTAAQADAPWRNFEYIPFGGGRRSCIGNTYA  331
             T L VN WK+ RDPRIW +P+ F P+R F++ +  D   ++FE IPFG GRRSC G + A
Sbjct  352   TRLIVNVWKIQRDPRIWEDPDSFKPDRFFMSNSNVDVKGQDFELIPFGSGRRSCPGASLA  411

Query  330   MQVSHLTVARLIQGFDFETPSEKPL-DMSEGLGITLPRATALDVVITPRLPPSFYG  166
             +QV HLT+AR +Q F+F  P +  L D++E  G+T+P+AT LDV+ITPRL  + YG
Sbjct  412   LQVLHLTLARFLQAFEFSKPVDDQLIDLTESPGLTIPKATPLDVLITPRLSANLYG  467



>ref|XP_009780811.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana sylvestris]
Length=708

 Score =   440 bits (1131),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 232/519 (45%), Positives = 323/519 (62%), Gaps = 18/519 (3%)
 Frame = -3

Query  1710  SWRSKIFHSFTKKKTL-PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRL  1534
             +++S+   S  K  ++  P+  GA P +GHL LL S  +P  R L  MADKYG +F L+L
Sbjct  200   TYKSRNRASTAKNSSIGAPKAPGAWPFIGHLHLL-SDPVPACRTLGLMADKYGPIFQLQL  258

Query  1533  GMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFA  1354
             G +  LVVSSWE VKDCFTTNDK+ A+RP   ++KY  YN AVF+L    PYWR++RK  
Sbjct  259   GTHPALVVSSWEMVKDCFTTNDKIFASRPKMTLSKYF-YNDAVFALAPYGPYWREIRKMV  317

Query  1353  VTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIV  1177
               EL ++ +LEKL+H+R SEV+  +KELY    ++++  T V++S WF  +T N+I++++
Sbjct  318   TLELFTNSRLEKLKHVRASEVDCCIKELYSFCNNNNNFPTQVNLSSWFEHITCNIIIRML  377

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
             AGKRF   V E     E +  + I    K+ ++L G FV  D  P   + W++    + K
Sbjct  378   AGKRFSSSVNEQSGTKEMQFKESI----KKALFLGGTFVVSDVIPS--LEWMDIGGHI-K  430

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQ-DFIDVMLSMIDDDFARGLA  820
              M +   E+D++   WL EH+   +KR    N +  +DHQ DFIDVMLS + ++      
Sbjct  431   AMKQTFNEVDSVFDIWLKEHI---QKRKDCENSNTGDDHQSDFIDVMLSTLPEETMVS-G  486

Query  819   YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDG  640
             Y  + IIKAT L +I+  S++TA  L W LSL++N    +K  ++++D  VG+ RWVE+ 
Sbjct  487   YDRDAIIKATTLILIMTASESTAETLIWTLSLLMNDRRILKIAQDELDEHVGRNRWVEES  546

Query  639   DIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRI  460
             D+K+++YLQA VKETLRLYPP P   P  A EDC VG Y I KGT L VN WK+ RD  I
Sbjct  547   DMKNLKYLQAIVKETLRLYPPGPLAGPREAIEDCYVGKYHIRKGTRLIVNLWKLQRDSSI  606

Query  459   WPEPERFMPERFLTAAQADAPWR--NFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGF  286
             W  P  F PER+      +  +R  +FEYIPF  GRR C G T+  QV HLT+ARL+ GF
Sbjct  607   WENPNEFQPERWFLKEHMNINFRGQSFEYIPFSSGRRMCPGLTFGTQVVHLTLARLLHGF  666

Query  285   DFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             +   P E+P+D+SEGLGI LP+   L  ++TPRLP   Y
Sbjct  667   NISMPREEPVDLSEGLGIALPKMKPLQPLLTPRLPMELY  705



>ref|XP_010447469.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=527

 Score =   434 bits (1115),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 221/497 (44%), Positives = 319/497 (64%), Gaps = 13/497 (3%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PP+  GA PI+GHL LL      L R L  +AD+YG   +LRLG     VVSS+E  KDC
Sbjct  34    PPKPSGAWPIIGHLHLLVGKEQLLYRTLGRLADRYGPTMSLRLGSSEAFVVSSFEVAKDC  93

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             FT NDK +A+RP  A AK++GYNYAVF     + +WR+MRK A  ELLS+++L+ L+H+ 
Sbjct  94    FTVNDKALASRPMTAAAKHMGYNYAVFGFAPYNAFWREMRKIATIELLSNRRLQMLKHVS  153

Query  1302  VSEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCD  1129
             VSE+   +K+LY L   +  ++   VD+  W   +TLN+IV++VAGKR+   V   +  +
Sbjct  154   VSEISMGVKDLYSLWVKNGGSEPVMVDLRRWLDNMTLNMIVRMVAGKRYFGGVVGSESSE  213

Query  1128  EYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRW  949
             + +E +       +F +L G F   DAFP   +RW +FQ    K+M +   ELD IL++W
Sbjct  214   DTEEGRQCKTAISKFFHLIGIFTVSDAFP--SLRWFDFQGHE-KEMKQTGSELDVILEKW  270

Query  948   LDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIID  769
             +D H   R++R  +  E   +D   FI VMLS+ +      L Y   I IK+T L++I+ 
Sbjct  271   IDNH---RQERKVSGTEEIDSD---FIHVMLSLAEQGKLSHLQYDANISIKSTCLALILG  324

Query  768   GSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLR  589
             GS+TT+  LTW ++L++N+ + +K+ +++ID  VG++R VE  DI ++ YLQA VKETLR
Sbjct  325   GSETTSSTLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVEVSDINNLVYLQAVVKETLR  384

Query  588   LYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT--A  415
             LYP  P   P  A EDC V GY++ +GT L VN WK+ RDP+++ EP  F PERF+T  A
Sbjct  385   LYPAGPLLGPREAMEDCTVAGYNVTRGTRLIVNVWKIQRDPKVYKEPNEFRPERFITGEA  444

Query  414   AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLG  235
              + D   +NFE +PFG GRRSC G++ AMQV HL +AR +  F+ +T  + P+DM+E  G
Sbjct  445   KEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMTESPG  504

Query  234   ITLPRATALDVVITPRL  184
             +T+P+AT L+V+I+PRL
Sbjct  505   LTIPKATPLEVLISPRL  521



>ref|NP_001236179.1| cytochrome P450 CYP82C1 [Glycine max]
 gb|AAB94590.1| CYP82C1p [Glycine max]
Length=532

 Score =   434 bits (1115),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 226/514 (44%), Positives = 325/514 (63%), Gaps = 23/514 (4%)
 Frame = -3

Query  1689  HSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVV  1510
             HS   K    P+  GA PI+GHL L G G     + L  MA+K+G +FT++LG Y++LV+
Sbjct  33    HSGHGKICSAPQAGGAWPIIGHLHLFG-GHQHTHKTLGIMAEKHGPIFTIKLGSYKVLVL  91

Query  1509  SSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQ  1330
             SSWE  K+CFT +DK  + RP  A +K +GYNYA+F      PYWR++RK    +LLS+ 
Sbjct  92    SSWEMAKECFTVHDKAFSTRPCVAASKLMGYNYAMFGFTPYGPYWREIRKLTTIQLLSNH  151

Query  1329  KLEKLRHLRVSEVETSLKELYMLITSSSSAK---TVDMSEWFGQLTLNLIVKIVAGKRFK  1159
             +LE L++ R SE E +++ELY L +     K    VDM +WFG LT N+++++V GK + 
Sbjct  152   RLELLKNTRTSESEVAIRELYKLWSREGCPKGGVLVDMKQWFGDLTHNIVLRMVRGKPYY  211

Query  1158  FKVKEDDDCDEYK--EAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGR  985
                  D   D+Y   EA+   +V  E + L G FV  DA PF  + W++      K M R
Sbjct  212   -----DGASDDYAEGEARRYKKVMGECVSLFGVFVLSDAIPF--LGWLDIN-GYEKAMKR  263

Query  984   IMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEI  805
                ELD +++ WL+EH     KR  A N   K +  +F+DVML+++ D    G  Y  + 
Sbjct  264   TASELDPLVEGWLEEH-----KRKRAFNMDAKEEQDNFMDVMLNVLKDAEISG--YDSDT  316

Query  804   IIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDM  625
             IIKAT L++I+ GSDTT + LTW+LSL++NH   +K++++++D+ +GK+R VE+ DI  +
Sbjct  317   IIKATCLNLILAGSDTTMISLTWVLSLLLNHQMELKKVQDELDTYIGKDRKVEESDITKL  376

Query  624   EYLQAAVKETLRLYPPLPTYAPHAATEDCKV-GGYDIPKGTHLYVNAWKVHRDPRIWPEP  448
              YLQA VKET+RLYPP P     AA EDC   GGY IP GT L VNAWK+HRD R+W +P
Sbjct  377   VYLQAIVKETMRLYPPSPLITLRAAMEDCTFSGGYHIPAGTRLMVNAWKIHRDGRVWSDP  436

Query  447   ERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETP  271
               F P RFLT+ +  D   +N+E +PFG GRR+C G + A++V HLT+ARL+  F+  +P
Sbjct  437   HDFKPGRFLTSHKDVDVKGQNYELVPFGSGRRACPGASLALRVVHLTMARLLHSFNVASP  496

Query  270   SEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             S + +DM+E +G+T  +AT L++++TPRL    Y
Sbjct  497   SNQVVDMTESIGLTNLKATPLEILLTPRLDTKLY  530



>ref|XP_002283952.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   433 bits (1114),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 232/514 (45%), Positives = 321/514 (62%), Gaps = 22/514 (4%)
 Frame = -3

Query  1710  SWRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLG  1531
             S+   ++ +   K  + PE  GA PI+GHL LLG            MADKYG VF++RLG
Sbjct  22    SYHLLLWRTGAGKSRMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLG  81

Query  1530  MYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAV  1351
             + R +VV+SWE  K+CFTT+D  +A+RP+   AKYLGYNYA+F+      YWR++RK A 
Sbjct  82    LKRAVVVNSWEMAKECFTTHDLALASRPEVEAAKYLGYNYAMFAFSPHGAYWREVRKIAT  141

Query  1350  TELLSSQKLEKLRHLRVSEVETSLKELYMLIT---SSSSAKTVDMSEWFGQLTLNLIVKI  1180
              ELLS+++LE L+++R+SEVET +KELY L     + +    VDM EWFG LTLN+I+ +
Sbjct  142   LELLSNRRLELLKNVRISEVETCMKELYKLWAEKKNEAGVVLVDMKEWFGHLTLNVILMM  201

Query  1179  VAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVV  1000
             VAGKR+     E  +    KEAQ   +  +EF  L G FV  DA PF+   W++    + 
Sbjct  202   VAGKRYFGYTGESKE----KEAQQCRKAIREFFRLWGLFVVSDAIPFF--GWLDVGGHL-  254

Query  999   KDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA  820
             K M +  KELD I Q WL+EH    R+R  +    G   +QDF+DV LS++     R + 
Sbjct  255   KAMKKTAKELDGIAQEWLEEH----RQRKDSGEADG---NQDFMDVTLSILG---GRDIT  304

Query  819   -YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVED  643
              Y  + I KAT L +I  G+DTT+  LTW++SL++N+PD +++ +E++D+ VGKER V +
Sbjct  305   DYDADTINKATALILIGGGTDTTSATLTWVISLLLNNPDVLRKAQEELDAHVGKERLVNE  364

Query  642   GDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPR  463
              DI  + YLQA VKETLR+ P  P   P    +D  +GGY I KGT L +N  K+ RDPR
Sbjct  365   MDISKLVYLQAIVKETLRINPTAPLSGPRQFIQDSILGGYHISKGTRLILNLTKIQRDPR  424

Query  462   IWPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGF  286
             +W  P  F P+RFLT  +  D   + FE  PFGGGRR C G  +A+QV HLT+A  +  F
Sbjct  425   VWLNPMEFQPDRFLTTHKDVDVRGKQFELTPFGGGRRICPGAVFALQVLHLTLANFLHRF  484

Query  285   DFETPSEKPLDMSEGLGITLPRATALDVVITPRL  184
                TPS+ P+DMSE  G+T  ++T L+V+I+PRL
Sbjct  485   QLSTPSDAPVDMSESFGLTNIKSTPLEVLISPRL  518



>ref|XP_006283535.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
 gb|EOA16433.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
Length=524

 Score =   433 bits (1113),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 221/501 (44%), Positives = 318/501 (63%), Gaps = 14/501 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             P+  GA PI+GHL L+      L R L  MAD YG+  +L+LG     VVSS+E  KDCF
Sbjct  33    PKPSGAWPIIGHLHLISGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKDCF  92

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP  A AK++GYN+AVF     S +WR+MRK A  ELLS+++L+ L+H+RV
Sbjct  93    TVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1299  SEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SE+   +  LY L      ++   VD+  W   +TLN++V++VAGKR+ F     +   +
Sbjct  153   SEISMGVNYLYSLWVKKGGSEPVMVDLKSWLDDMTLNMVVRMVAGKRY-FGGAGSESSKD  211

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
              +EA+   +   +F +L G F   DAFP   + W + Q    K+M +   ELD IL+RW+
Sbjct  212   TEEARQCKKAIAKFFHLIGIFTVSDAFP--TLGWFDLQGHE-KEMKQTGIELDVILERWV  268

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
             + H   R+      N+S      DFIDVMLS+ +      L Y   I IK+T L++I+ G
Sbjct  269   ENHRQQRKVSGPKENDS------DFIDVMLSLAEQGKLSHLQYDANISIKSTCLALILGG  322

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             S+TT+  LTW ++L++N+ + +K+ +++ID  VG ER VED DI+++ Y+QA +KETLRL
Sbjct  323   SETTSSTLTWAIALLLNNKEMLKKAQDEIDLHVGTERNVEDSDIENLVYVQAIIKETLRL  382

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT--AA  412
             YP  P   P  A EDC V G+++ +GT L VN WK+ RDPR++ EP  F PERF+T  A 
Sbjct  383   YPAGPLLGPREAMEDCTVAGHNVSRGTRLIVNVWKIQRDPRVYMEPNEFRPERFVTGEAK  442

Query  411   QADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
             + D   +NFE +PFG GRRSC G++ AMQV HL +AR++Q FD +T S+  +DMSE  G+
Sbjct  443   KFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARILQSFDVKTVSDMAVDMSESPGL  502

Query  231   TLPRATALDVVITPRLPPSFY  169
             T+P+AT L+V+I+PRL    +
Sbjct  503   TIPKATPLEVLISPRLKEHLF  523



>emb|CAN65652.1| hypothetical protein VITISV_016780 [Vitis vinifera]
Length=473

 Score =   431 bits (1108),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 228/514 (44%), Positives = 306/514 (60%), Gaps = 65/514 (13%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR K   +   K   PPE  GA P +GHL LL  G +P+ R L AMADK G VF +RLGM
Sbjct  24    WRGKTL-THKSKGMSPPEPSGAWPFVGHLHLL-HGKVPVFRTLGAMADKVGPVFVIRLGM  81

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             YR LVVS+ EA K+CFTTNDK+ A+RP+ + AK LGYNYA F+     PYWR+MRK ++ 
Sbjct  82    YRTLVVSNREAAKECFTTNDKIFASRPNSSAAKILGYNYAAFAFAPHGPYWREMRKXSML  141

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGK  1168
             E+LS+++L                                            ++++VAGK
Sbjct  142   EILSTRRL--------------------------------------------VLRMVAGK  157

Query  1167  RFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMG  988
             R+   V    +     EA+  I   K+ + L G  V  D  PF  + WV+ Q  +   M 
Sbjct  158   RYFNNVVHGGE-----EARSAIAAIKKLLLLVGASVASDVIPF--LEWVDLQGHL-SSMK  209

Query  987   RIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPE  808
              + KE+D++++ W+ EH       +S++        QDFID+ML+ + DD   G  Y  E
Sbjct  210   LVAKEMDSLIESWVKEHTGRLNSEASSS--------QDFIDIMLTKLKDDSLFG--YSRE  259

Query  807   IIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKD  628
              IIKAT L+MI+ GSDTT++  TWLLS ++N+   MK  +E++D KVG++RWVE  DI++
Sbjct  260   TIIKATVLTMIVAGSDTTSLTSTWLLSALLNNKHVMKHAQEELDLKVGRDRWVEQSDIQN  319

Query  627   MEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEP  448
             + Y++A VKETLRLY   P   PH A EDC VGGY I KGT L VNAWK+HRDP +W  P
Sbjct  320   LVYIKAIVKETLRLYTTFPLLVPHEAMEDCHVGGYHISKGTRLLVNAWKLHRDPAVWSNP  379

Query  447   ERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETP  271
             E F PERFLT+ A  D   ++FE IPFG GRRSC G    +Q+ HLT+ARL+QGFD   P
Sbjct  380   EEFQPERFLTSHANVDVFGQHFELIPFGSGRRSCPGLNMGLQMLHLTIARLLQGFDMTKP  439

Query  270   SEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             S  P+DM+EG+ + L + T L+V++TPRLP   Y
Sbjct  440   SNSPVDMTEGISVALSKLTPLEVMLTPRLPAELY  473



>gb|KDP38427.1| hypothetical protein JCGZ_04352 [Jatropha curcas]
Length=520

 Score =   433 bits (1113),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 227/517 (44%), Positives = 332/517 (64%), Gaps = 30/517 (6%)
 Frame = -3

Query  1704  RSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMY  1525
             RS IF S   KKT  P+  GA PI+GHL LL +G   L     ++AD+YG +FT+++G++
Sbjct  29    RSSIFCS---KKTRAPKAGGAWPIIGHLPLL-AGSKLLHITFGSLADRYGPIFTMQIGIH  84

Query  1524  RILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTE  1345
             + +VVSS E  K+ FTTND  ++ RP+F   KYLGY+  +F+      YWR+MRK    +
Sbjct  85    QAVVVSSGELAKELFTTNDMAVSERPNFTAFKYLGYDGVMFAFAPYGDYWREMRKIISLK  144

Query  1344  LLSSQKLEKLRHLRVSEVETSLKELYMLIT---SSSSAKTVDMSEWFGQLTLNLIVKIVA  1174
             LLS+ ++E L+H+R+SE+ET LKELY L T   + S    VD+++WFG+L LN+I+++V 
Sbjct  145   LLSNHQIELLKHVRLSEIETLLKELYKLWTEKKNGSGHVLVDLNKWFGELGLNVILRMVV  204

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKR          C    EA+H  +  +EF +  G FV  DA PF  + W++      K 
Sbjct  205   GKR----------CSGGGEAEHFRKTMREFFHYLGMFVLRDAIPF--LGWLDAGGHE-KG  251

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDD-DFARGLAY  817
             M    KE++ ++   L+EH   RRKR SA   + K   QDF+D MLS++++ DFA    Y
Sbjct  252   MKTTAKEMNCLVSELLEEH---RRKRGSAGKVATKE--QDFMDSMLSVLEEKDFA---GY  303

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
               ++IIK+  L++I  GSDT+ V LTW +SL++N+  A+++ +E++D  VG+ER V + D
Sbjct  304   DSDMIIKSACLNLIAGGSDTSTVTLTWTISLLLNNKQALEKAQEELDRLVGRERQVNEFD  363

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIW  457
             I  + YLQA +KE+LRLYPP P  AP    E+C +GG  I KGT L +N WK+HRDP+ W
Sbjct  364   ISKLIYLQAIIKESLRLYPPAPLSAPRVTRENCTIGGCHIKKGTRLIINVWKIHRDPKNW  423

Query  456   PEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDF  280
             P+P +F PERFLT+ +  D   +NFE IPFG GRR+C G  + +Q+ H+ +AR +Q F  
Sbjct  424   PDPLQFTPERFLTSHKDIDVRGQNFELIPFGSGRRACPGTAFGLQMVHIALARFLQAFQI  483

Query  279   ETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
               P+ +P+DM+E  G+T  +AT L+V+++PRLPP  Y
Sbjct  484   SNPTTEPIDMTESPGLTNLKATPLEVLLSPRLPPGLY  520



>gb|KDO42182.1| hypothetical protein CISIN_1g046041mg [Citrus sinensis]
Length=531

 Score =   433 bits (1114),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 223/508 (44%), Positives = 318/508 (63%), Gaps = 25/508 (5%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             +KKK   PE  GA P++GHL +LG G  PL R L +MADKYG +FT+++G+ R LVVSSW
Sbjct  46    SKKKRGAPEAGGAWPVIGHLHILG-GPEPLHRVLGSMADKYGPIFTIKIGINRALVVSSW  104

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             E  K+C TTNDK+ A+RP     + LGYN+++F       YW + RK A  ELLS+ +LE
Sbjct  105   EMAKECLTTNDKIFASRPKTLAMEILGYNFSMFGFSPYGSYWCETRKIATLELLSNHRLE  164

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAKT--VDMSEWFGQLTLNLIVKIVAGKRFKFKVK  1147
             KLRH+R  EV+T LKELY L   S S     V+M  WF     N+I++++ GK       
Sbjct  165   KLRHVRDYEVKTCLKELYELWDKSKSTNKMLVEMKRWFADTIRNVILRMIVGK-------  217

Query  1146  EDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELD  967
                 C+   +++  +E+   F+ ++G+FV  DA PF  +RW++      + M +  KELD
Sbjct  218   ---GCNSV-DSEEWMELLTRFLEMSGKFVVSDALPF--LRWLDIGGDE-RSMKKTAKELD  270

Query  966   TILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATG  787
              ++Q W +EH   +RKR S      K +  DF+ VM S++ D   +      + I KA  
Sbjct  271   IVVQGWFEEH---KRKRDS---REVKGEELDFMSVMPSILGDT-EQYSGRDVDTINKAVC  323

Query  786   LSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAA  607
             L +II G DTT V LTW++SL++NH D + +++ ++D +VG +R V + D+K++ YLQA 
Sbjct  324   LGLIIAGLDTTTVTLTWVISLLLNHRDILDKVQNELDIQVGTKRQVNESDLKNLVYLQAT  383

Query  606   VKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPER  427
             +KE +RLYP +P   PH A E+C V GY +P  T L +N WK+ RDPR+W EP +F PER
Sbjct  384   LKEAMRLYPAVPLLIPHEAIEECTVNGYHVPARTQLLINVWKLQRDPRVWEEPCKFQPER  443

Query  426   FLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDM  250
             FLT  +  D   ++ E +PFG GRR C G ++A+QV   T+A L+QGFDF TPS +PLDM
Sbjct  444   FLTKHKDIDVRGQHLELLPFGSGRRMCPGVSFALQVMQFTIASLLQGFDFATPSNEPLDM  503

Query  249   SEGLGITLPRATALDVVITPRLPPSFYG  166
              EG G+T+ ++  L+V+I PRL  S YG
Sbjct  504   GEGFGLTMEKSRPLEVLIAPRLSASLYG  531



>emb|CDP07595.1| unnamed protein product [Coffea canephora]
Length=880

 Score =   444 bits (1142),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 240/510 (47%), Positives = 323/510 (63%), Gaps = 25/510 (5%)
 Frame = -3

Query  1677  KKKTLPPEVDGARPILGHLRLLGSGGIPLGR-KLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             K  ++PPE  GA PI+GHL LLG G   L    LAA+A+KYG  FT+RLG+++ LVVSSW
Sbjct  388   KHGSVPPEAGGAWPIIGHLHLLGRGPERLPHITLAALAEKYGPAFTIRLGVHKNLVVSSW  447

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             E  K+ FTT+D   A+RP+   ++ L Y YA F       YWR+MRK    ELLS+++LE
Sbjct  448   ELAKEIFTTHDLAAASRPNSLASELLSYGYASFGFAPYGDYWREMRKVISIELLSTKRLE  507

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
              L+H+R+SE + S K+LY L  SSS    V+M +WF  LTLN+I+++V GKRF F     
Sbjct  508   LLKHVRISETDLSTKDLYNLWNSSSGPVLVEMKQWFADLTLNVILRMVVGKRF-FGAA--  564

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVE---FQRRVVKDMGRIMKEL  970
              D  E KEA+   +V +EF YL G FV  D+ P+  +RW++   ++R+    M    +E+
Sbjct  565   -DVSEEKEAKVCQKVMREFFYLTGLFVLADSVPY--LRWLDWGGYERK----MKVNAQEV  617

Query  969   DTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDD-DFARGLAYPPEIIIKA  793
             D +   WL EH   RRK+ S    S   DHQDF+DVMLS+ +  DF+ G  Y  + I KA
Sbjct  618   DRLADGWLKEH---RRKKHSGEATS---DHQDFMDVMLSLTEGADFSAG--YDADTITKA  669

Query  792   TGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQ  613
             T + +I  GSDTT V LTW LSLI+N+P  +K+ +E++D  VGKER V + DI ++ YLQ
Sbjct  670   TCVGLISGGSDTTVVMLTWTLSLIMNNPRVLKKAQEELDLHVGKERRVTESDISNLVYLQ  729

Query  612   AAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPE-PERFM  436
             A +KETLRLYPP P       +EDC +GGY IPKGT + +N WK+ RDP +W + P  F 
Sbjct  730   AIIKETLRLYPPGPLGGTRELSEDCIIGGYHIPKGTRVILNMWKIQRDPNVWHDGPLEFR  789

Query  435   PERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKP  259
             PERFLT     D    +FE IPFG GRR C G    +Q+ HL +A L+  FD  TPS +P
Sbjct  790   PERFLTTHKHIDVKGYHFELIPFGAGRRICPGINLGLQMLHLVLANLLHAFDLSTPSNEP  849

Query  258   LDMSEGLGITLPRATALDVVITPRLPPSFY  169
             +DM+E  G+T  +AT L +++ PRLPP  Y
Sbjct  850   VDMTESAGLTNIKATPLQLLVAPRLPPHLY  879



>ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52500.1| cytochrome P450, putative [Ricinus communis]
Length=528

 Score =   432 bits (1112),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 220/510 (43%), Positives = 322/510 (63%), Gaps = 22/510 (4%)
 Frame = -3

Query  1677  KKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             KKK   PE  GA P++GHL LL  G  P       MADKYG +FT+++G++  LV S+WE
Sbjct  33    KKKKAAPEAGGAWPLIGHLHLL-RGPQPSHIVFGNMADKYGPIFTIKMGVHPTLVASNWE  91

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
               K+CFTTNDK  A RP+      LGY  ++F+      YWR++RK +  ELLS+ +L+ 
Sbjct  92    MAKECFTTNDKAFANRPNILAMDLLGYGRSMFAFSPYGNYWRQIRKISTLELLSNHRLQM  151

Query  1317  LRHLRVSEVETSLKELYML-----ITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFK  1153
               H+R SEV T+LKELY L      T+S++   V+M  WFG +TLN+I++I+ GK   ++
Sbjct  152   FNHVRESEVGTALKELYKLWEKNKTTNSNNKVLVEMKRWFGDITLNIILRIIVGKFIGYE  211

Query  1152  VKEDDDCDEYKEAQH-IIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMK  976
                    DE KE+     +  ++F +L+G+F+  DA PF  +RW++      K M     
Sbjct  212   T-----ADEGKESNEGWKQALRDFFHLSGRFIAADAVPF--LRWLDIGGHE-KTMKHTAN  263

Query  975   ELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIK  796
             +LD ++  WL+EH   + K++S   + G+   +DF+D++L ++DD+    L+   + I K
Sbjct  264   KLDIVVTEWLNEH---KEKKASGCVKKGE---EDFMDLILDIMDDEAEATLSRDSDTINK  317

Query  795   ATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYL  616
             AT L++ +  SDTT+V L W LSL+VN+PD +K+ ++++D +VG+ER V + D+ ++ +L
Sbjct  318   ATCLALTLAASDTTSVTLIWALSLLVNNPDVLKKAQDELDVQVGRERQVHESDVNNLIFL  377

Query  615   QAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFM  436
             +A VKETLRLYP  P   PH + +DC V GY IP GT L  N  K+HRDPR+W  P  + 
Sbjct  378   KAIVKETLRLYPAGPLSVPHESMKDCTVAGYHIPAGTRLVTNLSKIHRDPRVWSNPSEYQ  437

Query  435   PERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKP  259
              ERFLT+ Q  D   + FE+IPFG GRR C G ++A+QV H+T+A L+ GF+F TP+ +P
Sbjct  438   QERFLTSHQDFDVRGKTFEFIPFGSGRRMCPGVSFALQVLHITLATLLHGFNFGTPTGEP  497

Query  258   LDMSEGLGITLPRATALDVVITPRLPPSFY  169
             LDM+E  G+T  RAT L+V I PRL P  Y
Sbjct  498   LDMTENFGLTNLRATPLEVAINPRLGPHLY  527



>ref|XP_009364178.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   432 bits (1112),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 225/505 (45%), Positives = 314/505 (62%), Gaps = 23/505 (5%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PPE  GA PILGHL LLG G  P    L AMADKYG +FT+R+G+Y  LV+SS E  K+C
Sbjct  37    PPEAKGAWPILGHLSLLG-GSTPPHITLGAMADKYGPIFTIRIGVYPSLVISSSEIAKEC  95

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             FTTND  + +RP  A  +++GYNYA+F      PYWR++RK    ELLS +K+E L+H+R
Sbjct  96    FTTNDLSLNSRPKMAAVEHIGYNYAMFGFGPSGPYWREIRKIVTLELLSIRKVELLKHIR  155

Query  1302  VSEVETSLKELYMLITS-----SSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDD  1138
             V EV T L+EL+   ++     S+    V++ +WFG +TLN++V++V GKR+     ED 
Sbjct  156   VLEVTTFLEELHKTWSTRQKEGSNDGVVVELKQWFGDMTLNVLVRMVNGKRYSVAADED-  214

Query  1137  DCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTIL  958
                E KEA+ +    +EF +  G F+ GDA P+  +RW++      K + +I KELDTI+
Sbjct  215   ---EKKEARRVQNALREFFHYAGLFLVGDAVPY--LRWLDLGGHE-KAIKKIAKELDTIV  268

Query  957   QRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSM  778
               W++EH   RR +  A  E      QDFID MLS++D     G  +  + I KAT L+M
Sbjct  269   GEWVEEH-KQRRAKGDAKGE------QDFIDAMLSVLDGAELGG--FDADTINKATSLNM  319

Query  777   IIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKE  598
             I  GSDT  V LTW +SL++N+   ++R   ++D+K+G++R V + DI ++ Y+QA +KE
Sbjct  320   IAAGSDTIMVTLTWAISLLLNNSHVLERALNELDTKIGRQRVVSEQDISNLVYIQAIIKE  379

Query  597   TLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT  418
             TLRLYPP P   P   TEDC + GY I KGT L +N WK+  DP+ WP+P  F PERFLT
Sbjct  380   TLRLYPPAPLSGPREFTEDCTIAGYHIRKGTRLTMNLWKLQTDPKNWPKPFEFKPERFLT  439

Query  417   A-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEG  241
                + D   ++FE IPFG GRR+C G  + +Q+   T+A  +  F+   PS  P+DM+E 
Sbjct  440   THKKVDVKGQHFELIPFGSGRRACPGLAFGLQMVQFTLASFLHAFEILNPSSTPIDMTES  499

Query  240   LGITLPRATALDVVITPRLPPSFYG  166
              G+T  + T L V+I PRL    YG
Sbjct  500   FGLTNNKRTPLKVLIKPRLSFELYG  524



>emb|CAN75482.1| hypothetical protein VITISV_020998 [Vitis vinifera]
Length=500

 Score =   431 bits (1109),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 236/514 (46%), Positives = 318/514 (62%), Gaps = 37/514 (7%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR       +K K+  PE  GA P LGHL LL  G  P+ R L AMADK+G VF +RLG+
Sbjct  23    WRVMTLAGKSKGKS-APEPSGAWPFLGHLPLL-RGQTPIFRTLGAMADKHGPVFMIRLGV  80

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +R LVVSS EAVK+CFTTNDK  A+RP  +  K LGYN+A F        WR+MRK ++ 
Sbjct  81    HRALVVSSREAVKECFTTNDKAFASRPSSSAGKILGYNHAGFGFAPYGALWREMRKLSMM  140

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGK  1168
             E+LS+   + ++    S+    +K              V MSEWF  L+ N+++K++AGK
Sbjct  141   EILSASSPQCVK--SCSDWVHPVK--------------VVMSEWFQHLSFNIVLKMIAGK  184

Query  1167  RFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMG  988
             R  F   +  +    +EA+  I    + ++L G FV  DA P   V W++ Q   +  M 
Sbjct  185   R-SFNTSDHGN----EEARRAIATIHKLLFLTGAFVLSDAIPG--VEWMDLQG-YLGSMK  236

Query  987   RIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPE  808
             R+ KE+D+++  W++EH + R  R         N  QDFIDVMLS+++D    G  Y  E
Sbjct  237   RVAKEVDSLVGGWVEEH-EMRLNREG-------NKRQDFIDVMLSVLEDTSMFG--YSRE  286

Query  807   IIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKD  628
              +IKAT + +I+ G+DT +   TWLLS ++N+  A+K  +E++D KVG+ RWVE+ DI +
Sbjct  287   TVIKATIMILIVGGTDTLSTTSTWLLSALLNNKHALKCAQEELDLKVGRGRWVEESDIPN  346

Query  627   MEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEP  448
             + YLQA +KETLRLY   P  APH A EDC V GY IPKGT L+VNAWK+HRDP +W +P
Sbjct  347   LLYLQAVIKETLRLYTATPLSAPHEAMEDCHVAGYHIPKGTRLFVNAWKLHRDPSVWSDP  406

Query  447   ERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETP  271
             E F PERFLT  A  D   ++FE IPFG GRRSC G T A+++  L + RL+QGFD  TP
Sbjct  407   EDFQPERFLTTHADLDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIGRLLQGFDLSTP  466

Query  270   SEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
                P+DM EGL ITL + T L+V++TPRLP  FY
Sbjct  467   LNAPVDMREGLSITLAKLTPLEVMLTPRLPSQFY  500



>emb|CAN64371.1| hypothetical protein VITISV_016844 [Vitis vinifera]
Length=527

 Score =   432 bits (1112),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 226/500 (45%), Positives = 320/500 (64%), Gaps = 19/500 (4%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PPE  G  P++GHL LLG+  + L R L  MADKYG +F +RLG+ + LVVSSWE  K+C
Sbjct  40    PPEPSGRWPLIGHLHLLGADKL-LHRTLGDMADKYGPIFCVRLGLKKTLVVSSWEVAKEC  98

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             +TT+DKV A RP     K +GY++  F      PYWR +RK A+ ELLS+++LE  +H++
Sbjct  99    YTTSDKVFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELLSNRQLEMHKHVQ  158

Query  1302  VSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
              SEV+  +KELY    S+      V+M E FG L LN++V+ +AGKR+       D+   
Sbjct  159   DSEVKILIKELYGQWASNKDGPALVEMKERFGNLALNVVVRAIAGKRYFGTHACGDEPKR  218

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
              K+A      F++F+ L G F+  D  PF  + W++  +    +M R+ KE+D +L  W+
Sbjct  219   XKKA------FEDFIILLGLFMVSDVIPF--LGWLDTMKGFTAEMKRVAKEVDYVLGSWV  270

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
             +EH    R+   +AN++G    QDFI  MLS+IDD    G    P+ IIK T  ++I+ G
Sbjct  271   EEH----RQNRLSANDNGAE--QDFIHAMLSVIDDGQFSG--RDPDTIIKGTCSNLILAG  322

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             +DTT++ LTW LSL++N+  A+K+ + +++  VGK R V+  DIK++ YLQA VKETLRL
Sbjct  323   NDTTSITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRL  382

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQ  409
             YPP P   PH A EDC V G+ I  GT L VN WK+HRDPR+W +P  F PERFLT  A 
Sbjct  383   YPPGPLSLPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAG  442

Query  408   ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGIT  229
              D   +N+E +PFG GRR C G ++A++++HLT+ARL+ GF+    ++ P+DM+E  G+T
Sbjct  443   LDVRGKNYELLPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLT  502

Query  228   LPRATALDVVITPRLPPSFY  169
              P+AT L+V I PRLP   Y
Sbjct  503   APKATPLEVTIVPRLPFELY  522



>gb|KCW68803.1| hypothetical protein EUGRSUZ_F02402, partial [Eucalyptus grandis]
Length=525

 Score =   432 bits (1111),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 222/501 (44%), Positives = 312/501 (62%), Gaps = 21/501 (4%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PP   GA PI GHL LLG G  P    L  MADKYG +F ++LG ++ +VVS  E  K+C
Sbjct  43    PPSAAGAWPITGHLHLLG-GPDPPHITLGQMADKYGPIFAIKLGSHQAIVVSGSELAKEC  101

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             FTTNDK    RP +  A+ LGYNYA+       PYWR +RK A  ELLS+  LEKLRH+R
Sbjct  102   FTTNDKAFCNRPKYLAAELLGYNYAMLGFSPYGPYWRHVRKIATLELLSNHTLEKLRHVR  161

Query  1302  VSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
              + V  S+KE Y   +++     ++M  WF  LT N+I K+V GK+       ++D D+ 
Sbjct  162   EAVVRASIKEAYER-SNAQGNTPIEMKSWFHALTFNVIFKMVGGKQSDGTTASEEDKDQN  220

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
                +      K F  L+GQFV  D  P+  +RW +     VK M R  KELD +++ WLD
Sbjct  221   DRCR---IALKSFFVLSGQFVASDVLPY--LRWFDVGG-YVKAMKRTAKELDDVVEGWLD  274

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMID--DDFARGLAYPPEIIIKATGLSMIID  769
             EH   +RKR+    E  +    DF+DVMLS++   D+     +Y  + I KAT L++I  
Sbjct  275   EH---KRKRACGEAEGDR----DFMDVMLSILGTADELP---SYDADTINKATCLALISG  324

Query  768   GSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLR  589
             G+DTTAV LTW LSL++N+   +K+ ++++DS++G+ER V + D+K++ YLQA +KETLR
Sbjct  325   GTDTTAVTLTWALSLLLNNRHVLKKAQQELDSQIGRERQVTESDVKNLVYLQAIIKETLR  384

Query  588   LYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQ  409
             LYP  P   PH + EDC +GGY +P GT L +N  K+H++P +WP P  F PERFLT  +
Sbjct  385   LYPAAPLSVPHESVEDCTIGGYRVPAGTRLLLNISKLHKNPLVWPAPLEFRPERFLTTHK  444

Query  408   -ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
               D   +NFEY+PFG GRR C   ++A+Q  H+ +A ++  F+ ET S+ P+DM+ G+G+
Sbjct  445   DLDVRGQNFEYLPFGSGRRMCPAVSFALQALHIVLATVLHSFEIETASDGPVDMTAGMGV  504

Query  231   TLPRATALDVVITPRLPPSFY  169
             T PR T L+V++TPRLP   Y
Sbjct  505   TSPRVTPLEVILTPRLPLHLY  525



>ref|XP_010064743.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=526

 Score =   432 bits (1111),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 222/501 (44%), Positives = 312/501 (62%), Gaps = 21/501 (4%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PP   GA PI GHL LLG G  P    L  MADKYG +F ++LG ++ +VVS  E  K+C
Sbjct  43    PPSAAGAWPITGHLHLLG-GPDPPHITLGQMADKYGPIFAIKLGSHQAIVVSGSELAKEC  101

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             FTTNDK    RP +  A+ LGYNYA+       PYWR +RK A  ELLS+  LEKLRH+R
Sbjct  102   FTTNDKAFCNRPKYLAAELLGYNYAMLGFSPYGPYWRHVRKIATLELLSNHTLEKLRHVR  161

Query  1302  VSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
              + V  S+KE Y   +++     ++M  WF  LT N+I K+V GK+       ++D D+ 
Sbjct  162   EAVVRASIKEAYER-SNAQGNTPIEMKSWFHALTFNVIFKMVGGKQSDGTTASEEDKDQN  220

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
                +      K F  L+GQFV  D  P+  +RW +     VK M R  KELD +++ WLD
Sbjct  221   DRCR---IALKSFFVLSGQFVASDVLPY--LRWFDVGG-YVKAMKRTAKELDDVVEGWLD  274

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMID--DDFARGLAYPPEIIIKATGLSMIID  769
             EH   +RKR+    E  +    DF+DVMLS++   D+     +Y  + I KAT L++I  
Sbjct  275   EH---KRKRACGEAEGDR----DFMDVMLSILGTADELP---SYDADTINKATCLALISG  324

Query  768   GSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLR  589
             G+DTTAV LTW LSL++N+   +K+ ++++DS++G+ER V + D+K++ YLQA +KETLR
Sbjct  325   GTDTTAVTLTWALSLLLNNRHVLKKAQQELDSQIGRERQVTESDVKNLVYLQAIIKETLR  384

Query  588   LYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQ  409
             LYP  P   PH + EDC +GGY +P GT L +N  K+H++P +WP P  F PERFLT  +
Sbjct  385   LYPAAPLSVPHESVEDCTIGGYRVPAGTRLLLNISKLHKNPLVWPAPLEFRPERFLTTHK  444

Query  408   -ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
               D   +NFEY+PFG GRR C   ++A+Q  H+ +A ++  F+ ET S+ P+DM+ G+G+
Sbjct  445   DLDVRGQNFEYLPFGSGRRMCPAVSFALQALHIVLATVLHSFEIETASDGPVDMTAGMGV  504

Query  231   TLPRATALDVVITPRLPPSFY  169
             T PR T L+V++TPRLP   Y
Sbjct  505   TSPRVTPLEVILTPRLPLHLY  525



>ref|XP_006423130.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
 ref|XP_006479372.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Citrus sinensis]
 ref|XP_006479373.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
 ref|XP_006479374.1| PREDICTED: cytochrome P450 82C4-like isoform X3 [Citrus sinensis]
 gb|ESR36370.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
Length=524

 Score =   432 bits (1110),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 221/499 (44%), Positives = 311/499 (62%), Gaps = 19/499 (4%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PPE  GA P +GHL LL      + + L  MADKYG  F + LG++R LV+SSWE  K+C
Sbjct  40    PPEAAGAWPCVGHLHLLAGSNQLIHQTLGEMADKYGKAFLIHLGIHRALVISSWEVTKEC  99

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             FTTNDK+ + RP     K +GY++A+        YWR++RK +  +LLS+ +LE L+H+R
Sbjct  100   FTTNDKLFSTRPKSLAVKLMGYDHAMIGFAPYGSYWREVRKLSTVQLLSNHRLELLKHVR  159

Query  1302  VSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
              +EV+  +KEL+     +     V+M E F  L +N+IV+++AGKR+       DD    
Sbjct  160   DTEVKVFIKELHEQCAKNGGHVAVEMKERFKDLAMNIIVRMIAGKRYYRSETNADD----  215

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
             +E++   +   +F+YL G F+  D  PF  + W++  +     M R  KELD +  R + 
Sbjct  216   QESKRFQKALGDFLYLLGLFLASDNIPF--LGWLDIVKGYTGQMKRTAKELDDVFGRLVQ  273

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP--PEIIIKATGLSMIID  769
             EH   R KR    N S   D +DFIDVMLS++DD    G   P   + +IKAT LS+I  
Sbjct  274   EH---RHKR---LNGSINKDEEDFIDVMLSVMDD----GKTSPEDADTVIKATCLSLISG  323

Query  768   GSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLR  589
             G+DTT   +TW LSL++N+   +K+ ++++D  VGK R VE+ DIK++ YLQA VKETLR
Sbjct  324   GNDTTVTTITWALSLLLNNRHVLKKAQDELDIHVGKNRQVEESDIKNLIYLQAIVKETLR  383

Query  588   LYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-A  412
             L PPLP  AP  A EDC + G+ IP GT L VN WK+HRDP IW  P  F+P+RFL   A
Sbjct  384   LCPPLPLSAPREAMEDCTIDGFHIPAGTRLIVNLWKMHRDPSIWANPSEFIPDRFLNENA  443

Query  411   QADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
             + D   ++FE++PFG GRR C G ++A+QV HLT+ARL+  F   T S+  +DMS   GI
Sbjct  444   KLDVNGQDFEFLPFGSGRRKCPGISFALQVQHLTLARLLHAFSLGTVSDTLVDMSGSPGI  503

Query  231   TLPRATALDVVITPRLPPS  175
             T+P+AT L+V +TPR+P +
Sbjct  504   TVPKATPLEVTLTPRVPSN  522



>ref|XP_010064744.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=529

 Score =   432 bits (1110),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 227/499 (45%), Positives = 305/499 (61%), Gaps = 17/499 (3%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PP   GA PI GHL LLG G  P    L  MADKYG +F+++LG  R +VVS  E  K+C
Sbjct  46    PPSATGAWPITGHLHLLG-GPDPAYITLGQMADKYGPIFSIKLGSQRAIVVSGSELAKEC  104

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             FTTNDK    RP +  AK LGYNYA+F      PYWR +RK A  ELLS+  LE LRH+R
Sbjct  105   FTTNDKAFCNRPKYLAAKLLGYNYAMFGFSPYGPYWRHVRKIATLELLSNHTLENLRHVR  164

Query  1302  VSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
              + V  S KE Y   +++     ++M  WF  LT NLI K+V GK++      ++D  + 
Sbjct  165   EAVVRASTKEAYER-SNAQENTPIEMKSWFNALTFNLIFKMVVGKQYDGTTASEEDEGQN  223

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
                +      K F  L GQFV  D  PF+  RW++     VK M R  KELD ++  WLD
Sbjct  224   DRCR---IALKSFFELGGQFVASDVLPFF--RWLDIGG-YVKAMKRTAKELDDVVGGWLD  277

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGS  763
             EH   +RKR+    E  +    DF+DVMLS++        +Y  + I KAT L++I  G+
Sbjct  278   EH---KRKRACGEAEGDR----DFMDVMLSILGTADVLP-SYDADTINKATCLALISGGT  329

Query  762   DTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLY  583
             DTTAV LTW LSL++N+   +K+ ++++DS++G+ER V + DIK+  Y+QA +KETLRLY
Sbjct  330   DTTAVTLTWALSLLLNNRHVLKQAQQELDSQIGRERRVTESDIKNQVYIQAIIKETLRLY  389

Query  582   PPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQAD  403
             P  P   PH + +DC +G Y +P GT L +N  K+H +P +WP P  F PERFLT  +  
Sbjct  390   PAAPLSVPHESVKDCTIGSYRVPAGTRLLLNISKLHWNPLVWPAPLEFRPERFLTTHKDL  449

Query  402   APW-RNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITL  226
               W +NFEY+PFG GRR C G ++A+QV H+ +A L+  F+ ET S  P DM  G+GIT 
Sbjct  450   GVWGQNFEYLPFGSGRRMCPGVSFALQVLHIVLATLLHSFEIETASVGPADMRAGMGITS  509

Query  225   PRATALDVVITPRLPPSFY  169
             P+ T L+VV+TPRLPP  Y
Sbjct  510   PKVTPLEVVLTPRLPPHLY  528



>gb|KEH18124.1| cytochrome P450 family 82 protein [Medicago truncatula]
Length=458

 Score =   429 bits (1102),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 215/470 (46%), Positives = 302/470 (64%), Gaps = 17/470 (4%)
 Frame = -3

Query  1572  MADKYGSVFTLRLGMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLD  1393
             MA+KYGS+F+LRLG  + LVV+S E  K+C T NDKV A+RP+ A  +YLGYN A+ +L 
Sbjct  1     MAEKYGSIFSLRLGCNQTLVVNSREIAKECLTKNDKVFASRPNVAAGRYLGYNNAILALA  60

Query  1392  TDSPYWRKMRKFAVTELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWF  1213
                 YWR MRK +  ELLSS +LEKL+H+R  E+ + +K LY  +  ++ +  V +S++ 
Sbjct  61    PYGDYWRYMRKISTLELLSSHRLEKLKHVRDFEIYSLVKNLYTFVKKTNGSIEVPISKFL  120

Query  1212  GQLTLNLIVKIVAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWI  1033
               +T N+IVK++AGKRF  +    +D     EA  +    K+  YL G FV  DA P   
Sbjct  121   DHMTFNIIVKMIAGKRFSGETINQED----SEAWRLRNAIKDTTYLCGVFVMADAIP--S  174

Query  1032  VRWVEFQRRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLS  853
             + W++FQ  V   M R  KE+D IL +WL EH    +KR     +SGK D  DF+DV++S
Sbjct  175   LSWIDFQGHV-GFMKRTAKEMDFILDKWLSEHY---KKRDEV--QSGKED--DFMDVLIS  226

Query  852   MIDDDFARGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDS  673
             M ++D      +  E +IKAT L +I+  S +T++ L W LSL++NHP  +K+ +E++D+
Sbjct  227   MFEED-DEICGHKRETVIKATTLILILTASGSTSITLGWALSLLINHPKVLKQAKEELDT  285

Query  672   KVGKERWVEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYV  493
              +GK++WV++ DIK+++YLQA +KETLRLYPP P      AT+DC V GY + KGT L++
Sbjct  286   NIGKDKWVQESDIKNLKYLQAIIKETLRLYPPAPLTGIREATDDCHVAGYKVTKGTRLFI  345

Query  492   NAWKVHRDPRIWPEPERFMPERFLTAAQADAPWRN--FEYIPFGGGRRSCIGNTYAMQVS  319
             N WK+ RDP +W  P +F PERF         ++N  F Y+PF  GRRSC G T+ MQV 
Sbjct  346   NLWKLQRDPLVWSNPNKFQPERFFNIHDQIDNFQNQEFGYLPFSYGRRSCAGATFGMQVL  405

Query  318   HLTVARLIQGFDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             HLT+ARLIQGFD  T    P+DM EG+G+ LP+   LDV++ PRLP   Y
Sbjct  406   HLTLARLIQGFDINTKDGGPVDMIEGVGLALPKENPLDVMLQPRLPLELY  455



>emb|CBI32510.3| unnamed protein product [Vitis vinifera]
Length=607

 Score =   434 bits (1115),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 228/505 (45%), Positives = 323/505 (64%), Gaps = 19/505 (4%)
 Frame = -3

Query  1677  KKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K+   PPE  G  P++GHL LLG+  + L R L  MADKYG +F +RLG+ + LVVSSWE
Sbjct  103   KRGKRPPEPSGRWPLIGHLHLLGADKL-LHRTLGDMADKYGPIFCVRLGLKKTLVVSSWE  161

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
               K+C+TT+DKV A RP     K +GY++  F      PYWR +RK A+ ELLS+++LE 
Sbjct  162   VAKECYTTSDKVFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELLSNRQLEM  221

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
              +H++ SEV+  +KELY    S+      V+M E FG L LN++V+ +AGKR+       
Sbjct  222   HKHVQDSEVKILIKELYGQWASNKDGPALVEMKERFGNLALNVVVRAIAGKRY---FGTH  278

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
                DE K A+   + F++F+ L G F+  D  PF  + W++  +    +M R+ KE+D +
Sbjct  279   ACGDEPKRAK---KAFEDFIILLGLFMVSDVIPF--LGWLDTMKGFTAEMKRVAKEVDYV  333

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLS  781
             L  W++EH    R+   +AN++G    QDFI  MLS+IDD    G    P+ IIK T  +
Sbjct  334   LGSWVEEH----RQNRLSANDNGAE--QDFIHAMLSVIDDGQFSG--RDPDTIIKGTCSN  385

Query  780   MIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVK  601
             +I+ G+DTT++ LTW LSL++N+  A+K+ + +++  VGK R V+  DIK++ YLQA VK
Sbjct  386   LILAGNDTTSITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVK  445

Query  600   ETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL  421
             ETLRLYPP P   PH A EDC V G+ I  GT L VN WK+HRDPR+W +P  F PERFL
Sbjct  446   ETLRLYPPGPLSLPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFL  505

Query  420   TA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSE  244
             T  A  D   +N+E +PFG GRR C G ++A++++HLT+ARL+ GF+    ++ P+DM+E
Sbjct  506   TKHAGLDVRGKNYELLPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTE  565

Query  243   GLGITLPRATALDVVITPRLPPSFY  169
               G+T P+AT L+V I PRLP   Y
Sbjct  566   SPGLTAPKATPLEVTIVPRLPFELY  590



>ref|XP_007156852.1| hypothetical protein PHAVU_002G022900g [Phaseolus vulgaris]
 gb|ESW28846.1| hypothetical protein PHAVU_002G022900g [Phaseolus vulgaris]
Length=527

 Score =   431 bits (1107),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 221/502 (44%), Positives = 320/502 (64%), Gaps = 20/502 (4%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             P+  GA PI+GHL L GS  +   + L  MA+K+G +FT++LG Y++LV+SSWE  K+CF
Sbjct  39    PQAAGAWPIIGHLHLFGSHQLT-HKTLGVMAEKHGPIFTIKLGSYKVLVLSSWEMAKECF  97

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T +DKV + RP  A +K +GYNYA+F      PYWR++RK A  ELLS+ +L+ L++ R 
Sbjct  98    TVHDKVFSTRPCVAASKLMGYNYAMFGFTPSGPYWRQVRKLATIELLSNNRLDPLKNTRT  157

Query  1299  SEVETSLKELYMLITSSSSAK---TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCD  1129
              E++ +++ LY L +     +    VDM +WFG LT N+ +++V GK +      D D  
Sbjct  158   FEIDAAIRGLYKLWSKEGCLEGEVLVDMKQWFGDLTHNIAIRMVGGKPY----YGDGDGY  213

Query  1128  EYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRW  949
                EA+      ++++ L G FV  DAFPF  + W++      KDM R   ELDT+++ W
Sbjct  214   ADGEARRYRRAMRDWVCLFGAFVLSDAFPF--LGWLDIN-GYEKDMKRTASELDTLVEGW  270

Query  948   LDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIID  769
             L+EH   +RKR+ + N  GK +  DF+DV+L+++      G  Y  + IIKAT L++++ 
Sbjct  271   LEEH---KRKRALSVN--GKEERDDFMDVLLNVLQGTEISG--YDSDTIIKATCLNLVLA  323

Query  768   GSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLR  589
             G+D T V LTW LSL++NHP  +KR + ++D+ +GK+R VE+ DI  + YLQA VKETLR
Sbjct  324   GTDPTMVTLTWALSLLLNHPTELKRTQHELDTLIGKDRKVEESDIDQLVYLQAVVKETLR  383

Query  588   LYPPLPTYAPHAATEDCKVG-GYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAA  412
             LYPP P     AA EDC    GY IP GT L VNAWK+HRD R+W +P  F PERFLT+ 
Sbjct  384   LYPPSPIITLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSDPHDFKPERFLTSH  443

Query  411   Q-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLG  235
             +  D   +N+E +PF  GRR+C G + A++V HLT++RL+  F    PS + +DM+E  G
Sbjct  444   KDVDVKGQNYELVPFSSGRRACPGASLALRVVHLTLSRLLHSFTVACPSNQVVDMTESFG  503

Query  234   ITLPRATALDVVITPRLPPSFY  169
             +T  +AT L+V++TPRL    Y
Sbjct  504   LTNLKATPLEVLLTPRLESKLY  525



>ref|XP_003547786.2| PREDICTED: cytochrome P450 82C2-like [Glycine max]
Length=541

 Score =   431 bits (1109),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 226/511 (44%), Positives = 314/511 (61%), Gaps = 20/511 (4%)
 Frame = -3

Query  1686  SFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVS  1507
             S  +K    PE  GA P +GHL LL +   P  R  +A+A+KYG +F L+LG +  LVV+
Sbjct  43    SKQRKGNQVPEPRGALPFIGHLHLLNARK-PYFRTFSAIAEKYGPIFILKLGCHPTLVVN  101

Query  1506  SWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQK  1327
             S E  K+C TTNDKV A+RP  +  K LGYN AVF       YWR++RK A+ E+LSS K
Sbjct  102   SREIAKECLTTNDKVFASRPITSAGKILGYNNAVFGFSPYGKYWREIRKMAILEILSSYK  161

Query  1326  LEKLRHLRVSEVETSLKELYMLITS----SSSAKTVDMSEWFGQLTLNLIVKIVAGKRFK  1159
             LEKL+H+R +E  + +K+LY  I+     + S   V +S     ++ N+IV+++AGKRF 
Sbjct  162   LEKLKHVRDTETLSLVKDLYSSISCPKNVNGSTTHVPISNLLEHMSFNIIVRMIAGKRFG  221

Query  1158  FKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIM  979
                   +D     EA  +    K+  YL G FV  DA P   + W++FQ   V  M R  
Sbjct  222   GDTVNQED----NEAWRLRNAIKDATYLCGVFVAADAIPS--LSWIDFQG-YVSFMKRTN  274

Query  978   KELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIII  799
             KE+D IL++WL+EH+  R +      ES      DF+DVM+S   ++      Y  E++I
Sbjct  275   KEIDLILEKWLEEHLRKRGEEKDGKCES------DFMDVMISAFQEE-EEICGYKREMVI  327

Query  798   KATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEY  619
             KAT + +I+  S +TA+ LTW LSL++NHP  +K  ++++D+ +GKERWV++ DI+++ Y
Sbjct  328   KATSVLLILTASGSTAITLTWALSLLLNHPKVLKAAQKELDTHLGKERWVQESDIENLTY  387

Query  618   LQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERF  439
             LQA +KETLRLYPP P        EDC V GY +PKGT L +N W + RDP++WP P +F
Sbjct  388   LQAIIKETLRLYPPAPLTGIREVMEDCCVAGYHVPKGTRLLINLWNLQRDPKVWPNPNKF  447

Query  438   MPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEK  262
              PERFLT     +   +NFE IPF  GRRSC G T+ +QV HLT+ARL+QGFD  T    
Sbjct  448   EPERFLTTHHDINFMSQNFELIPFSIGRRSCPGMTFGLQVLHLTLARLLQGFDICTKDGA  507

Query  261   PLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              +DM+EGLG+ LP+   L V++ PRLP   Y
Sbjct  508   EVDMTEGLGVALPKEHGLQVMLQPRLPLGLY  538



>ref|XP_007017410.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14635.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=628

 Score =   434 bits (1116),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 231/522 (44%), Positives = 331/522 (63%), Gaps = 35/522 (7%)
 Frame = -3

Query  1710  SWRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLG  1531
             +WR       T KK   PE   + P+LGHL LL +G  P    L+AMADKYG +FT++LG
Sbjct  135   TWRC------TNKKKAAPEAGNSWPVLGHLHLL-AGRQPAHLTLSAMADKYGPIFTIKLG  187

Query  1530  MYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAV  1351
             + R LVVSSWE  K+C TTNDK  A RP     + LGYN+A+F      PYWR MRK   
Sbjct  188   VRRALVVSSWETAKECLTTNDKAFATRPKNISMEVLGYNHAMFGFAPYGPYWRNMRKITT  247

Query  1350  TELLSSQKLEKLRHLRVSEVETSLKELYML---ITSSSSAKTVDMSEWFGQLTLNLIVKI  1180
              ELLS+ +L+ L+H+R SE++ SL+ELY L     +SS    V+M +WF   T N+I+K+
Sbjct  248   LELLSNHRLDMLKHVRESEMKVSLQELYQLWKENKNSSDKVLVEMDKWFRDATANVILKM  307

Query  1179  VAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEF--QRR  1006
             + GKR    +  D +   +K+A       KEF  L+G+F+  DAFPF  +RW++     R
Sbjct  308   IVGKRIS-SLGNDAESGRWKKA------LKEFFELSGKFLVADAFPF--LRWLDIGGDER  358

Query  1005  VVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARG  826
             ++K + +++ E   + + WL EH   ++KR+S      +++ +DF+DVMLS++ D     
Sbjct  359   LMKKVKKVLNE---VAEEWLQEH---KQKRASG---EFRDEEEDFMDVMLSILTD----A  405

Query  825   LAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVE  646
               Y  + I KAT L +I+  +D TAV LTW L+L++N+ DA+K+ +++ID  +GK++ VE
Sbjct  406   KEYDADTINKATCLILILAATDPTAVTLTWCLALLLNNRDALKKAQQEIDIHIGKDKPVE  465

Query  645   DGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDP  466
             + DIK++ YLQA +KETLRL+P  P   PH + E+C V GY IP GT L +N +K+HRD 
Sbjct  466   ENDIKNLVYLQAIIKETLRLHPAGPLAVPHESMENCTVNGYHIPAGTELLINLYKIHRDS  525

Query  465   RIWPEPERFMPERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQG  289
             R+W +P +F PERFLT  +  D   +NFE IPF  GRR C G ++A+QV  LT+A L+ G
Sbjct  526   RVWSDPYKFQPERFLTTHKNFDVRGQNFELIPFSSGRRMCPGVSFALQVVQLTLANLLHG  585

Query  288   FDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYGL  163
             FD  TP ++P+DM E  G++  +AT L+V I+PRLP S Y L
Sbjct  586   FDLATPFDEPVDMREAAGLSNFKATPLEVSISPRLPNSCYEL  627


 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 54/104 (52%), Gaps = 11/104 (11%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             P  +  A P   +LRLL              A  YG +FT++LG+ + ++VS+ E  K+C
Sbjct  7     PSPIQSATPTPYYLRLLFK-----------RAGNYGPIFTIKLGLSQAVIVSNRELAKEC  55

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAV  1351
              +TNDKV A RP     + LGYNYAVF       YW  +RK A 
Sbjct  56    LSTNDKVFATRPKSIAFEILGYNYAVFGFSPYGSYWHHIRKLAT  99



>ref|XP_007201702.1| hypothetical protein PRUPE_ppa004095mg [Prunus persica]
 gb|EMJ02901.1| hypothetical protein PRUPE_ppa004095mg [Prunus persica]
Length=530

 Score =   430 bits (1106),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 219/503 (44%), Positives = 324/503 (64%), Gaps = 17/503 (3%)
 Frame = -3

Query  1665  LPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKD  1486
             L P+  GA P +GHL LL  G  P+   L AMAD +G +F+L+LG +++LV+S+W+ VK+
Sbjct  40    LVPQPSGAWPFIGHLPLL-RGKDPVALTLGAMADDHGPIFSLKLGQHQVLVLSAWDTVKE  98

Query  1485  CFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHL  1306
             C TTND+V A RP  A  KYLGY+ A+FSL    PYWR +RK A  ELLS++++E L H+
Sbjct  99    CLTTNDRVFATRPSIAGGKYLGYDNALFSLAPYGPYWRHIRKLATLELLSTKRVETLSHV  158

Query  1305  RVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCD  1129
             R SEV+  +K L  L T + +  T V +SE    LT N+ V+++AGKRF  +   + + +
Sbjct  159   RTSEVDLFIKNLLSLCTKNGTGSTPVHLSELIEFLTFNINVRLIAGKRFTAEQYNEKNSE  218

Query  1128  EYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRW  949
              ++  + +    KE +YL G FV+ DA P+  + W++     V  M R  KELD +L +W
Sbjct  219   AWRFEKAV----KEALYLFGVFVWSDAMPW--LEWLDSLFGHVGSMKRCFKELDCVLGKW  272

Query  948   LDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIID  769
             L+EH    R+RSSA  +  + +  D +DVM+S + ++      +  + +IK+T L +I+ 
Sbjct  273   LEEH----RQRSSAQGKIERVE-SDLMDVMISSLQEEEDVISGHSLDNVIKSTALVLILT  327

Query  768   GSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLR  589
             G+++T+V LTW LSL++N+P  +K  ++++D  VG++RWV++ D+ +++YLQA +KETLR
Sbjct  328   GTESTSVTLTWALSLLLNNPKTLKAAQQELDIHVGRDRWVQESDLPNLKYLQAILKETLR  387

Query  588   LYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQ  409
             +YPP P      ATEDC + GY + KGT + VN WK+ RDPR+W  P  F PERF+T   
Sbjct  388   VYPPGPLTGLREATEDCHLAGYHVSKGTRVLVNIWKLQRDPRMWANPSEFQPERFMT-TH  446

Query  408   ADAPWR---NFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             AD  ++   NFEYIPF  GRRSC G    +QV  L +ARL+QGFD     E+ +DM EGL
Sbjct  447   ADVEFKGQNNFEYIPFSSGRRSCPGMVLGLQVVQLILARLVQGFDMSRVGEEAVDMREGL  506

Query  237   GITLPRATALDVVITPRLPPSFY  169
             G+ LP+A  L+ +++PRLP   Y
Sbjct  507   GLALPKANPLEALLSPRLPLHLY  529



>gb|KCW68806.1| hypothetical protein EUGRSUZ_F02405 [Eucalyptus grandis]
Length=524

 Score =   430 bits (1105),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 227/499 (45%), Positives = 306/499 (61%), Gaps = 17/499 (3%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PP   GA PI GHL LLG G  P    L  MADKYG +F+++LG  R +VVS  E  K+C
Sbjct  41    PPSATGAWPITGHLHLLG-GPDPAYITLGQMADKYGPIFSIKLGSQRAIVVSGSELAKEC  99

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             FTTNDK    RP +  AK LGYNYA+F      PYWR +RK A  ELLS+  LE LRH+R
Sbjct  100   FTTNDKAFCNRPKYLAAKLLGYNYAMFGFSPYGPYWRHVRKIATLELLSNHTLENLRHVR  159

Query  1302  VSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
              + V  S KE Y   +++     ++M  WF  LT NLI K+V GK++      ++D  + 
Sbjct  160   EAVVRASTKEAYER-SNAQENTPIEMKSWFNALTFNLIFKMVVGKQYDGTTASEEDEGQN  218

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
                +  +   K F  L GQFV  D  PF+  RW++     VK M R  KELD ++  WLD
Sbjct  219   DRCRIAL---KSFFELGGQFVASDVLPFF--RWLDIGG-YVKAMKRTAKELDDVVGGWLD  272

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGS  763
             EH   +RKR+    E  +    DF+DVMLS++        +Y  + I KAT L++I  G+
Sbjct  273   EH---KRKRACGEAEGDR----DFMDVMLSILGTADVLP-SYDADTINKATCLALISGGT  324

Query  762   DTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLY  583
             DTTAV LTW LSL++N+   +K+ ++++DS++G+ER V + DIK+  Y+QA +KETLRLY
Sbjct  325   DTTAVTLTWALSLLLNNRHVLKQAQQELDSQIGRERRVTESDIKNQVYIQAIIKETLRLY  384

Query  582   PPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQAD  403
             P  P   PH + +DC +G Y +P GT L +N  K+H +P +WP P  F PERFLT  +  
Sbjct  385   PAAPLSVPHESVKDCTIGSYRVPAGTRLLLNISKLHWNPLVWPAPLEFRPERFLTTHKDL  444

Query  402   APW-RNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITL  226
               W +NFEY+PFG GRR C G ++A+QV H+ +A L+  F+ ET S  P DM  G+GIT 
Sbjct  445   GVWGQNFEYLPFGSGRRMCPGVSFALQVLHIVLATLLHSFEIETASVGPADMRAGMGITS  504

Query  225   PRATALDVVITPRLPPSFY  169
             P+ T L+VV+TPRLPP  Y
Sbjct  505   PKVTPLEVVLTPRLPPHLY  523



>ref|XP_002284810.3| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=610

 Score =   433 bits (1113),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 228/505 (45%), Positives = 323/505 (64%), Gaps = 19/505 (4%)
 Frame = -3

Query  1677  KKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K+   PPE  G  P++GHL LLG+  + L R L  MADKYG +F +RLG+ + LVVSSWE
Sbjct  118   KRGKRPPEPSGRWPLIGHLHLLGADKL-LHRTLGDMADKYGPIFCVRLGLKKTLVVSSWE  176

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
               K+C+TT+DKV A RP     K +GY++  F      PYWR +RK A+ ELLS+++LE 
Sbjct  177   VAKECYTTSDKVFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELLSNRQLEM  236

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
              +H++ SEV+  +KELY    S+      V+M E FG L LN++V+ +AGKR+       
Sbjct  237   HKHVQDSEVKILIKELYGQWASNKDGPALVEMKERFGNLALNVVVRAIAGKRY---FGTH  293

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
                DE K A+   + F++F+ L G F+  D  PF  + W++  +    +M R+ KE+D +
Sbjct  294   ACGDEPKRAK---KAFEDFIILLGLFMVSDVIPF--LGWLDTMKGFTAEMKRVAKEVDYV  348

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLS  781
             L  W++EH    R+   +AN++G    QDFI  MLS+IDD    G    P+ IIK T  +
Sbjct  349   LGSWVEEH----RQNRLSANDNGAE--QDFIHAMLSVIDDGQFSG--RDPDTIIKGTCSN  400

Query  780   MIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVK  601
             +I+ G+DTT++ LTW LSL++N+  A+K+ + +++  VGK R V+  DIK++ YLQA VK
Sbjct  401   LILAGNDTTSITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVK  460

Query  600   ETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL  421
             ETLRLYPP P   PH A EDC V G+ I  GT L VN WK+HRDPR+W +P  F PERFL
Sbjct  461   ETLRLYPPGPLSLPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFL  520

Query  420   TA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSE  244
             T  A  D   +N+E +PFG GRR C G ++A++++HLT+ARL+ GF+    ++ P+DM+E
Sbjct  521   TKHAGLDVRGKNYELLPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTE  580

Query  243   GLGITLPRATALDVVITPRLPPSFY  169
               G+T P+AT L+V I PRLP   Y
Sbjct  581   SPGLTAPKATPLEVTIVPRLPFELY  605



>ref|XP_007224041.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
 gb|EMJ25240.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
Length=517

 Score =   429 bits (1104),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 216/507 (43%), Positives = 322/507 (64%), Gaps = 19/507 (4%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PP+  GARPI+GHL LLG G  P    L  MA++YG +FT+ +G+++ L+VSS E  K+C
Sbjct  20    PPKAGGARPIIGHLHLLG-GSKPPHLVLGKMAERYGPIFTVNIGVHKALIVSSSEIAKEC  78

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             FTTNDKV A+RP F  A+ + YNYA       S Y R++RK  + E+LS+ +LE L+H+R
Sbjct  79    FTTNDKVFASRPKFMAAEIMAYNYAFLPFSPYSHYSRQVRKIVLLEVLSNSRLEMLKHVR  138

Query  1302  VSEVETSLKELYMLITSSSSAKT------VDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
              SEV+ S+K +Y    ++  + T      V+M EWF  +  N++ +++ GKRF      +
Sbjct  139   ESEVKASMKGIYERCVTNGKSSTGSNKALVEMREWFLDINENIVFRMIVGKRFGEATSSN  198

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
                  Y   +   E + +F+ L+G FV  DA P W+ RW++      + M ++ KELD +
Sbjct  199   SKGSNYYLKK---ETYMDFLRLSGTFVLSDAIP-WL-RWLDLGGHE-RAMKKVAKELDLV  252

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA--YPPEIIIKATG  787
                WL+EH   ++KR  +    G +D  DF+DVMLS++D D A  +   Y  + + KAT 
Sbjct  253   FNGWLEEH---KQKRKISGQVKGDDDQLDFMDVMLSILDVDGANEITTDYDADTVNKATS  309

Query  786   LSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAA  607
             +++I+ G +  AV +TW L+L++N+ +A+K+ +E++D  +GK R V++ DIK++ YLQA 
Sbjct  310   MALIVAGVEAPAVQMTWALALLLNNREALKKAQEELDQIIGKGRQVKESDIKNLVYLQAI  369

Query  606   VKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPER  427
             +KE+ RLYP  P   PH +TEDC VG Y +P GT L+VN  K+HRDPR+W EP  F PER
Sbjct  370   IKESTRLYPAGPLSLPHESTEDCMVGDYHVPAGTRLFVNLSKLHRDPRVWSEPNEFRPER  429

Query  426   FLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDM  250
             FLT  ++ D    +FE IPFG GRR C G + A++V  LT+A L+ GF+  TP+++P+DM
Sbjct  430   FLTTHKSFDVKGHDFELIPFGSGRRMCPGMSLALKVIALTLASLLHGFEIATPTDEPVDM  489

Query  249   SEGLGITLPRATALDVVITPRLPPSFY  169
              E +G+T  +AT L+V+ TPRLP   Y
Sbjct  490   VETVGLTNNKATPLEVLFTPRLPAQLY  516



>ref|XP_003537400.1| PREDICTED: cytochrome P450 82A3-like [Glycine max]
Length=538

 Score =   430 bits (1106),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 228/509 (45%), Positives = 323/509 (63%), Gaps = 15/509 (3%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             TKK    P+  GA PI+GHL L  +  +   + L  MA+K+G +FT++LG Y++LV+SSW
Sbjct  33    TKKICRAPQAAGAWPIIGHLHLFNAHQLT-HKTLGKMAEKHGPIFTIKLGSYKVLVLSSW  91

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             E  K+CFT +DK  + RP  A +K +GYNYA+F       YWR++RK    ELLS+ +LE
Sbjct  92    EMAKECFTAHDKAFSTRPCVAASKLMGYNYAMFGFTPYGSYWRQVRKLTTIELLSNNRLE  151

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAK---TVDMSEWFGQLTLNLIVKIVAGKRFKFKV  1150
              L+  R  E++ +++ELY + T     K    VDM +WFG LT N+ +++V GK +   V
Sbjct  152   PLKDTRTVELDAAIRELYKVWTREGCPKGGVLVDMKQWFGDLTHNIALRMVGGKSYS-GV  210

Query  1149  KEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKEL  970
              +DD  +   EA+    V ++++ L G FV  D+FPF  + W++      KDM R   EL
Sbjct  211   GDDDHAE--GEARRYRRVMRDWVCLFGVFVLSDSFPF--LGWLDIN-GYEKDMKRTASEL  265

Query  969   DTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKAT  790
             D +++ WL+EH   +RKR    + +GK +  DF+DVML+++      G  Y  + IIKAT
Sbjct  266   DALVEGWLEEHK-RKRKRKRGLSVNGKEEQDDFMDVMLNVLQGTEISG--YDSDTIIKAT  322

Query  789   GLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQA  610
              L++I+ G+D T V LTW LSL++NH   +KR R ++D+ +GK+R VE+ DIK + YLQA
Sbjct  323   CLNLILAGTDPTMVTLTWALSLLLNHQMELKRARHELDTLIGKDRKVEESDIKKLVYLQA  382

Query  609   AVKETLRLYPPLPTYAPHAATEDCKVG-GYDIPKGTHLYVNAWKVHRDPRIWPEPERFMP  433
              VKETLRLYPP P     AA EDC    GY IP GT L VNAWK+HRD R+W EP  F P
Sbjct  383   VVKETLRLYPPSPIITLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSEPNDFKP  442

Query  432   ERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPL  256
             ERFLT  +  D   +N+E +PF  GRR+C G + A++V HLT+ARL+  FD  +PS + +
Sbjct  443   ERFLTIHKDVDVKGQNYELVPFSSGRRACPGASLALRVVHLTLARLLHSFDVASPSNQVV  502

Query  255   DMSEGLGITLPRATALDVVITPRLPPSFY  169
             DM+E  G+T  +AT L+V++TPRL   FY
Sbjct  503   DMTESFGLTNLKATPLEVLLTPRLDTKFY  531



>ref|XP_011037409.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
 ref|XP_011037412.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
Length=511

 Score =   429 bits (1103),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 227/517 (44%), Positives = 318/517 (62%), Gaps = 25/517 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             W++      +KK    PE  GA P++GHL  L  G  P  + LAA+ DKYG +++LRLG 
Sbjct  15    WKTLARERESKKLARVPEPSGAWPVIGHLPCL-RGQDPACKTLAAIDDKYGPIYSLRLGS  73

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +RI+VVSS E VKDC TTND+++A R + A  K++GYN A F+L     YWR +RK    
Sbjct  74    HRIVVVSSRETVKDCLTTNDRILATRANIAAGKHMGYNNAAFALSPYGKYWRDVRKLVTL  133

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSS-AKTVDMSEWFGQLTLNLIVKIVAG  1171
             +LLS+ +LE L+H+R  EV+  +K L+     ++     V MS+ F  LT N+ ++ + G
Sbjct  134   QLLSNHRLEMLKHVRKLEVDAFIKGLHNSYAETAEYPAKVTMSKLFESLTFNISLRTIVG  193

Query  1170  KRFKFKV--KEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
             KR+   +  KE+ +   YK+A       ++ +YL+G FV  DA P+  + W++FQ  V  
Sbjct  194   KRYCSTIYDKENSEPWRYKKA------IEKALYLSGIFVMSDAIPW--LEWIDFQGHV-S  244

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
              M R  KELD ++  WL+EH+    +  S           DF+DVM+S + D  A    Y
Sbjct  245   AMKRTAKELDAVIGSWLEEHLKKEIQGES-----------DFMDVMISNLADGAAEMSGY  293

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
               +++IKAT L + + G+ +TAV LTW LSL++NHP  +K  +E++D +VG+E+WVE+ D
Sbjct  294   SRDVVIKATTLILTLTGAGSTAVTLTWALSLLLNHPSVLKAAQEELDKQVGREKWVEESD  353

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIW  457
             I+++ YLQA VKETLRLYPP P      A EDC + GY +PKGT L VN WK+HRDPR+W
Sbjct  354   IQNLVYLQAIVKETLRLYPPGPLTGIREAMEDCHICGYYVPKGTRLVVNIWKLHRDPRVW  413

Query  456   PEPERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDF  280
               P  F PERFLT  A  D   ++FE+IPF  GRRSC      M V HLT+ARL+QGFD 
Sbjct  414   KNPNDFQPERFLTTHADLDFRGQDFEFIPFSSGRRSCPAINLGMAVVHLTLARLLQGFDL  473

Query  279   ETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              T +  P+DM+EG GI LP+   L+ V+ PRL    Y
Sbjct  474   TTVAGLPVDMNEGPGIALPKLIPLEAVVKPRLGLRLY  510



>ref|XP_010106082.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07352.1| Cytochrome P450 82A3 [Morus notabilis]
Length=532

 Score =   430 bits (1105),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 229/507 (45%), Positives = 321/507 (63%), Gaps = 23/507 (5%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PPE  G  PI+GHL LLG   +P    LA +ADK+G +FT+R+G YR LVVSS E  K+C
Sbjct  41    PPEAAGRWPIIGHLHLLGGSQLP-HITLANLADKWGPIFTIRIGSYRGLVVSSSEMAKEC  99

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
             FT ND   A+RP+   AK+LGY YA+F L    P+WR++RK A  +LLS+++LE L+H+R
Sbjct  100   FTINDLASASRPNLLAAKHLGYKYAMFGLAPHGPFWREIRKIATVQLLSNRRLELLKHIR  159

Query  1302  VSEVETSLKELYMLITSS------SSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
             +SEV + +KELY   T+       S   +V+M + F  LTLN+I+++VAGKR+     + 
Sbjct  160   ISEVASFVKELYEHWTTKWNDNDHSGQASVEMKQRFSDLTLNVILRMVAGKRYSI---DA  216

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
             +D  + KEA+ + +  KEF+   G FV GDA P+  + W++      K M +  K LD I
Sbjct  217   NDGGDVKEARLVQKEIKEFLKHLGLFVPGDAIPY--LGWLDLGG-CEKAMKKTAKALDGI  273

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMID-DDFARGLAYPPEIIIKATGL  784
             +  WL+EH   ++ R+   NE  K   QDF+DVMLS++   DF     +  + IIKAT L
Sbjct  274   VGEWLEEH---KQNRAEMNNEEKK--EQDFMDVMLSVLHGSDFG---GFDADTIIKATIL  325

Query  783   SMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAV  604
             +MI  GSDTTA+ LTW +SL++N+   +K+ +E++++ VGK R V + DI  + Y+ A V
Sbjct  326   NMIAGGSDTTALTLTWAVSLLLNNHHVLKKAQEELENNVGKNRTVNESDIGKLTYIFAIV  385

Query  603   KETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERF  424
             KETLRLYP  P  AP    EDC +GGY + KGT L  N WK+  DP +WP+P  F PERF
Sbjct  386   KETLRLYPVAPLSAPRVFLEDCTIGGYHVAKGTRLITNIWKIQTDPILWPDPFEFKPERF  445

Query  423   LTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMS  247
             LT  +  D   ++FE IPFG GRR+C G ++A+Q+   T+A  +Q FD  TP    +DM+
Sbjct  446   LTTNKDVDVRGQHFELIPFGSGRRACPGTSFALQMVQFTLASFLQAFDISTPLNALVDMT  505

Query  246   EGLGITLPRATALDVVITPRLPPSFYG  166
             E  G+T  +AT L+V+ITPRLP   Y 
Sbjct  506   ESFGLTNTKATPLEVLITPRLPAELYA  532



>ref|XP_006432714.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
 ref|XP_006471503.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45954.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
Length=525

 Score =   429 bits (1104),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 222/512 (43%), Positives = 319/512 (62%), Gaps = 32/512 (6%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             +KKK   PE  GA P++GHL LLG G  P  R L  MADKYG +FT+++G+ R LVVS+W
Sbjct  39    SKKKRGAPEAGGAWPVIGHLHLLG-GPEPPHRVLGCMADKYGPIFTIKMGINRALVVSNW  97

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             E  K+C TT+DKV A+RP     + LGYN+++F       YWR+ RK A  ELLS+ +LE
Sbjct  98    EMAKECLTTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLE  157

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAKT---VDMSEWFGQLTLNLIVKIVAGKRFKFKV  1150
             KL+ +R  E++T LKELY L  ++ S      V+M  W      N++++I+ GK      
Sbjct  158   KLKQVREYELKTCLKELYQLWDNNKSTNKMLLVEMKRWLADSIRNVVLRIIVGKGCN---  214

Query  1149  KEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKEL  970
                 D +E+KE      +   F  ++G+FV  DA PF  +RW++      + M +I KEL
Sbjct  215   --SMDSEEWKE------LLTRFFEMSGKFVVSDALPF--LRWLDIGGDE-RSMKKIAKEL  263

Query  969   DTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDD---FARGLAYPPEIII  799
             D ++Q WL+EH   + KR S   +    + +DF+ VMLS++ D    + R +    + I 
Sbjct  264   DVVVQGWLEEH---KMKRDS---QEMNQEEEDFMYVMLSILGDTEQYYGRDV----DTIN  313

Query  798   KATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEY  619
             KA  L +I+  +DTTAV LTW++SL++NH D + + R ++D +VG +R V + DIK + Y
Sbjct  314   KAICLGLILAATDTTAVTLTWIISLLLNHHDILNKARNELDIQVGTKRQVNESDIKKLVY  373

Query  618   LQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERF  439
             LQA +KE +RLYP  P   PH + E+C V GY++P GT L++N WK+ RDP +W EP +F
Sbjct  374   LQAILKEAMRLYPAAPLLIPHESIEECTVSGYNVPSGTQLFINVWKLQRDPHVWEEPCKF  433

Query  438   MPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEK  262
              PERFLT  +  D   +NFE +PF  GRR C G ++A+QV   T+A L+ GFD  TPS +
Sbjct  434   QPERFLTRHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLHGFDIATPSNE  493

Query  261   PLDMSEGLGITLPRATALDVVITPRLPPSFYG  166
             PLDM EGLG+T+ ++T L+V++ PRL  S YG
Sbjct  494   PLDMGEGLGLTVEKSTPLEVLVAPRLSASLYG  525



>emb|CBI37514.3| unnamed protein product [Vitis vinifera]
Length=1113

 Score =   447 bits (1149),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 235/507 (46%), Positives = 330/507 (65%), Gaps = 31/507 (6%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR +   +   K    P+  GA PI+GHL LL SG +P+ R L AMADK+G VF ++LGM
Sbjct  24    WRVRTL-THNSKGISAPKPPGAWPIIGHLHLL-SGQVPIFRTLGAMADKHGPVFMIQLGM  81

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +  +VVSS EAVK+CFTTNDKV A+RP  +V+K LGYNYA F      P+WR+MRK +V 
Sbjct  82    HPAVVVSSHEAVKECFTTNDKVFASRPRSSVSKLLGYNYAGFGFAPYGPFWREMRKLSVV  141

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSS--SAKTVDMSEWFGQLTLNLIVKIVA  1174
             E+LS+++L +L+ +R+SE++  +++LY L   ++  S   V MSEWF  LT N +++++A
Sbjct  142   EILSARRLNELKDVRISELDACIQDLYSLGKDNNWISPIEVVMSEWFEHLTFNFVLRMIA  201

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK-  997
             GKR+      D+     +EA+  I   K+F+ L+G FV  D FPF        +R  +K 
Sbjct  202   GKRYF-----DNAVHGNEEARGAIIAIKKFLSLSGAFVPSDVFPF-------LERLDLKG  249

Query  996   ---DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARG  826
                 M  + +ELD ++  W++EHV   R +S   +        DFIDV+LS + D    G
Sbjct  250   YLGSMKHVAEELDCLVGSWVEEHV--MRLKSEPGSR------HDFIDVLLSAVQDTSMFG  301

Query  825   LAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVE  646
               +  E +IKAT  ++I+ GSD+T++  TW+LS ++N+ +AMKR +E++D KVG+ RWVE
Sbjct  302   --HSRETVIKATIGNLIVGGSDSTSITSTWILSALLNNREAMKRAQEELDLKVGRSRWVE  359

Query  645   DGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDP  466
             + DI+ ++YL+A +KE+LRLY   P   PH AT+DC V GY IPKGT L+VNAWK+HRDP
Sbjct  360   ESDIQKLDYLRAIIKESLRLYSAAPLLVPHEATQDCHVCGYHIPKGTRLFVNAWKLHRDP  419

Query  465   RIWPEPERFMPERFL-TAAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQG  289
             R+W  PE F PERFL + A  D     FE IPFG GRR+C G   A+Q+ HLT ARL+QG
Sbjct  420   RVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINMALQMLHLTFARLLQG  479

Query  288   FDFETPSEKPLDMSEGLGITLPRATAL  208
             FD  TPS  P+DM+EG+  T+P+ T L
Sbjct  480   FDMATPSNAPVDMTEGISFTMPKLTPL  506


 Score =   446 bits (1147),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 232/493 (47%), Positives = 326/493 (66%), Gaps = 22/493 (4%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             P+  GA PI+GHL LL SG +P+ R L AMADK+G VF ++LGM+  +VVSS EAVK+CF
Sbjct  636   PKPPGAWPIIGHLHLL-SGQVPIFRTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECF  694

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             TTNDKV A+RP  +V+K LGYNYA+F       +WR+MRK +V E+LS+++L +L+ +R+
Sbjct  695   TTNDKVFASRPRSSVSKLLGYNYAMFGSAPYGLFWREMRKLSVVEILSARRLNELKDVRI  754

Query  1299  SEVETSLKELYMLITSSS--SAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SE++  +K+LY L   ++  S   V MSEWF  LT N  ++++AGKR+      D+    
Sbjct  755   SELDACIKDLYSLGKDNNWISPIKVVMSEWFEHLTFNFALRMIAGKRYF-----DNAVHG  809

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
              +EA+  I   K+++ L+G FV  D FPF  +  ++ Q   +  M  + +ELD ++  W+
Sbjct  810   NEEARGAIITIKKYLSLSGAFVPSDVFPF--LERLDLQG-YLGSMKHVTEELDCLVGSWV  866

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
             +EHV  R K              DFIDV+LS + D    G  +  E +IKAT +++I+ G
Sbjct  867   EEHV-MRLKSEPGCR-------HDFIDVLLSTVQDTSMFG--HTRETVIKATIVNLIVGG  916

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             SD+T++  TW+LS ++N+ +AMK  +E++D KVG+ RWVE+ DI+ ++YL+A +KE+LRL
Sbjct  917   SDSTSITSTWILSALLNNREAMKHAQEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRL  976

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL-TAAQ  409
             YP  P   PH AT+DC V GY IPKGT L+VNAWK+HRDPR+W  PE F PERFL + A 
Sbjct  977   YPAAPLLVPHEATQDCHVCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHAN  1036

Query  408   ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGIT  229
              D     FE IPFG GRR+C G   A+Q+ HLT ARL+QGFD  TPS  P+DM+EG+  T
Sbjct  1037  LDVFGHQFELIPFGSGRRACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFT  1096

Query  228   LPRATALDVVITP  190
             +P+ T L   I P
Sbjct  1097  MPKLTPLRSSINP  1109



>gb|KDO40894.1| hypothetical protein CISIN_1g009786mg [Citrus sinensis]
Length=525

 Score =   429 bits (1104),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 221/512 (43%), Positives = 320/512 (63%), Gaps = 32/512 (6%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             +KKK   PE  GA P++GHL LLG G  P  R L  MADKYG +FT+++G+ R LVVS+W
Sbjct  39    SKKKRGAPEAGGAWPVIGHLHLLG-GPEPPHRVLGCMADKYGPIFTIKMGINRALVVSNW  97

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             E  K+C TT+DKV A+RP     + LGYN+++F       YWR+ RK A  ELLS+ +LE
Sbjct  98    EMAKECLTTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLE  157

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAKT---VDMSEWFGQLTLNLIVKIVAGKRFKFKV  1150
             KL+ +R  E++T LKELY L  ++ S      V+M  W      N++++++ GK      
Sbjct  158   KLKQVREYELKTCLKELYQLWDNNKSTNKMLLVEMKRWLADSIRNVVLRMIVGKGCN---  214

Query  1149  KEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKEL  970
                 D +E+KE      +   F  ++G+FV  DA PF  +RW++      + M +I KEL
Sbjct  215   --SMDSEEWKE------LLTRFFEMSGKFVVSDALPF--LRWLDIGGDE-RSMKKIAKEL  263

Query  969   DTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDD---FARGLAYPPEIII  799
             D ++Q WL+EH   + KR S   +    + +DF+ VMLS++ D    + R +    + I 
Sbjct  264   DVVVQGWLEEH---KMKRDS---QEMNQEEEDFMYVMLSILGDTDQYYGRDV----DTIN  313

Query  798   KATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEY  619
             KA  L +I+  +DTTAV LTW++SL++NH D + + R ++D +VG +R V + DIK++ Y
Sbjct  314   KAICLGLILAATDTTAVTLTWIISLLLNHHDILNKARNELDIQVGTKRQVNESDIKNLVY  373

Query  618   LQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERF  439
             LQA +KE +RLYP  P   PH + E+C V GY++P GT L++N WK+ RDP +W EP +F
Sbjct  374   LQAILKEAMRLYPAAPLLIPHESIEECTVSGYNVPSGTQLFINVWKLQRDPHVWEEPCKF  433

Query  438   MPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEK  262
              PERFLT  +  D   +NFE +PF  GRR C G ++A+QV   T+A L+ GFD  TPS +
Sbjct  434   QPERFLTRHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLHGFDIATPSNE  493

Query  261   PLDMSEGLGITLPRATALDVVITPRLPPSFYG  166
             PLDM EGLG+T+ ++T L+V++ PRL  S YG
Sbjct  494   PLDMGEGLGLTVEKSTPLEVLVAPRLSASLYG  525



>emb|CBI40977.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   429 bits (1104),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 227/518 (44%), Positives = 321/518 (62%), Gaps = 35/518 (7%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             +R KI  +   K+   P   GA PI+GHL L G+  +   + L AMADKYG VFT+RLG+
Sbjct  54    YRLKIKAASNAKRCTAPRAGGAWPIIGHLHLFGAQQLT-HKTLGAMADKYGPVFTIRLGL  112

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
               ILV+SS E  ++CFTT+D+V + RP    +K LGY++A+F       YWR+MRK    
Sbjct  113   NEILVLSSSEMARECFTTHDRVFSTRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTI  172

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKT---VDMSEWFGQLTLNLIVKIV  1177
             ELLS+ +L+ L+H+R SEV TS++ELY +  S         VDM  WFG LTLNL V++V
Sbjct  173   ELLSNHRLDMLKHIRASEVGTSIRELYEMWVSERGTDGRVFVDMKRWFGDLTLNLAVRLV  232

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
              GKR+                     V ++F +L G FV  DA PF  + W++  +   K
Sbjct  233   GGKRY------------------FGAVIRDFAHLFGVFVLSDAIPF--LSWLDL-KGYKK  271

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
              M R  KELD++   WL EH + R          GK+D QDF+DVML++++D    G  +
Sbjct  272   AMKRTAKELDSLFGGWLQEHKEKR-----LLGGEGKDD-QDFMDVMLTVLEDVNFSG--F  323

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
               + + KAT L++I+ GSDTT V LTW LSL++NHP  +K+ + ++D +VGK+R V++ D
Sbjct  324   DADTVNKATCLNLILAGSDTTKVTLTWALSLLLNHPHVLKKAQAELDIQVGKDRQVDESD  383

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKV-GGYDIPKGTHLYVNAWKVHRDPRI  460
             +K++ YLQA +KETLRLYP  P    HAA EDC +  GY+I  GT + VNAWK+HRD R+
Sbjct  384   VKNLVYLQAIIKETLRLYPASPIITLHAAMEDCTLAAGYNISAGTQIMVNAWKIHRDERV  443

Query  459   WPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             W  P+ F PERF+T+ +  D   ++FE IPFG GRRSC G + A+QV H  +A L+  ++
Sbjct  444   WCNPKEFQPERFMTSHKDTDVRGQHFELIPFGSGRRSCPGISLALQVVHFALASLLHSYE  503

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
                PS+  +DM+E LG+T  +AT L+V+++PRL    Y
Sbjct  504   VTKPSDGDVDMTESLGLTNLKATPLEVLLSPRLKAELY  541



>ref|XP_007017413.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14638.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   429 bits (1102),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 230/519 (44%), Positives = 330/519 (64%), Gaps = 31/519 (6%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             W SK   +  K++   PE   + P++GHL LLG G  P    L  MA+KYG +FT+++G+
Sbjct  29    WISKSVKNRDKRRA-APEAGSSWPVIGHLHLLG-GPQPAHIVLGDMAEKYGPIFTIKMGV  86

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             YR LVV++WE  K+C TTNDK  A+RP     + L Y++A+F      PYWR+MRK A  
Sbjct  87    YRALVVNNWETAKECLTTNDKAFASRPKTLAMELLSYDHAMFGFAPYGPYWRQMRKVATL  146

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITS---SSSAKTVDMSEWFGQLTLNLIVKIV  1177
             ELLSS +L++L+H+R SE++TSLKELY   +    SS    V+M  WF  +TLN+I++++
Sbjct  147   ELLSSYRLDRLKHVRQSEIKTSLKELYQHWSENKDSSDKVLVEMKAWFRDVTLNVILRMI  206

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEF--QRRV  1003
              GKR           D   E +   +  ++F  L+G+FV  DA PF  ++W++     R 
Sbjct  207   VGKRIP-------SSDSDAEGERWKDALRDFFDLSGKFVISDALPF--LKWLDIGGDERF  257

Query  1002  VKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGL  823
             +K   ++ KELD + + WL +H   +R ++S   ES     QDF+DVM S++ D      
Sbjct  258   MK---KVTKELDEVAEGWLQDH---KRMKASGNQESD----QDFMDVMFSILSDVGK---  304

Query  822   AYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVED  643
              +  + I KAT L+MI+  SDTT V LTW LSL++N+  A+K+ +E++D  VG+++ VE+
Sbjct  305   -HDADTINKATCLAMILAASDTTMVTLTWALSLLLNNRGALKKAQEELDIHVGRDKLVEE  363

Query  642   GDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPR  463
              DIK + YL+A +KETLRLYP  P   PH + EDC V GY IP GT L +N +K+HRDPR
Sbjct  364   SDIKKLVYLRAILKETLRLYPAGPLSLPHESMEDCIVSGYHIPAGTRLLINVYKIHRDPR  423

Query  462   IWPEPERFMPERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGF  286
             +W +P  F PERFLT  +  D   +NFE IPFG GRR C G ++A+QV  LT+A L+QGF
Sbjct  424   VWSDPCEFQPERFLTTYKDFDVRGQNFELIPFGSGRRMCPGVSFALQVLELTLANLLQGF  483

Query  285   DFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             +  TP ++P+DMSE +G+T  +A+ L+V+ITPRLP   Y
Sbjct  484   ELGTPLDEPVDMSEAMGLTNLKASPLEVLITPRLPAVCY  522



>ref|XP_008220885.1| PREDICTED: cytochrome P450 82A3-like [Prunus mume]
Length=1017

 Score =   444 bits (1141),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 232/510 (45%), Positives = 317/510 (62%), Gaps = 25/510 (5%)
 Frame = -3

Query  1671  KTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAV  1492
             K  P E  GA PI GHL LLG G  P   KLAAMADKYG +FT+RLG+Y  LV+SS E  
Sbjct  525   KLAPTEAKGAWPIFGHLPLLG-GSTPPHIKLAAMADKYGPLFTIRLGVYPSLVISSSEIA  583

Query  1491  KDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLR  1312
             K+CFTTND   ++RP   V +++GYN+A+F      P+WR+MRK    +LLS+++LE LR
Sbjct  584   KECFTTNDLASSSRPKLVVVEHVGYNHAMFGFAPSGPFWREMRKITTLKLLSNRRLELLR  643

Query  1311  HLRVSEVETSLKELYMLITSSSSAKT-------VDMSEWFGQLTLNLIVKIVAGKRFKFK  1153
             H+RVSEV T L+ELY   +++   ++       V++ +WFG +TLN+I+++VAGKR+   
Sbjct  644   HIRVSEVTTFLQELYKTWSTAEKRESNNRDGVLVELKQWFGDMTLNVILRMVAGKRYSVA  703

Query  1152  VKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKE  973
               ED    E  EA+ +    K F Y  G FV GDA P+  +RW++      K M +I KE
Sbjct  704   ADED----EKTEARRVQSALKLFFYYVGLFVLGDAVPY--LRWLDLGGHE-KAMKKIAKE  756

Query  972   LDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKA  793
             LD I+  W++EH   RR R  A  E       DFID MLS++D     G  +  + + KA
Sbjct  757   LDAIVGGWVEEH-KRRRARGDAKGEP------DFIDAMLSVLDGADLGG--FDADTVNKA  807

Query  792   TGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQ  613
             T L+MI   SDTT V LTW +SL++N+P  +KR + ++D+++G++R V + DI  + Y+Q
Sbjct  808   TSLNMIAGASDTTMVTLTWAISLLLNNPHMLKRAQTELDTEIGRQRVVSESDISKLVYIQ  867

Query  612   AAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMP  433
             A VKETLRLYP  P   P   T+DC +GGY + KGT L  N WK+  DPRIWP+P  F P
Sbjct  868   AIVKETLRLYPAAPLSGPREFTKDCTIGGYHVSKGTRLITNLWKIQTDPRIWPDPLEFKP  927

Query  432   ERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPL  256
             ERFLT  +  D    +FE IPFG GRR+C G  +A+Q+   T+A  +  F+   P   P+
Sbjct  928   ERFLTTQKDVDVKGLHFELIPFGSGRRACPGLAFALQMVQFTLASFVHAFEISNPLSAPI  987

Query  255   DMSEGLGITLPRATALDVVITPRLPPSFYG  166
             DM+E  G+T  +AT L V+I PRLP   YG
Sbjct  988   DMTESFGLTNVKATPLQVLIKPRLPSQLYG  1017


 Score =   379 bits (973),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 202/441 (46%), Positives = 281/441 (64%), Gaps = 23/441 (5%)
 Frame = -3

Query  1581  LAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVF  1402
             LA++ DKYG  FT+ +G++  LV+S+WE  KDCFTTND V+++RP    AK+LGYN+A+F
Sbjct  77    LASLVDKYGPAFTINIGIHSALVISTWEVAKDCFTTNDMVVSSRPATLGAKHLGYNFAMF  136

Query  1401  SLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRVSEVETSLKELYMLIT---SSSSAKTV  1231
                   PYWR+MRK    ELLS+++LE L+ +RVSEVE SLKELY L      SS  + V
Sbjct  137   GFSPYGPYWREMRKLTSLELLSNRRLELLKKVRVSEVEMSLKELYTLWIKRKESSGERLV  196

Query  1230  DMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGD  1051
             +M  WFG LTLN+I ++VAGKR       + +  E KEA+   +  +EF +L G FV GD
Sbjct  197   EMKRWFGDLTLNVIFRMVAGKRCFM----NGNLSEEKEARRWQKAMREFFHLAGLFVLGD  252

Query  1050  AFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDF  871
             A P+  + W++   +  K M +  KELD+I+  WL+EH   ++K +      GK+  QDF
Sbjct  253   AVPW--LSWLDLGGQQ-KAMKKNAKELDSIVAEWLEEH---KQKITE-----GKD--QDF  299

Query  870   IDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRI  691
             +DVMLS I+     G  +  + +IKAT L +I  GSDTT V LTW LSL++N+   +K+I
Sbjct  300   MDVMLSAINGTDVAG--FDADTVIKATCLILIAGGSDTTMVTLTWALSLLLNNRQVLKKI  357

Query  690   REDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPK  511
              E++D  VGK R +E+ DI ++ YLQA VKE +RL P  P       TEDC +GGY +PK
Sbjct  358   YEELDQYVGKGRLLEESDINNLVYLQATVKEAMRLCPAGPLSGQREFTEDCTIGGYHVPK  417

Query  510   GTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTY  334
             GT L VN WK+  DPR+W +P  F PERFLT  +  D   + FE +PFG GRR+C G ++
Sbjct  418   GTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHKDVDVRGQQFELMPFGSGRRACPGISF  477

Query  333   AMQVSHLTVARLIQGFDFETP  271
              +Q++ LT+A  +   D+  P
Sbjct  478   GLQMTLLTLASFLFSMDYSLP  498



>gb|KDP26347.1| hypothetical protein JCGZ_17505 [Jatropha curcas]
Length=526

 Score =   429 bits (1102),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 221/505 (44%), Positives = 319/505 (63%), Gaps = 19/505 (4%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
              K  +LPPEV GA P +GHL  LG    P  R L  +AD YG +FT+RLG +  +V+S  
Sbjct  34    NKGGSLPPEVAGALPFIGHLHKLGDRK-PFARILGEIADNYGPIFTVRLGKHPTIVISDQ  92

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
               +K+ +TT+DK  A+RP  + +KYL YNYA F     S YWR +RK A+ ++LS  +L+
Sbjct  93    NILKEFYTTHDKFFASRPPSSQSKYLAYNYAAFGFAPYSTYWRDVRKLAMVQVLSLHRLK  152

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKED  1141
              L+H+RV+EV   +++L++    + +  +VDMSE    L LN+I ++VAGKR+       
Sbjct  153   LLQHVRVTEVSHIVQDLFLKCKENGNC-SVDMSELLEHLVLNIITRMVAGKRYFDGNSTG  211

Query  1140  DDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTI  961
             +D    +  + I ++ +EFMYL G FV  D  PF  + W EF   V K M ++MKE D I
Sbjct  212   ND----ENRRPIGQIMREFMYLAGVFVASDLIPF--LGWSEFLGPV-KTMKKVMKEFDNI  264

Query  960   LQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLS  781
             ++ W+ EH   R    S       N HQDFIDV+LS I DD   G +   + +IKAT L+
Sbjct  265   IENWIHEHESKRVNGES-------NVHQDFIDVLLSEIKDDSTFGNSR--KTVIKATILT  315

Query  780   MIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVK  601
             +I+ G+DTT++ +TW+L+ ++N+  A++  +E+ID KVG++R +E+ D +++ YL+A +K
Sbjct  316   VIVGGADTTSITMTWILANLLNNKKALELAQEEIDQKVGRDRILEESDCENLVYLKAIIK  375

Query  600   ETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFL  421
             ETLRLYP  P   P  +  DC   GY IP+GT    N WK+HRDP++W  P+ F PERFL
Sbjct  376   ETLRLYPAGPLAVPRESMVDCNFYGYHIPRGTRFLTNLWKLHRDPKVWANPDEFKPERFL  435

Query  420   TA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSE  244
             T+ A  D   +NFE +PFG GRRSC G  +AMQV  L + RL+QGF+  TPS + +DM+E
Sbjct  436   TSHADVDVVGQNFELLPFGSGRRSCPGLNFAMQVVQLGIGRLLQGFNLRTPSNELVDMTE  495

Query  243   GLGITLPRATALDVVITPRLPPSFY  169
              L I+L + T L++V+TPRL P  Y
Sbjct  496   SLNISLSKETPLEIVLTPRLAPQLY  520



>ref|XP_006432711.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
 gb|ESR45951.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
Length=473

 Score =   427 bits (1097),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 224/507 (44%), Positives = 312/507 (62%), Gaps = 37/507 (7%)
 Frame = -3

Query  1677  KKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             KKK   PE  GA P++GHL +LG G  PL R L +MADKYG +FT+++G+ R LVVSSWE
Sbjct  1     KKKRGAPEAGGAWPVIGHLHILG-GPEPLHRVLGSMADKYGPIFTIKIGINRALVVSSWE  59

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
               K+C TTNDK+ A+RP     + LGYN+++F       YWR+ RK A  ELLS  +LEK
Sbjct  60    MAKECLTTNDKIFASRPKTLAMEILGYNFSMFGSSPYGSYWRETRKIATLELLSKHRLEK  119

Query  1317  LRHLRVSEVETSLKELYMLITSSSSAKT--VDMSEWFGQLTLNLIVKIVAGKRFKFKVKE  1144
             LRH+R  EV+T LKELY L   S S     V+M  WF     N+I++++ GK        
Sbjct  120   LRHVRDYEVKTCLKELYELWDKSKSTNKMLVEMKRWFEDTICNVILRMIVGK--------  171

Query  1143  DDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDT  964
                C+   +             ++G+FV  DA PF  +RW++      + M +  KELD 
Sbjct  172   --GCNSVDK-------------MSGKFVVSDALPF--LRWLDIGGDE-RSMKKTAKELDI  213

Query  963   ILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGL  784
             ++Q  L+EH   +RKR S      K +  DF+ VMLS++ D   +      + I KA  L
Sbjct  214   VVQGCLEEH---KRKRDS---REMKGEELDFMSVMLSILGDT-EKYSGRDVDTINKAVCL  266

Query  783   SMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAV  604
              +II G DTT V LTW++SL++NH D + +++ ++D +VG +R V + D+K++ YLQA +
Sbjct  267   GLIIAGLDTTTVTLTWVISLLLNHRDILDKVQNELDIQVGTKRQVNESDLKNLVYLQATL  326

Query  603   KETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERF  424
             KE +RLYP +P   PH A E+C V GY +P GT L +N WK+ RDPR+W EP +F PERF
Sbjct  327   KEAMRLYPAVPLLIPHEAIEECTVNGYHVPAGTQLLINVWKLQRDPRVWEEPCKFQPERF  386

Query  423   LTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMS  247
             LT  +  D   ++ E +PFG GRR C G ++A+QV   T+A L+QGFDF TPS +PLDM 
Sbjct  387   LTKHKDIDVRGQHLELLPFGSGRRMCPGVSFALQVMQFTIASLLQGFDFATPSNEPLDMG  446

Query  246   EGLGITLPRATALDVVITPRLPPSFYG  166
             EG G+T+ ++  L+V+I PRL  S YG
Sbjct  447   EGFGLTMEKSRPLEVLIAPRLSASLYG  473



>ref|XP_007017411.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14636.1| Cytochrome P450, putative [Theobroma cacao]
Length=525

 Score =   429 bits (1102),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 232/518 (45%), Positives = 329/518 (64%), Gaps = 27/518 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             W S+   S   K+    E  GA PI+GH+ LLG G  P    LA MADK+G++FT++LG+
Sbjct  26    WFSRTASSSRNKRRTATEASGAWPIIGHIPLLG-GPRPPHLSLANMADKFGTIFTIKLGV  84

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +R LVVS+WE  K+C TTNDK  A RP  A  + LGYNYA+ +     PYWR++R+FA  
Sbjct  85    HRALVVSNWEIAKECLTTNDKAFATRPKLAGMEILGYNYAMIAFAPYGPYWRQVRRFATV  144

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYML--ITSSSSAKT-VDMSEWFGQLTLNLIVKIV  1177
             +LLS+ +L+ L+ +R SEVETSL++LY L     S+SAK  VDM  WF  + LN+I+ I+
Sbjct  145   KLLSNHRLDMLKRVRESEVETSLQQLYQLWDKKRSNSAKVLVDMKRWFRDVVLNVILMII  204

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
              GKR      E D+  ++K++        +F  L+G+FV  DA PF  +RW++      K
Sbjct  205   VGKRIP-NSSEGDETVKWKKS------LDDFSELSGKFVVSDALPF--LRWLDIGGE-EK  254

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
              M +I KELD +++ WL EH     K   AANE+  N  +DF+ VMLS++ D       +
Sbjct  255   FMKKIAKELDQVVEGWLQEH-----KHKRAANEA--NSEEDFMGVMLSILRD----AEEH  303

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKER-WVEDG  640
               + + KAT L++I+   DTT+  +TW LSL++N+ + +K++++++D++VG +R  V + 
Sbjct  304   DADTVNKATSLALILAAEDTTSTTMTWALSLLLNNRNRLKKVQQELDTQVGMDRLLVTES  363

Query  639   DIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRI  460
             D K++ YLQ+ VKETLRLYP  P    H A EDC V  Y +  GT L +N  K+HRDP +
Sbjct  364   DTKNLVYLQSVVKETLRLYPAAPLSVIHEAIEDCTVNDYHVSAGTWLILNLHKIHRDPGV  423

Query  459   WPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             W +P  F PERFLT  +  D   +NFE IPFG GRR C G ++A+Q+ HLT+A ++  FD
Sbjct  424   WSDPCEFRPERFLTTHKDVDVRGQNFELIPFGSGRRMCPGVSFALQILHLTLANVLHWFD  483

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             F TP ++P+ M EG G+T PRAT L+V ITPRLP S Y
Sbjct  484   FATPLDEPVAMREGAGLTSPRATPLEVHITPRLPASLY  521



>ref|XP_010028535.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=526

 Score =   429 bits (1102),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 221/506 (44%), Positives = 316/506 (62%), Gaps = 14/506 (3%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
              K+    PE  GA P+ GHL LLG   + L R LA MAD+YG  F++RLG+ R+LVVS+W
Sbjct  33    NKRGQTLPEAAGAWPLFGHLHLLGPNKL-LHRILAVMADQYGPAFSIRLGILRVLVVSNW  91

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             E  K+CFT+ND+V   RP     K +GY++A+       PYWR MRK AV ELLS+ +L+
Sbjct  92    EVAKECFTSNDRVFPTRPRSLSIKLMGYDHAMLGFAPYGPYWRGMRKLAVVELLSNHRLD  151

Query  1320  KLRHLRVSEVETSLKELY-MLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKE  1144
               +H+R +E    +K LY   +++  +  TV+M + FG + +N+ V++VAGKR+      
Sbjct  152   SFKHVRDAETNLFVKGLYEKWLSNGENPVTVEMEKDFGHVAMNITVRMVAGKRYLSGNGN  211

Query  1143  DDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDT  964
             + D +E    +   +   +F +L G+F+  DA PF  + W++  +  V +M R  KELD 
Sbjct  212   EGDEEESSRCR---KALGDFSHLVGEFMVSDAIPF--LGWLDIVKGRVAEMKRTAKELDW  266

Query  963   ILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGL  784
             +L RW++EH   R++R+ A  E   +D QDFI  MLS  + +  +      + I+KAT L
Sbjct  267   VLGRWVEEH---RKRRAVAKVE---DDEQDFIHFMLSATELEEGKYSVQEADTIVKATCL  320

Query  783   SMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAV  604
             SMI+ G+DT  + LTW LSL++N+P +++R ++++D +VGK R VE+ DIK++ YLQA V
Sbjct  321   SMILGGNDTIVLTLTWALSLLLNNPHSLERAQDELDVQVGKHRQVEESDIKNLTYLQAVV  380

Query  603   KETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERF  424
             KETLR+YP LP      A EDC V G+ +P GT L VN WK+ RDPR+W     F PERF
Sbjct  381   KETLRIYPVLPLSLQREAMEDCIVAGFHVPAGTRLMVNLWKLQRDPRVWSHASEFQPERF  440

Query  423   LT-AAQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMS  247
             LT     D   ++FEYIPFG GRR C G ++ +QV  L +ARL+  F  E  S   +DMS
Sbjct  441   LTDHVHVDVRGQSFEYIPFGTGRRMCPGVSFGLQVVQLILARLLHAFKLERVSGSEVDMS  500

Query  246   EGLGITLPRATALDVVITPRLPPSFY  169
             E   +T+PRAT L+ V+TPRLP + Y
Sbjct  501   ESPALTMPRATPLEAVLTPRLPATCY  526



>ref|XP_008235427.1| PREDICTED: cytochrome P450 82G1-like [Prunus mume]
Length=535

 Score =   429 bits (1102),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 220/503 (44%), Positives = 323/503 (64%), Gaps = 17/503 (3%)
 Frame = -3

Query  1665  LPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKD  1486
             L P+  GA P +GHL LL  G  P+   L AMAD +G +F+L+LG +++LV+S+WE VK+
Sbjct  45    LVPQPSGAWPFIGHLPLL-RGKDPVAITLGAMADDHGPLFSLKLGQHQVLVLSAWETVKE  103

Query  1485  CFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHL  1306
             C TTND+V A RP  A  KYLGY+ A F++    PYWR +RK A  ELLS++++E L H+
Sbjct  104   CLTTNDRVFATRPSMAGGKYLGYDNAAFAIAPYGPYWRHVRKLATLELLSTKRVEMLSHV  163

Query  1305  RVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCD  1129
             R SEV+  +K L  L T + S  T V +SE    LT N+ V+++AGKRF  +   + + D
Sbjct  164   RTSEVDLFVKNLLSLCTKNGSRTTPVHLSELIEFLTFNINVRLIAGKRFTAEQYNEKNSD  223

Query  1128  EYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRW  949
              ++  + +    K+ +YL G FV+ DA P+  + W++     V  M R  KELD +L +W
Sbjct  224   AWRFEKAV----KDALYLLGVFVWSDAMPW--LEWLDILFGHVGSMKRCFKELDCVLGKW  277

Query  948   LDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIID  769
             L+EH    R+RS    +  + +  D +DVM+S   ++      +  + +IKAT L +I+ 
Sbjct  278   LEEH----RQRSRPQCKIDRVE-SDLMDVMMSSFQEEDDVIFGHSRDDVIKATALVLILT  332

Query  768   GSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLR  589
             G+++T+V LTW LSL++N+P  +K +++++D  VG++RWV++ D+ +++YLQA +KETLR
Sbjct  333   GTESTSVTLTWALSLLLNNPTTLKAVQQELDIHVGRDRWVQESDLPNLKYLQAILKETLR  392

Query  588   LYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQ  409
             +YPP P      ATEDC + GY +PKGT + VN WK+ RD RIW  P  F PERF+T  +
Sbjct  393   IYPPGPLAGLREATEDCHLAGYHVPKGTRVLVNIWKLQRDARIWANPGEFQPERFMT-TR  451

Query  408   ADAPWR---NFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
             AD  ++   NFEYIPFG GRRSC G    +QV  L +ARL+QGFD     E+ +DM EGL
Sbjct  452   ADVEFKDQNNFEYIPFGSGRRSCPGMVLGLQVVQLILARLVQGFDISRVGEEAVDMREGL  511

Query  237   GITLPRATALDVVITPRLPPSFY  169
             G+ LP+A  L+ +++PRLP   Y
Sbjct  512   GLALPKANPLEALLSPRLPLHLY  534



>ref|XP_010064745.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   429 bits (1102),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 224/508 (44%), Positives = 326/508 (64%), Gaps = 25/508 (5%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
             KK   PE  GA P++GHL LLG G +P    LA+MADKYG +FT++ G++R L+VS+W+ 
Sbjct  43    KKASLPEAGGAWPLIGHLHLLG-GPVPPHIILASMADKYGPIFTIKTGVHRALIVSNWQI  101

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKL  1315
              K C T ND+  A+RP    ++ + YNYA+F L    PYWR +RK  + ELLS+ +LE L
Sbjct  102   AKQCLTVNDRAFASRPKSVSSEVMAYNYAMFGLAPYGPYWRHVRKITMLELLSNHRLELL  161

Query  1314  RHLRVSEVETSLKELYMLITSSSSAK----TVDMSEWFGQLTLNLIVKIVAGKRFKFKVK  1147
             +H+R SEV+ S+  LY     S S       VDM  WFG +TLN++ +++ GKR+     
Sbjct  162   KHVRHSEVQASVTHLYKRCMESYSGAPMKVLVDMKRWFGDITLNVVFRMIVGKRY-----  216

Query  1146  EDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELD  967
             ED+  ++ +EA       + +  L G+F+  DAFP  I+RW++      K M +   ELD
Sbjct  217   EDEQDEKGREA------LRSYFDLAGRFIVSDAFP--ILRWLDLDG-YEKMMKKTAHELD  267

Query  966   TILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGL-AYPPEIIIKAT  790
              ++Q WL+EH   RR+ ++      K+  QDF+DVMLS++D   A  L  Y  +  IKAT
Sbjct  268   RVVQGWLNEH--KRRRSANKRRGDNKDSDQDFMDVMLSIVDA--AEELPGYDADTFIKAT  323

Query  789   GLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQA  610
              +++++ GSDTT+V LTW LSL++NH + +K+ + ++D+++G+ER V + D+ ++ Y+QA
Sbjct  324   CMALVLAGSDTTSVSLTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDLMNLVYIQA  383

Query  609   AVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPE  430
              +KET+RLYP  P   PH + EDC V GY IPKGT L +N WK+HRD  IW +P  F PE
Sbjct  384   IIKETMRLYPAAPLGVPHESMEDCTVDGYHIPKGTRLLLNFWKIHRDQHIWSDPLEFRPE  443

Query  429   RFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLD  253
             RFLT  +  D   +NFE IPFG GRR C G   AMQ+  L++A L+ GFD  T +++P+D
Sbjct  444   RFLTTHRNFDVRGQNFELIPFGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEPVD  503

Query  252   MSEGLGITLPRATALDVVITPRLPPSFY  169
             M+E +G+T  +AT L+V++TPRLP   Y
Sbjct  504   MAEAIGMTNLKATPLEVLVTPRLPEHAY  531



>ref|XP_003548649.2| PREDICTED: cytochrome P450 82C2-like [Glycine max]
Length=541

 Score =   429 bits (1102),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 225/511 (44%), Positives = 313/511 (61%), Gaps = 20/511 (4%)
 Frame = -3

Query  1686  SFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVS  1507
             S  +K    PE  GA P +GH+ LL +   P  R  +A+A+KYG +F L+LG +  LVV+
Sbjct  43    SKQRKGNQVPEPRGALPFIGHVHLLNARK-PYFRTFSAIAEKYGPIFILKLGCHPTLVVN  101

Query  1506  SWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQK  1327
             S E  K+C TTNDKV A+RP  +  K LGYN AVF       YWR++RK A  E+LSS K
Sbjct  102   SREIAKECLTTNDKVFASRPITSAGKILGYNNAVFGFSPYGKYWREIRKMATLEILSSYK  161

Query  1326  LEKLRHLRVSEVETSLKELYMLIT----SSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFK  1159
             LEKL+H+R +E  + +K+LY  I+     + S   V +S     ++ N+IV+++AGKRF 
Sbjct  162   LEKLKHVRDTETLSLVKDLYSSISYPKNVNGSTTHVPISNLLEHMSFNIIVRMIAGKRFG  221

Query  1158  FKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIM  979
                   +D     EA  +    ++  YL G FV  DA P   + W++FQ   V  M R  
Sbjct  222   GDTVNQED----NEAWRLRNAIRDATYLCGVFVAADAIPS--LSWIDFQG-YVSFMKRTN  274

Query  978   KELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIII  799
             KE+D IL++WL+EH+  R +      ES      DF+DVM+S   ++      Y  E++I
Sbjct  275   KEIDLILEKWLEEHLRKRGEEKDGKCES------DFMDVMISAFQEE-EEICGYKREMVI  327

Query  798   KATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEY  619
             KAT + +I+  S +TA+ LTW LSL++NHP  +K  ++++D+ +GKERWV++ DIK++ Y
Sbjct  328   KATSVLLILTASGSTAITLTWALSLLLNHPKVLKAAQKELDTHLGKERWVQESDIKNLTY  387

Query  618   LQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERF  439
             LQA +KETLRLYPP P        EDC V GY +PKGT L +N W + RDP++WP P +F
Sbjct  388   LQAIIKETLRLYPPAPLTGIREVMEDCCVAGYHVPKGTRLLINLWNLQRDPKVWPNPNKF  447

Query  438   MPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEK  262
              PERFLT     +   +NFE IPF  GRRSC G T+ +QV HLT+ARL+QGFD  T    
Sbjct  448   EPERFLTTHHDINFMSQNFELIPFSIGRRSCPGMTFGLQVLHLTLARLLQGFDICTKDGA  507

Query  261   PLDMSEGLGITLPRATALDVVITPRLPPSFY  169
              +DM+EGLG+ LP+   L V++ PRLP   Y
Sbjct  508   EVDMTEGLGVALPKEHGLQVMLQPRLPLGLY  538



>ref|XP_002282035.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=528

 Score =   428 bits (1100),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 233/511 (46%), Positives = 326/511 (64%), Gaps = 23/511 (5%)
 Frame = -3

Query  1686  SFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVS  1507
             S   K+ + PE  GA PI+GHL LLG   +P    L  MADKYG +FT+RLG++R LVVS
Sbjct  35    SRAGKRRIAPEAAGAWPIIGHLHLLGGSQLP-HVTLGTMADKYGPIFTIRLGVHRALVVS  93

Query  1506  SWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQK  1327
             S E  K+CFTTND  ++ RP     ++LGYNYA+F+      YWR++RK   TELLS+++
Sbjct  94    SREVAKECFTTNDSAVSGRPKLVAPEHLGYNYAMFAFSPYDAYWREVRKIVNTELLSNRR  153

Query  1326  LEKLRHLRVSEVETSLKELYMLITSSSSA---KTVDMSEWFGQLTLNLIVKIVAGKRFKF  1156
             LE L+ +R SEVETS+KELY L     +      V+M +WFG L++N+I+++V GKR+ F
Sbjct  154   LELLKDVRASEVETSIKELYKLWAEKKNELGHVLVEMKQWFGDLSMNVILRMVVGKRY-F  212

Query  1155  KVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMK  976
              V    + +E +  Q  I   +EF  L G FV  D  P   + W++      K M +  K
Sbjct  213   GVGAGGEEEEARRCQKAI---REFFRLLGLFVVKDGIPS--LGWLDLGGHE-KAMKKTAK  266

Query  975   ELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGL-AYPPEIII  799
             E+D+I Q WL+EH    R+R     ++G +D   F+DV+LS++D    + L  Y  + I 
Sbjct  267   EIDSIAQEWLEEH----RRRKDWGEDNGMHD---FMDVLLSVLD---GKALPEYDADTIN  316

Query  798   KATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEY  619
             KAT +++I  G+DT  V LTW LSLI+N+ + +K+ +E++D+ VGKER V   DI  + Y
Sbjct  317   KATSMALISGGTDTMTVTLTWALSLILNNRETLKKAKEELDTHVGKERLVNASDISKLVY  376

Query  618   LQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERF  439
             LQA VKETLRL PP P   P   TEDC +GGY +PKGT L +N  K+HRDP +W +PE F
Sbjct  377   LQAIVKETLRLRPPGPLSGPRQFTEDCIIGGYHVPKGTRLVLNLSKLHRDPSVWLDPEEF  436

Query  438   MPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEK  262
              PERFLT  +  DA  ++F+ +PFG GRRSC G T+A+Q+ HL +A  + GF+  TPS  
Sbjct  437   QPERFLTTHRDVDARGQHFQLLPFGAGRRSCPGITFALQMLHLALASFLHGFEVSTPSNA  496

Query  261   PLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             P+DMSE  G+T  ++T L+++I PRLP + Y
Sbjct  497   PVDMSEIPGLTNIKSTPLEILIAPRLPYNSY  527



>ref|XP_002510298.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52485.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   427 bits (1099),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 221/508 (44%), Positives = 321/508 (63%), Gaps = 18/508 (4%)
 Frame = -3

Query  1686  SFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVS  1507
             S   K    PE  G+ PI+GHL LLG     L R L ++ADKYG  F +R+G +R LVV+
Sbjct  30    SVGSKSREAPEPAGSWPIIGHLHLLGGADKLLHRTLGSLADKYGPAFNIRIGSHRALVVA  89

Query  1506  SWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQK  1327
             S E  K+CFT NDK +A+R   A  K++ Y++AVF     S +WR+MRK  + ELLS+++
Sbjct  90    SKELAKECFTINDKTLASRSTTAATKHMCYDHAVFGFAPYSSHWREMRKIVMLELLSNRR  149

Query  1326  LEKLRHLRVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKV  1150
             LE ++H++ SEV+  +++LY L   +      V++ ++F  LTL++IV++VAGKR+    
Sbjct  150   LEMVKHVQASEVDLGIRKLYNLWAQNRCLPVIVELKQFFEDLTLDVIVRVVAGKRYTGS-  208

Query  1149  KEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKEL  970
              +DD+  +Y++A        +F +L G FV  DA PF  +RW++ +    K M +  K+L
Sbjct  209   SDDDEARQYQKA------ISQFFHLMGIFVVSDALPF--LRWLDLEGH-EKAMKKTAKDL  259

Query  969   DTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKAT  790
             D +L  WLDEH   RR+R S   +S  +  QDFIDVMLS+ +     G  Y  +  IK+T
Sbjct  260   DAVLAGWLDEH---RRRRVSGEVKSEGD--QDFIDVMLSLEEKGHLSGFQYDADTSIKST  314

Query  789   GLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQA  610
              L++I   SDTT   L W +SL++N+  A+K  +E+++  +G ER V++ D+K++ YLQA
Sbjct  315   CLALIAGASDTTTTTLVWAISLLLNNQLALKNAKEELEKHIGTERQVDESDLKNLVYLQA  374

Query  609   AVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPE  430
              +KETLRLYP  P   P    EDC+VGGY +P GT L VN WK+ RDP +W +   F PE
Sbjct  375   VIKETLRLYPVAP-LIPREFVEDCRVGGYHVPAGTRLLVNVWKIQRDPMLWTKASAFQPE  433

Query  429   RFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLD  253
             RFLT+ A  D    +FE +PFG GRRSC G ++A+   HLT+AR +  FD  TP ++P+D
Sbjct  434   RFLTSHADIDVRGHHFELLPFGSGRRSCPGASFALHALHLTLARFLHAFDVATPMDQPVD  493

Query  252   MSEGLGITLPRATALDVVITPRLPPSFY  169
             M+E  G TLP+AT L+V+++PRLP   Y
Sbjct  494   MTERSGTTLPKATPLEVLLSPRLPAKLY  521



>ref|XP_003516592.1| PREDICTED: cytochrome P450 82A3-like isoform X1 [Glycine max]
Length=530

 Score =   428 bits (1100),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 225/509 (44%), Positives = 322/509 (63%), Gaps = 18/509 (4%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             TKK    P+  GA PI+GHL L  +G     + L  MA+K+G +FT++LG Y++LV+SSW
Sbjct  33    TKKICSAPQAAGAWPIIGHLHLF-NGHQLTHKTLGMMAEKHGPIFTIKLGSYKVLVLSSW  91

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             E  K+CFT +DK  + RP  A +K +GYNYA+F       YWR++RK    ELLS+ +LE
Sbjct  92    EMAKECFTVHDKAFSTRPCVAASKLMGYNYAMFGFTPYGSYWRQVRKLTTIELLSNNRLE  151

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAK---TVDMSEWFGQLTLNLIVKIVAGKRFKFKV  1150
              L+  R  E++ ++KELY L T +   K    VDM +WFG LT N+ +++V GK +    
Sbjct  152   PLKETRTFELDAAVKELYKLWTRNGCPKGGVLVDMKQWFGDLTHNIALRMVGGKSY---C  208

Query  1149  KEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKEL  970
                DD  E  EA+    V ++++ L G FV+ D+FPF  + W++      KDM R   EL
Sbjct  209   GVGDDHAE-GEARRYRRVMRDWVCLFGVFVWSDSFPF--LGWLDIN-GYEKDMKRTASEL  264

Query  969   DTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKAT  790
             DT+++ WL+EH   +RK+    + +GK +  DF+DVML+++      G  Y  + IIKAT
Sbjct  265   DTLVEGWLEEH---KRKKKRGLSVNGKEEQDDFMDVMLNVLQGTEISG--YDSDTIIKAT  319

Query  789   GLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQA  610
              L++I+ G+D T V LTW LSL++NH   +KR + ++ + +GK R V++ DIK + YLQA
Sbjct  320   CLNLILAGTDPTMVTLTWALSLLLNHQTELKRAQHELGTLMGKHRKVDESDIKKLVYLQA  379

Query  609   AVKETLRLYPPLPTYAPHAATEDCKVG-GYDIPKGTHLYVNAWKVHRDPRIWPEPERFMP  433
              VKETLRLYPP P     AA EDC    GY IP GT L VNAWK+HRD R+W +P  F P
Sbjct  380   VVKETLRLYPPSPIITLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSDPNDFKP  439

Query  432   ERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPL  256
             ERFLT+ +  D   +N+E +PF  GRR+C G + A++V HLT+ARL+  F+  +PS + +
Sbjct  440   ERFLTSHKDVDVKGQNYELVPFSSGRRACPGASLALRVVHLTLARLLHSFNVASPSNQVV  499

Query  255   DMSEGLGITLPRATALDVVITPRLPPSFY  169
             DM+E  G+T  +AT L+V++TPR    FY
Sbjct  500   DMTESFGLTNLKATPLEVLLTPRQDTKFY  528



>ref|XP_007224171.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
 gb|EMJ25370.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
Length=517

 Score =   427 bits (1099),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 216/520 (42%), Positives = 330/520 (63%), Gaps = 19/520 (4%)
 Frame = -3

Query  1701  SKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYR  1522
             S +F     ++  PP+  GA PI+GHL LLG G  P    L  MA++YG +FT+ +G+ +
Sbjct  7     SSLFMKSRGERKSPPKAGGAWPIIGHLHLLG-GSKPPHLVLGKMAERYGPIFTVNIGVQK  65

Query  1521  ILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTEL  1342
              L+VSS E  K+CFTTNDKV A+RP F  A+ + YNYA+F     S Y R++RK  + E+
Sbjct  66    ALIVSSSEIAKECFTTNDKVFASRPKFMAAEIMAYNYALFPFSPYSHYSRQVRKIVLLEV  125

Query  1341  LSSQKLEKLRHLRVSEVETSLKELYMLI------TSSSSAKTVDMSEWFGQLTLNLIVKI  1180
             LS+ +LE L+H+R SEV+ S+K +Y         ++SS+   V+M EWF  +  N+++++
Sbjct  126   LSNSRLEMLKHVRESEVKASMKGIYERCVTNGKSSTSSNKALVEMREWFLDINENIVIRM  185

Query  1179  VAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVV  1000
             + GKRF+     +     Y   +   E + +F+ L+G FV  DA P W+ RW++      
Sbjct  186   IVGKRFREATSSNSKGSNYYLKK---ETYMDFLRLSGTFVLSDAIP-WL-RWLDLGGHE-  239

Query  999   KDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA  820
             + M ++ KELD +   WL+EH   +++R  +    G +D  DF+DVMLS++D D A  + 
Sbjct  240   RAMKKVAKELDLVFNGWLEEH---KQRRKISGQVKGGDDQLDFMDVMLSILDVDGANEIT  296

Query  819   --YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVE  646
               Y  + + KAT +++I+ G +  AV +TW L+L++N+ +A+K+ +E++D  +GK+R V+
Sbjct  297   SDYDADTVNKATSMALIVAGVEAPAVQMTWALALLLNNREALKKAQEELDQIIGKDRQVK  356

Query  645   DGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDP  466
             + DIK++ YLQA +KE++RLYP  P   PH +TEDC VG Y +P GT L VN  K+HRDP
Sbjct  357   ESDIKNLVYLQAIIKESMRLYPAGPLSLPHESTEDCMVGDYHVPAGTRLLVNLSKLHRDP  416

Query  465   RIWPEPERFMPERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQG  289
             R+W +P  F PERFLT  ++ D    +FE IPFG GRR C G + A++V  LT+A L+ G
Sbjct  417   RVWSDPNEFRPERFLTTHKSFDVKGHDFELIPFGSGRRMCPGMSLALKVIALTLASLLHG  476

Query  288   FDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             F+  TP+++ +DM E +G+T  +AT L+V+ TPRLP   Y
Sbjct  477   FEIGTPTDETVDMGETVGVTNNKATPLEVLFTPRLPAQLY  516



>ref|XP_011030967.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   428 bits (1100),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 227/525 (43%), Positives = 327/525 (62%), Gaps = 28/525 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             W S+ F + T KK   P+  GA P++GHL LLG G  P  + L +MA+KYG +FT+++G+
Sbjct  30    WISRKFLARTGKKKAAPKAGGAWPVIGHLHLLG-GAEPPHKVLGSMAEKYGPIFTIKMGV  88

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +R LVVS+WE  K+CFTT+DK  + RP    ++ L Y+ A+       PYWR++RK    
Sbjct  89    HRALVVSNWETAKECFTTHDKAFSGRPKTLASELLTYDGAMMGFSPYGPYWRQVRKITTV  148

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYML--------ITSSSSAKTVDMSEWFGQLTLNL  1192
             ELLS+ +LEKL+ +R SEV   LKELY L          S  S   V+M  WFG LTLN+
Sbjct  149   ELLSNYRLEKLKDVRESEVRAFLKELYKLWDDNRGGASKSKGSMVLVEMERWFGDLTLNI  208

Query  1191  IVKIVAGKRFKF--KVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVE  1018
             +++ + GK   +   V++++    +K+        K+F +  G F   DA PF  +R+++
Sbjct  209   VLRTIVGKTVGYITNVEDEESVKGWKKG------LKDFFHWTGVFPVSDALPF--LRFLD  260

Query  1017  FQRRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDD  838
                   + M +  KELD +++ WL+EH   +RKR+ A    GK   +DF+D+ML + D+D
Sbjct  261   LGGHG-EAMKKTAKELDLVVEDWLEEH---KRKRA-AGIVKGK---EDFMDLMLDVFDND  312

Query  837   FARGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKE  658
                      + I KAT L++I+  SDTTAV L W LSL+VN+P+A+K+ + ++D+ V KE
Sbjct  313   AEAVQGGDSDTINKATSLTLILAASDTTAVTLIWALSLLVNNPNALKKAQLELDTHVSKE  372

Query  657   RWVEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKV  478
             R VE+ D++++ YL+A +KETLRLYPP P   PH A EDC + GY +P+GT L VN  K+
Sbjct  373   RQVEESDVQNLVYLKAVLKETLRLYPPGPLLIPHEAIEDCTIDGYHVPRGTRLLVNVSKI  432

Query  477   HRDPRIWPEPERFMPERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVAR  301
             HRD R+W  P  F PERFLT  +  D   +NFE++PFG GRR C G ++A+    L +A 
Sbjct  433   HRDERVWSNPNEFDPERFLTTHRGFDVRGKNFEFLPFGSGRRMCPGVSFALHAMDLALAT  492

Query  300   LIQGFDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYG  166
             L+ GFDF TPS +P+DM E  G+T  RAT L+V++ PRLP   YG
Sbjct  493   LLHGFDFATPSGEPVDMHENSGLTNLRATPLEVLLCPRLPSRLYG  537



>gb|KCW68807.1| hypothetical protein EUGRSUZ_F02406 [Eucalyptus grandis]
Length=502

 Score =   427 bits (1097),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 222/503 (44%), Positives = 324/503 (64%), Gaps = 25/503 (5%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA P++GHL LLG G +P    LA+MADKYG +FT++ G++R L+VS+W+  K C 
Sbjct  18    PEAGGAWPLIGHLHLLG-GPVPPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCL  76

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T ND+  A+RP    ++ + YNYA+F L    PYWR +RK  + ELLS+ +LE L+H+R 
Sbjct  77    TVNDRAFASRPKSVSSEVMAYNYAMFGLAPYGPYWRHVRKITMLELLSNHRLELLKHVRH  136

Query  1299  SEVETSLKELYMLITSSSSAK----TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDC  1132
             SEV+ S+  LY     S S       VDM  WFG +TLN++ +++ GKR+     ED+  
Sbjct  137   SEVQASVTHLYKRCMESYSGAPMKVLVDMKRWFGDITLNVVFRMIVGKRY-----EDEQD  191

Query  1131  DEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQR  952
             ++ +EA       + +  L G+F+  DAFP  I+RW++      K M +   ELD ++Q 
Sbjct  192   EKGREA------LRSYFDLAGRFIVSDAFP--ILRWLDLDG-YEKMMKKTAHELDRVVQG  242

Query  951   WLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGL-AYPPEIIIKATGLSMI  775
             WL+EH   RR+ ++      K+  QDF+DVMLS++D   A  L  Y  +  IKAT ++++
Sbjct  243   WLNEH--KRRRSANKRRGDNKDSDQDFMDVMLSIVDA--AEELPGYDADTFIKATCMALV  298

Query  774   IDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKET  595
             + GSDTT+V LTW LSL++NH + +K+ + ++D+++G+ER V + D+ ++ Y+QA +KET
Sbjct  299   LAGSDTTSVSLTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDLMNLVYIQAIIKET  358

Query  594   LRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA  415
             +RLYP  P   PH + EDC V GY IPKGT L +N WK+HRD  IW +P  F PERFLT 
Sbjct  359   MRLYPAAPLGVPHESMEDCTVDGYHIPKGTRLLLNFWKIHRDQHIWSDPLEFRPERFLTT  418

Query  414   AQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGL  238
              +  D   +NFE IPFG GRR C G   AMQ+  L++A L+ GFD  T +++P+DM+E +
Sbjct  419   HRNFDVRGQNFELIPFGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEPVDMAEAI  478

Query  237   GITLPRATALDVVITPRLPPSFY  169
             G+T  +AT L+V++TPRLP   Y
Sbjct  479   GMTNLKATPLEVLVTPRLPEHAY  501



>gb|ABC69420.1| CYP82E8 [Nicotiana tabacum]
Length=519

 Score =   427 bits (1098),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 216/514 (42%), Positives = 321/514 (62%), Gaps = 32/514 (6%)
 Frame = -3

Query  1680  TKKKT-----LPPEVDGARPILGHLRLLGSGGIP---LGRKLAAMADKYGSVFTLRLGMY  1525
             TKK++     LPP++ G  P++GHL    + G       +KL  +ADKYG VFT RLG  
Sbjct  26    TKKQSKILNPLPPKIPGGWPVIGHLFYFKNNGDEDRHFSQKLGDLADKYGPVFTFRLGFR  85

Query  1524  RILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTE  1345
             R L VSS+EA+K+CFTTND   A RP     +YL YN A+ ++    PYW+K RK    E
Sbjct  86    RFLAVSSYEAMKECFTTNDIHFADRPSLLYGEYLCYNNAMLAVAKYGPYWKKNRKLVNQE  145

Query  1344  LLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKR  1165
             +LS  +LEK +H+R S ++ ++K+LY      S    +++S+W  +LT ++I+K+V GK 
Sbjct  146   VLSVSRLEKFKHVRFSIIQKNIKQLY---NCDSPMVKINLSDWIDKLTFDIILKMVVGKN  202

Query  1164  FKFKVKEDDDCDEYKEAQHIIEV-FKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMG  988
             +     E            I++V F++FM    +    D F     +W++    + K M 
Sbjct  203   YNNGHGE------------ILKVAFQKFMVQAMEMELYDVFHIPFFKWLDLTGNI-KAMK  249

Query  987   RIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPE  808
             +  K++D I+Q WLDEH+  R  +     + G  + QDFIDV+LS + D+   G  Y  +
Sbjct  250   QTFKDIDNIIQGWLDEHIKKRETK-----DVGGENEQDFIDVVLSKMSDEHL-GEGYSHD  303

Query  807   IIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKD  628
               IKAT  ++++D +DT A+H+ W+++L++N+   MK+ +E++D+ VG++RWVE+ DIK+
Sbjct  304   TTIKATVFTLVLDATDTLALHIKWVMALMINNKHVMKKAQEEMDTIVGRDRWVEESDIKN  363

Query  627   MEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEP  448
             + YLQA VKE LRL+PP P    H + EDC V GY IPKGT L  N  K+ RDP+ WP P
Sbjct  364   LVYLQAIVKEVLRLHPPAPLSVQHLSVEDCVVNGYHIPKGTALLTNIMKLQRDPQTWPNP  423

Query  447   ERFMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETP  271
             ++F PERFLT  A  D   +++E IPFG GRR+C    Y++QV HL++A +IQGF F T 
Sbjct  424   DKFDPERFLTTHATIDYRGQHYESIPFGTGRRACPAMNYSLQVEHLSIAHMIQGFSFATT  483

Query  270   SEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             + +PLDM +G+G+TLP+ T ++V+ITPRLPP+ Y
Sbjct  484   TNEPLDMKQGVGLTLPKKTDVEVLITPRLPPTLY  517



>gb|KDP26344.1| hypothetical protein JCGZ_17502 [Jatropha curcas]
Length=528

 Score =   427 bits (1099),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 225/509 (44%), Positives = 332/509 (65%), Gaps = 15/509 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             WR     +   KK   PE  G+ P++GHL LL +G  P  + LA++AD+ G  ++LRLG 
Sbjct  23    WRKITKKTTKTKKFKVPEPSGSWPLIGHLHLL-TGQKPACKILASIADESGPFYSLRLGF  81

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
              RILVVSSWE  K+CFT ND+V+A R   A  KY+GYN AVFSL     YWR +RK A  
Sbjct  82    NRILVVSSWEFAKECFTKNDRVLATRASIAAGKYMGYNNAVFSLAPYGQYWRDIRKLATL  141

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGK  1168
             +LLS+ +LE L+H+R SE++  LKELY L + + + K + MS+   +LT N+ ++++ GK
Sbjct  142   QLLSNNRLEALKHVRFSEIDLFLKELYDLYSQNHNQKVI-MSKLLERLTFNISLRMIVGK  200

Query  1167  RFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMG  988
             RF  K   +++ + ++  + I    +E  YL+G  V  DA P+  + W++++  + + M 
Sbjct  201   RFCSKSYSEENSEPWRYKKAI----EEATYLSGSPVMSDAIPW--LEWIDYKGYIGR-MK  253

Query  987   RIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPE  808
             +  KELD ++ +WL+EH+   +K+    NE+G+ND   F+DVMLS + +D      Y  +
Sbjct  254   KTGKELDDLVGKWLEEHL--MKKKWLNENENGEND---FMDVMLSHLQEDEIANSGYSRD  308

Query  807   IIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKD  628
             I++KAT + + + G+ +TAV LTW L+L++N+PDA+K  +E+++S VGK +WV++ DI +
Sbjct  309   IVVKATAVVLSLTGAGSTAVTLTWALALLLNNPDALKSAQEELNSYVGKSKWVQESDIPN  368

Query  627   MEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEP  448
             ++YLQA +KETLRLYPP P      A EDC + GY IPKGT L VN WK+ RDPR+W  P
Sbjct  369   LKYLQAIIKETLRLYPPGPITGIREAMEDCDINGYYIPKGTRLIVNIWKLQRDPRVWNNP  428

Query  447   ERFMPERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETP  271
               F+PERFLT     D   +NFE+IPF  GRR+C    + +QV HLT+ARLIQGFD    
Sbjct  429   HEFLPERFLTTHSGIDLRGQNFEFIPFSSGRRACPAINFGLQVVHLTLARLIQGFDLSRI  488

Query  270   SEKPLDMSEGLGITLPRATALDVVITPRL  184
               +P+DM EG G++LP+   ++V++ PRL
Sbjct  489   GNEPVDMKEGPGLSLPKVNPVEVILKPRL  517



>gb|KHN36187.1| Cytochrome P450 82A3 [Glycine soja]
Length=530

 Score =   427 bits (1098),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 225/509 (44%), Positives = 322/509 (63%), Gaps = 18/509 (4%)
 Frame = -3

Query  1680  TKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSW  1501
             TKK    P+  GA PI+GHL L  +G     + L  MA+K+G +FT++LG Y++LV+SSW
Sbjct  33    TKKICSAPQAAGAWPIIGHLHLF-NGHQLTHKTLGMMAEKHGPIFTIKLGSYKVLVLSSW  91

Query  1500  EAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLE  1321
             E  K+CFT +DK  + RP  A +K +GYNYA+F       YWR++RK    ELLS+ +LE
Sbjct  92    EMAKECFTVHDKAFSTRPCVAASKLMGYNYAMFGFTPYGSYWRQVRKLTTIELLSNNRLE  151

Query  1320  KLRHLRVSEVETSLKELYMLITSSSSAK---TVDMSEWFGQLTLNLIVKIVAGKRFKFKV  1150
              L+  R  E++ ++KELY L T +   K    VDM +WFG LT N+ +++V GK +    
Sbjct  152   PLKDTRTFELDAAVKELYKLWTRNGCPKGGVLVDMKQWFGDLTHNIALRMVGGKSY---C  208

Query  1149  KEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKEL  970
                DD  E  EA+    V ++++ L G FV+ D+FPF  + W++      KDM R   EL
Sbjct  209   GVGDDHAE-GEARRYRRVMRDWVCLFGVFVWSDSFPF--LGWLDIN-GYEKDMKRTASEL  264

Query  969   DTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKAT  790
             DT+++ WL+EH   +RK+    + +GK +  DF+DVML+++      G  Y  + IIKAT
Sbjct  265   DTLVEGWLEEH---KRKKKRGLSVNGKEEQDDFMDVMLNVLQGTEISG--YDSDTIIKAT  319

Query  789   GLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQA  610
              L++I+ G+D T V LTW LSL++NH   +KR + ++ + +GK R V++ DIK + YLQA
Sbjct  320   CLNLILAGTDPTMVTLTWALSLLLNHQTELKRAQHELGTLMGKHRKVDESDIKKLVYLQA  379

Query  609   AVKETLRLYPPLPTYAPHAATEDCKVG-GYDIPKGTHLYVNAWKVHRDPRIWPEPERFMP  433
              VKETLRLYPP P     AA EDC    GY IP GT L VNAWK+HRD R+W +P  F P
Sbjct  380   VVKETLRLYPPSPIITLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSDPNDFKP  439

Query  432   ERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPL  256
             ERFLT+ +  D   +N+E +PF  GRR+C G + A++V HLT+ARL+  F+  +PS + +
Sbjct  440   ERFLTSHKDVDVKGQNYELVPFSSGRRACPGASLALRVVHLTLARLLHSFNVASPSNQVV  499

Query  255   DMSEGLGITLPRATALDVVITPRLPPSFY  169
             DM+E  G+T  +AT L+V++TPR    FY
Sbjct  500   DMTESFGLTNLKATPLEVLLTPRQDTKFY  528



>ref|XP_007017414.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14639.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=755

 Score =   434 bits (1117),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 232/515 (45%), Positives = 332/515 (64%), Gaps = 26/515 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             W SK   +  KK+   P+   + P++GHL LLG G  P    L  MADKYG +FT+++G 
Sbjct  29    WISKSVQNRDKKRA-APQAGSSWPVIGHLHLLG-GPQPPHIVLGDMADKYGPIFTIKMGA  86

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             YR LVVS+WE  K+C TTNDK  A+RP      +L Y++A+F   +  PYWR+MRK A  
Sbjct  87    YRALVVSNWETAKECLTTNDKAFASRPKTHAIDFLTYDHAMFGFASYGPYWRQMRKVATL  146

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLIT---SSSSAKTVDMSEWFGQLTLNLIVKIV  1177
             ELLS+ +L+ L+H+R SE++TSLKELY   +    SS    +DM  WF  +TLN++++++
Sbjct  147   ELLSNYRLDMLKHVRQSEIKTSLKELYQHWSENKGSSDKVLLDMKAWFRDVTLNVMLRMI  206

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
              GKR       D + + +K+A       ++F  L+G+FV  DA PF  +RW++      K
Sbjct  207   VGKRIP-SSGSDAEGERWKDA------LQDFFDLSGKFVISDALPF--LRWLDVGGDE-K  256

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
              M ++ KELD + + WL +H   ++K +S   ES     QDF+DVM S++  D  +   +
Sbjct  257   FMKKVRKELDEVAEGWLQDH---KQKTASGNQESD----QDFMDVMFSILSTDAGK---H  306

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
               E I KA  L++I+ G DTT V LTW LSL++N+ DA+K+ +E++D  VG+++ VE+ D
Sbjct  307   DAETINKANCLNLILGGFDTTTVTLTWALSLLLNNRDALKKAQEELDIHVGRDKLVEESD  366

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIW  457
             +K + YLQA VKETLRLYP  P   PH +TEDC V GY IP GT L +N +K+HRDPR+W
Sbjct  367   VKKLIYLQAIVKETLRLYPAGPLSVPHESTEDCTVSGYHIPAGTRLLINLYKIHRDPRVW  426

Query  456   PEPERFMPERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDF  280
              +P  F PERFLT  +  D   +NFE IPFG GRR C G ++A+QV  LT+A L+QGF+ 
Sbjct  427   SDPCEFQPERFLTTYKDFDVRGQNFELIPFGSGRRMCPGVSFALQVLELTLANLLQGFEL  486

Query  279   ETPSEKPLDMSEGLGITLPRATALDVVITPRLPPS  175
              TP ++ +DMSE +G+T  +A+ L+V+ITPRLP +
Sbjct  487   GTPLDELVDMSEAIGMTNLKASPLEVLITPRLPAA  521


 Score = 82.4 bits (202),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = -3

Query  1656  EVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCFT  1477
             EV GARP+LGH+  L  G  P    L  + DKYG +FT++LGM   LV+S+ E  K+C T
Sbjct  663   EVSGARPLLGHIHNLLEGPKPAHITLGDLVDKYGPIFTIKLGMKPALVISNSELAKECLT  722

Query  1476  TNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPY  1378
             TN++    R     A++ GYNYA+      SPY
Sbjct  723   TNNEAFVNRLKSLAAEFFGYNYAMLRF---SPY  752



>gb|KCW58033.1| hypothetical protein EUGRSUZ_H00761 [Eucalyptus grandis]
Length=537

 Score =   427 bits (1098),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 221/512 (43%), Positives = 323/512 (63%), Gaps = 17/512 (3%)
 Frame = -3

Query  1677  KKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWE  1498
             K     PE+ GA P +GHL LL  G  PL + LAAMAD  G +          L   +  
Sbjct  28    KSANSAPELPGAWPTIGHLHLL-RGETPLAKTLAAMADAQGPIPHWPRPWPPWLTRKA--  84

Query  1497  AVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEK  1318
                  FTT+DK +A+R       +LGY  A F+      +WR+MRK  + ELLS ++L+ 
Sbjct  85    RCSGSFTTHDKELASRTKSKAGVHLGYGNAAFAFAEYGDFWREMRKITMLELLSIRRLDN  144

Query  1317  LRHLRVSEVETSLKELYMLITSSS------SAKTVDMSEWFGQLTLNLIVKIVAGKRF--  1162
             L+H++ SE++T +K+L+ L  +++      S+K V +S+    LTLN+I++++A KR+  
Sbjct  145   LKHVQASEIDTFVKDLHALCRTNAIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRYFG  204

Query  1161  KFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRI  982
                       D+ +EA H+ +V KEFMY++G     +  PF    W +     VK M R+
Sbjct  205   LLSASTGSSTDDDEEASHLRKVIKEFMYISGFPTVSELVPF--TGWTDCVG-TVKTMKRV  261

Query  981   MKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEII  802
              +E+D I+ +W++EH    ++      E   +  +DFIDVMLS+I +D      + PE +
Sbjct  262   AREMDEIVGKWVEEH--KLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETL  319

Query  801   IKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDME  622
             IKAT +++I+ GSDTT+++LTW+LSL++NH   +KR +E+ID KVGK++WV+D DI  + 
Sbjct  320   IKATVVNIIVAGSDTTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDKWVQDSDIGSLH  379

Query  621   YLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPER  442
             YLQA VKETLRLYPP P   PH A  DC V GY IPKGT ++VN WK+HRDP++W +PE+
Sbjct  380   YLQAIVKETLRLYPPGPLSIPHEARADCNVRGYLIPKGTRIFVNVWKLHRDPQVWSDPEK  439

Query  441   FMPERFLTA-AQADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSE  265
             F+PERFLT  +  DA  ++FE+IPFG GRR C G  +A++ +HLT+ARL+QGFD    S+
Sbjct  440   FLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLAISSD  499

Query  264   KPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             + +DM+EG+G+ LP+AT L VV+ PRLP   Y
Sbjct  500   ELVDMTEGIGLNLPKATPLRVVLNPRLPSMLY  531



>ref|XP_006375031.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
 gb|ERP52828.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
Length=538

 Score =   427 bits (1098),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 227/525 (43%), Positives = 326/525 (62%), Gaps = 28/525 (5%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             W S+ F + T KK   P+  GA P++GHL LLG G  P  + L  MA+KYG +FT+++G+
Sbjct  30    WISRKFLAGTGKKKAAPKAGGAWPVIGHLHLLG-GAEPPHKVLGNMAEKYGPIFTIKMGV  88

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +R LVVS+WE  K+CFTT+DK  + RP    ++ L Y+ A+       PYWR++RK    
Sbjct  89    HRALVVSNWETAKECFTTHDKAFSGRPRTLASELLTYDGAMVGFSPYGPYWRQVRKITTV  148

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYML--------ITSSSSAKTVDMSEWFGQLTLNL  1192
             ELLS+ +LEKL+ +R SEV   LKELY L          S S+   V+M  WFG LTLN+
Sbjct  149   ELLSNYRLEKLKDVRESEVRAFLKELYKLWDENRGSASKSKSNLALVEMKRWFGDLTLNI  208

Query  1191  IVKIVAGKRFKF--KVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVE  1018
             +++ + GK   +   V++++  + +K+        K+F +  G F   DA PF  +R+++
Sbjct  209   VLRTIVGKTVGYITNVEDEESVEGWKKG------LKDFFHWTGVFSVSDALPF--LRFLD  260

Query  1017  FQRRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDD  838
                   + M +  KELD +++ WL EH   +RKR+ A    GK   +DF+DVML + D+D
Sbjct  261   LGGHG-EAMKKTAKELDLVVEDWLKEH---KRKRA-AGIVKGK---EDFMDVMLDVFDND  312

Query  837   FARGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKE  658
                      +  IKAT L++I+  SDTTAV L W LSL+VN+P+ +K+ + ++D+ VGKE
Sbjct  313   AEAVQGGDSDTTIKATSLALILAASDTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKE  372

Query  657   RWVEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKV  478
             R VE+ D++++ YL+A +KETLRLYP  P   PH A EDC + GY +P+GT L VN  K+
Sbjct  373   RQVEESDVQNLVYLKAVLKETLRLYPAGPLLVPHEAIEDCTIDGYHVPRGTRLLVNVSKI  432

Query  477   HRDPRIWPEPERFMPERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVAR  301
             HRD R+W  P  F PERFLT  +  D   +NFE+ PFG GRR C G ++A+ V  L +A 
Sbjct  433   HRDERVWSNPNEFDPERFLTTHRGFDVRGKNFEFFPFGSGRRMCPGVSFALHVMDLALAT  492

Query  300   LIQGFDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYG  166
             L+ G DF TPS +P+DM E  G+T  RAT L+V+++PRLP   YG
Sbjct  493   LLHGLDFATPSGEPVDMHESSGLTNLRATPLEVLLSPRLPSRLYG  537



>ref|XP_007047112.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91269.1| Cytochrome P450 [Theobroma cacao]
Length=691

 Score =   432 bits (1111),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 234/520 (45%), Positives = 332/520 (64%), Gaps = 25/520 (5%)
 Frame = -3

Query  1701  SKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYR  1522
             SK   +  K+    P+  GA P++GH+ LLG G     + L AMADKYG VF++RLG + 
Sbjct  185   SKKSSTHRKRVCTAPQAGGALPVIGHMHLLG-GHQLTHKTLGAMADKYGPVFSIRLGSHS  243

Query  1521  ILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTEL  1342
              LV++SWE  ++CFT +DKV + RP    +K LGYNYA+F       YWR++R+ A  EL
Sbjct  244   ALVLNSWEMARECFTVHDKVFSTRPVLTASKVLGYNYAMFGFAPYGSYWREIRRIATIEL  303

Query  1341  LSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKT---VDMSEWFGQLTLNLIVKIVAG  1171
             LSS +++ L+H+R SEV+T+++ELY    S    +T   VDM +WFG LT N+ +++V G
Sbjct  304   LSSHRIDMLKHIRASEVKTAVRELYKSWLSKGGGETGVLVDMKQWFGDLTHNIALRMVGG  363

Query  1170  KRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDM  991
             KRF      + DC+E  EA+   +V ++  YL G FV  DA PF  + W++FQ    K M
Sbjct  364   KRF---FGPNADCEE-AEARRCQKVMRDSAYLFGVFVVSDALPF--IGWLDFQ-GYEKAM  416

Query  990   GRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPP  811
              R  KELD +L  WL+EH   ++K+       G    QDF+DVML++++D  A+  ++  
Sbjct  417   KRTAKELDILLGGWLEEH---KQKKHLGG---GLKKEQDFMDVMLNILED--AKITSFDA  468

Query  810   EIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIK  631
             + I KAT L++++ GSDTT + LTW LSL++N+P  +KR ++++D  VGK+R +E+ DI+
Sbjct  469   DTINKATCLNLVLAGSDTTMITLTWALSLLLNNPRVLKRAQDELDMHVGKDRLLEESDIR  528

Query  630   DMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVG-GYDIPKGTHLYVNAWKVHRDPRIWP  454
             ++ YL A VKETLRLYPP P     A+ EDC +  GY IP GT L VNAWK+ RD R+WP
Sbjct  529   NLVYLHAIVKETLRLYPPSPIIF-RASMEDCTLSTGYHIPAGTRLMVNAWKIQRDERVWP  587

Query  453   EPERFMPERFLTAAQADAPWRN--FEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDF  280
             +P  F PERFLT +  D  +R   FE IPFG GRRSC G + A+QV H  +A  +Q F+ 
Sbjct  588   DPHVFKPERFLT-SHKDMEFRGQTFELIPFGSGRRSCPGVSLALQVVHSALASFLQSFEV  646

Query  279   ETPSE-KPLDMSEGLGITLPRATALDVVITPRLPPSFYGL  163
               PS+ + +DM+E  G+T  +AT L+V+ TPRL    YGL
Sbjct  647   SKPSKLEDIDMTESTGLTNLKATPLEVLFTPRLDSKLYGL  686



>ref|XP_006432704.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
 ref|XP_006471494.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45944.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
Length=525

 Score =   426 bits (1096),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 221/517 (43%), Positives = 323/517 (62%), Gaps = 26/517 (5%)
 Frame = -3

Query  1704  RSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMY  1525
             R+ + +   KKK   PE  GA P+ GHL LLG G  P  R L AMADK G +FT+++G+ 
Sbjct  31    RNLLTNYTIKKKRRAPEAGGAWPVTGHLHLLG-GPEPPHRVLGAMADKCGPIFTIKMGIN  89

Query  1524  RILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTE  1345
             R LVVS+WE  K+C TT+DKV A+RP     +  GYN+++F       YWR+ RK A  E
Sbjct  90    RALVVSNWEMAKECLTTHDKVFASRPKTLAMEIFGYNFSMFGFSPYGSYWRETRKIATVE  149

Query  1344  LLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAKT---VDMSEWFGQLTLNLIVKIVA  1174
             LLS+ +LEKL+H+R  EV+T LKELY L   + S      V++  WF     N++++++ 
Sbjct  150   LLSNHRLEKLKHVRDYEVKTCLKELYELWDKNKSTNEMLLVELKRWFADTIRNVVLRMIV  209

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GK           C+   + +  +E+      ++G+FV  DA PF  +RW++      + 
Sbjct  210   GK----------GCNSV-DGEEWMELLTRSFEMSGKFVVSDALPF--LRWLDIGGDE-RS  255

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M  I +ELD +LQ WL++H   +RKR+S   +  K +  DF+ VML ++ D   +     
Sbjct  256   MKNIAEELDNLLQGWLEKH---KRKRNS---QEIKEEELDFMSVMLLILGDK-EQYSGRD  308

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              + + KAT L +I+  +DTTAV LTW++SL++NH D + + + ++D +VG +R V + DI
Sbjct  309   VDTVNKATCLGLILAATDTTAVTLTWVISLLLNHRDILNKAQNELDIQVGSKRQVNESDI  368

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
             K++ YLQA +KET+RLYP +P   PH + E+C V GY IP GT L++NAWK+ RDPR+W 
Sbjct  369   KNLVYLQAILKETMRLYPAVPLLVPHESMEECIVNGYHIPAGTQLFINAWKLQRDPRVWE  428

Query  453   EPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFE  277
             EP +F P+RFLT  +  D   +NFE +PF  GRR C G ++A+QV   T+A L+ GFDF 
Sbjct  429   EPYKFHPKRFLTRHKDIDVKGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLHGFDFA  488

Query  276   TPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYG  166
             TPS +P+DM EGLG+T+ ++T L V++ PRL  S YG
Sbjct  489   TPSNEPVDMGEGLGLTMEKSTPLVVLVAPRLSASLYG  525



>ref|XP_002268915.2| PREDICTED: cytochrome P450 82C2 [Vitis vinifera]
Length=744

 Score =   434 bits (1115),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 228/508 (45%), Positives = 324/508 (64%), Gaps = 23/508 (5%)
 Frame = -3

Query  1674  KKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEA  1495
             K+   P   GA PI+GHL L G+  +   + L AMADKYG VFT+RLG+  ILV+SS E 
Sbjct  252   KRCTAPRAGGAWPIIGHLHLFGAQQLT-HKTLGAMADKYGPVFTIRLGLNEILVLSSSEM  310

Query  1494  VKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKL  1315
              ++CFTT+D+V + RP    +K LGY++A+F       YWR+MRK    ELLS+ +L+ L
Sbjct  311   ARECFTTHDRVFSTRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDML  370

Query  1314  RHLRVSEVETSLKELYMLITSSSSAKT---VDMSEWFGQLTLNLIVKIVAGKRFKFKVKE  1144
             +H+R SEV TS++ELY +  S         VDM  WFG LTLNL V++V GKR+ F    
Sbjct  371   KHIRASEVGTSIRELYEMWVSERGTDGRVFVDMKRWFGDLTLNLAVRLVGGKRY-FGAGA  429

Query  1143  DDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDT  964
             D    E +  Q +I   ++F +L G FV  DA PF  + W++  +   K M R  KELD+
Sbjct  430   DTKEGEGRTCQKVI---RDFAHLFGVFVLSDAIPF--LSWLDL-KGYKKAMKRTAKELDS  483

Query  963   ILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDD-DFARGLAYPPEIIIKATG  787
             +   WL EH + R          GK+D QDF+DVML++++D +F+    +  + + KAT 
Sbjct  484   LFGGWLQEHKEKR-----LLGGEGKDD-QDFMDVMLTVLEDVNFS---GFDADTVNKATC  534

Query  786   LSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAA  607
             L++I+ GSDTT V LTW LSL++NHP  +K+ + ++D +VGK+R V++ D+K++ YLQA 
Sbjct  535   LNLILAGSDTTKVTLTWALSLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAI  594

Query  606   VKETLRLYPPLPTYAPHAATEDCKV-GGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPE  430
             +KETLRLYP  P    HAA EDC +  GY+I  GT + VNAWK+HRD R+W  P+ F PE
Sbjct  595   IKETLRLYPASPIITLHAAMEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPE  654

Query  429   RFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLD  253
             RF+T+ +  D   ++FE IPFG GRRSC G + A+QV H  +A L+  ++   PS+  +D
Sbjct  655   RFMTSHKDTDVRGQHFELIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVD  714

Query  252   MSEGLGITLPRATALDVVITPRLPPSFY  169
             M+E LG+T  +AT L+V+++PRL    Y
Sbjct  715   MTESLGLTNLKATPLEVLLSPRLKAELY  742



>ref|XP_006573615.1| PREDICTED: cytochrome P450 82A3-like isoform X2 [Glycine max]
Length=530

 Score =   426 bits (1096),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 224/518 (43%), Positives = 328/518 (63%), Gaps = 21/518 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             ++ K  H    K    P+  GA PI+GHL L G+  +   + L  MADK+G +FT++LG 
Sbjct  27    YKLKKTHGPNAKICTAPQAGGAWPIVGHLHLFGAHQLT-HKTLGTMADKHGPIFTIKLGS  85

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             Y++LV+SSWE  ++CFT +DK  + RP  A +K + YN A+F      PYWR+MRKFA  
Sbjct  86    YKVLVLSSWEMAEECFTVHDKAFSTRPCVAASKLMTYNSAMFGFAPHGPYWREMRKFATI  145

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAK---TVDMSEWFGQLTLNLIVKIV  1177
             ELLS+Q+LE L+ +R SE+E +  + Y L +     K    VDM +WFG LT N+I+++V
Sbjct  146   ELLSNQRLELLKDIRTSELEAATTKAYKLWSREGCPKGGVLVDMKQWFGDLTHNIILRMV  205

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
              GK +       DD  E  EA+   +  ++FM L G FV  DA PF  + W++      K
Sbjct  206   GGKPY---YGAGDDYAE-GEARRYKKTMRDFMRLFGVFVLSDAIPF--LGWID-NNGYKK  258

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
              M +   E+DT++  WL+EH   +RKR+++ N  GK + QD + VML+++ D    G  Y
Sbjct  259   AMKKTASEIDTLVAGWLEEH---KRKRATSTN--GKEE-QDVMGVMLNVLQDLKVSG--Y  310

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
               + IIKAT L++I+ G D+  V LTW LSL++N+   +K+ ++++D+++GK+R VE+ D
Sbjct  311   DSDTIIKATCLNLILAGGDSIMVALTWALSLLLNNEIELKKAQDELDTQIGKDRKVEESD  370

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVG-GYDIPKGTHLYVNAWKVHRDPRI  460
             IK + YLQA VKET+RLYPP P     AA E+C    GY IP GTHL VN WK+HRD  +
Sbjct  371   IKKLAYLQAIVKETMRLYPPSPVITLRAAMEECTFSCGYHIPAGTHLIVNTWKIHRDGCV  430

Query  459   WPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             WP+P  F PERFLT+ +  D   +N+E IPFG GRR C G++ A++V H+ +ARL+  F+
Sbjct  431   WPDPHDFKPERFLTSHKDVDVKGQNYELIPFGSGRRVCPGSSLALRVVHMVLARLLHSFN  490

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
               +PS + +DM+E +G+T  +AT L+V++TPRL    Y
Sbjct  491   VASPSNQAVDMTESIGLTNLKATPLEVLLTPRLDTKLY  528



>ref|XP_006471151.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=558

 Score =   427 bits (1098),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 230/513 (45%), Positives = 327/513 (64%), Gaps = 14/513 (3%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             W S+   +   KK +P E  GA P++GHL LLG G  P    L  +A+K G +F ++LGM
Sbjct  49    WLSRRHRNSIDKKPVP-EPGGAWPLIGHLHLLG-GQKPAYVTLGNIAEKCGPIFMIKLGM  106

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             +R L+VS+WE  K+CFTTNDKV + R      + LGYNYA+F      PYWR++RK A  
Sbjct  107   HRALIVSNWEIAKECFTTNDKVFSNRIKALAPEILGYNYAMFGFSPYGPYWRQIRKIATL  166

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELY---MLITSSSSAKTVDMSEWFGQLTLNLIVKIV  1177
             E+LS+ +LE L+H+R SEV TS+KELY   M  +  S    V+M E F  +TLN+  ++V
Sbjct  167   EVLSNHRLEMLKHVRESEVRTSMKELYDEWMKHSDGSGKALVEMKERFNAVTLNVATRMV  226

Query  1176  AGKR-FKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVV  1000
              GKR F     + +  +  +E     +  ++F  L G F   DA PF  +RW++      
Sbjct  227   VGKRLFVGGTGKTNHQEIDEENDRCRKAIRKFSELTGGFAIADAVPF--LRWLDLDG-CE  283

Query  999   KDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLA  820
             K MGR  KELD IL+ WL +H   ++KR S+ ++  K D  DF+DVM+S++ +      +
Sbjct  284   KSMGRTAKELDQILEGWLKDH---KQKRISSDDQVIK-DENDFMDVMISVLTEADEEIPS  339

Query  819   YPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDG  640
             +  + I KAT L++I+ G+DTT V LTW L+L++NH D +K++++++D+ +G+ER V + 
Sbjct  340   FDADTITKATCLALILGGTDTTMVTLTWALTLVLNHGDVLKKVQDELDTHIGRERQVNES  399

Query  639   DIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRI  460
             D K + YLQA VKETLRLYP  P   PH + EDC + GY +P GT L+VN  K+ RDP +
Sbjct  400   DTKKLVYLQAVVKETLRLYPATPLSVPHESIEDCTIAGYHVPAGTRLFVNIPKIQRDPNV  459

Query  459   WPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             W +P  F PERFLT  +  D   +NFE IPFG GRR C G ++A+QV  LT+A L+ GF+
Sbjct  460   WEKPNEFRPERFLTTHKDIDVRGQNFELIPFGSGRRGCPGISFALQVLLLTLASLLHGFE  519

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRL  184
             F TP ++PLDMSEG+G+T  +AT L V++TPRL
Sbjct  520   FATPGDEPLDMSEGVGLTNLKATPLQVLLTPRL  552



>gb|KDP38423.1| hypothetical protein JCGZ_04348 [Jatropha curcas]
Length=561

 Score =   427 bits (1098),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 226/499 (45%), Positives = 313/499 (63%), Gaps = 16/499 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             PE  GA PI+GHL LLG     L + L  MADKYG  F +R+G +   VV+S E  K+CF
Sbjct  75    PEPSGAWPIIGHLHLLGGADKLLHQTLGLMADKYGPAFNIRIGSHCAFVVASSELAKECF  134

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP  A  K++ YN+AVF     S +WR+MRK  + ELLS+++LE ++H++ 
Sbjct  135   TINDKDVASRPTTAATKHMCYNHAVFGFAPHSSHWREMRKIVMLELLSNRRLEMVKHVQN  194

Query  1299  SEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDEY  1123
             SEV   +K+LY L   ++     V++ +WF  LTLN+IV++VAGKR+       DD D  
Sbjct  195   SEVNLGIKKLYHLWAENNCLPVLVELKQWFEDLTLNVIVRVVAGKRY---TGSSDD-DGA  250

Query  1122  KEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWLD  943
             +  Q+ I    +F +L G FV  DA PF  ++W++ +    + M +  K+LD +L+ WL 
Sbjct  251   RRCQNAIS---KFFHLMGIFVVSDALPF--LQWLDLEGH-QRAMKKTAKDLDAVLEGWLT  304

Query  942   EHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDGS  763
             EH   R+KR S   E+     QDFIDVMLS+ +     G  Y  +  IK+T L++I   S
Sbjct  305   EH---RQKRVSVLGEAKTEGEQDFIDVMLSLEEKGHLSGFIYDADTSIKSTCLALIAGAS  361

Query  762   DTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRLY  583
             DTT   LTW +SL++N+  A+K+ RE++D  VG ER V++ D+K + Y+QA +KETLRLY
Sbjct  362   DTTTTTLTWAISLLLNNKSALKKAREELDLHVGPERQVDESDLKSLVYIQAIIKETLRLY  421

Query  582   PPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA-AQA  406
             P  P   P   T+DC + GY +P GT L VNAWK+ RDPR W  P  F PERFLT+ A  
Sbjct  422   PVAPLI-PREFTKDCTIAGYHVPAGTRLLVNAWKIQRDPRYWTNPSAFQPERFLTSHANV  480

Query  405   DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGITL  226
             D   ++ E IPFG GRRSC G  +A+   HLT+AR +  FD  T  +KP+DM+E  G TL
Sbjct  481   DVRGQHHELIPFGSGRRSCPGAAFALHALHLTLARFLHAFDLATTMDKPVDMTETPGTTL  540

Query  225   PRATALDVVITPRLPPSFY  169
             P+AT LDV+++PRLP   Y
Sbjct  541   PKATPLDVLLSPRLPAELY  559



>ref|XP_006375032.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
 gb|ERP52829.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
Length=538

 Score =   426 bits (1095),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 225/523 (43%), Positives = 327/523 (63%), Gaps = 28/523 (5%)
 Frame = -3

Query  1701  SKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYR  1522
             S+ F + T KK   P+  GA P++GHL LLG G  P  + L +MA+KYG +FT+++G++R
Sbjct  32    SRKFLAGTGKKKAAPKAGGAWPVIGHLHLLG-GAEPPHKVLGSMAEKYGPIFTIKMGVHR  90

Query  1521  ILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTEL  1342
              LVVS+WE  K+CFTT+DK  + RP    ++ L Y+ A+       PYWR++RK    EL
Sbjct  91    ALVVSNWETAKECFTTHDKAFSGRPRTLASELLTYDGAMMGFSPYGPYWRQVRKITTVEL  150

Query  1341  LSSQKLEKLRHLRVSEVETSLKELYML--------ITSSSSAKTVDMSEWFGQLTLNLIV  1186
             LS+ +LEKL+ +R SEV   LKELY L          S SS   V+M  WFG LTLN+++
Sbjct  151   LSNYRLEKLKDVRESEVRAFLKELYKLWDENRCSASKSKSSLVLVEMKRWFGDLTLNIVL  210

Query  1185  KIVAGKRFKF--KVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQ  1012
             + + GK   +   V++++  + +K+        K+F +  G F   DA PF  +R+++  
Sbjct  211   RTIVGKTVGYISNVEDEESVEGWKKG------LKDFFHWTGVFSVSDALPF--LRFLDLG  262

Query  1011  RRVVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFA  832
                 + M +  KELD +++ WL EH   +RKR+ A    GK   +DF+D+ML + D+D  
Sbjct  263   GHG-EAMKKTAKELDLVVEDWLQEH---KRKRA-AGIVKGK---EDFMDLMLDVFDNDAE  314

Query  831   RGLAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERW  652
                    +  IKAT L++I+  S+TTAV L W LSL+VN+P+ +K+ + ++D+ VGKER 
Sbjct  315   AVQGGDSDTTIKATSLALILAASNTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQ  374

Query  651   VEDGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHR  472
             VE+ D++++ YL+A +KETLRLYP  P   PH A EDC + GY +P+GT L +N  K+HR
Sbjct  375   VEESDVQNLVYLKAVLKETLRLYPAGPLLVPHEAIEDCTIDGYHVPRGTRLLINVPKIHR  434

Query  471   DPRIWPEPERFMPERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLI  295
             D R+W  P  F PERFLT  +  D   +NFE+ PFG GRR C G ++A+ V  L +A L+
Sbjct  435   DERVWSNPNEFDPERFLTTHRGFDVRGKNFEFFPFGSGRRKCPGVSFALHVMDLALATLL  494

Query  294   QGFDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYG  166
              GFDF TPS +P+DM E  G+T  RAT L+V+++PRLP   YG
Sbjct  495   HGFDFATPSGEPVDMHESSGLTNLRATPLEVLLSPRLPSRLYG  537



>ref|XP_011030916.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   426 bits (1095),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 225/521 (43%), Positives = 325/521 (62%), Gaps = 24/521 (5%)
 Frame = -3

Query  1701  SKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYR  1522
             S+ F + T KK   P+  GA P++GHL LLG G  P  + L +MA+KYG +FT+++G++R
Sbjct  32    SRKFLAGTSKKKAAPKAGGAWPVIGHLHLLG-GAEPPHKVLGSMAEKYGPIFTIKMGVHR  90

Query  1521  ILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTEL  1342
              LVVS WE  K+CFTT+DK  + RP    ++ L Y+ A+       PYWR++RK    EL
Sbjct  91    ALVVSRWETAKECFTTHDKAFSGRPKTLASELLTYDGAMMGFSPYGPYWRQVRKITTVEL  150

Query  1341  LSSQKLEKLRHLRVSEVETSLKELYML--------ITSSSSAKTVDMSEWFGQLTLNLIV  1186
             LS+ +LEKL+ +R SEV T LKELY L          S S+   V+M  WFG LTLN+++
Sbjct  151   LSNYRLEKLKDIRESEVRTFLKELYKLWDKNRGGASKSKSNMVLVEMKRWFGDLTLNIVL  210

Query  1185  KIVAGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRR  1006
             + + GK   +    +D+    + A+   +  K+F +    F   DA PF  +R ++    
Sbjct  211   RTIVGKTVGYITNVEDE----ESAKGWKKGLKDFFHWTAVFSVSDALPF--LRLLDLGGH  264

Query  1005  VVKDMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARG  826
             V + M +  KELD +++ WL+EH   +RKR+ A    GK   +DF+D+ML + D+D    
Sbjct  265   V-EAMKKTAKELDLVVEDWLEEH---KRKRA-AGIVKGK---EDFMDLMLDVFDNDAEAV  316

Query  825   LAYPPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVE  646
                  + I KAT L++I+  SDTTAV L W LSL+VN+P+ +K+ + ++D+ VGKER VE
Sbjct  317   QGGDSDTINKATSLALILAASDTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVE  376

Query  645   DGDIKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDP  466
             + D++++ +L+A ++ETLRLYP  P   PH ATEDC + GY +P+GT L V+  K+HRD 
Sbjct  377   ESDVQNLVFLKAVIRETLRLYPAAPLLLPHEATEDCTIDGYHVPRGTRLLVDVSKIHRDE  436

Query  465   RIWPEPERFMPERFLTAAQA-DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQG  289
             R+W  P  F PERFLT  +  DA  +NFE+ PFG GRR C G ++A+    L +A L+ G
Sbjct  437   RVWSNPNEFDPERFLTTHRGFDARGKNFEFFPFGSGRRMCPGVSFALHAMDLALATLLHG  496

Query  288   FDFETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFYG  166
             FDF TPS +P+DM E  G+T  RAT L+V++ PRLP   YG
Sbjct  497   FDFATPSGEPVDMHESSGLTNLRATPLEVLLCPRLPSGLYG  537



>ref|XP_006366435.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=517

 Score =   425 bits (1092),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 223/513 (43%), Positives = 320/513 (62%), Gaps = 22/513 (4%)
 Frame = -3

Query  1698  KIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRI  1519
             K+F S  K+    PE  GA PI+GHL LL    +P  +    MA+KYG +F L+LG+  +
Sbjct  22    KLFFSAKKQSKNVPEAAGAWPIIGHLHLLNGPQMP-HKIFGQMAEKYGPIFRLKLGVNDV  80

Query  1518  LVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELL  1339
             ++VS  +  K+CFTTNDK  A RP    ++ LGYNYA+F L    PYWR++RK   TE L
Sbjct  81    VIVSDHKIAKECFTTNDKAFANRPKSIASEILGYNYAMFGLGPYGPYWREIRKIVTTEFL  140

Query  1338  SSQKLEKLRHLRVSEVETSLKELY--MLITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKR  1165
             S++++E L+H+R  EV++++KE Y   L  + + A  ++M EWFG L +N +VK++    
Sbjct  141   SARRIEMLKHVREFEVKSAVKETYEYWLKNNLNGAVKIEMKEWFGNLIMNTMVKLL----  196

Query  1164  FKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGR  985
               F V+   + DE +   H  +  +  + L G FV  D  P+  +RW++      K M  
Sbjct  197   --FGVQYTGNEDEERSKAH--KAIQRLLELLGAFVVADFLPY--LRWLDIGGHE-KIMKS  249

Query  984   IMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEI  805
               KE+D I++ WL EH   RRKR    N  G  D +DF+DVMLS+ +D    G  +  + 
Sbjct  250   TAKEIDFIVEDWLAEH---RRKRKLRGNNCG--DEEDFMDVMLSICEDKNLHG--FDTDA  302

Query  804   IIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDM  625
             IIKAT +++   G+DTT V L W+LSL++N+ +A+K+ ++++D+ +GK RWV++ DIK++
Sbjct  303   IIKATCMALQTAGTDTTIVTLIWILSLLLNNYEALKKAQDELDTHIGKNRWVQESDIKNL  362

Query  624   EYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPE  445
              YLQA VKE+ RLYP  P   PH + EDC V GYDIPKGT L VN WK+  DP IWP P 
Sbjct  363   VYLQAIVKESFRLYPAAPLMLPHESIEDCVVSGYDIPKGTRLLVNVWKLQYDPEIWPNPH  422

Query  444   RFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPS  268
              F PERFLT  +  D    +FE IPFG GRR C G + A+QV    V+ L+QGFD + PS
Sbjct  423   EFKPERFLTTHKDVDVRGNHFELIPFGSGRRMCPGVSLALQVLQYVVSVLLQGFDIKRPS  482

Query  267   EKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             ++ +DMSE  G+T+ +A+ L+V +TPRL  + Y
Sbjct  483   DEAIDMSESFGLTILKASPLEVQLTPRLDSNLY  515



>ref|XP_010918630.1| PREDICTED: cytochrome P450 82C4-like [Elaeis guineensis]
Length=493

 Score =   424 bits (1090),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 224/501 (45%), Positives = 316/501 (63%), Gaps = 21/501 (4%)
 Frame = -3

Query  1662  PPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDC  1483
             PP+  G+ PI+GHL LL S   PL      MADKYG VF L LGM R LVV+SWEA K+C
Sbjct  10    PPKPSGSWPIIGHLHLLRSQK-PLAHLFGEMADKYGPVFMLHLGMRRTLVVNSWEAAKEC  68

Query  1482  FTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLR  1303
               TNDKV A RP  A  K+LGYNYA+        YWR +RK  + ELLS+ +LE L+H+R
Sbjct  69    LATNDKVFATRPGNAAGKHLGYNYAMVGFAPYGSYWRSVRKIIMVELLSNARLETLKHVR  128

Query  1302  VSEVETSLKELYML-ITSSSSAKTVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
               E++T ++ELY L + ++     V+M  W G L  N++V++VAGKR+       D+   
Sbjct  129   SMEMDTCIRELYELWLRNNRRPVKVEMKRWLGGLAYNIVVRVVAGKRYFGSGTGSDEAWR  188

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
             +++A     + + F  L+  FV  D FP   ++W+++ R     M    +E+D+I+   L
Sbjct  189   FRKA-----ISRLFGLLDA-FVASDMFP--CLKWMDW-RGHESAMKNTAQEVDSIMAGLL  239

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
             +EH   R++R S     G    QDF+DVMLS+++D    G+    + +IKAT L++I+ G
Sbjct  240   EEH---RQRRLSGKATGGP---QDFMDVMLSIVEDAEFSGMDV--DAVIKATSLALIMGG  291

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             +DTT   L W L+L+V +P  +K+ +++ID+ VGK+R VE+ D+K++ YLQA VKE LRL
Sbjct  292   TDTTTTSLAWTLALLVKNPQVLKKAQDEIDAVVGKDRHVEESDVKNLLYLQAIVKEVLRL  351

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTAAQA  406
             YP       H A  DC++GGYD+  GT L+VN WK+ RDP +W EP  F PERFL+A  A
Sbjct  352   YPAAKLLVQHEAMADCRIGGYDVAAGTRLHVNVWKLQRDPLVWSEPNEFRPERFLSAPHA  411

Query  405   --DAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
               D   ++FE IPFG GRRSC G ++A+QV HLT+ARLIQGF+ ETP   P +M++ LG+
Sbjct  412   GVDVRGQHFELIPFGSGRRSCPGISFALQVMHLTLARLIQGFELETPGGGPSEMADDLGL  471

Query  231   TLPRATALDVVITPRLPPSFY  169
               P  T L+V+++PRL    Y
Sbjct  472   PYPNTTPLEVLLSPRLADMLY  492



>ref|XP_008372516.1| PREDICTED: cytochrome P450 82G1-like [Malus domestica]
Length=539

 Score =   425 bits (1093),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 222/518 (43%), Positives = 324/518 (63%), Gaps = 27/518 (5%)
 Frame = -3

Query  1689  HSFTKKKTLP--PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRIL  1516
             ++  K  TLP  P+  GA P +GHL LL  G  P+   L AMAD++G +++L+LG + +L
Sbjct  35    NTINKNTTLPKVPQPSGAWPFVGHLPLL-RGENPVALILGAMADQHGPIYSLKLGQHELL  93

Query  1515  VVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLS  1336
             ++S+WE V++ FT ND+V A RP  A  KYLGY+ A+FSL     YWR +RK A  ELLS
Sbjct  94    LLSAWEQVQELFTKNDRVFATRPSTAGGKYLGYDNAIFSLAPYGSYWRDVRKLATLELLS  153

Query  1335  SQKLEKLRHLRVSEVETSLKELYMLITSSSSA------KTVDMSEWFGQLTLNLIVKIVA  1174
             SQ+++ L H+R SEV + +K L++L T  +         +V M+E    LT N+ VK++A
Sbjct  154   SQRVKTLSHIRASEVGSFIKTLHLLCTKDNVGPSSTSSSSVHMTELLEHLTFNINVKLIA  213

Query  1173  GKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKD  994
             GKRF      + + D ++  +      KE ++L G FV+ DA P +   W++     V  
Sbjct  214   GKRFTAGQYNEKNSDVWRFER----ALKEALHLFGVFVWSDAMPCF--GWLDSLFGHVSS  267

Query  993   MGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYP  814
             M +  KELD +L++WL+EH   R +  +   ES      D +DV++S   +D   G  + 
Sbjct  268   MKKCFKELDYVLEKWLEEHQQRRLESKTNRVES------DLMDVLISNFKEDEISG--HC  319

Query  813   PEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDI  634
              + +IKAT L +++ G+++T+V LTW +SL++NH  A+K  +E++D  VG++RWV++ D+
Sbjct  320   RDNVIKATALVLMLTGTESTSVTLTWAISLLLNHQKALKSAQEELDIHVGRDRWVQESDL  379

Query  633   KDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWP  454
              +++YLQA +KETLRLYPP P      A EDC +GGY +PKGT L VN WK+ RDPR+W 
Sbjct  380   TNLKYLQAILKETLRLYPPGPVTGLREAMEDCHLGGYFVPKGTRLIVNIWKLQRDPRMWA  439

Query  453   EPERFMPERFLTAAQADAPWR---NFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
              P  F PERF+T   AD  ++   NFEY+PF  GRRSC G T  + V  L +ARLIQGF+
Sbjct  440   NPCEFQPERFMT-THADVDFKGQCNFEYVPFSAGRRSCPGMTLGLHVVQLVLARLIQGFN  498

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
                  + P+DM EGLG+ LP+A  L+V++TPRLP   Y
Sbjct  499   MNRVGDGPVDMKEGLGLALPKANPLEVLLTPRLPLQLY  536



>ref|XP_006573616.1| PREDICTED: cytochrome P450 82A3-like isoform X3 [Glycine max]
Length=530

 Score =   425 bits (1092),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 227/518 (44%), Positives = 324/518 (63%), Gaps = 21/518 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             ++ K  H    K    P+  GA PI+GHL L G+  +   + L  MADK+G +FT++LG 
Sbjct  27    YKLKKTHGPNAKICTAPQAGGAWPIVGHLHLFGAHQLT-HKTLGTMADKHGPIFTIKLGS  85

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             Y++LV+SSWE  ++CFT +DK  + RP  A +K + YN A+F      PYWR+MRKFA  
Sbjct  86    YKVLVLSSWEMAEECFTVHDKAFSTRPCVAASKLMTYNSAMFGFAPHGPYWREMRKFATI  145

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAK---TVDMSEWFGQLTLNLIVKIV  1177
             ELLS+Q+LE L+ +R SE+E +  + Y L +     K    VDM +WFG LT N+I+++V
Sbjct  146   ELLSNQRLELLKDIRTSELEAATTKAYKLWSREGCPKGGVLVDMKQWFGDLTHNIILRMV  205

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
              GK +       DD  E  EA+   +  ++FM L G FV  DA PF  + W++      K
Sbjct  206   GGKPY---YGAGDDYAE-GEARRYKKTMRDFMRLFGVFVLSDAIPF--LGWID-NNGYKK  258

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
              M +   E+DT++  WL+EH   +RKR+++ N  GK + QD + VML+++ D    G  Y
Sbjct  259   AMKKTASEIDTLVAGWLEEH---KRKRATSTN--GKEE-QDVMGVMLNVLQDLKVSG--Y  310

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
               + IIKAT L++I+ G+D T V LTW LSL++NH   +KR + ++ + +GK R V++ D
Sbjct  311   DSDTIIKATCLNLILAGTDPTMVTLTWALSLLLNHQTELKRAQHELGTLMGKHRKVDESD  370

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVG-GYDIPKGTHLYVNAWKVHRDPRI  460
             IK + YLQA VKETLRLYPP P     AA EDC    GY IP GT L VNAWK+HRD R+
Sbjct  371   IKKLVYLQAVVKETLRLYPPSPIITLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRV  430

Query  459   WPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             W +P  F PERFLT+ +  D   +N+E +PF  GRR+C G + A++V HLT+ARL+  F+
Sbjct  431   WSDPNDFKPERFLTSHKDVDVKGQNYELVPFSSGRRACPGASLALRVVHLTLARLLHSFN  490

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
               +PS + +DM+E  G+T  +AT L+V++TPR    FY
Sbjct  491   VASPSNQVVDMTESFGLTNLKATPLEVLLTPRQDTKFY  528



>gb|KHN42044.1| Cytochrome P450 82A3 [Glycine soja]
Length=538

 Score =   425 bits (1093),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 228/515 (44%), Positives = 322/515 (63%), Gaps = 15/515 (3%)
 Frame = -3

Query  1698  KIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRI  1519
             K     TKK    P+  GA PI+GHL L  +  +   + L  MA+K+G +FT++LG Y++
Sbjct  27    KTLCGNTKKICRAPQAAGAWPIIGHLHLFNAHQLT-HKTLGKMAEKHGPIFTIKLGSYKV  85

Query  1518  LVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELL  1339
             LV+SSWE  K+CFT +DK  + RP  A +K +GYNYA+F       YWR + K    ELL
Sbjct  86    LVLSSWEMAKECFTAHDKAFSTRPCVAASKLMGYNYAMFGFTPYGSYWRPVPKLTTIELL  145

Query  1338  SSQKLEKLRHLRVSEVETSLKELYMLITSSSSAK---TVDMSEWFGQLTLNLIVKIVAGK  1168
             S+ +LE L+  R  E++ +++ELY + T     K    VDM +WFG LT N+ +++V GK
Sbjct  146   SNNRLEPLKDTRTVELDAAIRELYKVWTREGCPKGGVLVDMKQWFGDLTHNIALRMVGGK  205

Query  1167  RFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMG  988
              +   V +DD  +   EA+    V ++++ L G FV  D+FPF  + W++      KDM 
Sbjct  206   SYS-GVGDDDHAE--GEARRYRRVMRDWVCLFGVFVLSDSFPF--LGWLDIN-GYEKDMK  259

Query  987   RIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPE  808
             R   ELD +++ WL+EH   +RKR    + +GK +  DF+DVML+++      G  Y  +
Sbjct  260   RTASELDALVEGWLEEHK-RKRKRKRGLSVNGKEEQDDFMDVMLNVLQGTEISG--YDSD  316

Query  807   IIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKD  628
              IIKAT L++I+ G+D T V LTW LSL++NH   +KR R ++D+ +GK+R VE+ DIK 
Sbjct  317   TIIKATCLNLILAGTDPTMVTLTWALSLLLNHQMELKRARHELDTLIGKDRKVEESDIKK  376

Query  627   MEYLQAAVKETLRLYPPLPTYAPHAATEDCKVG-GYDIPKGTHLYVNAWKVHRDPRIWPE  451
             + YLQA VKETLRLYPP P     AA EDC    GY IP GT L VNAWK+HRD R+W E
Sbjct  377   LVYLQAVVKETLRLYPPSPIITLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSE  436

Query  450   PERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFET  274
             P  F PERFLT  +  D   +N+E +PF  GRR+C G + A++V HLT+ARL+  FD  +
Sbjct  437   PNDFKPERFLTIHKDVDVKGQNYELVPFSSGRRACPGASLALRVVHLTLARLLHSFDVAS  496

Query  273   PSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
             PS + +DM+E  G+T  +AT L+V++TPRL   FY
Sbjct  497   PSNQVVDMTESFGLTNLKATPLEVLLTPRLDTKFY  531



>gb|KHN36186.1| Cytochrome P450 82A3 [Glycine soja]
Length=530

 Score =   425 bits (1092),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 224/518 (43%), Positives = 327/518 (63%), Gaps = 21/518 (4%)
 Frame = -3

Query  1707  WRSKIFHSFTKKKTLPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGM  1528
             ++ K  H    K    P+  GA PI+GHL L G+  +   + L  MADK+G +FT++LG 
Sbjct  27    YKLKKTHGPNAKICTAPQAGGAWPIVGHLHLFGAHQLT-HKTLGTMADKHGPIFTIKLGS  85

Query  1527  YRILVVSSWEAVKDCFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVT  1348
             Y++LV+SSWE  ++CFT +DK  + RP  A +K + YN A+F      PYWR+MRKFA  
Sbjct  86    YKVLVLSSWEMAEECFTVHDKAFSTRPCVAASKLMTYNSAMFGFAPHGPYWREMRKFATI  145

Query  1347  ELLSSQKLEKLRHLRVSEVETSLKELYMLITSSSSAK---TVDMSEWFGQLTLNLIVKIV  1177
             ELLS+Q+LE L+  R SE+E +  + Y L +     K    VDM +WFG LT N+I+++V
Sbjct  146   ELLSNQRLELLKDTRTSELEAATTKAYKLWSREGCPKGGVLVDMKQWFGDLTHNIILRMV  205

Query  1176  AGKRFKFKVKEDDDCDEYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVK  997
              GK +       DD  E  EA+   +  ++FM L G FV  DA PF  + W++      K
Sbjct  206   GGKPY---YGAGDDYAE-GEARRYKKTMRDFMRLFGVFVLSDAIPF--LGWID-NNGYKK  258

Query  996   DMGRIMKELDTILQRWLDEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAY  817
              M +   E+DT++  WL+EH   +RKR+++ N  GK + QD + VML+++ D    G  Y
Sbjct  259   AMKKTASEIDTLVAGWLEEH---KRKRATSTN--GKEE-QDVMGVMLNVLQDLKVSG--Y  310

Query  816   PPEIIIKATGLSMIIDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGD  637
               + IIKAT L++I+ G D+  V LTW LSL++N+   +K+ ++++D+++GK+R VE+ D
Sbjct  311   DSDTIIKATCLNLILAGGDSIMVALTWALSLLLNNEIELKKAQDELDTQIGKDRKVEESD  370

Query  636   IKDMEYLQAAVKETLRLYPPLPTYAPHAATEDCKVG-GYDIPKGTHLYVNAWKVHRDPRI  460
             IK + YLQA VKET+RLYPP P     AA E+C    GY IP GTHL VN WK+HRD  +
Sbjct  371   IKKLAYLQAIVKETMRLYPPSPVITLRAAMEECTFSCGYHIPAGTHLIVNTWKIHRDGCV  430

Query  459   WPEPERFMPERFLTAAQ-ADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFD  283
             WP+P  F PERFLT+ +  D   +N+E IPFG GRR C G++ A++V H+ +ARL+  F+
Sbjct  431   WPDPHDFKPERFLTSHKDVDVKGQNYELIPFGSGRRVCPGSSLALRVVHMALARLLHSFN  490

Query  282   FETPSEKPLDMSEGLGITLPRATALDVVITPRLPPSFY  169
               +PS + +DM+E +G+T  +AT L+V++TPRL    Y
Sbjct  491   VASPSNQAVDMTESIGLTNLKATPLEVLLTPRLDTKLY  528



>ref|XP_002869302.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45561.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   424 bits (1091),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 218/501 (44%), Positives = 313/501 (62%), Gaps = 14/501 (3%)
 Frame = -3

Query  1659  PEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKDCF  1480
             P   GA PI+GHL LL      L R L  MAD YG   +LRLG     VVSS+E  K+CF
Sbjct  33    PAPSGAWPIIGHLHLLSGKEQLLYRTLGKMADHYGPAMSLRLGSSETFVVSSFEVAKECF  92

Query  1479  TTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHLRV  1300
             T NDK +A+RP  A AK++GYN+AVF       +WR+MRK A  ELLS+++L+ L+H+RV
Sbjct  93    TVNDKALASRPMSAAAKHMGYNFAVFGFAPYGAFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1299  SEVETSLKELYMLITSSSSAK--TVDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCDE  1126
             SE+   +K+LY L      A+   VD+  W   ++LN++V++VAGKR+ F        ++
Sbjct  153   SEIAMGVKDLYSLWVKKGGAEPVMVDLQSWLEDISLNMMVRMVAGKRY-FGGGGSLSSED  211

Query  1125  YKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRWL  946
              +EA+   +    F +L G F   DAFP   + W + Q    K+M +  +ELD IL+RW+
Sbjct  212   TEEARQCRKGVANFFHLVGIFTVSDAFP--KLGWFDLQGHE-KEMKQTGRELDVILERWI  268

Query  945   DEHVDARRKRSSAANESGKNDHQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMIIDG  766
             + H   R+   +  N+S      DFIDVMLS+ +      L Y     IK+T L+MI+ G
Sbjct  269   ENHRQQRKVSGTKHNDS------DFIDVMLSLAEQGKLSHLQYDANTSIKSTCLAMILGG  322

Query  765   SDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKETLRL  586
             ++T+   LTW +SL++N+ + +K+ +E+ID  VG++R VED DI+++ YLQA +KETLRL
Sbjct  323   TETSPATLTWAISLLLNNKEMLKKAQEEIDIHVGRDRNVEDSDIENLVYLQAIIKETLRL  382

Query  585   YPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLT--AA  412
             YP  P      A EDC V GY++P GT + VN WK+ RDP+++ EP+ F PERF+T  A 
Sbjct  383   YPAGPLLGHREAMEDCTVAGYNVPCGTRMLVNVWKIQRDPKVYMEPDEFRPERFITGEAK  442

Query  411   QADAPWRNFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSEGLGI  232
             + D   +NFE +PFG GRRSC G + AMQV HL +AR +  F+ +T  + P+DMSE  G+
Sbjct  443   EFDVRGQNFELMPFGSGRRSCPGASLAMQVLHLGLARFLHSFEVKTVMDMPVDMSESPGL  502

Query  231   TLPRATALDVVITPRLPPSFY  169
             T+P+ T L+V+I+PRL    +
Sbjct  503   TIPKGTPLEVLISPRLKEELF  523



>ref|XP_008235428.1| PREDICTED: cytochrome P450 82G1-like [Prunus mume]
Length=535

 Score =   425 bits (1092),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 221/505 (44%), Positives = 320/505 (63%), Gaps = 21/505 (4%)
 Frame = -3

Query  1665  LPPEVDGARPILGHLRLLGSGGIPLGRKLAAMADKYGSVFTLRLGMYRILVVSSWEAVKD  1486
             L P+  GA P +GHL LL  G  P+   L AMAD +G +F+L+LG +++LV+S+W+ VK+
Sbjct  45    LVPQPSGAWPFIGHLPLL-RGKDPVALTLGAMADDHGPIFSLKLGQHQVLVLSAWDTVKE  103

Query  1485  CFTTNDKVMAARPDFAVAKYLGYNYAVFSLDTDSPYWRKMRKFAVTELLSSQKLEKLRHL  1306
             C TTND+V A R   A  KYLGY+ A+F+L    PYWR +RK A  ELLS++++E L H+
Sbjct  104   CLTTNDRVFATRASIAGGKYLGYDNALFALAPYGPYWRHVRKLATLELLSTKRVEMLSHV  163

Query  1305  RVSEVETSLKELYMLITSSSSAKT-VDMSEWFGQLTLNLIVKIVAGKRFKFKVKEDDDCD  1129
             R SEV+  +K L  L T + +  T V +SE    LT N+ V+++AGKRF  +   + +  
Sbjct  164   RTSEVDLFVKNLLSLCTKNGAGSTPVHLSELIEFLTFNINVRLIAGKRFTAEQYNEKN--  221

Query  1128  EYKEAQHIIEVFKEFMYLNGQFVFGDAFPFWIVRWVEFQRRVVKDMGRIMKELDTILQRW  949
                EA    +  KE +YL G FV+ DA P+  + W++     V  M R  KELD +L +W
Sbjct  222   --SEAWCFEKAVKEALYLFGVFVWSDAMPW--LEWLDSLFGHVGSMKRCFKELDCVLGKW  277

Query  948   LDEHVDARRKRSSAANESGKND--HQDFIDVMLSMIDDDFARGLAYPPEIIIKATGLSMI  775
             L+EH    R+RS      GK D    D +DVM+S + ++      +  + +IK+T L +I
Sbjct  278   LEEH----RQRS---RPQGKIDRVESDLMDVMISSLQEEEDAISGHSLDNVIKSTALVLI  330

Query  774   IDGSDTTAVHLTWLLSLIVNHPDAMKRIREDIDSKVGKERWVEDGDIKDMEYLQAAVKET  595
             + G+++T+V +TW LSL++N+P  +K  ++++D  VG++RWV++ D+ +++YLQA +KET
Sbjct  331   LTGTESTSVTVTWALSLLLNNPKTLKAAQQELDIHVGRDRWVQESDLPNLKYLQAILKET  390

Query  594   LRLYPPLPTYAPHAATEDCKVGGYDIPKGTHLYVNAWKVHRDPRIWPEPERFMPERFLTA  415
             LR+YPP P      ATEDC + GY +PKGT L VN WK+ RDPR+W  P  F PERF+T 
Sbjct  391   LRVYPPGPLTGLREATEDCHLAGYHVPKGTRLLVNIWKLQRDPRMWANPSEFQPERFMT-  449

Query  414   AQADAPWR---NFEYIPFGGGRRSCIGNTYAMQVSHLTVARLIQGFDFETPSEKPLDMSE  244
               AD  ++   NFEYIPF  GRRSC G    +QV  L +ARL+QGFD     E+ +DM E
Sbjct  450   THADVEFKGQNNFEYIPFSSGRRSCPGMVLGLQVVQLILARLVQGFDMSRVGEEAVDMRE  509

Query  243   GLGITLPRATALDVVITPRLPPSFY  169
             GLG+ LP+A  L+ +++PRLP   Y
Sbjct  510   GLGLALPKANPLEALLSPRLPLHLY  534



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5344985009236