BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84017_g1_i1 len=1075 path=[1:0-1074]

Length=1075
                                                                      Score     E

ref|XP_009780570.1|  PREDICTED: uncharacterized protein LOC104229610    206   6e-61   
ref|XP_009597345.1|  PREDICTED: uncharacterized protein LOC104093319    202   2e-59   
ref|XP_006449722.1|  hypothetical protein CICLE_v10016695mg             198   9e-58   
ref|XP_002274403.1|  PREDICTED: uncharacterized protein LOC100246942    197   2e-57   Vitis vinifera
gb|KDP20752.1|  hypothetical protein JCGZ_21223                         196   4e-57   
ref|XP_003632945.1|  PREDICTED: uncharacterized protein LOC100855186    195   9e-57   
ref|XP_006467441.1|  PREDICTED: uncharacterized protein LOC102607295    193   6e-56   
ref|XP_011086185.1|  PREDICTED: uncharacterized protein LOC105167985    193   9e-56   
ref|XP_009614259.1|  PREDICTED: uncharacterized protein LOC104107229    191   6e-55   
ref|XP_011047992.1|  PREDICTED: uncharacterized protein LOC105142178    188   8e-54   
ref|XP_007026065.1|  Uncharacterized protein TCM_030219                 188   8e-54   
ref|XP_011037653.1|  PREDICTED: uncharacterized protein LOC105134801    186   3e-53   
ref|XP_002518486.1|  conserved hypothetical protein                     186   4e-53   Ricinus communis
ref|XP_004231609.1|  PREDICTED: uncharacterized protein LOC101255844    185   1e-52   
ref|XP_002305577.1|  hypothetical protein POPTR_0004s01560g             185   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_009785363.1|  PREDICTED: uncharacterized protein LOC104233638    183   4e-52   
ref|XP_006389626.1|  hypothetical protein POPTR_0021s00760g             183   4e-52   
ref|XP_006363108.1|  PREDICTED: uncharacterized protein LOC102599...    183   5e-52   
ref|XP_008224827.1|  PREDICTED: uncharacterized protein LOC103324534    181   3e-51   
ref|XP_011096069.1|  PREDICTED: uncharacterized protein LOC105175348    181   3e-51   
ref|XP_006348114.1|  PREDICTED: uncharacterized protein LOC102595538    179   1e-50   
ref|XP_008371092.1|  PREDICTED: uncharacterized protein LOC103434506    177   5e-50   
ref|XP_009360958.1|  PREDICTED: uncharacterized protein LOC103951301    177   9e-50   
ref|XP_004232713.1|  PREDICTED: uncharacterized protein LOC101253959    175   6e-49   
ref|XP_004293285.1|  PREDICTED: uncharacterized protein LOC101291898    173   3e-48   
ref|XP_008384072.1|  PREDICTED: uncharacterized protein LOC103446718    170   3e-47   
ref|XP_010276081.1|  PREDICTED: uncharacterized protein LOC104610921    169   9e-47   
ref|XP_009357584.1|  PREDICTED: uncharacterized protein LOC103948301    169   1e-46   
gb|EYU33892.1|  hypothetical protein MIMGU_mgv1a013450mg                168   4e-46   
ref|XP_004486158.1|  PREDICTED: uncharacterized protein LOC101500992    167   8e-46   
ref|XP_010093287.1|  hypothetical protein L484_006301                   165   5e-45   
gb|EYU27793.1|  hypothetical protein MIMGU_mgv1a027068mg                162   3e-44   
gb|AFK48551.1|  unknown                                                 161   1e-43   
gb|KEH36847.1|  senescence regulator                                    161   2e-43   
gb|EPS57709.1|  hypothetical protein M569_17108                         159   3e-43   
ref|XP_003546150.1|  PREDICTED: uncharacterized protein LOC100796798    154   3e-41   
ref|XP_008439981.1|  PREDICTED: uncharacterized protein LOC103484606    154   3e-41   
ref|XP_006594426.1|  PREDICTED: uncharacterized protein LOC100798894    154   4e-41   
ref|XP_004155601.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    150   1e-39   
ref|XP_007153942.1|  hypothetical protein PHAVU_003G078300g             151   1e-39   
ref|XP_004134758.1|  PREDICTED: uncharacterized protein LOC101218032    150   2e-39   
ref|XP_010686848.1|  PREDICTED: uncharacterized protein LOC104901003    149   4e-39   
ref|XP_010057926.1|  PREDICTED: uncharacterized protein LOC104445711    149   7e-39   
ref|XP_010278697.1|  PREDICTED: uncharacterized protein LOC104612810    144   4e-37   
ref|XP_007147731.1|  hypothetical protein PHAVU_006G150000g             140   2e-35   
ref|XP_003529631.2|  PREDICTED: uncharacterized protein LOC100815796    139   3e-35   
gb|KFK43441.1|  hypothetical protein AALP_AA1G125700                    135   4e-34   
ref|XP_003550491.2|  PREDICTED: uncharacterized protein LOC100813375    135   7e-34   
ref|XP_010052839.1|  PREDICTED: uncharacterized protein LOC104441399    134   3e-33   
ref|XP_003610423.1|  hypothetical protein MTR_4g132020                  128   8e-32   
ref|NP_172635.1|  uncharacterized protein                               129   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004507692.1|  PREDICTED: uncharacterized protein LOC101501221    128   1e-31   
ref|XP_008441099.1|  PREDICTED: uncharacterized protein LOC103485322    127   3e-31   
ref|XP_010546875.1|  PREDICTED: uncharacterized protein LOC104818811    127   7e-31   
ref|XP_010923895.1|  PREDICTED: uncharacterized protein LOC105046857    126   1e-30   
ref|XP_006417325.1|  hypothetical protein EUTSA_v10008790mg             125   2e-30   
ref|XP_010473412.1|  PREDICTED: uncharacterized protein LOC104752848    124   1e-29   
ref|XP_008812625.1|  PREDICTED: uncharacterized protein LOC103723486    123   1e-29   
ref|XP_010929998.1|  PREDICTED: uncharacterized protein LOC105051322    122   2e-29   
ref|XP_004145178.1|  PREDICTED: uncharacterized protein LOC101209631    122   2e-29   
ref|XP_010418168.1|  PREDICTED: uncharacterized protein LOC104703794    121   9e-29   
ref|XP_010458577.1|  PREDICTED: uncharacterized protein LOC104739816    120   2e-28   
ref|XP_010493172.1|  PREDICTED: uncharacterized protein LOC104770441    120   2e-28   
ref|NP_564788.1|  uncharacterized protein                               119   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008806403.1|  PREDICTED: uncharacterized protein LOC103719105    119   5e-28   
ref|XP_002889889.1|  hypothetical protein ARALYDRAFT_471309             117   1e-27   
gb|AAM64551.1|  unknown                                                 117   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305623.1|  hypothetical protein CARUB_v10010311mg             117   3e-27   
ref|XP_010430218.1|  PREDICTED: uncharacterized protein LOC104714523    115   8e-27   
ref|XP_010476104.1|  PREDICTED: uncharacterized protein LOC104755423    115   1e-26   
ref|XP_009113110.1|  PREDICTED: uncharacterized protein LOC103838426    115   1e-26   
emb|CDY19509.1|  BnaC09g13940D                                          114   3e-26   
emb|CDX97979.1|  BnaA06g07300D                                          113   5e-26   
ref|XP_009148499.1|  PREDICTED: uncharacterized protein LOC103871920    113   5e-26   
ref|XP_007212173.1|  hypothetical protein PRUPE_ppa012541mg             110   2e-25   
emb|CDY12918.1|  BnaA09g13560D                                          111   3e-25   
emb|CDY34631.1|  BnaC08g41900D                                          110   8e-25   
gb|KFK40634.1|  hypothetical protein AALP_AA2G022100                    110   9e-25   
emb|CDY49797.1|  BnaCnng18100D                                          107   5e-24   
gb|KFK28777.1|  hypothetical protein AALP_AA7G046300                    106   8e-24   
ref|XP_006284630.1|  hypothetical protein CARUB_v10005873mg             105   2e-23   
ref|XP_006391948.1|  hypothetical protein EUTSA_v10023699mg             105   5e-23   
ref|XP_010538927.1|  PREDICTED: uncharacterized protein LOC104813102    103   8e-23   
ref|XP_006413710.1|  hypothetical protein EUTSA_v10026386mg             103   9e-23   
ref|XP_002888058.1|  hypothetical protein ARALYDRAFT_475139             100   1e-21   
emb|CAA17160.1|  putative protein                                       100   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193924.2|  uncharacterized protein                             99.4    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382720.1|  PREDICTED: uncharacterized protein LOC103970604  97.1    2e-20   
ref|XP_009135451.1|  PREDICTED: uncharacterized protein LOC103859632  96.7    2e-20   
emb|CDX79110.1|  BnaA01g11770D                                        94.7    1e-19   
ref|XP_010448966.1|  PREDICTED: uncharacterized protein LOC104731330  91.7    1e-18   
ref|XP_009392755.1|  PREDICTED: uncharacterized protein LOC103978629  91.3    2e-18   
ref|XP_006302821.1|  hypothetical protein CARUB_v10020952mg           91.7    3e-18   
ref|XP_010434102.1|  PREDICTED: uncharacterized protein LOC104718126  91.3    3e-18   
ref|XP_010439399.1|  PREDICTED: uncharacterized protein LOC104722848  90.9    3e-18   
ref|XP_009398796.1|  PREDICTED: uncharacterized protein LOC103983291  90.9    4e-18   
ref|XP_009408805.1|  PREDICTED: uncharacterized protein LOC103991172  89.7    9e-18   
ref|XP_009389746.1|  PREDICTED: uncharacterized protein LOC103976267  88.2    3e-17   
ref|XP_002869857.1|  hypothetical protein ARALYDRAFT_492675           87.4    5e-17   
emb|CDX82885.1|  BnaC01g13350D                                        87.0    6e-17   
ref|XP_009387201.1|  PREDICTED: uncharacterized protein LOC103974165  87.4    6e-17   
ref|XP_010455755.1|  PREDICTED: uncharacterized protein LOC104737310  84.7    4e-16   
ref|XP_009398222.1|  PREDICTED: uncharacterized protein LOC103982883  85.1    4e-16   
ref|XP_009599011.1|  PREDICTED: uncharacterized protein LOC104094737  82.8    1e-15   
ref|XP_009610044.1|  PREDICTED: uncharacterized protein LOC104103814  82.4    2e-15   
ref|XP_009769824.1|  PREDICTED: uncharacterized protein LOC104220620  80.9    6e-15   
ref|XP_010689547.1|  PREDICTED: uncharacterized protein LOC104903237  81.3    6e-15   
gb|ABK25188.1|  unknown                                               82.8    7e-15   Picea sitchensis
gb|ABK26775.1|  unknown                                               82.8    8e-15   Picea sitchensis
ref|XP_004249833.1|  PREDICTED: uncharacterized protein LOC101261979  80.5    1e-14   
ref|XP_006855856.1|  hypothetical protein AMTR_s00037p00097690        81.6    1e-14   
ref|XP_001765057.1|  predicted protein                                80.5    1e-14   
gb|KDO73285.1|  hypothetical protein CISIN_1g031000mg                 80.1    2e-14   
ref|XP_010253678.1|  PREDICTED: uncharacterized protein LOC104594856  80.1    2e-14   
emb|CDY16655.1|  BnaA09g20330D                                        80.1    2e-14   
ref|XP_006363694.1|  PREDICTED: uncharacterized protein LOC102595296  79.3    2e-14   
ref|XP_002461294.1|  hypothetical protein SORBIDRAFT_02g000350        79.3    3e-14   Sorghum bicolor [broomcorn]
ref|XP_010422288.1|  PREDICTED: uncharacterized protein LOC104707610  79.3    4e-14   
gb|ABK22020.1|  unknown                                               80.9    4e-14   Picea sitchensis
ref|XP_004957861.1|  PREDICTED: uncharacterized protein LOC101756704  79.3    4e-14   
gb|KFK30976.1|  hypothetical protein AALP_AA6G052500                  79.0    5e-14   
ref|XP_010043750.1|  PREDICTED: uncharacterized protein LOC104432877  79.3    5e-14   
ref|XP_002874806.1|  hypothetical protein ARALYDRAFT_911721           78.6    5e-14   
gb|AEW08411.1|  hypothetical protein 2_9187_01                        77.0    6e-14   
ref|XP_006354325.1|  PREDICTED: uncharacterized protein LOC102591579  78.6    6e-14   
ref|XP_009114555.1|  PREDICTED: uncharacterized protein LOC103839822  78.6    7e-14   
dbj|BAC43196.1|  unknown protein                                      78.6    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567264.1|  uncharacterized protein                             78.6    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011094663.1|  PREDICTED: uncharacterized protein LOC105174308  78.2    8e-14   
ref|XP_002519536.1|  conserved hypothetical protein                   78.6    8e-14   Ricinus communis
ref|XP_010432523.1|  PREDICTED: uncharacterized protein LOC104716776  78.2    8e-14   
ref|XP_004304430.1|  PREDICTED: uncharacterized protein LOC101312271  78.2    9e-14   
ref|NP_001044884.1|  Os01g0862600                                     79.0    9e-14   Oryza sativa Japonica Group [Japonica rice]
gb|KCW85739.1|  hypothetical protein EUGRSUZ_B02501                   79.3    1e-13   
ref|XP_006389614.1|  hypothetical protein POPTR_0021s00640g           77.8    1e-13   
gb|EAZ14237.1|  hypothetical protein OsJ_04162                        79.0    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010264683.1|  PREDICTED: uncharacterized protein LOC104602622  77.8    1e-13   
ref|XP_004145741.1|  PREDICTED: uncharacterized protein LOC101215539  77.8    1e-13   
gb|ABK21985.1|  unknown                                               78.2    1e-13   Picea sitchensis
ref|XP_009137232.1|  PREDICTED: uncharacterized protein LOC103861270  77.8    1e-13   
gb|AAD29777.1|AF074021_9  hypothetical protein                        78.2    2e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CAN61164.1|  hypothetical protein VITISV_001394                   77.4    2e-13   Vitis vinifera
ref|XP_002285165.1|  PREDICTED: uncharacterized protein LOC100253658  77.4    2e-13   Vitis vinifera
gb|ABR17234.1|  unknown                                               77.8    2e-13   Picea sitchensis
emb|CDY29096.1|  BnaC09g18220D                                        77.0    2e-13   
emb|CDX94568.1|  BnaC09g22680D                                        77.0    2e-13   
gb|AFG64475.1|  hypothetical protein 2_9187_01                        75.9    2e-13   
emb|CDX94069.1|  BnaC07g37030D                                        77.0    2e-13   
gb|AFG64465.1|  hypothetical protein 2_9187_01                        75.9    2e-13   
tpg|DAA40985.1|  TPA: hypothetical protein ZEAMMB73_135782            77.8    2e-13   
gb|EYU34447.1|  hypothetical protein MIMGU_mgv1a023553mg              76.3    3e-13   
dbj|BAJ96673.1|  predicted protein                                    76.6    3e-13   
ref|XP_006413702.1|  hypothetical protein EUTSA_v10027246mg           76.3    3e-13   
ref|XP_009420510.1|  PREDICTED: uncharacterized protein LOC104000238  77.4    4e-13   
ref|XP_008243937.1|  PREDICTED: uncharacterized protein LOC103342133  76.3    5e-13   
ref|XP_008463944.1|  PREDICTED: uncharacterized protein LOC103501949  75.9    5e-13   
gb|KHN02339.1|  hypothetical protein glysoja_002363                   75.5    5e-13   
gb|ACU21467.1|  unknown                                               75.9    5e-13   Glycine max [soybeans]
ref|XP_003539761.1|  PREDICTED: uncharacterized protein LOC100812183  76.3    5e-13   
ref|XP_003554378.1|  PREDICTED: uncharacterized protein LOC100808952  75.5    6e-13   
gb|KFK33927.1|  hypothetical protein AALP_AA5G079000                  75.5    6e-13   
ref|XP_002462928.1|  hypothetical protein SORBIDRAFT_02g034690        76.3    7e-13   Sorghum bicolor [broomcorn]
ref|XP_006645063.1|  PREDICTED: soluble starch synthase 2-3, chlo...  76.6    8e-13   
ref|XP_007206026.1|  hypothetical protein PRUPE_ppa012473mg           75.5    8e-13   
ref|XP_011047979.1|  PREDICTED: uncharacterized protein LOC105142...  75.9    8e-13   
ref|XP_006846774.1|  hypothetical protein AMTR_s00148p00028850        75.5    8e-13   
ref|XP_011047980.1|  PREDICTED: uncharacterized protein LOC105142...  75.9    8e-13   
ref|XP_010436451.1|  PREDICTED: uncharacterized protein LOC104720202  75.9    9e-13   
ref|XP_004153812.1|  PREDICTED: uncharacterized protein LOC101208118  75.5    9e-13   
ref|XP_004158009.1|  PREDICTED: uncharacterized protein LOC101225374  75.5    1e-12   
gb|AFK35468.1|  unknown                                               75.1    1e-12   
ref|XP_010538971.1|  PREDICTED: uncharacterized protein LOC104813134  75.1    1e-12   
ref|XP_007133098.1|  hypothetical protein PHAVU_011G151500g           74.7    1e-12   
ref|XP_007207567.1|  hypothetical protein PRUPE_ppa016754mg           75.1    1e-12   
ref|NP_193928.2|  uncharacterized protein                             74.7    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288768.1|  hypothetical protein CARUB_v10002087mg           75.1    1e-12   
ref|XP_011037628.1|  PREDICTED: uncharacterized protein LOC105134789  75.1    2e-12   
ref|XP_009796302.1|  PREDICTED: uncharacterized protein LOC104242882  74.3    2e-12   
gb|AFK46583.1|  unknown                                               74.3    2e-12   
ref|XP_008441031.1|  PREDICTED: uncharacterized protein LOC103485264  74.3    2e-12   
ref|XP_009612829.1|  PREDICTED: uncharacterized protein LOC104106054  73.9    3e-12   
ref|XP_002281329.1|  PREDICTED: uncharacterized protein LOC100258555  73.9    3e-12   Vitis vinifera
ref|XP_008808441.1|  PREDICTED: uncharacterized protein LOC103720500  73.9    3e-12   
emb|CAN66257.1|  hypothetical protein VITISV_001236                   73.9    3e-12   Vitis vinifera
ref|XP_009135481.1|  PREDICTED: uncharacterized protein LOC103859660  73.6    3e-12   
emb|CAA18100.1|  hypothetical protein                                 73.9    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003544880.1|  PREDICTED: uncharacterized protein LOC100790...  74.3    3e-12   
emb|CAA17164.1|  putative protein                                     74.7    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011097873.1|  PREDICTED: uncharacterized protein LOC105176685  73.9    4e-12   
ref|XP_008462513.1|  PREDICTED: uncharacterized protein LOC103500846  73.6    4e-12   
gb|ABK26383.1|  unknown                                               73.6    5e-12   Picea sitchensis
ref|XP_008225670.1|  PREDICTED: uncharacterized protein LOC103325290  73.6    5e-12   
ref|XP_010098187.1|  hypothetical protein L484_007649                 73.6    5e-12   
gb|EPS62644.1|  hypothetical protein M569_12146                       72.8    5e-12   
emb|CBI26645.3|  unnamed protein product                              73.9    6e-12   
gb|KDP44049.1|  hypothetical protein JCGZ_05516                       73.2    6e-12   
gb|KDP29113.1|  hypothetical protein JCGZ_16502                       73.2    6e-12   
ref|XP_009597452.1|  PREDICTED: uncharacterized protein LOC104093419  72.8    7e-12   
ref|XP_002869851.1|  hypothetical protein ARALYDRAFT_492672           72.8    7e-12   
ref|XP_008387660.1|  PREDICTED: uncharacterized protein LOC103450120  73.2    7e-12   
ref|XP_003632958.1|  PREDICTED: uncharacterized protein LOC100854465  73.2    8e-12   
gb|KDP20742.1|  hypothetical protein JCGZ_21213                       73.2    8e-12   
gb|KCW87356.1|  hypothetical protein EUGRSUZ_B03837                   72.4    9e-12   
ref|XP_010276118.1|  PREDICTED: uncharacterized protein LOC104610944  72.8    9e-12   
ref|XP_006396678.1|  hypothetical protein EUTSA_v10029023mg           72.4    9e-12   
ref|XP_008391399.1|  PREDICTED: uncharacterized protein LOC103453622  72.8    9e-12   
ref|XP_003563024.1|  PREDICTED: uncharacterized protein LOC100822827  72.8    9e-12   
ref|XP_010107536.1|  hypothetical protein L484_024389                 72.4    1e-11   
ref|XP_003543482.1|  PREDICTED: uncharacterized protein LOC100814909  72.0    1e-11   
ref|XP_011096060.1|  PREDICTED: uncharacterized protein LOC105175340  72.8    1e-11   
ref|XP_006352633.1|  PREDICTED: SUN domain-containing protein 2-like  72.4    1e-11   
ref|XP_006285893.1|  hypothetical protein CARUB_v10007405mg           72.4    1e-11   
ref|XP_006292450.1|  hypothetical protein CARUB_v10018671mg           72.4    1e-11   
ref|XP_003542862.1|  PREDICTED: uncharacterized protein LOC100796...  72.4    1e-11   
ref|XP_010037963.1|  PREDICTED: uncharacterized protein LOC104426559  72.4    1e-11   
gb|KHN37606.1|  hypothetical protein glysoja_007309                   72.4    1e-11   
gb|EAZ04057.1|  hypothetical protein OsI_26194                        72.8    1e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001168585.1|  hypothetical protein                             72.4    1e-11   Zea mays [maize]
ref|NP_001240052.1|  uncharacterized protein LOC100796494             72.4    1e-11   
ref|XP_010425942.1|  PREDICTED: uncharacterized protein LOC104710...  72.0    1e-11   
ref|XP_002456678.1|  hypothetical protein SORBIDRAFT_03g040710        72.8    1e-11   Sorghum bicolor [broomcorn]
ref|XP_008804302.1|  PREDICTED: pre-rRNA-processing protein esf2-...  72.0    1e-11   
gb|KEH36866.1|  senescence regulator                                  71.6    1e-11   
ref|XP_009787318.1|  PREDICTED: uncharacterized protein LOC104235292  72.0    2e-11   
ref|XP_004139450.1|  PREDICTED: uncharacterized protein LOC101217269  72.0    2e-11   
gb|AEW08415.1|  hypothetical protein 2_9289_01                        70.5    2e-11   
ref|XP_003597242.1|  hypothetical protein MTR_2g094410                71.6    2e-11   
dbj|BAK07561.1|  predicted protein                                    71.6    2e-11   
ref|XP_004134973.1|  PREDICTED: uncharacterized protein LOC101209587  72.0    2e-11   
ref|XP_010451289.1|  PREDICTED: uncharacterized protein LOC104733411  72.4    2e-11   
ref|XP_001783393.1|  predicted protein                                72.8    2e-11   
ref|XP_011089296.1|  PREDICTED: uncharacterized protein LOC105170296  71.6    2e-11   
ref|XP_010514861.1|  PREDICTED: uncharacterized protein LOC104790774  71.2    2e-11   
emb|CDP05737.1|  unnamed protein product                              72.0    2e-11   
ref|XP_004241275.1|  PREDICTED: uncharacterized protein LOC101262623  71.2    2e-11   
ref|XP_006340195.1|  PREDICTED: uncharacterized protein LOC102589274  71.6    2e-11   
gb|EYU38536.1|  hypothetical protein MIMGU_mgv1a018290mg              71.2    2e-11   
ref|XP_010503169.1|  PREDICTED: uncharacterized protein LOC104780370  71.2    2e-11   
ref|XP_004291575.1|  PREDICTED: uncharacterized protein LOC101299444  71.2    2e-11   
ref|XP_009767681.1|  PREDICTED: uncharacterized protein LOC104218792  71.2    3e-11   
ref|XP_006365734.1|  PREDICTED: uncharacterized protein LOC102600128  71.2    3e-11   
ref|XP_009593461.1|  PREDICTED: uncharacterized protein LOC104090119  71.2    3e-11   
ref|XP_004155672.1|  PREDICTED: uncharacterized LOC101209587          71.6    3e-11   
gb|KDP34425.1|  hypothetical protein JCGZ_12706                       72.0    3e-11   
ref|XP_010439392.1|  PREDICTED: uncharacterized protein LOC104722843  70.9    3e-11   
ref|XP_004251136.1|  PREDICTED: uncharacterized protein LOC101259309  71.2    3e-11   
ref|XP_010046638.1|  PREDICTED: uncharacterized protein LOC104435621  70.9    3e-11   
ref|XP_002448198.1|  hypothetical protein SORBIDRAFT_06g022820        71.2    3e-11   Sorghum bicolor [broomcorn]
ref|XP_010647511.1|  PREDICTED: uncharacterized protein LOC100853717  69.3    3e-11   
ref|XP_010923848.1|  PREDICTED: uncharacterized protein LOC105046820  70.9    3e-11   
ref|XP_004244111.1|  PREDICTED: phospholipase D C-like                71.2    4e-11   
ref|XP_008791539.1|  PREDICTED: uncharacterized protein LOC103708409  70.9    4e-11   
ref|XP_006384902.1|  hypothetical protein POPTR_0004s22060g           70.5    4e-11   
ref|XP_004246659.1|  PREDICTED: uncharacterized protein LOC101246954  70.5    4e-11   
ref|XP_010538229.1|  PREDICTED: uncharacterized protein LOC104812655  70.1    4e-11   
ref|XP_010520370.1|  PREDICTED: uncharacterized protein LOC104799504  70.5    4e-11   
ref|XP_008385317.1|  PREDICTED: uncharacterized protein LOC103447887  70.9    4e-11   
ref|XP_004970671.1|  PREDICTED: vegetative cell wall protein gp1-...  71.6    4e-11   
ref|XP_008359263.1|  PREDICTED: uncharacterized protein LOC103422971  70.5    4e-11   
ref|XP_008442681.1|  PREDICTED: uncharacterized protein LOC103486480  70.9    5e-11   
ref|XP_011089909.1|  PREDICTED: uncharacterized protein LOC105170719  70.1    5e-11   
ref|XP_007162749.1|  hypothetical protein PHAVU_001G177200g           70.5    5e-11   
gb|EYU18831.1|  hypothetical protein MIMGU_mgv1a015289mg              70.5    5e-11   
gb|AFG68833.1|  hypothetical protein 2_9289_01                        68.9    5e-11   
ref|XP_007150200.1|  hypothetical protein PHAVU_005G134900g           70.1    6e-11   
gb|EAZ40012.1|  hypothetical protein OsJ_24450                        70.1    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004293291.1|  PREDICTED: uncharacterized protein LOC101293662  70.5    6e-11   
ref|XP_010920416.1|  PREDICTED: uncharacterized protein LOC105044291  70.1    6e-11   
ref|XP_010929843.1|  PREDICTED: histone chaperone RTT106 isoform X2   69.7    6e-11   
ref|XP_003521393.2|  PREDICTED: uncharacterized protein LOC100786301  70.5    6e-11   
ref|XP_006424568.1|  hypothetical protein CICLE_v10029410mg           70.1    7e-11   
ref|XP_007027332.1|  Uncharacterized protein TCM_022158               70.1    7e-11   
ref|XP_007016742.1|  Uncharacterized protein TCM_042056               70.1    7e-11   
ref|XP_009385100.1|  PREDICTED: uncharacterized protein LOC103972471  70.9    8e-11   
gb|EYU33646.1|  hypothetical protein MIMGU_mgv1a022006mg              69.7    8e-11   
ref|XP_002305570.1|  hypothetical protein POPTR_0004s01400g           70.5    8e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010929835.1|  PREDICTED: uncharacterized protein LOC105051...  69.7    8e-11   
emb|CDM85097.1|  unnamed protein product                              70.5    9e-11   
ref|XP_010549441.1|  PREDICTED: uncharacterized protein LOC104820624  69.3    9e-11   
ref|XP_009352744.1|  PREDICTED: uncharacterized protein LOC103944073  70.1    1e-10   
gb|ABK21247.1|  unknown                                               70.1    1e-10   
gb|EYU27783.1|  hypothetical protein MIMGU_mgv1a024298mg              69.3    1e-10   
ref|XP_004487109.1|  PREDICTED: uncharacterized protein LOC101512341  69.7    1e-10   
ref|NP_001059782.1|  Os07g0516300                                     70.1    1e-10   
ref|XP_011095405.1|  PREDICTED: uncharacterized protein LOC105174872  70.1    1e-10   
ref|XP_008439987.1|  PREDICTED: uncharacterized protein LOC103484...  69.7    1e-10   
ref|XP_004486164.1|  PREDICTED: uncharacterized protein LOC101503430  69.3    1e-10   
gb|EPS70245.1|  hypothetical protein M569_04515                       69.3    1e-10   
ref|NP_001143808.1|  uncharacterized protein LOC100276582             70.1    1e-10   
ref|XP_008439986.1|  PREDICTED: uncharacterized protein LOC103484...  69.7    1e-10   
gb|KHN09502.1|  hypothetical protein glysoja_016601                   69.3    1e-10   
gb|ABK22988.1|  unknown                                               68.9    1e-10   
gb|EYU36187.1|  hypothetical protein MIMGU_mgv1a015493mg              68.9    1e-10   
ref|XP_002975647.1|  hypothetical protein SELMODRAFT_442846           70.9    1e-10   
ref|NP_001064875.2|  Os10g0481000                                     69.3    2e-10   
ref|XP_002987983.1|  hypothetical protein SELMODRAFT_426737           69.7    2e-10   
ref|XP_009357457.1|  PREDICTED: uncharacterized protein LOC103948180  69.3    2e-10   
gb|KDP21173.1|  hypothetical protein JCGZ_21644                       68.2    2e-10   
ref|XP_009397179.1|  PREDICTED: uncharacterized protein LOC103982093  68.9    2e-10   
ref|XP_011044356.1|  PREDICTED: uncharacterized protein LOC105139576  68.9    2e-10   
ref|XP_003550488.1|  PREDICTED: uncharacterized protein LOC100810...  68.9    2e-10   
ref|XP_010317416.1|  PREDICTED: uncharacterized protein LOC104646090  68.2    2e-10   
gb|AFK35467.1|  unknown                                               69.3    2e-10   
ref|XP_009387245.1|  PREDICTED: uncharacterized protein LOC103974208  68.6    2e-10   
gb|ABR16960.1|  unknown                                               68.9    2e-10   
ref|XP_009604431.1|  PREDICTED: uncharacterized protein LOC104099219  68.2    2e-10   
tpg|DAA57796.1|  TPA: hypothetical protein ZEAMMB73_265438            67.0    2e-10   
ref|XP_008224856.1|  PREDICTED: uncharacterized protein LOC103324562  65.9    2e-10   
ref|NP_001144899.1|  uncharacterized protein LOC100278004             68.6    3e-10   
gb|ACJ83912.1|  unknown                                               68.2    3e-10   
ref|XP_003606376.1|  hypothetical protein MTR_4g059320                68.2    3e-10   
ref|XP_007027824.1|  Uncharacterized protein isoform 1                68.9    3e-10   
gb|AFK43089.1|  unknown                                               68.2    3e-10   
ref|XP_002322879.1|  hypothetical protein POPTR_0016s09110g           68.2    3e-10   
gb|AEW08416.1|  hypothetical protein 2_9289_01                        66.6    3e-10   
ref|XP_010052849.1|  PREDICTED: ATPase family AAA domain-containi...  68.6    3e-10   
ref|XP_010538729.1|  PREDICTED: uncharacterized protein LOC104812972  67.8    3e-10   
ref|XP_010497951.1|  PREDICTED: uncharacterized protein LOC104775719  65.9    3e-10   
ref|XP_009768073.1|  PREDICTED: uncharacterized protein LOC104219136  68.6    3e-10   
ref|XP_008785283.1|  PREDICTED: uncharacterized protein LOC103703964  67.8    4e-10   
ref|XP_006295659.1|  hypothetical protein CARUB_v10024774mg           67.4    4e-10   
ref|XP_010092201.1|  hypothetical protein L484_013519                 68.6    4e-10   
ref|XP_002314267.1|  hypothetical protein POPTR_0009s01960g           68.2    4e-10   
emb|CDP06741.1|  unnamed protein product                              68.2    4e-10   
ref|XP_007142288.1|  hypothetical protein PHAVU_008G268000g           68.2    4e-10   
ref|XP_010543396.1|  PREDICTED: uncharacterized protein LOC104816337  67.8    4e-10   
ref|XP_011007679.1|  PREDICTED: uncharacterized protein LOC105113274  67.8    4e-10   
ref|XP_010644457.1|  PREDICTED: uncharacterized protein LOC104877592  68.2    4e-10   
ref|XP_003580155.1|  PREDICTED: uncharacterized protein LOC100822702  67.8    4e-10   
ref|XP_006652266.1|  PREDICTED: insulinoma-associated protein 1-like  68.9    5e-10   
ref|XP_010327173.1|  PREDICTED: uncharacterized protein LOC104649489  67.4    5e-10   
ref|XP_004137823.1|  PREDICTED: uncharacterized protein LOC101217342  67.8    5e-10   
gb|ADE76487.1|  unknown                                               67.8    5e-10   
ref|XP_003625632.1|  hypothetical protein MTR_7g101250                67.4    5e-10   
ref|XP_002877392.1|  hypothetical protein ARALYDRAFT_484911           67.4    5e-10   
gb|AFW58878.1|  hypothetical protein ZEAMMB73_952839                  67.8    6e-10   
ref|XP_002972949.1|  hypothetical protein SELMODRAFT_413288           68.2    6e-10   
emb|CDX82889.1|  BnaC01g13390D                                        67.0    6e-10   
ref|XP_008225397.1|  PREDICTED: uncharacterized protein LOC103325047  67.0    6e-10   
ref|XP_003540175.1|  PREDICTED: uncharacterized protein LOC100817341  67.0    7e-10   
ref|XP_006449732.1|  hypothetical protein CICLE_v10017735mg           67.4    7e-10   
ref|NP_174257.1|  uncharacterized protein                             66.6    8e-10   
ref|XP_011004700.1|  PREDICTED: protein DSE2-like                     67.8    8e-10   
ref|XP_009126590.1|  PREDICTED: uncharacterized protein LOC103851491  67.0    8e-10   
ref|XP_009777438.1|  PREDICTED: uncharacterized protein LOC104227008  66.2    8e-10   
ref|NP_001144115.1|  uncharacterized protein LOC100276955             67.0    9e-10   
ref|XP_009360999.1|  PREDICTED: nucleomorphin-like                    66.2    9e-10   
ref|XP_004976251.1|  PREDICTED: uncharacterized protein LOC101760473  67.0    9e-10   
ref|XP_009388876.1|  PREDICTED: uncharacterized protein LOC103975590  67.0    9e-10   
ref|NP_190107.1|  uncharacterized protein                             66.6    9e-10   
ref|XP_010483718.1|  PREDICTED: uncharacterized protein LOC104762175  66.6    1e-09   
ref|XP_006453504.1|  hypothetical protein CICLE_v10009734mg           66.6    1e-09   
ref|XP_010934341.1|  PREDICTED: uncharacterized protein LOC105054512  66.6    1e-09   
gb|KHN35738.1|  hypothetical protein glysoja_039524                   66.6    1e-09   
gb|KDO62349.1|  hypothetical protein CISIN_1g031154mg                 66.6    1e-09   
ref|XP_009342883.1|  PREDICTED: uncharacterized protein LOC103934848  67.0    1e-09   
ref|XP_002323415.1|  hypothetical protein POPTR_0016s07710g           67.4    1e-09   
gb|KHN48294.1|  hypothetical protein glysoja_007963                   66.2    1e-09   
ref|XP_003596839.1|  hypothetical protein MTR_2g086660                67.8    1e-09   
ref|XP_009588594.1|  PREDICTED: uncharacterized protein LOC104086119  67.4    1e-09   
ref|XP_004246486.1|  PREDICTED: uncharacterized protein LOC101246370  67.4    1e-09   
ref|XP_003542516.1|  PREDICTED: uncharacterized protein LOC100790091  66.6    1e-09   
ref|XP_002518475.1|  hypothetical protein RCOM_0904330                67.0    1e-09   
ref|XP_011075923.1|  PREDICTED: uncharacterized protein LOC105160301  66.6    1e-09   
ref|XP_003538194.2|  PREDICTED: uncharacterized protein LOC100782946  66.2    1e-09   
ref|XP_003528686.1|  PREDICTED: uncharacterized protein LOC100791...  66.6    1e-09   
ref|XP_003561535.1|  PREDICTED: uncharacterized protein LOC100839665  66.6    2e-09   
ref|XP_004493973.1|  PREDICTED: uncharacterized protein LOC101494881  66.2    2e-09   
ref|XP_008229135.1|  PREDICTED: transcription factor MafB-like        67.4    2e-09   
gb|EPS60592.1|  hypothetical protein M569_14211                       65.9    2e-09   
ref|XP_006346209.1|  PREDICTED: uncharacterized protein LOC102579297  66.6    2e-09   
ref|XP_002893572.1|  hypothetical protein ARALYDRAFT_890490           65.5    2e-09   
ref|XP_007153950.1|  hypothetical protein PHAVU_003G079000g           66.2    2e-09   
ref|XP_006481461.1|  PREDICTED: uncharacterized protein LOC102610402  65.9    2e-09   
ref|XP_007015777.1|  Uncharacterized protein TCM_041373               67.4    2e-09   
ref|NP_001053333.1|  Os04g0520700                                     65.9    2e-09   
ref|XP_002978830.1|  hypothetical protein SELMODRAFT_109526           63.5    2e-09   
ref|XP_002881332.1|  hypothetical protein ARALYDRAFT_482377           65.1    2e-09   
ref|XP_010675727.1|  PREDICTED: uncharacterized protein LOC104891692  65.9    2e-09   
ref|XP_009781859.1|  PREDICTED: uncharacterized protein LOC104230693  65.5    2e-09   
ref|XP_003558985.1|  PREDICTED: uncharacterized protein LOC100828029  65.9    2e-09   
ref|XP_009120602.1|  PREDICTED: uncharacterized protein LOC103845482  65.5    2e-09   
ref|XP_009594932.1|  PREDICTED: uncharacterized protein LOC104091320  65.5    2e-09   
emb|CAN76322.1|  hypothetical protein VITISV_010458                   66.2    3e-09   
ref|XP_004982836.1|  PREDICTED: uncharacterized protein LOC101784168  65.9    3e-09   
ref|XP_006428783.1|  hypothetical protein CICLE_v10012912mg           65.5    3e-09   
ref|XP_011090489.1|  PREDICTED: mucin-1-like                          66.2    3e-09   
ref|XP_006468189.1|  PREDICTED: uncharacterized protein LOC102613705  65.9    3e-09   
gb|KDO78234.1|  hypothetical protein CISIN_1g029439mg                 65.9    3e-09   
tpg|DAA36906.1|  TPA: hypothetical protein ZEAMMB73_312513            65.9    3e-09   
ref|XP_010278674.1|  PREDICTED: uncharacterized protein LOC104612795  65.9    3e-09   
emb|CDY65979.1|  BnaCnng49210D                                        65.1    3e-09   
ref|XP_011077840.1|  PREDICTED: uncharacterized protein LOC105161740  66.2    3e-09   
ref|NP_001146522.1|  uncharacterized protein LOC100280113             65.5    3e-09   
gb|AFK48660.1|  unknown                                               65.1    3e-09   
ref|XP_008345042.1|  PREDICTED: nucleolin-like                        65.9    3e-09   
ref|XP_003539161.1|  PREDICTED: uncharacterized protein LOC100779194  66.2    3e-09   
ref|XP_003571889.1|  PREDICTED: uncharacterized protein LOC100830832  65.5    3e-09   
ref|XP_008806103.1|  PREDICTED: uncharacterized protein LOC103718881  66.2    3e-09   
ref|XP_010943817.1|  PREDICTED: uncharacterized protein LOC105061463  66.2    3e-09   
ref|XP_010443870.1|  PREDICTED: transcription initiation factor T...  65.1    4e-09   
ref|XP_006281214.1|  hypothetical protein CARUB_v10027254mg           65.1    4e-09   
emb|CDX94683.1|  BnaC07g09750D                                        64.7    4e-09   
ref|XP_010037272.1|  PREDICTED: uncharacterized protein LOC104426046  65.9    4e-09   
emb|CDY17236.1|  BnaA05g09520D                                        64.3    4e-09   
ref|XP_002971509.1|  hypothetical protein SELMODRAFT_95729            64.3    4e-09   
ref|XP_010272677.1|  PREDICTED: uncharacterized protein LOC104608402  64.3    4e-09   
ref|XP_010521764.1|  PREDICTED: uncharacterized protein LOC104800605  64.7    4e-09   
ref|XP_008371174.1|  PREDICTED: uncharacterized protein LOC103434595  65.1    4e-09   
emb|CDX94684.1|  BnaC07g09740D                                        64.3    4e-09   
ref|XP_002274347.1|  PREDICTED: uncharacterized protein LOC100253575  65.5    4e-09   
ref|XP_010456667.1|  PREDICTED: transcription initiation factor T...  65.1    4e-09   
ref|XP_009413717.1|  PREDICTED: uncharacterized protein LOC103994969  64.7    4e-09   
gb|KFK27594.1|  hypothetical protein AALP_AA8G404000                  64.7    5e-09   
ref|XP_007207481.1|  hypothetical protein PRUPE_ppa011154mg           65.5    5e-09   
ref|XP_011004204.1|  PREDICTED: uncharacterized protein LOC105110747  65.5    5e-09   
ref|XP_009594778.1|  PREDICTED: uncharacterized protein LOC104091203  63.9    5e-09   
ref|XP_006449590.1|  hypothetical protein CICLE_v10017454mg           64.3    6e-09   
ref|XP_009400822.1|  PREDICTED: uncharacterized protein LOC103984958  64.7    6e-09   
ref|XP_003539474.2|  PREDICTED: uncharacterized protein LOC100778...  65.9    6e-09   
ref|XP_010686835.1|  PREDICTED: probable serine/threonine-protein...  65.1    6e-09   
emb|CAN77892.1|  hypothetical protein VITISV_016272                   65.1    7e-09   
ref|XP_010102003.1|  hypothetical protein L484_016293                 65.5    7e-09   
ref|XP_008364111.1|  PREDICTED: uncharacterized protein LOC103427808  64.7    7e-09   
gb|KHN02845.1|  hypothetical protein glysoja_009711                   64.7    7e-09   
ref|XP_004497503.1|  PREDICTED: uncharacterized protein LOC101503850  63.9    7e-09   
ref|XP_009367072.1|  PREDICTED: uncharacterized protein LOC103956768  64.3    7e-09   
ref|XP_010662913.1|  PREDICTED: uncharacterized protein LOC104882243  64.7    7e-09   
ref|XP_002864697.1|  hypothetical protein ARALYDRAFT_496217           63.9    8e-09   
gb|AFW68567.1|  hypothetical protein ZEAMMB73_025917                  64.3    8e-09   
ref|XP_010413751.1|  PREDICTED: uncharacterized protein LOC104700006  63.5    8e-09   
emb|CBI23059.3|  unnamed protein product                              63.9    8e-09   
gb|KEH38985.1|  senescence regulator                                  65.9    9e-09   
ref|XP_010671363.1|  PREDICTED: uncharacterized protein LOC104888174  64.3    9e-09   
ref|XP_004249432.1|  PREDICTED: uncharacterized protein LOC101255845  65.1    9e-09   
ref|XP_009143784.1|  PREDICTED: uncharacterized protein LOC103867465  63.2    9e-09   
ref|XP_011048547.1|  PREDICTED: uncharacterized protein LOC105142559  63.9    9e-09   
gb|KDO45145.1|  hypothetical protein CISIN_1g030317mg                 63.9    1e-08   
ref|XP_006381452.1|  hypothetical protein POPTR_0006s12970g           63.9    1e-08   
ref|XP_004232709.1|  PREDICTED: uncharacterized protein LOC101252739  63.5    1e-08   
ref|XP_002464477.1|  hypothetical protein SORBIDRAFT_01g019100        63.9    1e-08   
ref|XP_003541967.1|  PREDICTED: rho GTPase-activating protein gac...  64.7    1e-08   
ref|XP_011040881.1|  PREDICTED: uncharacterized protein LOC105137020  63.9    1e-08   
ref|XP_006607037.1|  PREDICTED: uncharacterized protein LOC102668618  62.8    1e-08   
ref|XP_009141374.1|  PREDICTED: uncharacterized protein LOC103865329  63.2    1e-08   
emb|CDX84328.1|  BnaC04g10900D                                        62.8    1e-08   
ref|XP_004295416.1|  PREDICTED: uncharacterized protein LOC101300038  62.8    1e-08   
ref|XP_009102835.1|  PREDICTED: uncharacterized protein LOC103828949  62.8    1e-08   
emb|CDP04405.1|  unnamed protein product                              63.5    1e-08   
ref|XP_002991623.1|  hypothetical protein SELMODRAFT_429904           63.9    2e-08   
ref|XP_010553009.1|  PREDICTED: uncharacterized protein LOC104823238  63.2    2e-08   
ref|XP_002963487.1|  hypothetical protein SELMODRAFT_405391           64.7    2e-08   
ref|XP_002988196.1|  hypothetical protein SELMODRAFT_426954           64.7    2e-08   
gb|EYU28151.1|  hypothetical protein MIMGU_mgv1a016118mg              62.8    2e-08   
gb|KEH36680.1|  senescence regulator                                  62.4    2e-08   
ref|XP_010535607.1|  PREDICTED: uncharacterized protein LOC104810859  63.2    2e-08   
ref|NP_001048739.1|  Os03g0113900                                     63.5    2e-08   
emb|CDY68974.1|  BnaA07g36440D                                        62.4    2e-08   
ref|NP_180407.1|  uncharacterized protein                             63.2    2e-08   
ref|XP_010654113.1|  PREDICTED: uncharacterized protein LOC104880155  63.9    2e-08   
emb|CAN79276.1|  hypothetical protein VITISV_027900                   63.9    2e-08   
ref|XP_004487487.1|  PREDICTED: uncharacterized protein LOC101502592  64.3    2e-08   
ref|XP_006339317.1|  PREDICTED: uncharacterized protein LOC102585652  64.3    2e-08   
ref|XP_008226887.1|  PREDICTED: uncharacterized protein LOC103326...  63.5    2e-08   
gb|EAY88262.1|  hypothetical protein OsI_09715                        63.5    2e-08   
ref|XP_009352010.1|  PREDICTED: uncharacterized protein LOC103943423  62.4    2e-08   
ref|XP_011089908.1|  PREDICTED: uncharacterized protein LOC105170718  62.8    2e-08   
ref|XP_008784036.1|  PREDICTED: uncharacterized protein LOC103703104  63.9    2e-08   
gb|EEE58201.1|  hypothetical protein OsJ_09154                        61.6    2e-08   
ref|NP_001052750.1|  Os04g0413900                                     63.9    2e-08   
ref|XP_006410577.1|  hypothetical protein EUTSA_v10017404mg           62.4    2e-08   
ref|XP_003567072.1|  PREDICTED: uncharacterized protein LOC100834304  61.6    2e-08   
ref|XP_007145215.1|  hypothetical protein PHAVU_007G220200g           62.8    2e-08   
ref|XP_008371530.1|  PREDICTED: uncharacterized protein LOC103434932  62.4    2e-08   
ref|XP_009780243.1|  PREDICTED: uncharacterized protein LOC104229316  63.2    3e-08   
gb|EYU38657.1|  hypothetical protein MIMGU_mgv1a013461mg              63.2    3e-08   
ref|XP_007147959.1|  hypothetical protein PHAVU_006G168600g           61.6    3e-08   
ref|XP_010478328.1|  PREDICTED: uncharacterized protein LOC104757297  62.0    3e-08   
ref|XP_008226886.1|  PREDICTED: uncharacterized protein LOC103326...  63.2    3e-08   
ref|XP_006662742.1|  PREDICTED: uncharacterized protein LOC102722151  62.4    3e-08   
gb|EAY78462.1|  hypothetical protein OsI_33549                        63.5    3e-08   
dbj|BAJ92790.1|  predicted protein                                    62.4    3e-08   
ref|NP_001044239.1|  Os01g0748300                                     62.0    3e-08   
ref|XP_006855891.1|  hypothetical protein AMTR_s00037p00153530        62.4    3e-08   
ref|XP_009396751.1|  PREDICTED: uncharacterized protein LOC103981740  61.2    4e-08   
emb|CDY32323.1|  BnaC01g36420D                                        62.8    4e-08   
ref|XP_003579706.1|  PREDICTED: uncharacterized protein LOC100839160  63.2    4e-08   
ref|XP_007143956.1|  hypothetical protein PHAVU_007G116700g           60.1    4e-08   
emb|CDY20098.1|  BnaA01g29040D                                        62.4    5e-08   
ref|XP_010557316.1|  PREDICTED: uncharacterized protein LOC104826363  61.6    5e-08   
ref|XP_009381973.1|  PREDICTED: uncharacterized protein LOC103970065  61.6    5e-08   
ref|NP_001136996.1|  uncharacterized protein LOC100217159             63.2    5e-08   
gb|KGN64943.1|  hypothetical protein Csa_1G165750                     62.8    5e-08   
ref|XP_006419060.1|  hypothetical protein EUTSA_v10002696mg           61.6    5e-08   
ref|NP_565785.1|  uncharacterized protein                             61.2    5e-08   
ref|XP_010655596.1|  PREDICTED: uncharacterized protein LOC104880497  60.8    5e-08   
emb|CBI23248.3|  unnamed protein product                              60.8    5e-08   
ref|XP_008461249.1|  PREDICTED: putative protein TPRXL                62.8    5e-08   
ref|XP_009366740.1|  PREDICTED: uncharacterized protein LOC103956468  62.0    6e-08   
ref|XP_010068833.1|  PREDICTED: uncharacterized protein LOC104455798  62.0    6e-08   



>ref|XP_009780570.1| PREDICTED: uncharacterized protein LOC104229610 [Nicotiana sylvestris]
Length=204

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 145/225 (64%), Gaps = 25/225 (11%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCE-SELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRKLT S SER LGSYSY+    HG     E SELGEDDVWSTVD M N     ++ 
Sbjct  1    MAKGRKLTTSMSERYLGSYSYN----HGNETVNETSELGEDDVWSTVDDMVNGDDHLLNG  56

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQ  540
            S S +WS RA +ES  S  + R                  G SL F+D G TT   ++HQ
Sbjct  57   SRS-DWSSRATAESNRSLRSRRQTG---------------GLSLAFDDPGTTTQPRILHQ  100

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHE  720
            FRGQ D +T      RH+++S PVN+P+WS   RVDSVESF+DSD    + + EMVPPHE
Sbjct  101  FRGQ-DNMTVQSPRERHMASSAPVNVPDWSMICRVDSVESFHDSDDGVDDHELEMVPPHE  159

Query  721  YLAREYG---RTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            YLAR YG   R+S NS+ EG GRTLKGRDMSRVRDAVWSQTGFNG
Sbjct  160  YLARGYGRSRRSSTNSVFEGVGRTLKGRDMSRVRDAVWSQTGFNG  204



>ref|XP_009597345.1| PREDICTED: uncharacterized protein LOC104093319 [Nicotiana tomentosiformis]
Length=201

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 148/225 (66%), Gaps = 28/225 (12%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCE-SELGEDDVWSTVDGMANDRRRGVDS  360
            M KGRKLTAS SER LGSYSY+    HG     E SELGEDDVWST D         V+ 
Sbjct  1    MTKGRKLTASMSERYLGSYSYN----HGNETVNETSELGEDDVWSTGDDHL------VNG  50

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQ  540
            S S +W  RA +ES GSF +FRS R               G SL F+D G+T PS ++HQ
Sbjct  51   SRS-DWEARATAESNGSFSSFRSCRQAG------------GLSLAFDDSGKTAPSRILHQ  97

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHE  720
            FRGQ D + A   + RH++ S PVN+P+WS   RVDSVESF+DSD    + + E+VPPHE
Sbjct  98   FRGQ-DSMAAQSPSERHMAFSAPVNVPDWSKIYRVDSVESFHDSDDGVDDHELEIVPPHE  156

Query  721  YLAREYGR---TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            YLAR +GR   ++ NS+ EG GRTLKGRDMSRVR+AVWSQTGFNG
Sbjct  157  YLARGHGRSRKSTTNSVFEGVGRTLKGRDMSRVRNAVWSQTGFNG  201



>ref|XP_006449722.1| hypothetical protein CICLE_v10016695mg [Citrus clementina]
 gb|ESR62962.1| hypothetical protein CICLE_v10016695mg [Citrus clementina]
Length=210

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 142/228 (62%), Gaps = 25/228 (11%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SER LGSYSYSN        G  SELGE+DVWSTVD +A+     V ++
Sbjct  1    MAKGRKLTTSRSERYLGSYSYSNGQG---TNGGVSELGEEDVWSTVDDVADSNDEVVINN  57

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDD----GSSLTFEDLGETTPSGV  531
               EWSPRA  ES   F                 +  DD    G SL F+D G+T+ S +
Sbjct  58   PRNEWSPRAAGESNVGF----------STKSRRRNNRDDHHVGGLSLAFDDAGKTSASRI  107

Query  532  VHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVP  711
            VHQFR  +D + A+P     ++TS PVN+P+WS   RVDSV+S +DSD     RD EM+P
Sbjct  108  VHQFRA-NDSMAASPRG-HQMATSAPVNVPDWSKIYRVDSVDSMHDSDDE---RDMEMIP  162

Query  712  PHEYLAREYGR---TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PHEYLAREY R   T   S+ EG GRTLKGRD+ RVRDAVWSQTGF+G
Sbjct  163  PHEYLAREYARSKKTGGASVFEGVGRTLKGRDLRRVRDAVWSQTGFDG  210



>ref|XP_002274403.1| PREDICTED: uncharacterized protein LOC100246942 [Vitis vinifera]
Length=213

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 149/229 (65%), Gaps = 24/229 (10%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCES-ELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRKLT S SERLLGS++Y     HG+ AG +S ELGE+DVWS VD M  +R   V+ 
Sbjct  1    MAKGRKLTTSRSERLLGSFAYG----HGQGAGADSSELGEEDVWSMVDDMV-ERDDHVNG  55

Query  361  SE----SGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG  528
                    +WSPRAG E      + R R  R    +        G SL F+D G+TT S 
Sbjct  56   GGGGGGQSDWSPRAGGEPAMRNHHHRRRIPRDDRHQVG------GLSLAFDDSGKTTSSR  109

Query  529  VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMV  708
            +VHQ+R Q DGVT +P    H++TS PVN+P+W    RVDSVES +DSD    +R+ EMV
Sbjct  110  IVHQYRPQ-DGVTPSPRG-HHMATSAPVNVPDWHKILRVDSVESLHDSDD---DRELEMV  164

Query  709  PPHEYLAREYG---RTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PPHEYLAREY    + +A S+ EG GRTLKGRDMSRVRDAVWSQTGF+G
Sbjct  165  PPHEYLAREYAASRKMAATSVLEGVGRTLKGRDMSRVRDAVWSQTGFDG  213



>gb|KDP20752.1| hypothetical protein JCGZ_21223 [Jatropha curcas]
Length=215

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 144/225 (64%), Gaps = 14/225 (6%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGR+LT S SERLLGS++Y+N     R     SELGE+DVWS VD   +   + VD+S
Sbjct  1    MAKGRRLTTSRSERLLGSFAYANG--QDRTDTDSSELGEEDVWSMVDDAGDRNEQNVDNS  58

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDL-GETTPSGVVHQ  540
            + G+W+ RA  ES GS      RR               G SL FED   +T  S ++HQ
Sbjct  59   Q-GDWNTRADVESNGSMTTRSRRRVPRDNRHVG------GLSLAFEDSSAKTASSRILHQ  111

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHE  720
            FRG HD V +   + RH++TS PVN+P+WS   RVDSVES ++SD    +RD EMVPPHE
Sbjct  112  FRG-HDSVASPAASPRHMATSAPVNVPDWSKILRVDSVESLHESDDGFDDRDSEMVPPHE  170

Query  721  YLAREYGRTSA---NSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            YLAREY R+      S+ EG GRTLKGRD+ RVRDAVWSQTGF+G
Sbjct  171  YLAREYARSKKMGGASVFEGVGRTLKGRDLRRVRDAVWSQTGFDG  215



>ref|XP_003632945.1| PREDICTED: uncharacterized protein LOC100855186 [Vitis vinifera]
Length=213

 Score =   195 bits (496),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 125/229 (55%), Positives = 151/229 (66%), Gaps = 24/229 (10%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCES-ELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRKLT S SERLLGS++Y     HG+ AG +S ELGE+DVWS VD M  +R   V+ 
Sbjct  1    MAKGRKLTTSRSERLLGSFAYG----HGQGAGADSSELGEEDVWSMVDDMV-ERDDHVNG  55

Query  361  SE----SGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG  528
                    +WSPRAG E   +  N   RR  PR  R +   L    SL F+D G+T  S 
Sbjct  56   GGGGGGQSDWSPRAGGEP--AIRNHHHRRRIPRDDRHQVGGL----SLAFDDSGKTASSR  109

Query  529  VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMV  708
            +VHQ+R Q DGVT +P    H++TS PVN+P+W    RVDSVES +DSD    +R+ EMV
Sbjct  110  IVHQYRPQ-DGVTPSPRG-HHMATSAPVNVPDWHKILRVDSVESLHDSDD---DRELEMV  164

Query  709  PPHEYLAREYG---RTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PPHEYLAREY    + +A S+ EG GRTLKGRDMSRVRDAVWSQTGF+G
Sbjct  165  PPHEYLAREYAASRKMAATSVLEGVGRTLKGRDMSRVRDAVWSQTGFDG  213



>ref|XP_006467441.1| PREDICTED: uncharacterized protein LOC102607295 [Citrus sinensis]
 gb|KDO78216.1| hypothetical protein CISIN_1g028358mg [Citrus sinensis]
Length=210

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 140/224 (63%), Gaps = 17/224 (8%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S  ER LGSYSYSN        G  SELGE+DVWSTVD + +     V ++
Sbjct  1    MAKGRKLTTSRCERYLGSYSYSNGQG---TNGGVSELGEEDVWSTVDDVEDSNDEVVINN  57

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
               EWSPRA  ES   F     RR+              G SL F+D G+T+ S +VHQF
Sbjct  58   PRNEWSPRAAGESNVGFSTRSRRRNTRDDHHVG------GLSLAFDDAGKTSASRIVHQF  111

Query  544  RGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEY  723
            R  +D + A+P     ++TS PVN+P+WS   RVDSV+S +DSD     RD EM+PPHEY
Sbjct  112  RA-NDSMAASPRG-HQMATSAPVNVPDWSKIYRVDSVDSMHDSDDE---RDMEMIPPHEY  166

Query  724  LAREYGR---TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            LAREY R   T   S+ EG GRTLKGRD+ RVRDAVWSQTGF+G
Sbjct  167  LAREYARSKKTGGASVFEGVGRTLKGRDLRRVRDAVWSQTGFDG  210



>ref|XP_011086185.1| PREDICTED: uncharacterized protein LOC105167985 [Sesamum indicum]
Length=214

 Score =   193 bits (490),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 145/224 (65%), Gaps = 13/224 (6%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            M KGRKLT S SER LGS+ Y+     G   G   ELGED+VWS VD   N    G D S
Sbjct  1    MGKGRKLTTSRSERFLGSFCYNQE--QGTANGAAPELGEDEVWSLVDDTVN----GDDHS  54

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
             SG W  RA SE+ G+F ++ +RR  P     +  ++  G SL F+    T+   +VHQF
Sbjct  55   VSGGWGSRASSEANGTFSSYSTRRPHPHTDHHQRRQVG-GLSLAFDHSSNTSSPRIVHQF  113

Query  544  RGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEY  723
            R Q D V  +P   R+++TS PVN+P+WS   RVDSVES +DSD    N D E+VPPHEY
Sbjct  114  RAQ-DSVAESPRG-RNMATSAPVNVPDWSKIYRVDSVESLHDSDD-GWNEDSELVPPHEY  170

Query  724  LAREYGRT---SANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            LAREY R+   +ANS+ EG GRTLKGRDMSRVRDAVWSQTGF+G
Sbjct  171  LAREYARSRRIAANSVFEGVGRTLKGRDMSRVRDAVWSQTGFDG  214



>ref|XP_009614259.1| PREDICTED: uncharacterized protein LOC104107229 [Nicotiana tomentosiformis]
Length=210

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 142/222 (64%), Gaps = 13/222 (6%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SE LLG+YSY N           SELGEDDVWSTV+GM N    G D  
Sbjct  1    MAKGRKLTNSRSEMLLGNYSYRNG---SETVNGSSELGEDDVWSTVNGMVN----GDDHV  53

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGS-SLTFEDLGETTPSGVVHQ  540
               EWSPRA ++S G+F  F SR+           R   G  SL F+D G+ + S ++HQ
Sbjct  54   PRNEWSPRATTDSNGTFGGFMSRKQPVPRADHHSRRHQVGGLSLAFDDSGKMSSSRILHQ  113

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHE  720
            F GQ     A      H++TS PVN+P+WS   RV+SVES +DSD   ++ D E+VPPHE
Sbjct  114  FHGQ----DAPSPRACHMATSAPVNVPDWSKIYRVNSVESLHDSDDGVNDHDSEIVPPHE  169

Query  721  YLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            Y+AR    ++++S+ EG GRTLKGRD+SRVRDAVWSQTGF+G
Sbjct  170  YIARSRN-SASHSVFEGVGRTLKGRDLSRVRDAVWSQTGFDG  210



>ref|XP_011047992.1| PREDICTED: uncharacterized protein LOC105142178 [Populus euphratica]
Length=219

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 148/229 (65%), Gaps = 18/229 (8%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGS-YSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGR+LT S SERLLGS YSY N      I    SELGE+DVWS VD  A DR     S
Sbjct  1    MAKGRRLTTSRSERLLGSNYSYGNGQIP--IVNEVSELGEEDVWSMVDDTA-DRGDSAVS  57

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDL----GETTPSG  528
            + +G W+PRA  ES  SFD+      R R+PR + +    G SL FED      +T  S 
Sbjct  58   NSNGAWNPRAELES--SFDHMSISGGRRRIPRDDRNM--GGLSLAFEDSSSGSNKTASSR  113

Query  529  VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMV  708
            +VHQFRG     +A+P   RH++TS PVN+P+WS   RV+SVES +DSD    +++ EMV
Sbjct  114  IVHQFRGNDLVASASP---RHMATSAPVNVPDWSQIYRVNSVESLHDSDDGFDDQESEMV  170

Query  709  PPHEYLAREYGR---TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PPHEYLAREY R   T   S+ EG GRTLKGRDM RVRDAVWSQTGF+G
Sbjct  171  PPHEYLAREYARSRKTGGASVVEGVGRTLKGRDMRRVRDAVWSQTGFDG  219



>ref|XP_007026065.1| Uncharacterized protein TCM_030219 [Theobroma cacao]
 gb|EOY28687.1| Uncharacterized protein TCM_030219 [Theobroma cacao]
Length=217

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 145/225 (64%), Gaps = 12/225 (5%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGR+LT S SER LGSYSY +S   G     E ELGE+DVWS VD +A    + V++S
Sbjct  1    MAKGRRLTTSRSERFLGSYSYGHS--LGDAVTDEPELGEEDVWSMVDNVAERDDQNVNNS  58

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
            +S EWSPRA +E+ G   N        R       R   G SL FED   T P  +VHQF
Sbjct  59   QS-EWSPRAEAENNG---NGNVDVRGGRRRVPRGDRHVGGLSLAFEDSSSTKPR-IVHQF  113

Query  544  RGQHDGVTAAPT-NVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHE  720
            RG HDG+ AA +    H++TS PVN+P+WS   RVDSVES +DSD    + D EMVPPHE
Sbjct  114  RG-HDGMAAAASPRGHHMATSAPVNVPDWSKIYRVDSVESIHDSDDGLDDGDSEMVPPHE  172

Query  721  YLAREYGRTS---ANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            YLAREY R+      S+ EG GRTLKGRD+ RVRDAVWSQTGF+G
Sbjct  173  YLAREYARSKKMGGASVFEGVGRTLKGRDLRRVRDAVWSQTGFDG  217



>ref|XP_011037653.1| PREDICTED: uncharacterized protein LOC105134801 [Populus euphratica]
Length=217

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 145/228 (64%), Gaps = 18/228 (8%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGR+LTAS SERLLGS SYS    HG +    SELGE+DVWS VD  A+   RGV +S
Sbjct  1    MAKGRRLTASRSERLLGS-SYSYGSGHGPMVNDVSELGEEDVWSMVDDTADRNDRGVHNS  59

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDL----GETTPSGV  531
                WSPR   ES  SFDN      R R+PR + H    G SL FED      +   S +
Sbjct  60   N---WSPRTDLES--SFDNMSISSGRRRIPRDDRHM--GGLSLAFEDSSSGNNKIASSRI  112

Query  532  VHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVP  711
            VHQFRG     + +P   R+++TS PVN+P+WS   RV+SV+S  DSD    N + EMVP
Sbjct  113  VHQFRGNDLVASQSP---RNMATSAPVNVPDWSKIYRVNSVDSCNDSDDGLDNHESEMVP  169

Query  712  PHEYLAREYGRTS---ANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PHEYLAREY +T      S+ EG GRTLKGRDMSRVRDAVWSQTGF G
Sbjct  170  PHEYLAREYAQTQKMGGASVVEGVGRTLKGRDMSRVRDAVWSQTGFYG  217



>ref|XP_002518486.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43873.1| conserved hypothetical protein [Ricinus communis]
Length=221

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 120/231 (52%), Positives = 141/231 (61%), Gaps = 20/231 (9%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRG---V  354
            MAKGR+LTAS SERLLGSY+YSN   H  +    SELGE+DVWS VD   +D  R    +
Sbjct  1    MAKGRRLTASRSERLLGSYTYSNGHGHDMLGTDSSELGEEDVWSMVDDGDDDGDRNDNQL  60

Query  355  DSSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDL--GETTPSG  528
             ++  G+WSPRA  ES  S         R             G SL FED   G+T  S 
Sbjct  61   MNNSQGDWSPRADFESMRSRRRIPRGDDRHVG----------GLSLAFEDSSSGKTASSR  110

Query  529  VVHQFRGQHDGVTAAPTNV--RHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE  702
            +VHQFRG HD V A P     RH++TS PVN+P+WS   RVDSVES +D D      D E
Sbjct  111  IVHQFRGHHDSVAAPPAAASPRHMATSAPVNVPDWSKILRVDSVESLHDLDDGFDEGDSE  170

Query  703  MVPPHEYLAREYGRTSA---NSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            MVPPHEYLAR Y R+      S+ EG GRTLKGRD+ RVRDAVW+QTGF+G
Sbjct  171  MVPPHEYLARVYARSRKMGNASVFEGVGRTLKGRDLRRVRDAVWNQTGFDG  221



>ref|XP_004231609.1| PREDICTED: uncharacterized protein LOC101255844 [Solanum lycopersicum]
Length=215

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 140/226 (62%), Gaps = 16/226 (7%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SER LGSYSY+N +   +      E GEDDVWSTVD M N      D  
Sbjct  1    MAKGRKLTISMSERYLGSYSYNNGN---QTVNETWEFGEDDVWSTVDEMVNAGGGDDDHL  57

Query  364  ESGEWSPRAGSESG-GSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG-VVH  537
             +G  + RA +ES   SF + R  +             DD       D G+ T S  ++H
Sbjct  58   MNGACNSRATAESDVRSFRSSRRCQAGGGSSGGLSLAFDD-------DAGKATSSSRIIH  110

Query  538  QFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPH  717
            QFRGQ D + A     RH+++S PVN+P+WS   RVDSVESF+DSD    + + +M+PPH
Sbjct  111  QFRGQ-DSLAAQSPRGRHMASSAPVNVPDWSKIYRVDSVESFHDSDDGADDHELDMIPPH  169

Query  718  EYLAREYGR---TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            EYLAR YGR   ++ +SM EG GRTLKGRDMSRVRDAVWSQTGF+G
Sbjct  170  EYLARGYGRSRKSTTDSMFEGVGRTLKGRDMSRVRDAVWSQTGFDG  215



>ref|XP_002305577.1| hypothetical protein POPTR_0004s01560g [Populus trichocarpa]
 gb|EEE86088.1| hypothetical protein POPTR_0004s01560g [Populus trichocarpa]
Length=217

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 146/228 (64%), Gaps = 18/228 (8%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGR+LTAS SERLLGS SYS    HG +    SELGE+DVWS VD  A+   RGV +S
Sbjct  1    MAKGRRLTASRSERLLGS-SYSYGSGHGPMVNDVSELGEEDVWSMVDDTADRNDRGVHNS  59

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFED----LGETTPSGV  531
                WSPR   E+  SFDN      R R+PR + H    G SL FED      +   S +
Sbjct  60   N---WSPRTDLEN--SFDNMSISSGRRRIPRDDRHM--GGLSLAFEDSSSGKNKIASSRI  112

Query  532  VHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVP  711
            VHQFRG     + +P   R+++TS PVN+P+WS   RV+SVES  DSD    +++ EMVP
Sbjct  113  VHQFRGNDLVASQSP---RNMATSAPVNVPDWSKIYRVNSVESCNDSDDGLDDQESEMVP  169

Query  712  PHEYLAREYGRTS---ANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PHEYLAREY ++      S+ EG GRTLKGRDMSRVRDAVWSQTGF G
Sbjct  170  PHEYLAREYAQSQKMGGASVVEGVGRTLKGRDMSRVRDAVWSQTGFYG  217



>ref|XP_009785363.1| PREDICTED: uncharacterized protein LOC104233638 [Nicotiana sylvestris]
Length=210

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 139/222 (63%), Gaps = 13/222 (6%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SE LLG+YSY N           SELGEDDVWST+D + N    G D  
Sbjct  1    MAKGRKLTNSRSEMLLGNYSYRNGSE---TVNGSSELGEDDVWSTIDDVVN----GNDHG  53

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGS-SLTFEDLGETTPSGVVHQ  540
              GEWSPRA ++S GSF  F SR+           R   G  SL F+D G+   S ++HQ
Sbjct  54   SRGEWSPRATADSNGSFGGFNSRKQPIPRADHHSRRRQVGGLSLAFDDSGKMASSRILHQ  113

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHE  720
            FRGQ     A      H++TS PVN+P+WS   RV+SVES +DSD    + D EMVPPHE
Sbjct  114  FRGQ----DAPSPRACHMATSAPVNVPDWSKIYRVNSVESLHDSDDCVDDHDSEMVPPHE  169

Query  721  YLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            Y+AR     S +S+ EG GRTLKGRD+SRVRDAVWSQTGF+G
Sbjct  170  YVARSRNLAS-HSVFEGVGRTLKGRDLSRVRDAVWSQTGFDG  210



>ref|XP_006389626.1| hypothetical protein POPTR_0021s00760g [Populus trichocarpa]
 gb|ERP48540.1| hypothetical protein POPTR_0021s00760g [Populus trichocarpa]
Length=209

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 141/235 (60%), Gaps = 40/235 (17%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGS-YSYSNSDSHGRIAGCE--SELGEDDVWSTVDGMANDRRRGV  354
            MAKGR+LT S SERLLGS YSY N    G++      SELGE+DVWS VD  A DR    
Sbjct  1    MAKGRRLTTSRSERLLGSNYSYGN----GQVPMVNEVSELGEEDVWSMVDDTA-DRSDSA  55

Query  355  DSSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDD----GSSLTFEDL----G  510
             S+ +G W+PRA  ES                        DD    G SL FED      
Sbjct  56   VSNSNGAWNPRAELESRRRIPR------------------DDRNMGGLSLAFEDSSSGGN  97

Query  511  ETTPSGVVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHN  690
            +T  S +VHQFRG     +A+P   RH++TS PVN+P+WS   RV+SVES +DSD    +
Sbjct  98   KTASSRIVHQFRGNDLVASASP---RHMATSAPVNVPDWSKIYRVNSVESLHDSDDGFDD  154

Query  691  RDFEMVPPHEYLAREYGR---TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            ++ EMVPPHEYLAREY R   T   S+ EG GRTLKGRDM RVRDAVWSQTGF+G
Sbjct  155  QESEMVPPHEYLAREYARSRKTGGASVVEGVGRTLKGRDMRRVRDAVWSQTGFDG  209



>ref|XP_006363108.1| PREDICTED: uncharacterized protein LOC102599997 isoform X1 [Solanum 
tuberosum]
 ref|XP_006363109.1| PREDICTED: uncharacterized protein LOC102599997 isoform X2 [Solanum 
tuberosum]
Length=212

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 144/229 (63%), Gaps = 25/229 (11%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SER LGSYSY++++   +     SE GEDDVWSTVD +  +   G D  
Sbjct  1    MAKGRKLTISMSERYLGSYSYNHAN---QTVNETSEFGEDDVWSTVDDIVVN---GGDDD  54

Query  364  E--SGEWSPRAGSESG-GSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLG--ETTPSG  528
               +G +  RA +ES  GSF          R  R        G SL F+D     T+ S 
Sbjct  55   HLMNGAFDSRATAESDVGSF----------RSSRQHQAGGGGGLSLAFDDDAGKATSSSR  104

Query  529  VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMV  708
            ++HQFRGQ D + A      H+++S PVN+P+WS   RVDSVESF+DSD    + + +MV
Sbjct  105  IIHQFRGQ-DSLAAQSPRGHHMASSAPVNVPDWSKIYRVDSVESFHDSDDGVDDHELDMV  163

Query  709  PPHEYLAREYGR---TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PPHEYLAR YGR   ++ +SM EG GRTLKGRDMSRVRDAVWSQTGF+G
Sbjct  164  PPHEYLARGYGRSRKSTTDSMFEGVGRTLKGRDMSRVRDAVWSQTGFDG  212



>ref|XP_008224827.1| PREDICTED: uncharacterized protein LOC103324534 [Prunus mume]
Length=205

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 141/222 (64%), Gaps = 18/222 (8%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SERLLG+YS   S SH   A    ELGEDDVWS V+ +       +++S
Sbjct  1    MAKGRKLTQSRSERLLGNYS---SYSH---AHDSPELGEDDVWSMVNTVDEREDPEIENS  54

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG-VVHQ  540
              G+WSPRA +E+ G   + RSRR               G SL F+D G+T  S  +VHQ
Sbjct  55   H-GDWSPRASAETNGGVSSRRSRRIAREDGNVG------GLSLAFDDSGKTASSPRIVHQ  107

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHE  720
            FRG HD V  A     H++TS PVN+P+WS   RVDSV+S Y+ D      D EM+PPHE
Sbjct  108  FRG-HDSV--ASPRAHHMATSAPVNVPDWSKILRVDSVDSLYELDEELDGNDSEMIPPHE  164

Query  721  YLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            YLAREY R  A S+ EG GRTLKGRDM RVRDAVWS+TGF+G
Sbjct  165  YLAREYTR-GATSVFEGVGRTLKGRDMRRVRDAVWSRTGFDG  205



>ref|XP_011096069.1| PREDICTED: uncharacterized protein LOC105175348 [Sesamum indicum]
Length=206

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 143/225 (64%), Gaps = 23/225 (10%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGR-IAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRKLT S SER LGS  ++    HG+  A   SELGE+DVWS VD   N    G D 
Sbjct  1    MAKGRKLTTSRSERFLGSLGHN----HGQGTASDASELGEEDVWSVVDDTVN----GEDH  52

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQ  540
            S +GE+S RA   S G F  +RSRR            L    SL F+D   T+   ++HQ
Sbjct  53   SGNGEFSSRA---SDGVFSVYRSRRPPAPADHHPVGGL----SLAFDDPSNTSSQRILHQ  105

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHE  720
            FR Q D V  +P   RH++TS PVN+P+WS   RV+SVES +D D   +  D E+VPPHE
Sbjct  106  FRPQ-DSVAESPRG-RHMATSAPVNVPDWSKIYRVNSVESLHDLDDSFN--DSELVPPHE  161

Query  721  YLAREYGR---TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            YLAREY R   T+ANS+ EG GRTLKGRDMSRVRDAVWSQTGF+G
Sbjct  162  YLAREYARSRKTAANSVFEGVGRTLKGRDMSRVRDAVWSQTGFDG  206



>ref|XP_006348114.1| PREDICTED: uncharacterized protein LOC102595538 [Solanum tuberosum]
Length=207

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 137/222 (62%), Gaps = 16/222 (7%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSY-SYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRKL  S SE LLG+Y SY N  +        SELGEDD+WSTVD M        D 
Sbjct  1    MAKGRKLATSRSEMLLGNYPSYRNGTA---TLNGSSELGEDDIWSTVDDMD-------DH  50

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQ  540
               GEWSPRA  ES   + N +    +     +   R   G SL F+D G+T    ++HQ
Sbjct  51   DSRGEWSPRAADESNNGYVNRKLPVQQSDHHHSRRGRQVGGLSLAFDDSGKTASPRILHQ  110

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHE  720
            FRGQ     A  T V H++TS PVN+P+WS   RV+SVES +DSD    + D EMVPPHE
Sbjct  111  FRGQ----DAPSTRVAHMATSAPVNVPDWSKIYRVNSVESLHDSDDGVDDHDSEMVPPHE  166

Query  721  YLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            Y+AR    ++A S+ EG GRTLKGRD+SRVRDAVWSQTGF+G
Sbjct  167  YIARSRN-SNARSVFEGVGRTLKGRDLSRVRDAVWSQTGFDG  207



>ref|XP_008371092.1| PREDICTED: uncharacterized protein LOC103434506 [Malus domestica]
Length=205

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 141/226 (62%), Gaps = 26/226 (12%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSY-SYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRKLT S SERLLG+Y SYS+       A    ELGEDDVWS V+ + ++R      
Sbjct  1    MAKGRKLTQSRSERLLGTYGSYSH-------AHDSPELGEDDVWSMVNSV-DEREDHETE  52

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDD---GSSLTFEDLGETTPSG-  528
            +  GEWSPRA  ES G                    R DD   G SL F+D G+T  S  
Sbjct  53   NSQGEWSPRAVPESNGGV---------QVRRGHRIPRXDDSVGGLSLAFDDSGKTVSSPR  103

Query  529  VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMV  708
            +VHQFRG HD + A+P    H++TS P+N+P+WS   RVDSV+S YD D      + E++
Sbjct  104  IVHQFRG-HDSM-ASPGG-HHIATSAPMNVPDWSKILRVDSVDSLYDXDDGLDGNNSEII  160

Query  709  PPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PPHEYLAREY R  A S+ EG GRTLKGRDMSRVRDAVWS+TGF+G
Sbjct  161  PPHEYLAREYTR-GATSVFEGVGRTLKGRDMSRVRDAVWSRTGFDG  205



>ref|XP_009360958.1| PREDICTED: uncharacterized protein LOC103951301 [Pyrus x bretschneideri]
Length=205

 Score =   177 bits (448),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 143/227 (63%), Gaps = 28/227 (12%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSY-SYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRKLT S SERLLG+Y SYS+       A    ELGEDDVWS V+ + ++R      
Sbjct  1    MAKGRKLTQSRSERLLGTYGSYSH-------AHDSPELGEDDVWSMVNSV-DEREDHETE  52

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDD----GSSLTFEDLGETTPS-  525
            +  GEWSPRA  ES G            +V R      DD    G SL F+D G+T  S 
Sbjct  53   NLQGEWSPRAVPESNGGV----------QVRRGHRIPRDDHNVGGLSLAFDDSGKTVSSP  102

Query  526  GVVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEM  705
            G+VHQFRG HD + A+P    H++TS PVN+P+WS   RVDSV+S YD +      D E+
Sbjct  103  GIVHQFRG-HDSM-ASPGG-HHMATSAPVNVPDWSKILRVDSVDSLYDMNDGLDGNDSEV  159

Query  706  VPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            +PPHEYLAREY R  A S+ EG GRTLKGRDM RVRDAVWS+TGF+G
Sbjct  160  IPPHEYLAREYTR-GAPSVFEGVGRTLKGRDMRRVRDAVWSRTGFDG  205



>ref|XP_004232713.1| PREDICTED: uncharacterized protein LOC101253959 [Solanum lycopersicum]
Length=206

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 138/222 (62%), Gaps = 17/222 (8%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSY-SYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRKL  S SE LLG+Y SY N  +        SELGEDDVW+TVD M        D 
Sbjct  1    MAKGRKLATSRSEMLLGNYPSYRNGTA---TVNGSSELGEDDVWATVDDMD-------DH  50

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQ  540
               GEWSPRA +E    + N + ++           ++  G SL F+D G+T    ++HQ
Sbjct  51   DSRGEWSPRAAAEGNNGYVNRKVQQSDHHHHSHRGRQVG-GLSLAFDDSGKTASPRILHQ  109

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHE  720
            FRGQ     A    V H++TS PVN+P+WS   RV+SVES +DSD    + D EMVPPHE
Sbjct  110  FRGQ----DAPSPRVAHMATSAPVNVPDWSKIYRVNSVESLHDSDDGVDDHDSEMVPPHE  165

Query  721  YLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            Y+AR    ++A+S+ EG GRTLKGRD+SRVRDAVWSQTGF+G
Sbjct  166  YIARSRN-SNAHSVFEGVGRTLKGRDLSRVRDAVWSQTGFDG  206



>ref|XP_004293285.1| PREDICTED: uncharacterized protein LOC101291898 [Fragaria vesca 
subsp. vesca]
Length=209

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 141/231 (61%), Gaps = 32/231 (14%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SER LGSYS   S SH   A    EL EDDVWS V+ +       VDSS
Sbjct  1    MAKGRKLTQSRSERFLGSYS---SYSH---AQESPELAEDDVWSMVESVEEREDNEVDSS  54

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDD-------GSSLTF-EDLGETT  519
            +S EWSPR  +E+ G F          R  R+     DD       G SL F +D G+T 
Sbjct  55   QS-EWSPRVAAETNGGF--------AARGIRSRRISRDDDNNVSGGGLSLAFVDDSGKTA  105

Query  520  PSG-VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYD-SDSHTHNR  693
             S  +VHQFRG HD         RH++TS+P+N+P+WS   RVDSV+S Y+  D    + 
Sbjct  106  SSPRIVHQFRG-HDSPRG-----RHMATSLPMNVPDWSKILRVDSVDSLYEFDDGMDSSN  159

Query  694  DFEMVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            D EM+PPHEYLAREY R  A S+ EG GRTLKGRDM RVRDAVWS+TGF+G
Sbjct  160  DPEMIPPHEYLAREYTR-GATSVFEGVGRTLKGRDMRRVRDAVWSRTGFDG  209



>ref|XP_008384072.1| PREDICTED: uncharacterized protein LOC103446718 [Malus domestica]
Length=205

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 138/227 (61%), Gaps = 28/227 (12%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYS-YSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRKLT S SERLLG+YS YS+       A    ELGEDDVWS V+ + ++R      
Sbjct  1    MAKGRKLTQSRSERLLGTYSGYSH-------AHDSPELGEDDVWSMVNSV-DEREDHETE  52

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDD----GSSLTFEDLGETTPSG  528
            +  GEWSP A          F       +  +  H   DD    G SL F+D G+T  S 
Sbjct  53   NSQGEWSPHA----------FPESTVGIQARKGRHIARDDRNVGGLSLAFDDSGKTASSP  102

Query  529  -VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEM  705
             +VHQFRG HD V A+P    H++TS PVN+P+WS   RVDSV+S Y+        D EM
Sbjct  103  RIVHQFRG-HDSV-ASPRG-HHMATSAPVNVPDWSKILRVDSVDSLYEMGDGLDGNDSEM  159

Query  706  VPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            +PPHEYLARE+ R  A S+ EG GRTLKGRDM RVRDAVWS+TGF+G
Sbjct  160  IPPHEYLAREHTR-GATSVFEGVGRTLKGRDMRRVRDAVWSRTGFDG  205



>ref|XP_010276081.1| PREDICTED: uncharacterized protein LOC104610921 [Nelumbo nucifera]
Length=211

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 136/227 (60%), Gaps = 22/227 (10%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRR--RGVD  357
            MAKGRKL +S  ERLLG+ SY     +G  A   SELGE+DVWS VD M +     R V 
Sbjct  1    MAKGRKLGSSHHERLLGTLSYGAGQQNGTDA---SELGEEDVWSMVDDMVDRDDHTRNVA  57

Query  358  SSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG-VV  534
             SE    +P +  + G     + +R  R             G SL F D G+TTPS  +V
Sbjct  58   PSEWASMAPESNGDRGIRSRRWVAREDRHVG----------GLSLAFNDAGKTTPSSRIV  107

Query  535  HQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPP  714
            HQFR Q +   AAP    H++ S PVN+P+W    RVDSVES  DSD    + D E +PP
Sbjct  108  HQFRPQDN--VAAPRG-HHMAASAPVNVPDWPKILRVDSVESLQDSDDGIEDHDAEWIPP  164

Query  715  HEYLAREYGRT---SANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            HEYLAREY RT   +A S+ EG GRTLKGRDMSRVRDAVWSQTGF+G
Sbjct  165  HEYLAREYARTRKMTATSVFEGVGRTLKGRDMSRVRDAVWSQTGFDG  211



>ref|XP_009357584.1| PREDICTED: uncharacterized protein LOC103948301 [Pyrus x bretschneideri]
Length=205

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 136/222 (61%), Gaps = 18/222 (8%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SE+LLG+YS   S SH   A    ELGEDDVWS V+  A++R    +  
Sbjct  1    MAKGRKLTQSRSEQLLGTYS---SYSH---AHDSPELGEDDVWSMVNS-ADEREDHENED  53

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVV-HQ  540
              GEWSP A  ES G     R RR               G SL F+D G+T  S  V HQ
Sbjct  54   SQGEWSPHAFPESNGGIQARRGRRIARDDRNVG------GLSLAFDDSGKTVSSPRVGHQ  107

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHE  720
            FRG HD V A+P    H++TS PVN+P+WS   RVDSV+S Y+        D EM+PPHE
Sbjct  108  FRG-HDSV-ASPRG-HHVATSAPVNVPDWSKILRVDSVDSLYEMGDGLDGNDSEMIPPHE  164

Query  721  YLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            YLARE  R  A S+ EG GRTLKGRDM RVRDAVWS+TGF+G
Sbjct  165  YLARESTR-GATSVFEGVGRTLKGRDMRRVRDAVWSRTGFDG  205



>gb|EYU33892.1| hypothetical protein MIMGU_mgv1a013450mg [Erythranthe guttata]
Length=220

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 138/229 (60%), Gaps = 17/229 (7%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVD--GMANDRRRGVD  357
            MAKGRKLT S SE  LGS+SYS+   HG  A   SEL ED+VWS VD     N+    V 
Sbjct  1    MAKGRKLTTSRSELYLGSFSYSHG--HGAAANGSSELREDEVWSMVDDESAVNE----VT  54

Query  358  SSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDD--GSSLTFEDLGETTPSG-  528
               S EWS RA  ES GS       R    +    HHR     G SL F++      S  
Sbjct  55   YPASSEWSTRASVESNGSLSGSYKSRRPNPLTDHHHHRRRHVGGLSLAFDNSSSNASSPR  114

Query  529  VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMV  708
            +VHQFR   D +  +P   RH+++S PVN+P+WS   RV+SVES  DSD   ++ D E+V
Sbjct  115  IVHQFRPP-DSMAESP-RARHVASSAPVNVPDWSKIYRVNSVESMQDSDDGMYD-DSEVV  171

Query  709  PPHEYLAREYGRTS---ANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PPHEYLAREY R+    ANS+ EG GR LKGRD+SRVRD VWSQTGF+G
Sbjct  172  PPHEYLAREYARSRKMVANSVFEGVGRKLKGRDLSRVRDTVWSQTGFDG  220



>ref|XP_004486158.1| PREDICTED: uncharacterized protein LOC101500992 [Cicer arietinum]
Length=211

 Score =   167 bits (422),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 142/228 (62%), Gaps = 24/228 (11%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SERLLG+Y+YS +   G +A   SEL E+D+WST    A++     D +
Sbjct  1    MAKGRKLTTSRSERLLGTYAYSYN--QGSVAADPSELREEDIWSTTGDSADN-----DLN  53

Query  364  ESGEWSPR--AGSESGG--SFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG-  528
             S +W P+  A SES G  S+ N R         R        G SL FED    T +  
Sbjct  54   TSDDWEPQHAATSESNGGSSYRNRRRISQNGDDHRQIG-----GLSLAFEDPASNTATMT  108

Query  529  --VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE  702
              +VHQFR  H+ V ++P   RH+++S+PVN+P+WS   RVDSVES +D D    +   E
Sbjct  109  ARIVHQFRS-HESVASSPRG-RHVASSLPVNVPDWSKILRVDSVESLHDDDVDDDD--LE  164

Query  703  MVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            MVPPHEYLAR   + +A S+ EG GRTLKGRD+SRVRDAVWSQTGF+G
Sbjct  165  MVPPHEYLARSR-KMAAKSVFEGVGRTLKGRDLSRVRDAVWSQTGFDG  211



>ref|XP_010093287.1| hypothetical protein L484_006301 [Morus notabilis]
 gb|EXB53812.1| hypothetical protein L484_006301 [Morus notabilis]
Length=211

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 140/228 (61%), Gaps = 24/228 (11%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYS-YSNSD-SHGRIAGCESELGEDDVWSTVDGMANDRRRGVD  357
            MAKGRKLT S SERLLGSY  Y +S+ S G      +ELGE+D+WS V+          D
Sbjct  1    MAKGRKLTTSRSERLLGSYGGYGHSETSTGTGTESSAELGEEDIWSMVE----------D  50

Query  358  SSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVH  537
            ++E  + +   G  SGG   N   R          H     G SL F D  +T  S +VH
Sbjct  51   AAERVDHAATNGC-SGGDGGNISIRNRGRIHRDDRHVG---GLSLAF-DSSKTASSRIVH  105

Query  538  QFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESF--YDSDSHTHNRDFEMVP  711
            QFRG +DGV++ P   RH++TS PVN+P+WS   RVDSV+S    D D   +  D E+VP
Sbjct  106  QFRG-NDGVSS-PRGGRHMATSAPVNVPDWSKILRVDSVDSLPELDEDFGDYGGDSEIVP  163

Query  712  PHEYLAREYG---RTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PHEYLAREY    +T+ANS+ EG GRTLKGRDMSRVRDAVW QTGF+G
Sbjct  164  PHEYLAREYAHSRKTAANSVFEGVGRTLKGRDMSRVRDAVWRQTGFDG  211



>gb|EYU27793.1| hypothetical protein MIMGU_mgv1a027068mg [Erythranthe guttata]
Length=216

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 133/226 (59%), Gaps = 15/226 (7%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SE  LG+  Y N    G      +ELGE+DVWS     A+D   G D S
Sbjct  1    MAKGRKLTTSRSELFLGNSGY-NYQVQG-AGDTAAELGEEDVWSAA---ADDTVDGDDHS  55

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETT-PSGVVHQ  540
            E G +S RA ++S GSF +      +             G S  F++ G TT P  ++HQ
Sbjct  56   EYGGFSSRASTQSNGSFSSSYRSHRQASRADGHQVG---GLSFAFDNFGNTTSPQTILHQ  112

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHE  720
            +  Q      +P   RH++ S PVN+P+WS   RV+SVES +DSD +  N   ++VPPHE
Sbjct  113  YHPQGSAAAQSPRG-RHVANSAPVNVPDWSKIYRVNSVESLHDSDDYCFNEP-DLVPPHE  170

Query  721  YL-AREYG---RTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            YL AREY    + +A S+ EG GRTLKGRD SRVRDAVWSQTGF+G
Sbjct  171  YLAAREYASSHKMAAYSVFEGVGRTLKGRDASRVRDAVWSQTGFDG  216



>gb|AFK48551.1| unknown [Medicago truncatula]
Length=218

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 138/232 (59%), Gaps = 25/232 (11%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SER LG+Y YS++ S    A   SEL E+D+WST  G        VD +
Sbjct  1    MAKGRKLTTSRSERFLGTYGYSHNQSSA-AAAEPSELREEDIWSTDVGSGE-----VDLN  54

Query  364  ESGEW-SPRA------GSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTP  522
             S EW SP A      G  SG S+ N           R        G SL FED   ++ 
Sbjct  55   FSDEWESPNAETVEIIGGGSGSSYRNRHRITQNSDEHRQLG-----GLSLAFEDPVNSST  109

Query  523  SG---VVHQFRGQHDGVTAAPTNV-RHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHN  690
                 +VHQFR  HDGV ++P+   RH++TS+PVN+P+WS   RVDSVES +D      +
Sbjct  110  VATARIVHQFRA-HDGVASSPSARGRHMATSLPVNVPDWSKILRVDSVESLHDDSFDDDD  168

Query  691  RDFEMVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
               EMVPPHEYLAR   + +A S+ EG GRTLKGRD+SRVRDAVWSQTGF+G
Sbjct  169  ES-EMVPPHEYLARSR-KNAAKSVFEGVGRTLKGRDLSRVRDAVWSQTGFDG  218



>gb|KEH36847.1| senescence regulator [Medicago truncatula]
Length=218

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 138/232 (59%), Gaps = 25/232 (11%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SER LG+Y YS++ S    A   SEL E+D+WST  G        VD +
Sbjct  1    MAKGRKLTTSRSERFLGTYGYSHNQSSA-AAADPSELREEDIWSTDVGSGE-----VDLN  54

Query  364  ESGEW-SPRA------GSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTP  522
             S EW SP A      G  SG S+ N           R        G SL FED   ++ 
Sbjct  55   FSDEWESPNAETVEIIGGGSGSSYRNRHRITQNSDEHRQLG-----GLSLAFEDPVNSST  109

Query  523  SG---VVHQFRGQHDGVTAAPTNV-RHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHN  690
                 +VHQFR  HDGV ++P+   RH++TS+PVN+P+WS   RVDSVES +D      +
Sbjct  110  VATARIVHQFRA-HDGVASSPSARGRHMATSLPVNVPDWSKILRVDSVESLHDDSFDDDD  168

Query  691  RDFEMVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
               EMVPPHEYLAR   + +A S+ EG GRTLKGRD+SRVRDAVWSQTGF+G
Sbjct  169  ES-EMVPPHEYLARSR-KNAAKSVFEGVGRTLKGRDLSRVRDAVWSQTGFDG  218



>gb|EPS57709.1| hypothetical protein M569_17108 [Genlisea aurea]
Length=187

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 130/224 (58%), Gaps = 40/224 (18%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRK+  S +ER LGS +YS+    G   G   EL ED+VW+ VDG            
Sbjct  1    MAKGRKIPTSRNERYLGSLAYSHGQGTG---GNSPELDEDEVWAVVDG------------  45

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
             S  W  RAG +  G     R+                   SL F+D G +  S +VHQF
Sbjct  46   -SEAWDSRAGMDVHGGGGYRRAGGL----------------SLAFDDSGGSA-SRIVHQF  87

Query  544  RGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEY  723
            R +HD     P N R ++TS PVN+P+WS   RVD +ES  DSD +T N   E+VPPHEY
Sbjct  88   R-RHDAAPETPRN-RSMATSAPVNVPDWSKVYRVDCLESLPDSD-YTLNVS-EIVPPHEY  143

Query  724  LAREYGR---TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            LAREY R   T+ANS+ EG GRTLKGRDMSRVRDAVWSQTGF+G
Sbjct  144  LAREYARSRRTAANSVFEGVGRTLKGRDMSRVRDAVWSQTGFDG  187



>ref|XP_003546150.1| PREDICTED: uncharacterized protein LOC100796798 [Glycine max]
Length=193

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 130/221 (59%), Gaps = 28/221 (13%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SER LG+Y+YS     G  A   SEL E+DVW   D  A DR       
Sbjct  1    MAKGRKLTTSRSERFLGTYAYS----QGSAALNPSELREEDVWGAGDD-AGDR-------  48

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
               EW P A +      +N    R R      EH R+  G SL FE     +   +VHQF
Sbjct  49   ---EWEPHAAA-----LNNSGVSRRRIPRDTEEHRRVG-GLSLAFEAPASGSSPRMVHQF  99

Query  544  RGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEY  723
            R + + +T+ P   RH++TS PVN+P+WS   RVDSVES  D D      + EM+PPHEY
Sbjct  100  RAREE-MTSTPRG-RHMATSAPVNVPDWSKILRVDSVESINDEDGD----ESEMMPPHEY  153

Query  724  LAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            LAR   +  ANS+ EG GRTLKGRD+SRVRDAVW+QTGF+G
Sbjct  154  LARSQ-KMVANSVFEGVGRTLKGRDLSRVRDAVWNQTGFDG  193



>ref|XP_008439981.1| PREDICTED: uncharacterized protein LOC103484606 [Cucumis melo]
Length=211

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 124/225 (55%), Gaps = 18/225 (8%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SER LGSY+Y++S   G      SELGE+DVW  VD +  +R    + +
Sbjct  1    MAKGRKLTTSRSERFLGSYTYNHS--QGSTGSDSSELGEEDVWPMVDSVETEREEFSEEN  58

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDD----GSSLTFEDLGETTPSGV  531
                +        GG   N        R          +    G SL FED    T + +
Sbjct  59   SLAAY--------GGGGINISHGGISVRRGSGVPVDTRERHVGGLSLAFEDPSRMTSARI  110

Query  532  VHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVP  711
            VHQFRG     T A    R ++TS PVN+P+WS   RVDSVES  + D    + D E+VP
Sbjct  111  VHQFRGND---TVASPRGRQMATSAPVNVPDWSKILRVDSVESLQEFDEPLDDPDSEIVP  167

Query  712  PHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PHEYLAR   + +A S+  G GRTLKGRD+ RVRDAVW QTGF+G
Sbjct  168  PHEYLARSR-KKNATSVFVGVGRTLKGRDLRRVRDAVWMQTGFDG  211



>ref|XP_006594426.1| PREDICTED: uncharacterized protein LOC100798894 [Glycine max]
Length=195

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 124/223 (56%), Gaps = 30/223 (13%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SER LG+Y+YS     G  A   SEL E+DVW            G D+ 
Sbjct  1    MAKGRKLTTSRSERFLGTYAYS----QGSAAVNPSELREEDVWGA----------GDDAG  46

Query  364  ESGEWSPR--AGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVH  537
            E  EW P   A S  GGS           R           G SL FE         +VH
Sbjct  47   ER-EWDPHFAAMSNGGGSRRRIPRDTDVHRRVG--------GLSLAFEAPASGASPRIVH  97

Query  538  QFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPH  717
            QFR + +   A+   VRH++TS P+N+P+WS   RVDSV+S   +D +    + EMVPPH
Sbjct  98   QFRAREE--MASTPRVRHMATSAPMNVPDWSKILRVDSVDSL--NDDYNDEDESEMVPPH  153

Query  718  EYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            EYLAR      ANS+ EG GRTLKGRD+SRVRDAVWSQTGF+G
Sbjct  154  EYLARSQTMV-ANSVFEGVGRTLKGRDLSRVRDAVWSQTGFDG  195



>ref|XP_004155601.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101218032 
[Cucumis sativus]
Length=211

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 124/234 (53%), Gaps = 36/234 (15%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRR-----  348
            MAKGRKLT S SER LGSY+Y+++   G      SELGE+DVW  VD +  +R       
Sbjct  1    MAKGRKLTTSRSERFLGSYTYNHN--QGSTGSDSSELGEEDVWPMVDSVETEREEFSEEN  58

Query  349  --------GVDSSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFED  504
                    G++ S  G    R     G + +                     G SL FED
Sbjct  59   SLAGYDGGGINISHGGIPVRRGSGVPGDTRERHVG-----------------GLSLAFED  101

Query  505  LGETTPSGVVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHT  684
                T + +VHQFRG     T A    R ++TS PVN+P+WS   RVDSV+S  + D   
Sbjct  102  PSRKTSARIVHQFRGND---TVASPRGRQMATSAPVNVPDWSKILRVDSVDSLQEFDEPL  158

Query  685  HNRDFEMVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             + + E+VPPHEYLAR   R  A S+  G GRTLKGRD+ RVRDAVW QTGF+G
Sbjct  159  DDPESEIVPPHEYLARSRKR-XATSVFVGVGRTLKGRDLRRVRDAVWMQTGFDG  211



>ref|XP_007153942.1| hypothetical protein PHAVU_003G078300g [Phaseolus vulgaris]
 gb|ESW25936.1| hypothetical protein PHAVU_003G078300g [Phaseolus vulgaris]
Length=225

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 103/229 (45%), Positives = 129/229 (56%), Gaps = 29/229 (13%)
 Frame = +1

Query  178  TKMAKGRKL-TASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGV  354
             +MAKGRK  T + SER LG+ +YS   S G  A   SE  E+DVWST +      R G 
Sbjct  20   AQMAKGRKFPTTARSERFLGT-TYS---SQGSAAVEPSEFREEDVWSTPED-----REGD  70

Query  355  DSSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG--  528
              +  G+W PR       S +    R                G SL FE+   +   G  
Sbjct  71   FKASPGQWEPREWPRRRNSREQQVHRHVG-------------GLSLAFENPNGSGGGGAT  117

Query  529  --VVHQFRGQHDGVTAAPTNVRH-LSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDF  699
              V HQ+R QHD V+++P    H ++TS PVN+P+WS   R DSVES ++ D    + D 
Sbjct  118  RIVHHQYRAQHDTVSSSPRGRHHQMATSAPVNVPDWSKILRADSVESLHEMDVAFDDNDS  177

Query  700  EMVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            EMVPPHEYLAR   + +ANS+ EG GRTLKGRDM RVRDAVWSQTGF+G
Sbjct  178  EMVPPHEYLARSR-QMAANSVFEGVGRTLKGRDMRRVRDAVWSQTGFDG  225



>ref|XP_004134758.1| PREDICTED: uncharacterized protein LOC101218032 [Cucumis sativus]
 gb|KGN49115.1| hypothetical protein Csa_6G513790 [Cucumis sativus]
Length=211

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/234 (42%), Positives = 125/234 (53%), Gaps = 36/234 (15%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRR-----  348
            MAKGRKLT S SER LGSY+Y+++   G      SELGE+DVW  VD +  +R       
Sbjct  1    MAKGRKLTTSRSERFLGSYTYNHN--QGSTGSDSSELGEEDVWPMVDSVETEREEFSEEN  58

Query  349  --------GVDSSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFED  504
                    G++ S  G    R     G + +                     G SL FED
Sbjct  59   SLAGYDGGGINISHGGIPVRRGSGVPGDTRERHVG-----------------GLSLAFED  101

Query  505  LGETTPSGVVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHT  684
                T + +VHQFRG     T A    R ++TS PVN+P+WS   RVDSV+S  + D   
Sbjct  102  PSRKTSARIVHQFRGND---TVASPRGRQMATSAPVNVPDWSKILRVDSVDSLQEFDEPL  158

Query  685  HNRDFEMVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             + + E+VPPHEYLAR   + +A S+  G GRTLKGRD+ RVRDAVW QTGF+G
Sbjct  159  DDPESEIVPPHEYLARSR-KKNATSVFVGVGRTLKGRDLRRVRDAVWMQTGFDG  211



>ref|XP_010686848.1| PREDICTED: uncharacterized protein LOC104901003 [Beta vulgaris 
subsp. vulgaris]
Length=225

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 107/233 (46%), Positives = 128/233 (55%), Gaps = 20/233 (9%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLG--SYSYSNSDSHGRIAGCE--------SELGEDDVWSTVDGMA  333
            MAKGR+LT+S SER LG  SY+Y N   H    G          SE  E DVW   D ++
Sbjct  1    MAKGRRLTSSLSERFLGTESYNYYNHHVHDHDHGYHGNGTVSEVSEFEEVDVWPMEDDVS  60

Query  334  NDRRRGVDSSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGE  513
             +      ++   EWSPRA  ESG      R R     V   E  R   G SL F+D   
Sbjct  61   ENHHHLHHNNLQREWSPRATVESG------RRRVIANNVKCQEEERHVGGLSLAFDDKTA  114

Query  514  TTPSGVVHQFRGQ--HDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTH  687
             +   ++HQF G     G      N RH++TS PVN+P+WS   RV+SVES +DSD    
Sbjct  115  PSSRRILHQFGGATGSGGARVVGPN-RHMATSAPVNVPDWSKILRVNSVESMHDSDEDDR  173

Query  688  NRDFEMVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
              D  M PPHEYLAR   + +A S+ EG GRTLKGRDMSRVRDAVWSQTGF G
Sbjct  174  VSDSAMEPPHEYLARSR-QKNAFSVFEGVGRTLKGRDMSRVRDAVWSQTGFEG  225



>ref|XP_010057926.1| PREDICTED: uncharacterized protein LOC104445711 [Eucalyptus grandis]
Length=224

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 109/238 (46%), Positives = 134/238 (56%), Gaps = 31/238 (13%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHG----RIAGCESELGEDDVWSTVDGMANDRRR-  348
            MAKGR+LT+S SERLLGSY Y +   HG          +E  EDDVWS  DG   D  R 
Sbjct  1    MAKGRRLTSSRSERLLGSYGYGH---HGFGAAANGNDAAEFDEDDVWSAADGGGADAMRE  57

Query  349  --GVDSSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTP  522
              G++ S+ G W+  A  + GG        R                 S  FED G    
Sbjct  58   DGGMEGSQLG-WATLAAEDGGGGGGGGGGGRRSRTARGGL--------SFAFEDSGVRPS  108

Query  523  SGVVHQFRGQHDGVTAAPTNVR-----HLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTH  687
            S +VHQFRG  +   AA ++ R     H++TS PVN+P+WS   RV SVES +DSD    
Sbjct  109  SRIVHQFRG--NDAAAASSSPRGGHGHHMATSAPVNVPDWSKIYRVGSVESMHDSDEGLD  166

Query  688  NRDFE--MVPPHEYLAREYGRT---SANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            +   +  MVPPHEYLAREY R+   +A S+ EG GRTLKGRDM R+RDAVWSQTGF+G
Sbjct  167  DGGGDAGMVPPHEYLAREYARSQKSAATSVFEGVGRTLKGRDMRRMRDAVWSQTGFDG  224



>ref|XP_010278697.1| PREDICTED: uncharacterized protein LOC104612810 [Nelumbo nucifera]
Length=212

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 129/228 (57%), Gaps = 23/228 (10%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRR--RGVD  357
            M KGRKL  +  +RLLGS  Y   + +G+ A    ELGE+DVWS VD M +     R V 
Sbjct  1    MVKGRKLGPN-HQRLLGSLGYGAGEDNGKDA---PELGEEDVWSMVDDMVDRDDHTRNVA  56

Query  358  SSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG-VV  534
            ++E G        + G     +  R  R           +DG S        T+PS  +V
Sbjct  57   ATEWGSLGAENNGDRGIRPQRWMGREDRDDHVGGLSLAFNDGRS-------RTSPSPRIV  109

Query  535  HQFRGQHDGVTAAPTNVRH-LSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVP  711
            HQFR Q +  +      RH ++ S PVN+P+W    RVDSVES +DSD    + D E +P
Sbjct  110  HQFRSQENMASQ-----RHNMAASAPVNVPDWPRIFRVDSVESMHDSDDGIEDHDGERIP  164

Query  712  PHEYLAREYGRT---SANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PHEYLAREY RT   +  S+ EGAGRTLKGRDMSRVRDAVWSQTGF+G
Sbjct  165  PHEYLAREYARTRKMTPTSVFEGAGRTLKGRDMSRVRDAVWSQTGFDG  212



>ref|XP_007147731.1| hypothetical protein PHAVU_006G150000g [Phaseolus vulgaris]
 gb|ESW19725.1| hypothetical protein PHAVU_006G150000g [Phaseolus vulgaris]
Length=255

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 125/221 (57%), Gaps = 25/221 (11%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SER LG+Y Y NS   G  A   SEL E+D+WST D          DS 
Sbjct  60   MAKGRKLTTSRSERFLGTYEYVNS--RGSAAVEPSELREEDIWSTGD----------DSG  107

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
            E  EW     S S G     R  R R    R        G SL FE     +   +VHQ+
Sbjct  108  EV-EWEQHVSSGSNGGDHQRRIPRDREDHRRV------GGLSLAFEAPASGSSQRIVHQY  160

Query  544  RGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEY  723
            R + +   AA    RH++TS PVN+P+WS   RVDSVES  D +    +   EM PPHEY
Sbjct  161  RAREE--MAATPRGRHVATSAPVNVPDWSKILRVDSVESMNDEEEDDES---EMEPPHEY  215

Query  724  LAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            LAR   +  ANS+ EG GRTLKGRD+SRVRDAVWSQTGF+G
Sbjct  216  LARSQ-KMVANSVFEGVGRTLKGRDLSRVRDAVWSQTGFDG  255



>ref|XP_003529631.2| PREDICTED: uncharacterized protein LOC100815796 [Glycine max]
Length=231

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/226 (44%), Positives = 120/226 (53%), Gaps = 31/226 (14%)
 Frame = +1

Query  184  MAKGRKL-TASWSERLLG---SYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRG  351
            MAKGRK  T + SER LG     + +   S G  A   SE  E+DVWST +      R G
Sbjct  32   MAKGRKFPTTTGSERFLGLGMGTTTTTYSSQGSAAADRSEFWEEDVWSTAE-----HRDG  86

Query  352  VDSSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGV  531
              ++  GEW   A      + +N                    G SL FED        V
Sbjct  87   DVNACPGEWEACAPPRRRNNRENCNVG----------------GLSLAFEDGSGGGTRIV  130

Query  532  VHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYD-SDSHTHNRDFEMV  708
             HQ+R QHD V+      R ++TS PVN+P+WS   R DSVES +   D    N + EMV
Sbjct  131  HHQYRAQHDAVS----RQRQMATSAPVNVPDWSKILRADSVESLHGMDDGFDENNESEMV  186

Query  709  PPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PPHEYLAR   + +ANS+ EG GRTLKGRDM RVRDAVWSQTGF+G
Sbjct  187  PPHEYLARSR-KMAANSVFEGVGRTLKGRDMRRVRDAVWSQTGFDG  231



>gb|KFK43441.1| hypothetical protein AALP_AA1G125700 [Arabis alpina]
Length=203

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 123/232 (53%), Gaps = 40/232 (17%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MA+GRKLT S SER LGS SYS  DS+G     ESEL E+++WS     + +     D +
Sbjct  1    MARGRKLTMSQSERYLGS-SYSYGDSNGNSVTDESELTEEEIWSHAVDHSPE-----DLT  54

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
            E G WSPRA     G                    R+  G SL FED    +   +VHQ 
Sbjct  55   EIGAWSPRASVSRNG--------------------RVGGGLSLAFEDT--LSSPRIVHQI  92

Query  544  RGQHDGVTAAPT--NVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPH  717
            RG            N R L++S PVN+P+WS   RV+SVES ++S+      D  M+PPH
Sbjct  93   RGGGVEGGGGGGGGNRRQLASSAPVNVPDWSKIYRVNSVESIHESEEEDDE-DSGMMPPH  151

Query  718  EYLAREYGRTSANS---------MCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            EYLA+   R S  S         + EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  152  EYLAKSQKRRSRKSGGGVGGGASVLEGVGRTLKGRELRRVRDAIWSQTGFYG  203



>ref|XP_003550491.2| PREDICTED: uncharacterized protein LOC100813375 [Glycine max]
Length=213

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 123/223 (55%), Gaps = 29/223 (13%)
 Frame = +1

Query  184  MAKGRKL-TASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRK  T + ++R LG  +YS   S    A   SE  E+DVWST    + DR R V++
Sbjct  18   MAKGRKFPTTTRTDRFLGMGTYS---SQASAATDLSEFREEDVWST----SEDRDRDVNA  70

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVV-H  537
               GEW   A      S +    R                G SL FED      + +V H
Sbjct  71   Y-PGEWEALAPPRRRSSRELQGHRHVG-------------GLSLAFEDGSGGAGTRIVHH  116

Query  538  QFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPH  717
            Q+R QHD V    ++   ++TS PVN+P+WS   RVDS+    D     +N + EMVPPH
Sbjct  117  QYRAQHDAV----SHQHQMATSAPVNVPDWSKILRVDSLHEM-DDVFDDNNNESEMVPPH  171

Query  718  EYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            EYLAR   + +ANS+ EG GRTLKGRDM RVRDAVWSQTGF+G
Sbjct  172  EYLARSR-KMAANSVFEGVGRTLKGRDMRRVRDAVWSQTGFDG  213



>ref|XP_010052839.1| PREDICTED: uncharacterized protein LOC104441399 [Eucalyptus grandis]
Length=230

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 124/238 (52%), Gaps = 25/238 (11%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGR+LT S SER LGSYSY +       A   SELGE+D+WS VD MA     G    
Sbjct  1    MAKGRRLTVSLSERYLGSYSYGDGGRGAGGA-DASELGEEDIWSAVDDMAPA---GAAGD  56

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGS-----SLTFEDLGETTPSG  528
              G W+P A + S    D  R       V         DG      SL   D G      
Sbjct  57   PQGAWTPPAANGS----DGSRGVGVGVGVGSGGLEIPRDGRRAGGLSLALVDSGAAAAPS  112

Query  529  ----VVHQFRGQHDGVTAAPTNV-----RHLSTSVPVNIPNWSNFNRVDSVESFYDSDSH  681
                +VHQFRG      A          R L++S PVN+P+WS   RVDSVES +DSD  
Sbjct  113  SSSRIVHQFRGSEAAAAAGGGAAPSPRGRQLASSAPVNVPDWSKIYRVDSVESLHDSDDT  172

Query  682  THNRDF--EMVPPHEYLARE-YGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
              +     EM+PPHEYLAR+     +A S+ EG GRTLKGRD  R+RDAVWS+TGF+G
Sbjct  173  FDDGGGDAEMMPPHEYLARKGAAAAAATSVFEGVGRTLKGRDARRIRDAVWSRTGFDG  230



>ref|XP_003610423.1| hypothetical protein MTR_4g132020 [Medicago truncatula]
 gb|AES92620.1| senescence regulator [Medicago truncatula]
Length=176

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 126/226 (56%), Gaps = 55/226 (24%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRK T + +ERLLG+    +S++   +    ++  E+DVWS V+    DR   V+ +
Sbjct  1    MAKGRKFTTNRNERLLGTNYIQSSNTTHEV----TDFREEDVWSIVE----DRDHNVNFT  52

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFED----LGETTPSGV  531
              G+W  RA S     F++                    G SL FE+    +  T+   V
Sbjct  53   -PGDWDSRAPSRR---FNH-------------------GGLSLPFENPVSNVATTSSRNV  89

Query  532  VHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVP  711
             HQ+R              +++TS PVN+P+WS   RV+SVES +D D    + + EMVP
Sbjct  90   HHQYR--------------NVATSAPVNVPDWSKILRVESVESLHDMDD---DNESEMVP  132

Query  712  PHEYLAREYGR-TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PHEYLAR  GR  +ANS+ EG GRTLKGRD+ RVRDAVW+QTGF+G
Sbjct  133  PHEYLAR--GRKMAANSVFEGVGRTLKGRDLRRVRDAVWNQTGFDG  176



>ref|NP_172635.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD30253.1|AC007296_14 ESTs gb|R65381 and gb|T44635 come from this gene [Arabidopsis 
thaliana]
 gb|AAK15552.1|AF348581_1 unknown protein [Arabidopsis thaliana]
 gb|AAO24547.1| At1g11700 [Arabidopsis thaliana]
 dbj|BAE99668.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28772.1| uncharacterized protein AT1G11700 [Arabidopsis thaliana]
Length=201

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 122/234 (52%), Gaps = 46/234 (20%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MA+GRKLT S SER LGS SYS  DS+G  A  ESEL E+D+WS            VD S
Sbjct  1    MARGRKLTMSQSERYLGS-SYSYGDSNGNSATDESELTEEDIWS----------HAVDHS  49

Query  364  ES-----GEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG  528
                   G W+ R      G                    R+  G SL FED   ++P  
Sbjct  50   PEMLESHGAWNTRDAVVRNG--------------------RVGGGLSLAFED-ASSSPR-  87

Query  529  VVHQFRGQHDGVTAAPTNVR---HLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDF  699
            +VHQ RG  +G        R    L++S PVN+P+WS   RV+SVES ++SD        
Sbjct  88   IVHQIRGGGEGGGGGGGGGRVERQLASSAPVNVPDWSKIYRVNSVESIHESDEEEEEDSG  147

Query  700  EMVPPHEYLAREYGRTS-----ANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             M+PPHEYLA+   R S       S+ EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  148  MMMPPHEYLAKSQQRRSRKSGGGGSVFEGVGRTLKGRELRRVRDAIWSQTGFYG  201



>ref|XP_004507692.1| PREDICTED: uncharacterized protein LOC101501221 [Cicer arietinum]
Length=182

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 125/224 (56%), Gaps = 45/224 (20%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGS-YSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRK + + SERLLG+ Y+  ++ +H       ++  E+DVWS    M  DR R V+ 
Sbjct  1    MAKGRKFSTNRSERLLGTNYTQGSTVNHE-----VTDFREEDVWS----MVEDRERDVNL  51

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQ  540
            S SGEW  RA S       + R+                 G SL F++      + +VH+
Sbjct  52   S-SGEWDSRAPSWRRNREQDHRNLG---------------GLSLAFDN-----STRIVHR  90

Query  541  F--RGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPP  714
               R +H+           ++TS PVN+P+WS   RVDSV S +D D      D EMVPP
Sbjct  91   ASQRAEHN-----------MATSAPVNVPDWSKILRVDSVGSLHDLDDGFDVNDSEMVPP  139

Query  715  HEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            HEYLAR   + +ANS+ EG GRTLKGRD+ RVRDAVW+QTGF+G
Sbjct  140  HEYLARGR-KMAANSVFEGVGRTLKGRDLRRVRDAVWNQTGFDG  182



>ref|XP_008441099.1| PREDICTED: uncharacterized protein LOC103485322 [Cucumis melo]
Length=197

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 126/228 (55%), Gaps = 38/228 (17%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCES-ELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRKL  + +ER LGSYS +N  + G   G +S EL E+DVWS +D      R   D 
Sbjct  1    MAKGRKLGINRNERFLGSYS-NNGHAQGSYNGDDSSELREEDVWSIIDN-----RNSADG  54

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQ  540
             +              ++ N   R  R   PR E H    G S+ F+D G  T    V  
Sbjct  55   EDE-------------NYGNITVRTRRRSTPRDERHL--GGVSIAFQDSGSRT---AVAT  96

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDS--HTHNRDFEMVPP  714
             +G +      P   RH+S S PVN+P+WS     +SVES  + D   + +N + EMVPP
Sbjct  97   SQGNN------PRG-RHVSASAPVNVPDWSKILWAESVESLREMDDGGYYNNDETEMVPP  149

Query  715  HEYLAREYGRT----SANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            HEYLAREY R+    +A S+ EG GRTLKGRDM RVRDAVWSQTGF+G
Sbjct  150  HEYLAREYARSRNTAAATSVFEGVGRTLKGRDMRRVRDAVWSQTGFDG  197



>ref|XP_010546875.1| PREDICTED: uncharacterized protein LOC104818811 [Tarenaya hassleriana]
Length=216

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 90/231 (39%), Positives = 119/231 (52%), Gaps = 25/231 (11%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MA+G+KLT S SER LGSYSY   D H      +SEL EDD+WS      ++        
Sbjct  1    MARGQKLTMSRSERYLGSYSYG--DGHPNSVTDQSELVEDDIWSATAEHEHE--------  50

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprt---ehhrLDDGSSLTFEDLGETTPSGVV  534
            + G W+PR+ +    S                         DG SL F+D   ++ S +V
Sbjct  51   DEGAWTPRSSANDVWSIVERAEAPSPVETYGAWPARAAAARDGLSLAFQD--SSSSSTIV  108

Query  535  HQFR----GQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE  702
            H  R        G   +    R L+TS PVN+P+WS   RV+SVES ++S+      D  
Sbjct  109  HPPRRNGYEGGVGGGGSGGGGRQLATSAPVNVPDWSKIYRVNSVESIHESED---EEDSG  165

Query  703  MVPPHEYL---AREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            MVPPHEY    +R+ G     S+ +G GRTLKGR++ RVRDA+WSQTGF G
Sbjct  166  MVPPHEYQVRRSRKIGGGGGASLFQGVGRTLKGRELRRVRDAIWSQTGFYG  216



>ref|XP_010923895.1| PREDICTED: uncharacterized protein LOC105046857 [Elaeis guineensis]
Length=207

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 115/237 (49%), Gaps = 46/237 (19%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVD----GMANDRRRG  351
            MA+GR+  A   +RLLG+YSY     H   A    +L E+DVWS V     G A  RR G
Sbjct  1    MARGRRYCA---DRLLGTYSYGGQ-GHATAAADLPDLREEDVWSAVADDYVGDAAGRRPG  56

Query  352  VDSSESGE----WSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETT  519
            +D S+       W  R G    G                        G SL F D G   
Sbjct  57   LDRSDEDRAGRRWLAREGRRHVG------------------------GLSLAF-DEGYEP  91

Query  520  PSGVVHQFRGQHDGVTAAPTNVRHLS-------TSVPVNIPNWSNFNRVDSVESFYDS-D  675
             + VVHQ+R   D   A P   R           S PVN+P+W  F RVD  ES   + +
Sbjct  92   RTTVVHQYRNV-DAAAAPPYGRRRQHQHHHPPVASAPVNVPDWPRFLRVDGGESMLGAGE  150

Query  676  SHTHNRDFEMVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
                  D E VPPHEYLARE G+  A S+ EG GRTLKGRDMSRVR+AVWSQTGF G
Sbjct  151  GGADCDDGEWVPPHEYLAREQGKMVAASVFEGVGRTLKGRDMSRVREAVWSQTGFFG  207



>ref|XP_006417325.1| hypothetical protein EUTSA_v10008790mg [Eutrema salsugineum]
 gb|ESQ35678.1| hypothetical protein EUTSA_v10008790mg [Eutrema salsugineum]
Length=205

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 122/231 (53%), Gaps = 36/231 (16%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWS-TVDGMANDRRRGVDS  360
            MAKGRKLT S SER LGS SY   DS+G     ESEL E+D+WS  VD    DR    + 
Sbjct  1    MAKGRKLTVSQSERYLGS-SYGYGDSNGNSVTDESELTEEDIWSHAVDHSPEDRSEMPEL  59

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQ  540
               G WSPR      G                    R+  G SL FED   ++   +VHQ
Sbjct  60   L--GAWSPRDALVRNG--------------------RVRGGLSLAFED--TSSSPRIVHQ  95

Query  541  FRGQHDGVTAAPTNV--RHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPP  714
             RG  +G          R L++S PVN+P+WS   RV+SVES ++SD         M+PP
Sbjct  96   IRGGGEGGGGGGGGGIQRQLASSAPVNVPDWSKIYRVNSVESIHESDEEDEEDS-GMMPP  154

Query  715  HEYLAR-------EYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            HEYLA+       + G     S+ EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  155  HEYLAKSQKRRSRKSGGGGGGSVFEGVGRTLKGRELRRVRDAIWSQTGFYG  205



>ref|XP_010473412.1| PREDICTED: uncharacterized protein LOC104752848 [Camelina sativa]
Length=203

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/235 (40%), Positives = 115/235 (49%), Gaps = 46/235 (20%)
 Frame = +1

Query  184  MAKGRKLTASWS--ERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVD  357
            MAKGRK T + S  ER LGSY Y   DSHG     E EL E+D+WS    + +D     D
Sbjct  1    MAKGRKPTTTMSRNERYLGSYGYG--DSHGSSVTDELELAEEDIWSP--AVIHDTTAETD  56

Query  358  SSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFED-LGETTPSG--  528
             +    W+ RA     G                        G SL FE  L    PS   
Sbjct  57   EAYHA-WNLRATLGKNGRVG---------------------GLSLAFESSLAAPPPSSSP  94

Query  529  -VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEM  705
             +VHQ     D       N R L++S PVN+P+WS   RVDSVES ++ D      +  M
Sbjct  95   IIVHQINDGGD------ENRRKLASSAPVNVPDWSKIYRVDSVESIHELDEDDDEEESRM  148

Query  706  VPPHEYLAREYGRTSAN--------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            +PPHEY+A+   R S          S+ EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  149  MPPHEYVAKSQARRSRKIGGVDVGASVFEGVGRTLKGRELRRVRDAIWSQTGFYG  203



>ref|XP_008812625.1| PREDICTED: uncharacterized protein LOC103723486 [Phoenix dactylifera]
Length=191

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 111/227 (49%), Gaps = 42/227 (19%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRI--AGCESELGEDDVWSTVDGMANDRRRGVD  357
            MAKGR+  A   +RLLG+YSY      GR+  A    +L E+DVWS             D
Sbjct  1    MAKGRRYGA---DRLLGTYSYGG---QGRVTDAADLPDLDEEDVWSVA---------AED  45

Query  358  SSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVH  537
                  W+      SG  +      R               G SL FE+ G      VVH
Sbjct  46   YKADEAWTRPNRDRSGRRWIEGEDHRQLG------------GLSLAFEE-GYDARHTVVH  92

Query  538  QFRGQHDGVTAAPTNVRH----LSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEM  705
            Q+R       AAP    H     + S PVN+P W  F RVDS E   + D      D E 
Sbjct  93   QYRNV--DAAAAPPRRHHRHQPAAMSAPVNVPEWPRFLRVDSGEEGAERD------DGEW  144

Query  706  VPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            VPPHEYLARE+GR  A S+ EG GRTLKGRDMSRVRDAVWSQTGF G
Sbjct  145  VPPHEYLAREHGRMVATSVFEGVGRTLKGRDMSRVRDAVWSQTGFFG  191



>ref|XP_010929998.1| PREDICTED: uncharacterized protein LOC105051322 [Elaeis guineensis]
Length=198

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 98/227 (43%), Positives = 118/227 (52%), Gaps = 35/227 (15%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCE--SELGEDDVWSTVDGMANDRRRGVD  357
            MAKGR+  A   +RLLG+YSY      G + G     +L E+DVWS             D
Sbjct  1    MAKGRRYGA---DRLLGTYSYGG---QGHVTGAADLPDLEEEDVWSVA----------AD  44

Query  358  SSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVH  537
              E GE   RA  +               R    E HR   G SL FE+  +  P+ VVH
Sbjct  45   DYEDGEAWTRAHRDR-----------SDRRWVAGEDHRQVGGLSLAFEEGYKARPT-VVH  92

Query  538  QFRGQHDGVTAAPTN---VRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRD-FEM  705
            Q+R   D   A P         + S PVN+P W  F RVDS ES + +     +RD  E 
Sbjct  93   QYRNV-DAAAAPPRRQHHHHSAAASAPVNVPEWPRFLRVDSGESVHAAGEEGADRDDGEW  151

Query  706  VPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            VPPHEYLARE+G+  A S+ EG GRTLKGRDMSRVRDAVWS+TGF G
Sbjct  152  VPPHEYLAREHGKIVATSVFEGVGRTLKGRDMSRVRDAVWSRTGFFG  198



>ref|XP_004145178.1| PREDICTED: uncharacterized protein LOC101209631 [Cucumis sativus]
 ref|XP_004153103.1| PREDICTED: uncharacterized protein LOC101212597 [Cucumis sativus]
 ref|XP_004165388.1| PREDICTED: uncharacterized LOC101212597 [Cucumis sativus]
 gb|KGN64524.1| hypothetical protein Csa_1G063480 [Cucumis sativus]
Length=194

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 114/233 (49%), Gaps = 51/233 (22%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCES-ELGEDDVWSTVDGM----ANDRRR  348
            MAKGRKL  + +ER LGSYS  N  +     G +S EL E+DVWS +D      A D   
Sbjct  1    MAKGRKLGINRNERFLGSYS--NGHAQASYNGDDSSELREEDVWSIIDNKNSADAEDENY  58

Query  349  G-VDSSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPS  525
            G +        +PR     GG                          S+ F+D G  T +
Sbjct  59   GNITLRTRRRSTPRDERNVGGV-------------------------SIAFQDSGSRTAA  93

Query  526  GVVH--QFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDF  699
                    RG            RH+S S PVN+P+WS     +S     D   + +N + 
Sbjct  94   ATSQGNNPRG------------RHVSASAPVNVPDWSKILWAESSLREMDDGGYYNNDET  141

Query  700  EMVPPHEYLAREYGRT----SANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            EMVPPHEYLAREY R+    +A S+ EG GRTLKGRDM RVRDAVWSQTGF+G
Sbjct  142  EMVPPHEYLAREYARSRNTAAATSVFEGVGRTLKGRDMRRVRDAVWSQTGFDG  194



>ref|XP_010418168.1| PREDICTED: uncharacterized protein LOC104703794 [Camelina sativa]
Length=200

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 90/232 (39%), Positives = 112/232 (48%), Gaps = 43/232 (19%)
 Frame = +1

Query  184  MAKGRK--LTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVD  357
            MAKGRK   T S S+R LGSY Y   DSHG     E EL E+D+WS    + +D     D
Sbjct  1    MAKGRKPTTTMSRSDRYLGSYGYG--DSHGASVTDELELAEEDIWSP--AVIHDTTAETD  56

Query  358  SSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVH  537
             +    W+ RA     G                        G SL FE      P  +VH
Sbjct  57   EAYHA-WNLRATLGKNGRVG---------------------GLSLAFEGSLAAPPPIIVH  94

Query  538  QFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYD-SDSHTHNRDFEMVPP  714
            Q     D       N R L++S PVN+P+WS   RVDSVES ++  +         M+PP
Sbjct  95   QINDGDD------ENRRKLASSAPVNVPDWSKIYRVDSVESIHELGEDDDEEESRMMMPP  148

Query  715  HEYLAREYGRTSAN--------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            HEY+A+   R S          S+ EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  149  HEYVAKSQARRSRKIGGVDVGASVFEGVGRTLKGRELRRVRDAIWSQTGFYG  200



>ref|XP_010458577.1| PREDICTED: uncharacterized protein LOC104739816 [Camelina sativa]
Length=200

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 94/237 (40%), Positives = 118/237 (50%), Gaps = 53/237 (22%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGS-YSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MA+GRKLT S SER LGS YSY + +        E EL E+D+WS            VD 
Sbjct  1    MARGRKLTMSQSERYLGSGYSYGDGN-----VSDEPELTEEDIWS----------HAVDH  45

Query  361  SES-----GEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPS  525
            S       G W+ R      G                    R+  G SL FED   ++P 
Sbjct  46   SPEMLESHGAWNTRDAVVRNG--------------------RVGGGLSLAFED-ASSSPR  84

Query  526  GVVHQFRGQHDGVTAAPTNV-RHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE  702
             +VHQ R   +G       V R L++S PVN+P+WS   RV+SVES ++SD         
Sbjct  85   -IVHQIRCGGEGGGGGGERVQRQLASSAPVNVPDWSKIYRVNSVESIHESDEEDEEDSGM  143

Query  703  MVPPHEYLAREYGRTSAN---------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            M+PPHEYLA+   R S           S+ EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  144  MMPPHEYLAKSQKRRSRKSGGGLGGGASVFEGVGRTLKGRELRRVRDAIWSQTGFYG  200



>ref|XP_010493172.1| PREDICTED: uncharacterized protein LOC104770441 [Camelina sativa]
Length=200

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 94/237 (40%), Positives = 118/237 (50%), Gaps = 53/237 (22%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGS-YSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MA+GRKLT S SER LGS YSY + +        E EL E+D+WS            VD 
Sbjct  1    MARGRKLTMSQSERYLGSGYSYGDGN-----VTNEPELTEEDIWS----------HAVDH  45

Query  361  SES-----GEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPS  525
            S       G W+ R      G                    R+  G SL FED   ++P 
Sbjct  46   SPEMLESHGAWNTRDAVVRNG--------------------RVGGGLSLAFED-ASSSPR  84

Query  526  GVVHQFRGQHDGVTAAPTNV-RHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE  702
             +VHQ R   +G       V R L++S PVN+P+WS   RV+SVES ++SD         
Sbjct  85   -IVHQIRCGGEGGGGGGEIVQRQLASSAPVNVPDWSKIYRVNSVESIHESDEEDEEDSGM  143

Query  703  MVPPHEYLAREYGRTSAN---------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            M+PPHEYLA+   R S           S+ EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  144  MMPPHEYLAKSQKRRSRKSGGGLGGGASVFEGVGRTLKGRELRRVRDAIWSQTGFYG  200



>ref|NP_564788.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC28509.1| F8K4.12 [Arabidopsis thaliana]
 dbj|BAF02031.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABI93899.1| At1g61930 [Arabidopsis thaliana]
 gb|AEE33904.1| uncharacterized protein AT1G61930 [Arabidopsis thaliana]
Length=203

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 118/233 (51%), Gaps = 42/233 (18%)
 Frame = +1

Query  184  MAKGRK-LTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRK  T + S+R LGSY+Y   DSHG     E ELGE+D+WS    + +D     D+
Sbjct  1    MAKGRKPTTMNRSDRYLGSYTYG--DSHGNSVTDELELGEEDIWSPA--VIHD-----DT  51

Query  361  SES----GEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG  528
            +E+    G W+ RA     G                        G SL FE      PS 
Sbjct  52   TENEESYGTWNLRATLGKNGRVG---------------------GLSLAFEGSLVAPPSS  90

Query  529  VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE-M  705
                 +  H G      + R L++S PVN+P+WS   RVDSVES ++ D      +   M
Sbjct  91   SPMIVQKIHGGGGEGEEDRRKLASSAPVNVPDWSKIYRVDSVESIHELDDEDDEDEESGM  150

Query  706  VPPHEYLAREYGRTSAN------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            +PPHEYLA+   R S        S+ +G GRTLKGR++ RVRDA+WSQTGF G
Sbjct  151  MPPHEYLAKSQARRSRKIGGGGASVFDGVGRTLKGRELRRVRDAIWSQTGFYG  203



>ref|XP_008806403.1| PREDICTED: uncharacterized protein LOC103719105 [Phoenix dactylifera]
Length=195

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 111/229 (48%), Gaps = 42/229 (18%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVD----GMANDRRRG  351
            MAKGRK      +RLLG+Y+Y     H   A    +L E+DVWS V     G A  RR G
Sbjct  1    MAKGRKYC---PDRLLGTYTYGGQ-GHATGAADLPDLREEDVWSAVAEDYVGDAAGRRHG  56

Query  352  VDSSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGV  531
             D S   +   R  +                            G SL FE+  E  P  V
Sbjct  57   PDRSGEDQADRRCLAREDRRHVG--------------------GLSLAFEEGYEPRPK-V  95

Query  532  VHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSV----ESFYDSDSHTHNRDF  699
            VHQ+R                + S PVN+P+W  F RV+S+    E+  D D      D 
Sbjct  96   VHQYRNVERRRRHHHHPP---AASAPVNVPDWPRFLRVESMHGGGEAGADWD------DG  146

Query  700  EMVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            E VPPHEYLARE GR  A S+ EG GRTLKGRDMSRVR+AVWSQTGF G
Sbjct  147  ERVPPHEYLAREQGRMVAASVFEGVGRTLKGRDMSRVRNAVWSQTGFFG  195



>ref|XP_002889889.1| hypothetical protein ARALYDRAFT_471309 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66148.1| hypothetical protein ARALYDRAFT_471309 [Arabidopsis lyrata subsp. 
lyrata]
Length=201

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 121/234 (52%), Gaps = 46/234 (20%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MA+GRKLT S SER LGS SYS  DS+G     ESEL E+D+WS            VD S
Sbjct  1    MARGRKLTTSQSERYLGS-SYSYGDSNGNSVTDESELTEEDIWS----------HAVDHS  49

Query  364  ES-----GEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG  528
                   G W+ R      G                    R+  G SL FED   ++P  
Sbjct  50   PEMLESHGAWNTRDAVVRNG--------------------RVGGGLSLAFED-ASSSPR-  87

Query  529  VVHQFRGQHDGVTAAPTNVR---HLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDF  699
            +VHQ RG  +G        R    L++S PVN+P+WS   RV+SVES ++S+        
Sbjct  88   IVHQIRGGGEGGGGGGGGGRVERQLASSAPVNVPDWSKIYRVNSVESIHESEEEEEEDSR  147

Query  700  EMVPPHEYLAREYGRTS-----ANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             M+PPHEYLA+   R S       S+ EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  148  MMMPPHEYLAQSQKRRSRKSGGGGSVFEGIGRTLKGRELRRVRDAIWSQTGFYG  201



>gb|AAM64551.1| unknown [Arabidopsis thaliana]
Length=203

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 117/233 (50%), Gaps = 42/233 (18%)
 Frame = +1

Query  184  MAKGRK-LTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRK  T + S+R LGSY+Y   DSHG     E ELGE+D+WS    + +D     D+
Sbjct  1    MAKGRKPTTMNRSDRYLGSYTYG--DSHGNSVTDELELGEEDIWSPA--VIHD-----DT  51

Query  361  SES----GEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG  528
            +E+    G W+ RA     G                        G SL FE      P  
Sbjct  52   TENEESYGTWNLRATLGKNGRVG---------------------GLSLAFEGSLVAPPLS  90

Query  529  VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE-M  705
                 +  H G      + R L++S PVN+P+WS   RVDSVES ++ D      +   M
Sbjct  91   SPMIVQKIHGGGGEGEEDRRKLASSAPVNVPDWSKIYRVDSVESIHELDDEDDEDEESGM  150

Query  706  VPPHEYLAREYGRTSAN------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            +PPHEYLA+   R S        S+ +G GRTLKGR++ RVRDA+WSQTGF G
Sbjct  151  MPPHEYLAKSQARRSRKIGGGGASVFDGVGRTLKGRELRRVRDAIWSQTGFYG  203



>ref|XP_006305623.1| hypothetical protein CARUB_v10010311mg [Capsella rubella]
 gb|EOA38521.1| hypothetical protein CARUB_v10010311mg [Capsella rubella]
Length=205

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 115/233 (49%), Gaps = 40/233 (17%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MA+GRKLT S SER LGS  YS  D +      E EL E+D+WS     A D    +  S
Sbjct  1    MARGRKLTMSQSERYLGS-GYSYGDGNVNSVTDEPELTEEDIWSH----AVDHNPEMLES  55

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
              G W+ R      G                    R+  G SL FED   ++P  +VHQ 
Sbjct  56   H-GAWNTRDSVVRNG--------------------RVGGGLSLAFED-ASSSPR-IVHQI  92

Query  544  RGQHDGVTAAPTN---VRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPP  714
            R                R L++S PVN+P+WS   RV+SVES ++S+         M+PP
Sbjct  93   RCGGGDGGGGGGGEKVQRQLASSAPVNVPDWSKIYRVNSVESIHESEEEDEEDSGMMMPP  152

Query  715  HEYLAREYGRTSAN---------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            HEYLA+   R S           S+ EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  153  HEYLAKSQKRRSRKSGGGLGGGASVFEGVGRTLKGRELRRVRDAIWSQTGFYG  205



>ref|XP_010430218.1| PREDICTED: uncharacterized protein LOC104714523 [Camelina sativa]
Length=205

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 93/240 (39%), Positives = 115/240 (48%), Gaps = 54/240 (23%)
 Frame = +1

Query  184  MAKGRK--LTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVD  357
            MAKGRK   T S S+R LGSY Y   DSHG     E EL E+D+WS            V 
Sbjct  1    MAKGRKPTTTMSRSDRYLGSYGYG--DSHGSSVTDELELAEEDIWSPAVIH-------VT  51

Query  358  SSESGE----WSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFED-LGETTP  522
            ++ES E    W+ RA     G                        G SL FE+ L    P
Sbjct  52   TAESDEAYHAWNLRATLGKNGRVG---------------------GLSLAFENSLAAPPP  90

Query  523  SG---VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYD-SDSHTHN  690
            S    +V Q     D       N R L++S PVN+P+WS   RVDSVES ++  +     
Sbjct  91   SSSPIIVQQINDGGD-----EENRRKLASSAPVNVPDWSKIYRVDSVESIHELDEDDDEE  145

Query  691  RDFEMVPPHEYLAREYGRTSAN--------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
                M+PPHEY+A+   R S          S+ EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  146  ESRMMMPPHEYVAKSQARRSRKIGGVDGGASVFEGVGRTLKGRELRRVRDAIWSQTGFYG  205



>ref|XP_010476104.1| PREDICTED: uncharacterized protein LOC104755423 [Camelina sativa]
Length=202

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 116/238 (49%), Gaps = 53/238 (22%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MA+GRKLT S SER LGS  YS  D +      E EL E+D+WS            VD S
Sbjct  1    MARGRKLTMSQSERYLGS-GYSCGDGN---VNDEPELTEEDIWS----------HAVDHS  46

Query  364  ES-----GEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG  528
                   G W+ R      G                    R+  G SL FED   ++P  
Sbjct  47   PEMLESHGAWNTRDAVVRNG--------------------RVGGGLSLAFED-ASSSPR-  84

Query  529  VVHQFRGQHDGVTAAPTNVR---HLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDF  699
            +VHQ R   +G        R    L++S PVN+P+WS   RV+SVES ++SD        
Sbjct  85   IVHQIRCGGEGGGGGGGGERVQRQLASSAPVNVPDWSKIYRVNSVESIHESDEEDEEDSG  144

Query  700  EMVPPHEYLAREYGRTSAN---------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             M+PPHEYLA+   R S           S+ EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  145  MMMPPHEYLAKSQKRRSRKSGGGLGGGASVFEGVGRTLKGRELRRVRDAIWSQTGFYG  202



>ref|XP_009113110.1| PREDICTED: uncharacterized protein LOC103838426 [Brassica rapa]
Length=198

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 115/233 (49%), Gaps = 47/233 (20%)
 Frame = +1

Query  184  MAKGRK-LTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTV---DGMANDRRRG  351
            MA+GR   T + S+R LGSYSY   DSHG     E EL E+D+WS     D    D   G
Sbjct  1    MARGRNPTTMNRSDRYLGSYSYG--DSHGTSLTDELELAEEDIWSPAVIHDTETEDSYGG  58

Query  352  VDSSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG-  528
             +SS +   S R G                             G SLTF+       S  
Sbjct  59   WNSSANSVKSGRVG-----------------------------GLSLTFKSSSNAPSSSP  89

Query  529  -VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEM  705
             +V Q    H GV      +R+L++S PVN+P+WS   RV+ VES ++ D      +  M
Sbjct  90   MLVQQI---HGGVGEGGEIMRNLASSAPVNVPDWSKIYRVNLVESTHELDGDDEE-EPGM  145

Query  706  VPPHEYLAREYGRTSAN------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            +PPHEYLA+   R S        SM EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  146  MPPHEYLAKSQARRSRKMGGGGASMFEGVGRTLKGRELRRVRDAIWSQTGFYG  198



>emb|CDY19509.1| BnaC09g13940D [Brassica napus]
Length=198

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 117/230 (51%), Gaps = 41/230 (18%)
 Frame = +1

Query  184  MAKGRK-LTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MA+GR   T + S+R LGSYSY   DSHG     E EL E+D+WS    + +D     + 
Sbjct  1    MARGRNPTTMNRSDRYLGSYSYG--DSHGTSLTDELELAEEDIWSPA--VIHDTE--TED  54

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG--VV  534
            S SG W+  A S   G                        G SLTF+       S   +V
Sbjct  55   SYSG-WNLSANSMKSGRVG---------------------GLSLTFKSSSNAPSSSPMLV  92

Query  535  HQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPP  714
             Q    H GV      +R+L++S PVN+P+WS   RV+ VES ++ D      +  M+PP
Sbjct  93   QQI---HGGVGEGGEIMRNLASSAPVNVPDWSEIYRVNLVESTHELDGDDEE-EPGMMPP  148

Query  715  HEYLAREYGRTSAN------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            HEYLA+   R S        SM EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  149  HEYLAKSQARRSRKMGGGGASMFEGVGRTLKGRELRRVRDAIWSQTGFYG  198



>emb|CDX97979.1| BnaA06g07300D [Brassica napus]
Length=204

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 96/233 (41%), Positives = 124/233 (53%), Gaps = 41/233 (18%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MA+ RKLT S SER LGS SYS  DS+G     ESEL E+DVWS     + +     D+ 
Sbjct  1    MARVRKLTISQSERYLGS-SYSFGDSNGNSVTDESELTEEDVWSHAVDHSPE-----DTP  54

Query  364  ES-GEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQ  540
            ES G WS R      G                    R+  G SL FED+  ++P+ +VHQ
Sbjct  55   ESFGAWSSRDAVMRNG--------------------RVCGGLSLAFEDM-SSSPT-IVHQ  92

Query  541  FRGQHDGVTAAPTNV------RHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE  702
             RG  +               R L++S PVN+P+WS   RV+SVES ++S+         
Sbjct  93   IRGGGEVGGGEVGGGGGGQAPRQLASSAPVNVPDWSKIYRVNSVESIHESEEEEDEES-G  151

Query  703  MVPPHEYLAREYGRTSANS-----MCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            M+PPHEYLA+   R S  S     + EG G+TLKGR++ RVRDA+WSQTGF G
Sbjct  152  MMPPHEYLAKSQKRRSRKSGGGASVFEGVGKTLKGRELRRVRDAIWSQTGFYG  204



>ref|XP_009148499.1| PREDICTED: uncharacterized protein LOC103871920 [Brassica rapa]
Length=205

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 98/235 (42%), Positives = 124/235 (53%), Gaps = 44/235 (19%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWS-TVDGMANDRRRGVDS  360
            MA+ RKLT S SER LGS SYS  DS+G     ESEL E+DVWS  VD    D      +
Sbjct  1    MARVRKLTISQSERYLGS-SYSFGDSNGNSVTDESELTEEDVWSHAVDHSPED------T  53

Query  361  SES-GEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVH  537
             ES G WS R      G                    R+  G SL FED+  ++P+ +VH
Sbjct  54   PESFGAWSSRDAVMRNG--------------------RVCGGLSLAFEDM-SSSPT-IVH  91

Query  538  QFRGQHDGVTAAPTNV-------RHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRD  696
            Q RG  +                R L++S PVN+P+WS   RV+SVES ++S+       
Sbjct  92   QIRGGGEVGGGEVGGGGGGGQAQRQLASSAPVNVPDWSKIYRVNSVESIHESEEEEDEES  151

Query  697  FEMVPPHEYLAREYGRTSANS-----MCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
              M+PPHEYLA+   R S  S     + EG G+TLKGR++ RVRDA+WSQTGF G
Sbjct  152  -GMMPPHEYLAKSQKRRSRKSGGGASVFEGVGKTLKGRELRRVRDAIWSQTGFYG  205



>ref|XP_007212173.1| hypothetical protein PRUPE_ppa012541mg [Prunus persica]
 gb|EMJ13372.1| hypothetical protein PRUPE_ppa012541mg [Prunus persica]
Length=165

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 102/165 (62%), Gaps = 17/165 (10%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGRKLT S SERLLGSYS   S SH   A    ELGEDDVWSTV+ +       +++S
Sbjct  1    MAKGRKLTQSRSERLLGSYS---SYSH---AHDSPELGEDDVWSTVNTVDEREDPEIENS  54

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG-VVHQ  540
              G+WSPRA +E+ G   + RSRR               G SL F+D G+T  S  +VHQ
Sbjct  55   H-GDWSPRASAETNGGVSSRRSRRIAREDGNVG------GLSLAFDDSGKTASSPRIVHQ  107

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSD  675
            FRG HD V A+P  V H++TS PVN+P+WS   RVDSV+S Y+ D
Sbjct  108  FRG-HDSV-ASP-RVHHMATSAPVNVPDWSKILRVDSVDSLYELD  149



>emb|CDY12918.1| BnaA09g13560D [Brassica napus]
Length=198

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 89/231 (39%), Positives = 117/231 (51%), Gaps = 43/231 (19%)
 Frame = +1

Query  184  MAKGRK-LTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MA+GR   T + S+R LGSYSY   DSHG     E EL E+D+WS    + +D     ++
Sbjct  1    MARGRNPTTMNRSDRYLGSYSYG--DSHGTSITDELELDEEDIWSPA--VIHD----TET  52

Query  361  SES-GEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG--V  531
             +S G W+  A S   G                        G SL F+       S   +
Sbjct  53   EDSYGGWNLSANSMKSGRVG---------------------GLSLAFKSSSNAPSSSPML  91

Query  532  VHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVP  711
            V Q    H GV      +R+L++S PVN+P+WS   RV+ VES ++ D      +  M+P
Sbjct  92   VQQI---HGGVGEGGEIMRNLASSAPVNVPDWSKIYRVNLVESTHELDGDDEE-EPGMMP  147

Query  712  PHEYLAREYGRTSAN------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PHEYLA+   R S        SM EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  148  PHEYLAKSQARRSRKMGGGGASMFEGVGRTLKGRELRRVRDAIWSQTGFYG  198



>emb|CDY34631.1| BnaC08g41900D [Brassica napus]
Length=201

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 115/231 (50%), Gaps = 40/231 (17%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLG-SYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGRKLT S SER LG SYSY  SD+       E EL E+D+WS     + +    +  
Sbjct  1    MAKGRKLTTSQSERYLGCSYSYGGSDAD------EPELTEEDIWSHAIDHSQEELTEIPE  54

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQ  540
            S  G W+ R    S G                        G SL F+D   ++P  +VHQ
Sbjct  55   S-LGAWNSRDAVVSNGRV-------------------CGGGLSLAFQDT-SSSPR-IVHQ  92

Query  541  FRGQHDGVTAAPTNVR---HLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVP  711
             R             R    L++S PVN+P+WS   RV+S ES ++S+         M+P
Sbjct  93   IRIGGGEGGGGGKGGRIQRQLASSAPVNVPDWSKIYRVNSAESIHESEEEDEESG--MMP  150

Query  712  PHEYLAREYGRTSAN------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PHEY+A+   R S+       S+ EG G+TLKGR + RVRDA+WSQTGF G
Sbjct  151  PHEYVAKSQKRRSSKTGGGDASVFEGVGKTLKGRQLRRVRDAIWSQTGFYG  201



>gb|KFK40634.1| hypothetical protein AALP_AA2G022100 [Arabis alpina]
Length=197

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 90/228 (39%), Positives = 114/228 (50%), Gaps = 38/228 (17%)
 Frame = +1

Query  184  MAKGRK-LTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MA+GRK  T + S+R LGSYSY   DSH      E EL E+D+WS    + +D     D 
Sbjct  1    MARGRKPTTMNRSDRYLGSYSYG--DSHRTSVTDELELSEEDIWSP--AVIHDTE--TDD  54

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQ  540
            S S  W+ RA      SF                      G SL FE   +  P      
Sbjct  55   SYSA-WNLRA------SFSRNERVG---------------GLSLAFEASSDAPPPSSPMI  92

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHE  720
             +  HD         R+L++S PVN+P+WS   RVDSVES ++ D      + EM+PPHE
Sbjct  93   VQQIHD---EGGEIRRNLASSAPVNVPDWSKIYRVDSVESIHELDDEDEEEEDEMMPPHE  149

Query  721  YLAREYGRTSAN------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            YL +   R S        S+ EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  150  YLVKSQARRSRKTGGGGASVFEGVGRTLKGRELRRVRDAIWSQTGFYG  197



>emb|CDY49797.1| BnaCnng18100D [Brassica napus]
Length=205

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 122/234 (52%), Gaps = 42/234 (18%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MA+ RKLT S SER LGS SYS   S+G     ESEL E+DVWS     + +     D+ 
Sbjct  1    MARVRKLTISQSERYLGS-SYSFGGSNGNSVTDESELTEEDVWSHAVDHSPE-----DTP  54

Query  364  ES-GEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQ  540
            ES G WS        G                    R+  G SL FED+  ++P+ +VHQ
Sbjct  55   ESFGAWSSHDAVMRNG--------------------RVCGGLSLAFEDM-SSSPT-IVHQ  92

Query  541  FRGQHDGVTAAPTNV-------RHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDF  699
             RG  +                R L++S PVN+P+WS   RV+SVES ++S+        
Sbjct  93   IRGVGEVGGGEVGGGGGGGQGQRQLASSAPVNVPDWSKIYRVNSVESIHESEEEEDEES-  151

Query  700  EMVPPHEYLAREYGRTSANS-----MCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             M+PPHEYLA+   R S  S     + EG G+TLKGR++ RVRDA+WSQTGF G
Sbjct  152  GMMPPHEYLAKSQKRRSRKSGGGASVFEGVGKTLKGRELRRVRDAIWSQTGFYG  205



>gb|KFK28777.1| hypothetical protein AALP_AA7G046300 [Arabis alpina]
Length=179

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 107/223 (48%), Gaps = 46/223 (21%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSH--GRIAGCESELGEDDVWSTVDGMANDRRRGVD  357
            M KGR+LT S SE  LGSY  S+ D H  G  A  E EL E+D+WS ++   ND     D
Sbjct  1    MGKGRRLTMSRSELFLGSYHQSD-DRHVDGGEATVELELMEEDLWSVLE--PND-----D  52

Query  358  SSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVH  537
            S+    W+ R       S D    R +         + L                     
Sbjct  53   STGESAWTAR-------SLDASERRSNGHGHGHGHVNGL---------------------  84

Query  538  QFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPH  717
                    VT      RH++TS PV +P+WS   +++SV S + +D    + + EMVPPH
Sbjct  85   -------AVTNDELRKRHVATSAPVKVPDWSKILKIESVVSVH-ADVADGDWESEMVPPH  136

Query  718  EYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            EY+AR       +S+  G GRTLKGRDM RVRD VWSQTGF G
Sbjct  137  EYVARRRNGDGGSSVFLGVGRTLKGRDMRRVRDTVWSQTGFYG  179



>ref|XP_006284630.1| hypothetical protein CARUB_v10005873mg [Capsella rubella]
 gb|EOA17528.1| hypothetical protein CARUB_v10005873mg [Capsella rubella]
Length=175

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 105/228 (46%), Gaps = 60/228 (26%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRI-AGCESELGEDDVWSTVDGMANDRRRGVDS  360
            M KGR LT S SERLLGS + S  D H  +    E EL E+DVWS ++            
Sbjct  1    MGKGRGLTISRSERLLGSPNQSG-DQHVNVETAVEMELMEEDVWSVLEP--------DQP  51

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQ  540
            ++   W+ R+   SGG+                                        +H 
Sbjct  52   TQESAWTARSLDASGGAR---------------------------------------IHN  72

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFY----DSDSHTHNRDFEMV  708
              G+  G        +HL+TS PV +P+WS   + + V S +    D+D    + + EMV
Sbjct  73   GSGRAGG-----RRKKHLATSAPVKVPDWSKILKTEPVGSMHRNNNDADVADGDWESEMV  127

Query  709  PPHEYLAREYGRTS--ANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PPHEY+A    R     +S+  G GRTLKGRDM RVRDAVWSQTGF G
Sbjct  128  PPHEYVAARIRRNGDGGSSLILGVGRTLKGRDMRRVRDAVWSQTGFYG  175



>ref|XP_006391948.1| hypothetical protein EUTSA_v10023699mg [Eutrema salsugineum]
 gb|ESQ29234.1| hypothetical protein EUTSA_v10023699mg [Eutrema salsugineum]
Length=202

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 84/234 (36%), Positives = 119/234 (51%), Gaps = 45/234 (19%)
 Frame = +1

Query  184  MAKGRK-LTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MA+GR   T + S+R LGSY+Y   D H      E EL E+D+WS    + +D     ++
Sbjct  1    MARGRNPTTMNRSDRYLGSYNYG--DRHVTSITDELELAEEDIWSP--AVIHD----TET  52

Query  361  SES-GEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFE--DLGETTPSGV  531
             +S G W+ RA  E  G                        G SL F+   +  ++   +
Sbjct  53   QDSYGAWNLRATLEENGRVG---------------------GLSLAFKGSSVAPSSSPVI  91

Query  532  VHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE-MV  708
            VH+    H G        R L++S PVN+P+WS   RV+SVES ++ D+   + +   M+
Sbjct  92   VHKI---HGGGGEGGEIRRKLASSAPVNVPDWSKIYRVNSVESIHELDNDDEDEEESEMM  148

Query  709  PPHEYLAREYGRTSAN--------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PPHEYLA+   R S          S+ EG G+TLKGR++ RVRDA+WSQTGF G
Sbjct  149  PPHEYLAKSQARRSRKMGGGGGGASVFEGVGKTLKGRELRRVRDAIWSQTGFYG  202



>ref|XP_010538927.1| PREDICTED: uncharacterized protein LOC104813102 [Tarenaya hassleriana]
Length=182

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 102/226 (45%), Gaps = 53/226 (23%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            M KG++LT S SER LG++SYSN       +  + EL E+DVWS  +          D  
Sbjct  5    MGKGQRLTNSRSERFLGTHSYSNRHVDA-ASSADPELMEEDVWSVTE-------HDSDRY  56

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
              G W+ RA +                                        TPS  +   
Sbjct  57   HVGAWNSRATA---------------------------------------PTPSWGLKPA  77

Query  544  RGQHDGVTAAPTN----VRHLSTSVPVNIPNWSNFNRVDSVESF-YDSDSHTHNRDFEMV  708
               H G+  A          +S S PV++PNW    RVDS +    D D      D +MV
Sbjct  78   GRHHVGIPDASERDGGGRIQMSASAPVSVPNWGKILRVDSADPLGSDWDDDVAETDGDMV  137

Query  709  PPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PPHE++ARE  R    S+  G GRTLKGRDMSRVRD+VWSQ GF+G
Sbjct  138  PPHEWVARER-RNGGASVFVGVGRTLKGRDMSRVRDSVWSQIGFDG  182



>ref|XP_006413710.1| hypothetical protein EUTSA_v10026386mg [Eutrema salsugineum]
 dbj|BAJ34564.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55163.1| hypothetical protein EUTSA_v10026386mg [Eutrema salsugineum]
Length=173

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = +1

Query  562  VTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYG  741
            V +A    RH++TS PVN+P+WS   +V+SVES  ++D    + + EMVPPHEY+AR   
Sbjct  79   VNSAGRRKRHVATSAPVNVPDWSKILKVESVESMRNNDVADGDWEREMVPPHEYVARSRH  138

Query  742  RTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
                +S+  G GR+LKGRDM RVRDAVWSQTGF G
Sbjct  139  VDGGSSVFLGVGRSLKGRDMRRVRDAVWSQTGFYG  173



>ref|XP_002888058.1| hypothetical protein ARALYDRAFT_475139 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64317.1| hypothetical protein ARALYDRAFT_475139 [Arabidopsis lyrata subsp. 
lyrata]
Length=197

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 83/228 (36%), Positives = 105/228 (46%), Gaps = 46/228 (20%)
 Frame = +1

Query  184  MAKGRK-LTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDS  360
            MAKGR   T + S+R LGSYSY   DSHG     E EL E+D+WS             D+
Sbjct  1    MAKGRNPTTMNRSDRYLGSYSYG--DSHGNSVTDELELAEEDIWSPAVIH--------DT  50

Query  361  SES----GEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSG  528
            SE+    G W+ RA     G                        G S+ FE      PS 
Sbjct  51   SETDESYGAWNLRATLGKNGRVG---------------------GLSMAFEGALAAPPSS  89

Query  529  VVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE-M  705
                 +  H G        R L++S PVN+P+WS   RVDSVES ++ D      +   M
Sbjct  90   SPMLVQKFHGGGGEGEEVRRKLASSAPVNVPDWSKIYRVDSVESIHELDVDDEEDEESGM  149

Query  706  VPPHEYLAREYGRTSAN---------SMCEGAGRTLKGRDMSRVRDAV  822
            +PPHEYLA+   R S           S+ EG GRTLKGR++ RVRDA+
Sbjct  150  MPPHEYLAKSQARRSRKIRGGGGGGASVFEGVGRTLKGRELRRVRDAI  197



>emb|CAA17160.1| putative protein [Arabidopsis thaliana]
 emb|CAB79148.1| putative protein [Arabidopsis thaliana]
Length=193

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 89/237 (38%), Positives = 115/237 (49%), Gaps = 56/237 (24%)
 Frame = +1

Query  166  R*TVTK--MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMAND  339
            R  VTK  M KGR L  S SER LGS+  S+          E EL E+DVWS V+     
Sbjct  3    RRQVTKRDMGKGRSLPISRSERFLGSHQQSDDHHVDGETTFELELMEEDVWSVVEPD---  59

Query  340  RRRGVDSSESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETT  519
                 +  E G W+ R+   SG  +                      G  ++  DL  T 
Sbjct  60   -----EPKELGAWNARSLEASGSEWRR-------------------KGGRVS--DL--TV  91

Query  520  PSGVVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNR--  693
            PS          DG        RH++TS PV +P+WS   +V+SV+S +++++   N   
Sbjct  92   PS----------DG-----QRKRHVATSAPVKVPDWSKILKVESVKSMHNNNNDNDNADV  136

Query  694  ---DFE--MVPPHEYLA-REYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
               D+E  MVPPHEY+A R       +S+  G GRTLKGRDM RVRDAVWSQTGF G
Sbjct  137  ADCDWESAMVPPHEYVAARSRNGDGGSSVFLGVGRTLKGRDMRRVRDAVWSQTGFYG  193



>ref|NP_193924.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM53278.1| putative protein [Arabidopsis thaliana]
 gb|AAN15346.1| putative protein [Arabidopsis thaliana]
 gb|AEE84531.1| uncharacterized protein AT4G21930 [Arabidopsis thaliana]
Length=183

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 111/229 (48%), Gaps = 54/229 (24%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            M KGR L  S SER LGS+  S+          E EL E+DVWS V+          +  
Sbjct  1    MGKGRSLPISRSERFLGSHQQSDDHHVDGETTFELELMEEDVWSVVEPD--------EPK  52

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
            E G W+ R+   SG  +                      G  ++  DL  T PS      
Sbjct  53   ELGAWNARSLEASGSEWRR-------------------KGGRVS--DL--TVPS------  83

Query  544  RGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNR-----DFE--  702
                DG        RH++TS PV +P+WS   +V+SV+S +++++   N      D+E  
Sbjct  84   ----DG-----QRKRHVATSAPVKVPDWSKILKVESVKSMHNNNNDNDNADVADCDWESA  134

Query  703  MVPPHEYLA-REYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            MVPPHEY+A R       +S+  G GRTLKGRDM RVRDAVWSQTGF G
Sbjct  135  MVPPHEYVAARSRNGDGGSSVFLGVGRTLKGRDMRRVRDAVWSQTGFYG  183



>ref|XP_009382720.1| PREDICTED: uncharacterized protein LOC103970604 [Musa acuminata 
subsp. malaccensis]
Length=170

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 56/82 (68%), Gaps = 2/82 (2%)
 Frame = +1

Query  607  PVNIPNWSNFNRV--DSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANSMCEGAGR  780
            PV +P W  F +   D+    +D +     RD   VPPHEYLARE GR+ A S+ EGAGR
Sbjct  89   PVEVPVWPKFLQAEPDAPVGLFDREVEEETRDGGWVPPHEYLAREKGRSVATSVLEGAGR  148

Query  781  TLKGRDMSRVRDAVWSQTGFNG  846
            TLKGRDMSRVRDAVWS+TGF G
Sbjct  149  TLKGRDMSRVRDAVWSRTGFFG  170



>ref|XP_009135451.1| PREDICTED: uncharacterized protein LOC103859632 [Brassica rapa]
Length=173

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 103/221 (47%), Gaps = 48/221 (22%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            M KGR+LT S SER L  +  S+       A  E EL E+DVWS ++             
Sbjct  1    MRKGRRLTISRSERFLWDHHKSSDRHMDGKAAVEMELMEEDVWSVMEA----------HE  50

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
            +   W+ R+   +GG   +                  + G +    D             
Sbjct  51   QPNAWTIRSPKTTGGERRH------------------NGGGTGGLAD-------------  79

Query  544  RGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEY  723
               +DG        +H+++S PV +P+WS  ++ +       +D+ +   D EMVPPHEY
Sbjct  80   --NNDG-----RRKKHVASSAPVKVPDWSEISKEEESIESSHNDNASDVGDGEMVPPHEY  132

Query  724  LAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            +AR      ++SM  G GRTLKGRDM RVRDAVWSQTGF+G
Sbjct  133  VARSRNGDGSSSMFLGVGRTLKGRDMRRVRDAVWSQTGFDG  173



>emb|CDX79110.1| BnaA01g11770D [Brassica napus]
Length=173

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 64/88 (73%), Gaps = 2/88 (2%)
 Frame = +1

Query  586  RHLSTSVPVNIPNWSNFNRVD-SVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANSM  762
            +H+++S PV +P WS  ++ + S+ES ++ D+ +   D EMVPPHEY+AR      ++SM
Sbjct  87   KHVASSAPVKVPEWSKISKEEESIESLHN-DNTSDVGDGEMVPPHEYVARSRNGDGSSSM  145

Query  763  CEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
              G GRTLKGRDM RVRDAVWSQTGF+G
Sbjct  146  FLGVGRTLKGRDMRRVRDAVWSQTGFDG  173



>ref|XP_010448966.1| PREDICTED: uncharacterized protein LOC104731330 [Camelina sativa]
 ref|XP_010497265.1| PREDICTED: uncharacterized protein LOC104774334 [Camelina sativa]
Length=176

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 99/232 (43%), Gaps = 67/232 (29%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            M KGR LT S SER LGS   S           E EL E+DVWS ++            +
Sbjct  1    MGKGRGLTVSRSERFLGSPHQSGDRVVDVETAVELELMEEDVWSVLEPD--------QPT  52

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
            E  +W+ R+    GG                                             
Sbjct  53   EESDWTARSLEAGGGER-------------------------------------------  69

Query  544  RGQHDGV-TAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE------  702
              +H+GV  A+    RH +TS PV +P+WS   ++   ES   S  H +N D +      
Sbjct  70   --RHNGVGRASGRRKRHAATSAPVKVPDWS---KILKPESVVGSMHHKNNDDADVADDDW  124

Query  703  ---MVPPHEYLA-REYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
               MVPPHEY+A R       +S+  G GRTLKGRDM RVRDAVWSQTGF G
Sbjct  125  ESGMVPPHEYVAARSRNGDGGSSVILGVGRTLKGRDMRRVRDAVWSQTGFYG  176



>ref|XP_009392755.1| PREDICTED: uncharacterized protein LOC103978629 [Musa acuminata 
subsp. malaccensis]
Length=165

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = +1

Query  586  RHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANSMC  765
            R ++ S P+ +P W +F RV+               +   VPPHEYLARE GR+ A S+ 
Sbjct  79   RTVAASAPMEVPVWPSFLRVEPEGPVGWLGREEEEEEGGWVPPHEYLAREKGRSVATSVL  138

Query  766  EGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            EG GRTLKGRDMSRVRDAVWS+TGF G
Sbjct  139  EGVGRTLKGRDMSRVRDAVWSRTGFFG  165



>ref|XP_006302821.1| hypothetical protein CARUB_v10020952mg [Capsella rubella]
 gb|EOA35719.1| hypothetical protein CARUB_v10020952mg [Capsella rubella]
Length=208

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 64/101 (63%), Gaps = 12/101 (12%)
 Frame = +1

Query  580  NVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE----MVPPHEYLAREYGRT  747
            N R L++S PVN+P+WS   RV+SVES ++ +      D E    M+PPHEY+A+   R 
Sbjct  108  NRRKLASSAPVNVPDWSKIYRVNSVESVHEMNGDDDEEDDEESRMMMPPHEYVAKSQARR  167

Query  748  SAN--------SMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            S          S+ EG GRTLKGR++ RVRDA+WSQTGF G
Sbjct  168  SRKIGGVDGGASVFEGVGRTLKGRELRRVRDAIWSQTGFYG  208



>ref|XP_010434102.1| PREDICTED: uncharacterized protein LOC104718126 [Camelina sativa]
Length=205

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 102/228 (45%), Gaps = 59/228 (26%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            M KGR LT S SER LGS   S +         E EL E+DVWS ++    D+      +
Sbjct  30   MGKGRGLTVSRSERFLGSPHQSGNRHVDVETSVELELMEEDVWSVLE---PDQ-----PT  81

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
            E   W+ R+   SGG                                             
Sbjct  82   EESAWTARSLEASGGE--------------------------------------------  97

Query  544  RGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSV------ESFYDSDSHTHNRDFEM  705
            R  + G  A+    RH++TS PV +P+WS   + +SV       +  D+D   ++ +  M
Sbjct  98   RRHNGGGRASGRRKRHVATSAPVKVPDWSKILKTESVVGSMHHNNNDDADVADNDWESGM  157

Query  706  VPPHEYLA-REYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            VPPHEY+A R       +S+  G GRTLKGRDM RVRDAVWSQTGF G
Sbjct  158  VPPHEYVAARSRNGDGGSSVILGVGRTLKGRDMRRVRDAVWSQTGFYG  205



>ref|XP_010439399.1| PREDICTED: uncharacterized protein LOC104722848 [Camelina sativa]
Length=176

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 104/229 (45%), Gaps = 61/229 (27%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRI-AGCESELGEDDVWSTVDGMANDRRRGVDS  360
            M KGR LTAS SER LGS  + + D H  +    E EL E+DVWS ++    D+      
Sbjct  1    MGKGRGLTASRSERFLGS-PHQSGDRHVDVETAVELELMEEDVWSVLE---PDQ-----P  51

Query  361  SESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQ  540
            +E   W+ R+   SGG                                            
Sbjct  52   TEESAWTARSLEASGGE-------------------------------------------  68

Query  541  FRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSV------ESFYDSDSHTHNRDFE  702
             R  + G  A+    RH++TS PV +P+WS   + +SV       +  D+D    + +  
Sbjct  69   -RRHNGGGRASGRRKRHVATSAPVKVPDWSKILKTESVVGSMHHNNNDDADVADDDWESG  127

Query  703  MVPPHEYLA-REYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            M PPHEY+A R       +S+  G GRTLKGRDM RVRDAVWSQTGF G
Sbjct  128  MGPPHEYVAARSRNGDGGSSVILGVGRTLKGRDMRRVRDAVWSQTGFYG  176



>ref|XP_009398796.1| PREDICTED: uncharacterized protein LOC103983291 [Musa acuminata 
subsp. malaccensis]
Length=183

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 99/224 (44%), Gaps = 44/224 (20%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGR+  A   ERLL + ++S   S    A     L EDD+W+  +G  ND   G D  
Sbjct  1    MAKGRRHGA---ERLLEAPAHSAGRSG---AADLPNLAEDDIWAAFEG-DNDEGGGQDRR  53

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
             S     RA S      D                     G SL FED    T +      
Sbjct  54   TS-----RARSRV--WVDGHVG-----------------GLSLNFEDSYHGTAAVAARSL  89

Query  544  RGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDS---VESFYDSDSHTHNRDFEMVPP  714
                      P +   ++ S PVN+P WS   R  S          +        E +PP
Sbjct  90   ----------PLDRLRVAASAPVNVPAWSRSLRSSSGVPPPEEEAEEEEEEETGGEWLPP  139

Query  715  HEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            HEYLAR  G+T   S+ EGAGRTLKGRDMSRVRDAVWSQTG+ G
Sbjct  140  HEYLARVQGKTMGTSVLEGAGRTLKGRDMSRVRDAVWSQTGYFG  183



>ref|XP_009408805.1| PREDICTED: uncharacterized protein LOC103991172 [Musa acuminata 
subsp. malaccensis]
Length=190

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 98/228 (43%), Gaps = 62/228 (27%)
 Frame = +1

Query  214  WSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMAN-----DRRRGVDSSESGEW  378
            W+ERLL + +      H   A    +L E +VWS+    A+     D R   D + +  W
Sbjct  8    WAERLLAAPARFGDQGHVACADDLPDLAEAEVWSSFLAPAHEAEDADGRHDPDHASTRPW  67

Query  379  SPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQFRGQHD  558
              R   + GG                          SL FE             +RG   
Sbjct  68   GHR---QVGGL-------------------------SLAFEG-----------AYRG---  85

Query  559  GVTAAPTN---VRH--LSTSVPVNIPNWSNFNRVDS-------VESFYDSDSHTHNRDFE  702
               AAP+    VRH  L+ S PV++P W    R  S                       E
Sbjct  86   ---AAPSQRPQVRHPALAASAPVDVPAWPRSLRAGSGGPAPEREGEGAGEGEGEGEDADE  142

Query  703  MVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             +PPHEY+AR +GR+ A S+ EGAGRTLKGRDMSRVRDAVWSQTGF G
Sbjct  143  WLPPHEYVARAHGRSMATSVLEGAGRTLKGRDMSRVRDAVWSQTGFFG  190



>ref|XP_009389746.1| PREDICTED: uncharacterized protein LOC103976267 [Musa acuminata 
subsp. malaccensis]
Length=185

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 66/122 (54%), Gaps = 11/122 (9%)
 Frame = +1

Query  481  GSSLTFEDLGETTPSGVVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVES  660
            G SL  ED     P+      RG+H         V  LS S PV++P WS   R      
Sbjct  75   GLSLALED-ACWGPAASQLVSRGRH--------RVSSLS-SAPVDVPAWSRSLRSGWEGP  124

Query  661  FYDSDSHTHNRDFEMVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
              D +      D E +PPHEYLAR  G++ A S+ EG GRTLKGRDMSRVRD VWSQTGF
Sbjct  125  LPDRE-EAEEADGEWLPPHEYLARAQGKSMATSVLEGVGRTLKGRDMSRVRDTVWSQTGF  183

Query  841  NG  846
             G
Sbjct  184  FG  185



>ref|XP_002869857.1| hypothetical protein ARALYDRAFT_492675 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46116.1| hypothetical protein ARALYDRAFT_492675 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 6/93 (6%)
 Frame = +1

Query  586  RHLSTSVPVNIPNWSNFNRVDSVESFYDSDSH-----THNRDFEMVPPHEYLA-REYGRT  747
            RH++TS PV +P+WS   +V+S++S +++++        N   E+VPPHEY+A R     
Sbjct  85   RHVATSAPVKVPDWSKILKVESIKSMHNNNNDDADAAVFNWGSEIVPPHEYVAARSRNGD  144

Query  748  SANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             ++S+  G GRTLKGRDM RVRDAVW QTGF G
Sbjct  145  GSSSVFLGVGRTLKGRDMRRVRDAVWRQTGFYG  177



>emb|CDX82885.1| BnaC01g13350D [Brassica napus]
Length=173

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 60/88 (68%), Gaps = 2/88 (2%)
 Frame = +1

Query  586  RHLSTSVPVNIPNWSN-FNRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANSM  762
            +H+++S PV +P+ S      +S+ES ++ D+       EMVPPHEY+AR      ++SM
Sbjct  87   KHVASSAPVKVPDCSEILKEKESIESLHN-DNAAEVGHGEMVPPHEYVARSRNGDGSSSM  145

Query  763  CEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
              G GRTLKGRDM RVRDAVWSQTGF+G
Sbjct  146  FLGVGRTLKGRDMRRVRDAVWSQTGFDG  173



>ref|XP_009387201.1| PREDICTED: uncharacterized protein LOC103974165 [Musa acuminata 
subsp. malaccensis]
Length=182

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 102/223 (46%), Gaps = 43/223 (19%)
 Frame = +1

Query  184  MAKGRKLTASWSERLLGSYSYSNSDSHGRIAGCESELGEDDVWSTVDGMANDRRRGVDSS  363
            MAKGR+  A   ERLL + ++S   S    A     L EDD+W+  +G  ND   G D  
Sbjct  1    MAKGRRHGA---ERLLEAPAHSAGRSG---AADLPNLAEDDIWAAFEG-DNDEGGGQDRR  53

Query  364  ESGEWSPRAGSESGGSFDNFrsrrhrprvprtehhrLDDGSSLTFEDLGETTPSGVVHQF  543
             S     RA S      D                     G SL FED    T +      
Sbjct  54   TS-----RARSRV--WVDGHVG-----------------GLSLNFEDSYHGTAAVAARSL  89

Query  544  RGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDF--EMVPPH  717
                      P +   ++ S PVN+P WS   R  S     + ++     +   E +PPH
Sbjct  90   ----------PLDRLRVAASAPVNVPAWSRSLRSSSSVPPPEEEAEEEEEETGSEWLPPH  139

Query  718  EYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            EYLAR  G+T   S+ EGAGRTLKGRDMSRVRDAVWSQTG+ G
Sbjct  140  EYLARVQGKTMGTSVLEGAGRTLKGRDMSRVRDAVWSQTGYFG  182



>ref|XP_010455755.1| PREDICTED: uncharacterized protein LOC104737310 [Camelina sativa]
Length=165

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 6/87 (7%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE----MVPPHEYLAREYGRT--SANS  759
            +S P+N+P+WS     DS  S + S   +H  D +    MVPPHE++AR+  RT  S+ S
Sbjct  77   SSAPMNVPDWSKVYGGDSKSSRWSSHLCSHGDDEDDDGCMVPPHEWVARKLARTQISSFS  136

Query  760  MCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            MCEG GRTLKGRD+S+VR+AV S+TGF
Sbjct  137  MCEGVGRTLKGRDLSKVRNAVLSKTGF  163



>ref|XP_009398222.1| PREDICTED: uncharacterized protein LOC103982883 [Musa acuminata 
subsp. malaccensis]
Length=190

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  694  DFEMVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            D E +PPHEYLAR +GR  A S+ EGAGRTLKGRDMSRVRDAVWSQTGF+G
Sbjct  140  DGEWLPPHEYLARAHGRCLATSVLEGAGRTLKGRDMSRVRDAVWSQTGFSG  190



>ref|XP_009599011.1| PREDICTED: uncharacterized protein LOC104094737 [Nicotiana tomentosiformis]
Length=148

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 59/111 (53%), Gaps = 18/111 (16%)
 Frame = +1

Query  562  VTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESF-----YDSDSHTHNRDFE--------  702
            +  A     H  +S PVNIP+WS          F     +DSD +  N   E        
Sbjct  36   IPRAKITPMHQQSSTPVNIPDWSKIYNKKKSSRFLKNGSWDSDENVENIVVEDEDCDYDF  95

Query  703  ---MVPPHEYLAREYGRTSAN--SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
               MVPPHEY+AR   R+     SMCEG GRTLKGRD+S++R+A+ ++TGF
Sbjct  96   GDGMVPPHEYIARRVARSQIAPFSMCEGVGRTLKGRDLSKLRNAILTKTGF  146



>ref|XP_009610044.1| PREDICTED: uncharacterized protein LOC104103814 [Nicotiana tomentosiformis]
Length=159

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 5/85 (6%)
 Frame = +1

Query  595  STSVPVNIPNWSNF--NRVDSVESFYDSDSHTHNRDFEM-VPPHEYLAREYGRTSANSMC  765
            STS+PVNIP+WS    +   S     D ++   + D+E  +PPHEYLAR   R ++ S+ 
Sbjct  75   STSLPVNIPDWSKILGDEYRSCPKEIDDNNVVEDFDYESGIPPHEYLAR--TRVASFSVH  132

Query  766  EGAGRTLKGRDMSRVRDAVWSQTGF  840
            EG GRTLKGRD+SRVR+A+W QTGF
Sbjct  133  EGIGRTLKGRDLSRVRNAIWKQTGF  157



>ref|XP_009769824.1| PREDICTED: uncharacterized protein LOC104220620 [Nicotiana sylvestris]
Length=148

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 59/102 (58%), Gaps = 18/102 (18%)
 Frame = +1

Query  589  HLSTSVPVNIPNWSN-FNRVDSVESF----YDSDSHTHNRDFE-----------MVPPHE  720
            H  +S PVNIP+WS  +N+  S        +DSD    N   E           MVPPHE
Sbjct  45   HQQSSAPVNIPDWSKIYNKKKSSRFLKNGSWDSDESVENIVAEDEDCDYDFGDGMVPPHE  104

Query  721  YLAREYGRTSAN--SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            Y+AR   R+     SMCEG GRTLKGRD+S++R+A+ ++TGF
Sbjct  105  YIARRVARSQIAPFSMCEGVGRTLKGRDLSKLRNAILTKTGF  146



>ref|XP_010689547.1| PREDICTED: uncharacterized protein LOC104903237 [Beta vulgaris 
subsp. vulgaris]
Length=163

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 66/109 (61%), Gaps = 10/109 (9%)
 Frame = +1

Query  541  FRGQHDGVTAAPTNVRH---LSTSVPVNIPNWSNFNR----VDSVESFYDSDSHTHNRDF  699
            +R       AAPT VR     + S+PVNIP+WS   R    VD   SF   D+   N + 
Sbjct  56   WRQSTRRAIAAPTPVRRRGDTAASLPVNIPDWSKILRDEYKVDEKWSFDGGDNGGDNGNG  115

Query  700  E-MVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFN  843
            E  VPPHEYLAR   R ++ S+ EG GRTLKGRD+++VR+A+W +TGF 
Sbjct  116  EEWVPPHEYLAR--TRMASFSVHEGIGRTLKGRDLNKVRNAIWEKTGFQ  162



>gb|ABK25188.1| unknown [Picea sitchensis]
Length=241

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 57/91 (63%), Gaps = 9/91 (10%)
 Frame = +1

Query  601  SVPVNIPNWSNFNRV-------DSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRT--SA  753
            S PVN+P+WS    V       ++   F+ + +       +M+PPHEYLARE  R+  + 
Sbjct  151  SAPVNVPDWSKILGVGMDRLKENNPNLFFSAAADEDEDGGDMLPPHEYLAREQARSQMTT  210

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             S+ EG GRTLKGRDMSRVR+AVW QTGF G
Sbjct  211  TSVFEGVGRTLKGRDMSRVRNAVWRQTGFLG  241



>gb|ABK26775.1| unknown [Picea sitchensis]
Length=276

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 57/91 (63%), Gaps = 9/91 (10%)
 Frame = +1

Query  601  SVPVNIPNWSNFNRV-------DSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRT--SA  753
            S PVN+P+WS    V       ++   F+ + +       +M+PPHEYLARE  R+  + 
Sbjct  186  SAPVNVPDWSKILGVGMDRLKENNPNLFFSAAADEDEDGGDMLPPHEYLAREQARSQMTT  245

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             S+ EG GRTLKGRDMSRVR+AVW QTGF G
Sbjct  246  TSVFEGVGRTLKGRDMSRVRNAVWRQTGFLG  276



>ref|XP_004249833.1| PREDICTED: uncharacterized protein LOC101261979 [Solanum lycopersicum]
Length=158

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 59/91 (65%), Gaps = 10/91 (11%)
 Frame = +1

Query  592  LSTSVPVNIPNWSNF----NRVDSVESFYDSDSHTHNR----DFEMVPPHEYLAREYGRT  747
            L+ S+PVNIP+WS      N+ ++++   + D          D   +PPHEYLA++ G  
Sbjct  68   LARSLPVNIPDWSKVQGDKNKNEAIQDKEEVDIQDKEEVDADDDTWIPPHEYLAKKRG--  125

Query  748  SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            ++ S+CEG GRTLKGRD+SR+RDA+  QTGF
Sbjct  126  ASFSVCEGVGRTLKGRDLSRLRDAILKQTGF  156



>ref|XP_006855856.1| hypothetical protein AMTR_s00037p00097690 [Amborella trichopoda]
 gb|ERN17323.1| hypothetical protein AMTR_s00037p00097690 [Amborella trichopoda]
Length=205

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 70/127 (55%), Gaps = 19/127 (15%)
 Frame = +1

Query  481  GSSLTFEDLGETTPSG---VVHQFRGQHDGVTAAPTNVRHLST-SVPVNIPNWSNFNRVD  648
            G SL FED   T P+    ++ QFRG    +T   +  +H +  S P+N+P+WS      
Sbjct  93   GLSLAFED-KHTNPAAAARIIQQFRG----MTMEKSEQQHGAVQSAPMNVPDWSRV----  143

Query  649  SVESFYDSDSHTHNRDFEMVPPHEYLAREYGRT-SANSMCEGAGRTLKGRDMSRVRDAVW  825
                           + E +PPHEYLAR    T +A S+ EG GRTLKGRDMSRVR+AVW
Sbjct  144  -----MGDAEDEGEEEGEWLPPHEYLARSRDNTVTATSVFEGVGRTLKGRDMSRVRNAVW  198

Query  826  SQTGFNG  846
             +TGF G
Sbjct  199  RRTGFFG  205



>ref|XP_001765057.1| predicted protein [Physcomitrella patens]
 gb|EDQ70052.1| predicted protein [Physcomitrella patens]
Length=160

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 57/94 (61%), Gaps = 6/94 (6%)
 Frame = +1

Query  571  APTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSD--SHTHNRDFEMVPPHEYLAREYGR  744
            +P  + H   S PVN+P+WS     +    + D D  S   +   E +PPH ++ REY +
Sbjct  67   SPRQMMH--QSAPVNVPDWSKILGAEKKHKWADEDVDSDKEDEQEERLPPHLHIQREYAQ  124

Query  745  TSAN--SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            +     S+CEGAGRTLKGRD+SRVR+AV  QTGF
Sbjct  125  SQMTTFSVCEGAGRTLKGRDLSRVRNAVLRQTGF  158



>gb|KDO73285.1| hypothetical protein CISIN_1g031000mg [Citrus sinensis]
Length=167

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 54/90 (60%), Gaps = 9/90 (10%)
 Frame = +1

Query  601  SVPVNIPNWSNF-------NRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANS  759
            SVPVNIP+WS         +R  + E   D D +    D E VPPHE+LAR+  RT   S
Sbjct  77   SVPVNIPDWSKILKDEYRDSRRRAAEDSDDEDGYGGGEDSERVPPHEFLARQMARTRIVS  136

Query  760  MC--EGAGRTLKGRDMSRVRDAVWSQTGFN  843
                EG GRTLKG D++RVR+A+W +TGF 
Sbjct  137  FSVHEGVGRTLKGGDLTRVRNAIWEKTGFQ  166



>ref|XP_010253678.1| PREDICTED: uncharacterized protein LOC104594856 [Nelumbo nucifera]
Length=168

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 60/90 (67%), Gaps = 7/90 (8%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVES-----FYDSDSHTHNRDFEMVPPHEYLAREYGRT--SA  753
            STS+PVNIP+WS   R D  ++       + D    + +   +PPHE+LAR++ RT  ++
Sbjct  78   STSLPVNIPDWSKILREDYRDTRRRENNDNFDDEDEDSEDSRIPPHEFLARQFARTRTAS  137

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGFN  843
             S+ EG GRTLKGRD+SRVR+A+W +TGF 
Sbjct  138  FSVHEGIGRTLKGRDLSRVRNAIWEKTGFQ  167



>emb|CDY16655.1| BnaA09g20330D [Brassica napus]
Length=167

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 62/91 (68%), Gaps = 15/91 (16%)
 Frame = +1

Query  598  TSVPVNIPNWSNF-----NRVDSVESFYDSDSHTHNRDFE---MVPPHEYLAREYGRT--  747
            +S P+N+P+WS       N+  S+ +      H+H+ D +   MVPPHE++AR+  +T  
Sbjct  80   SSAPMNVPDWSKIYGNARNKERSIHNL-----HSHDEDDDDGCMVPPHEWVARKLAKTQI  134

Query  748  SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            S+ SMCEG GRTLKGRD+S++R+AV ++TGF
Sbjct  135  SSFSMCEGVGRTLKGRDLSKMRNAVLTKTGF  165



>ref|XP_006363694.1| PREDICTED: uncharacterized protein LOC102595296 [Solanum tuberosum]
Length=147

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 55/84 (65%), Gaps = 12/84 (14%)
 Frame = +1

Query  601  SVPVNIPNWSNF----NRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANSMCE  768
            S+P+NIP+WS       + D +    + D+ T       +PPHEYLA++ G  ++ S+ E
Sbjct  70   SLPINIPDWSKILGDKKKNDDIRDKEEVDADT------WIPPHEYLAKKRG--ASFSVHE  121

Query  769  GAGRTLKGRDMSRVRDAVWSQTGF  840
            G GRTLKGRD+SRVRDA+W QTGF
Sbjct  122  GVGRTLKGRDLSRVRDAIWKQTGF  145



>ref|XP_002461294.1| hypothetical protein SORBIDRAFT_02g000350 [Sorghum bicolor]
 gb|EER97815.1| hypothetical protein SORBIDRAFT_02g000350 [Sorghum bicolor]
Length=168

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 54/93 (58%), Gaps = 16/93 (17%)
 Frame = +1

Query  568  AAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRT  747
            AAP   RH   S PV++P W      D     YD        D E VPPHEYL R +   
Sbjct  92   AAPA--RH---SAPVSVPEWPAATLPD-----YDGG------DLEWVPPHEYLQRRWCGA  135

Query  748  SANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
               S+ EGAGRTLKGRD++RVRDAVWS+TGF G
Sbjct  136  GGASVLEGAGRTLKGRDITRVRDAVWSKTGFFG  168



>ref|XP_010422288.1| PREDICTED: uncharacterized protein LOC104707610 [Camelina sativa]
Length=165

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 6/87 (7%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE----MVPPHEYLAREYGRT--SANS  759
            +S P+N+P+WS     DS  S   S   +H  D +    MVPPHE++AR+  RT  S+ S
Sbjct  77   SSAPMNVPDWSKVYGGDSKSSKKSSHLCSHGDDEDDDGCMVPPHEWVARKLARTQISSFS  136

Query  760  MCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            MCEG GRTLKGRD+S+VR+AV S+TGF
Sbjct  137  MCEGVGRTLKGRDLSKVRNAVLSKTGF  163



>gb|ABK22020.1| unknown [Picea sitchensis]
 gb|ACN40387.1| unknown [Picea sitchensis]
 gb|ACN40869.1| unknown [Picea sitchensis]
Length=276

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 56/91 (62%), Gaps = 9/91 (10%)
 Frame = +1

Query  601  SVPVNIPNWSNFNRV-------DSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRT--SA  753
            S PVN+P+WS    V       ++    + + +       +M+PPHEYLARE  R+  + 
Sbjct  186  SAPVNVPDWSKILGVGMDRLKENNPNLLFSAAADEDEDGGDMLPPHEYLAREQARSQMTT  245

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             S+ EG GRTLKGRDMSRVR+AVW QTGF G
Sbjct  246  TSVFEGVGRTLKGRDMSRVRNAVWRQTGFLG  276



>ref|XP_004957861.1| PREDICTED: uncharacterized protein LOC101756704 [Setaria italica]
Length=185

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 53/91 (58%), Gaps = 7/91 (8%)
 Frame = +1

Query  586  RHLSTSVPVNIPNW-SNFNRVDSVESF---YDSDSHTHNRDFEMVPPHEYLAREYGRTSA  753
            R ++ S PV +P W S+F   D    F      D    +     VPPH YLAR   R S 
Sbjct  98   RQVAASAPVEVPAWPSHFAVPDPALLFEMEMPEDEPGKDGAGGWVPPHVYLARRQARAS-  156

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
              + EG GRTLKGRDMSRVRDAVWS+TGF+G
Sbjct  157  --VVEGVGRTLKGRDMSRVRDAVWSRTGFDG  185



>gb|KFK30976.1| hypothetical protein AALP_AA6G052500 [Arabis alpina]
Length=165

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 66/104 (63%), Gaps = 15/104 (14%)
 Frame = +1

Query  574  PTNVRHLS--------TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE-----MVPP  714
            P N+ H S        +S P+N+P+WS     ++  +   S  H+H+ D +     MVPP
Sbjct  60   PWNINHRSKEVTRVKQSSAPMNVPDWSKVYGNNTKSNRKSSHLHSHDDDEDEDDGCMVPP  119

Query  715  HEYLAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            HE++AR+  RT  S+ SMCEG GRTLKGRD+S++R+AV ++TGF
Sbjct  120  HEWVARKLARTQISSFSMCEGIGRTLKGRDLSKMRNAVLTKTGF  163



>ref|XP_010043750.1| PREDICTED: uncharacterized protein LOC104432877 [Eucalyptus grandis]
Length=185

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 58/94 (62%), Gaps = 13/94 (14%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRV------------DSVESFYDSDSHTHNRDFEMVPPHEYLAREYG  741
            +S+PVNIP+WS   R             D+  S  D D+     D   VPPHE+LAR+  
Sbjct  90   SSLPVNIPDWSKILRGEYRENRRRDSLGDTCYSDDDEDACGGGEDGGRVPPHEFLARQMA  149

Query  742  RTS-ANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            RT  A+S+ EG GRTLKGRD+SRVR+A+W +TGF
Sbjct  150  RTRIASSVHEGVGRTLKGRDLSRVRNAIWEKTGF  183



>ref|XP_002874806.1| hypothetical protein ARALYDRAFT_911721 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51065.1| hypothetical protein ARALYDRAFT_911721 [Arabidopsis lyrata subsp. 
lyrata]
Length=167

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 8/89 (9%)
 Frame = +1

Query  598  TSVPVNIPNWSNF------NRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRT--SA  753
            +S P+N+P+WS        NR  S   ++D+D    + D  MVPPHE++AR+  RT  S+
Sbjct  77   SSAPMNVPDWSKVYGDSKSNRRSSHLHYHDADDDEEDDDGCMVPPHEWVARKLARTQISS  136

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             SMCEG GRTLKGRD+S+VR+AV S+TGF
Sbjct  137  FSMCEGVGRTLKGRDLSKVRNAVLSKTGF  165



>gb|AEW08411.1| hypothetical protein 2_9187_01, partial [Pinus radiata]
Length=104

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 52/94 (55%), Gaps = 7/94 (7%)
 Frame = +1

Query  580  NVRHLSTSVPVNIPNWSNFNRVDS-----VESFYDSDSHTHNRDFEMVPPHEYLAREYGR  744
            + R    S PVN+P WS  N++       V    +        D E +PPHE  AREY  
Sbjct  9    SARMYHRSAPVNVPPWSKSNQISMKSQLMVNPGLEEVEDDDENDEERLPPHEITAREYAM  68

Query  745  TSAN--SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            +     SMCEG GRTLKGRD SRVR+AVW QTGF
Sbjct  69   SQMTTFSMCEGLGRTLKGRDQSRVRNAVWRQTGF  102



>ref|XP_006354325.1| PREDICTED: uncharacterized protein LOC102591579 [Solanum tuberosum]
Length=160

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 56/88 (64%), Gaps = 12/88 (14%)
 Frame = +1

Query  595  STSVPVNIPNWSNF------NRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSAN  756
            +TS+PVNIP+WS        N   ++    D DS   NR    +PPHEYLAR   R ++ 
Sbjct  77   ATSLPVNIPDWSKILGDEKGNLGKNIMFDDDGDSDNENR----IPPHEYLART--RVASF  130

Query  757  SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            S+ EG GRTLKGRD+SRVR+A+W + GF
Sbjct  131  SVHEGIGRTLKGRDLSRVRNAIWKKIGF  158



>ref|XP_009114555.1| PREDICTED: uncharacterized protein LOC103839822 [Brassica rapa]
Length=166

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 61/88 (69%), Gaps = 9/88 (10%)
 Frame = +1

Query  598  TSVPVNIPNWSNF--NRVDSVESFYDSDSHTHNRDFE---MVPPHEYLAREYGRT--SAN  756
            +S P+N+P+WS    N      S ++   H+H+ D +   MVPPHE++AR+  +T  S+ 
Sbjct  79   SSAPMNVPDWSKIYGNARSKERSIHNL--HSHDEDDDDGCMVPPHEWVARKLAKTQISSF  136

Query  757  SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            SMCEG GRTLKGRD+S++R+AV ++TGF
Sbjct  137  SMCEGVGRTLKGRDLSKMRNAVLTKTGF  164



>dbj|BAC43196.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39924.1| At4g04630 [Arabidopsis thaliana]
Length=168

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 60/90 (67%), Gaps = 10/90 (11%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE-------MVPPHEYLAREYGRT--S  750
            +S P+N+P+WS     DS  +   S  H+H  D +       MVPPHE++AR+  RT  S
Sbjct  78   SSAPMNVPDWSKVYG-DSKSNRRSSHLHSHAADDDDEDDDGCMVPPHEWVARKLARTQIS  136

Query  751  ANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            + SMCEG GRTLKGRD+S+VR+AV S+TGF
Sbjct  137  SFSMCEGVGRTLKGRDLSKVRNAVLSKTGF  166



>ref|NP_567264.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM61390.1| unknown [Arabidopsis thaliana]
 gb|AEE82406.1| uncharacterized protein AT4G04630 [Arabidopsis thaliana]
Length=168

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 60/90 (67%), Gaps = 10/90 (11%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE-------MVPPHEYLAREYGRT--S  750
            +S P+N+P+WS     DS  +   S  H+H  D +       MVPPHE++AR+  RT  S
Sbjct  78   SSAPMNVPDWSKVYG-DSKSNRRSSHLHSHAADDDDEDDDGCMVPPHEWVARKLARTQIS  136

Query  751  ANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            + SMCEG GRTLKGRD+S+VR+AV S+TGF
Sbjct  137  SFSMCEGVGRTLKGRDLSKVRNAVLSKTGF  166



>ref|XP_011094663.1| PREDICTED: uncharacterized protein LOC105174308 [Sesamum indicum]
Length=160

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 58/97 (60%), Gaps = 11/97 (11%)
 Frame = +1

Query  577  TNVRHLST---SVPVNIPNWSNFNRVDSVE---SFYDSDSHTHNRD---FEMVPPHEYLA  729
             NV HL     S+PVNIP+WS   R +  +      D D      D    + +PPHEYLA
Sbjct  64   VNVDHLRVGPRSLPVNIPDWSQILRGEYRKHAGELTDVDYGDEEEDDGGNDRIPPHEYLA  123

Query  730  REYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            R   R ++ S+ EG GRTLKGRD+SRVR+A+W QTGF
Sbjct  124  RT--RVASLSVHEGVGRTLKGRDLSRVRNAIWKQTGF  158



>ref|XP_002519536.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42950.1| conserved hypothetical protein [Ricinus communis]
Length=176

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 60/102 (59%), Gaps = 14/102 (14%)
 Frame = +1

Query  562  VTAAPTNVRHLSTSVPVNIPNWSNFNRVD---------SVESFYDSDSHTHNRDFEMVPP  714
            VT  P      ++S+PVNIP+WS   RVD           +S YD  +H  +     VPP
Sbjct  78   VTKTPVTC---ASSLPVNIPDWSKIYRVDHRGQSNNLDDQDSDYDILNHDDDAYDGRVPP  134

Query  715  HEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            HEYLAR  G  ++ S+ EG GRTLKGRD+ +VR+A+W Q GF
Sbjct  135  HEYLARRRG--ASFSVHEGIGRTLKGRDLRQVRNAIWKQVGF  174



>ref|XP_010432523.1| PREDICTED: uncharacterized protein LOC104716776 [Camelina sativa]
Length=169

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (64%), Gaps = 10/91 (11%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE--------MVPPHEYLAREYGRT--  747
            +S P+N+P+WS     DS  S   S    H  D +        MVPPHE++AR+  RT  
Sbjct  77   SSAPMNVPDWSKVYGGDSKSSRRSSHLCFHGDDEDGDEDDDGCMVPPHEWVARKLARTQI  136

Query  748  SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            S+ SMCEG GRTLKGRD+S+VR+AV S+TGF
Sbjct  137  SSFSMCEGVGRTLKGRDLSKVRNAVLSKTGF  167



>ref|XP_004304430.1| PREDICTED: uncharacterized protein LOC101312271 [Fragaria vesca 
subsp. vesca]
Length=162

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 62/120 (52%), Gaps = 16/120 (13%)
 Frame = +1

Query  499  EDLGETTPSGVVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDS  678
            + L  T P     +      G TA        S+SVPVNIP+WS    +       D+  
Sbjct  51   KKLMSTIPREPRRKTTADQKGTTAV------TSSSVPVNIPDWSKI--LKEQRQQRDTSD  102

Query  679  HTHNRDFE------MVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
               N D+E       +PPHEYLAR  G  ++ S+ EG GRTLKGRD+ RVR+A+W Q GF
Sbjct  103  EDVNEDYEDGDADERLPPHEYLARNRG--ASFSVHEGVGRTLKGRDLRRVRNAIWKQVGF  160



>ref|NP_001044884.1| Os01g0862600 [Oryza sativa Japonica Group]
 dbj|BAD82590.1| prolyl 4-hydroxylase alpha subunit-like [Oryza sativa Japonica 
Group]
 dbj|BAF06798.1| Os01g0862600 [Oryza sativa Japonica Group]
 gb|EAY76581.1| hypothetical protein OsI_04528 [Oryza sativa Indica Group]
 dbj|BAG98377.1| unnamed protein product [Oryza sativa Japonica Group]
Length=219

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 56/87 (64%), Gaps = 5/87 (6%)
 Frame = +1

Query  589  HLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSAN---S  759
            H+  S PVN+P  + F R+ SVE+  D      + D EM+PPHE +AR   R S     S
Sbjct  133  HIPQSAPVNVP-VAQFRRL-SVEALMDKAEDDDDDDEEMLPPHEMVARARARDSPMTTFS  190

Query  760  MCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            + EGAGRTLKGRD+ +VR+AVW +TGF
Sbjct  191  VLEGAGRTLKGRDLRQVRNAVWRKTGF  217



>gb|KCW85739.1| hypothetical protein EUGRSUZ_B02501, partial [Eucalyptus grandis]
Length=236

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 58/94 (62%), Gaps = 13/94 (14%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRV------------DSVESFYDSDSHTHNRDFEMVPPHEYLAREYG  741
            +S+PVNIP+WS   R             D+  S  D D+     D   VPPHE+LAR+  
Sbjct  141  SSLPVNIPDWSKILRGEYRENRRRDSLGDTCYSDDDEDACGGGEDGGRVPPHEFLARQMA  200

Query  742  RTS-ANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            RT  A+S+ EG GRTLKGRD+SRVR+A+W +TGF
Sbjct  201  RTRIASSVHEGVGRTLKGRDLSRVRNAIWEKTGF  234



>ref|XP_006389614.1| hypothetical protein POPTR_0021s00640g [Populus trichocarpa]
 gb|ERP48528.1| hypothetical protein POPTR_0021s00640g [Populus trichocarpa]
Length=151

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 63/102 (62%), Gaps = 15/102 (15%)
 Frame = +1

Query  580  NVRHLSTSVPVNIPNWSNFNRVDSVE----------SFYDSDSHTHNR---DFEMVPPHE  720
             V    +S PVNIP+WS     +S            ++ D D H ++    D ++VPPHE
Sbjct  48   KVVQQQSSAPVNIPDWSKIYGKNSRNMGSWADHNGIAYDDGDYHVNDDEGGDDDIVPPHE  107

Query  721  YLAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            +LAR+  R+  S+ S+CEG GRTLKGRD+S+VR+A+ ++TGF
Sbjct  108  WLARKLARSQISSFSVCEGIGRTLKGRDLSKVRNAILTKTGF  149



>gb|EAZ14237.1| hypothetical protein OsJ_04162 [Oryza sativa Japonica Group]
Length=219

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 56/87 (64%), Gaps = 5/87 (6%)
 Frame = +1

Query  589  HLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSAN---S  759
            H+  S PVN+P  + F R+ SVE+  D      + D EM+PPHE +AR   R S     S
Sbjct  133  HIPQSAPVNVP-VAQFRRL-SVEALMDKAEDDDDDDEEMLPPHEMVARARARDSPMTTFS  190

Query  760  MCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            + EGAGRTLKGRD+ +VR+AVW +TGF
Sbjct  191  VLEGAGRTLKGRDLRQVRNAVWRKTGF  217



>ref|XP_010264683.1| PREDICTED: uncharacterized protein LOC104602622 [Nelumbo nucifera]
Length=168

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVES-----FYDSDSHTHNRDFEMVPPHEYLAREYGRTSANS  759
            + S+PVNIP+WS   R D   S       D D   ++ +   +PPHE+LAR++ RT   S
Sbjct  78   AMSLPVNIPDWSKILREDYRASRRAENDEDFDDDDNDSEDNKIPPHEFLARQFARTQIAS  137

Query  760  MC--EGAGRTLKGRDMSRVRDAVWSQTGFN  843
                EG GRTLKGRD+SRVR+A+W +TGF 
Sbjct  138  FSVHEGIGRTLKGRDLSRVRNAIWEKTGFQ  167



>ref|XP_004145741.1| PREDICTED: uncharacterized protein LOC101215539 [Cucumis sativus]
 ref|XP_004165435.1| PREDICTED: uncharacterized protein LOC101231271 [Cucumis sativus]
 gb|KGN46838.1| hypothetical protein Csa_6G141350 [Cucumis sativus]
Length=165

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 7/89 (8%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVD-----SVESFYDSDSHTHNRDFEMVPPHEYLAREYGRT--SA  753
            ++S+PVNIP+WS   + +     S+E   D +      +   VPPHE+LAR+  RT  ++
Sbjct  75   ASSLPVNIPDWSKILKEEYREKRSLEYADDMEEDEEEEEEMRVPPHEFLARQMARTRIAS  134

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             S+ EG GRTLKGRD+SRVR+A+W +TGF
Sbjct  135  FSVHEGIGRTLKGRDLSRVRNAIWEKTGF  163



>gb|ABK21985.1| unknown [Picea sitchensis]
 gb|ABR18469.1| unknown [Picea sitchensis]
Length=182

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 60/102 (59%), Gaps = 21/102 (21%)
 Frame = +1

Query  583  VRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEM-----------VPPHEYLA  729
            +RH   S PVN+P+WS    VD     +  D + +  D +M           +PPHEYLA
Sbjct  88   LRHHHQSAPVNVPDWSKILGVD-----HRKDQNPYAVDVDMAADEEEEEEERLPPHEYLA  142

Query  730  REYGR---TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            RE+ R   ++ +S+ EG G  LKGRDMSRVR+AVW QTGF G
Sbjct  143  REHARCRISTPSSVLEGVG--LKGRDMSRVRNAVWRQTGFLG  182



>ref|XP_009137232.1| PREDICTED: uncharacterized protein LOC103861270 [Brassica rapa]
 emb|CDX98721.1| BnaA03g45060D [Brassica napus]
Length=157

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 57/88 (65%), Gaps = 7/88 (8%)
 Frame = +1

Query  598  TSVPVNIPNWSNF--NRVDSVESFYDSDSHTHNRDFE---MVPPHEYLAREYGRT--SAN  756
            +S P+N+P+WS    N   S  S +     TH+ D +   MVPPHE +A+   RT  S+ 
Sbjct  58   SSAPMNVPDWSKIYGNTKKSTRSNHLHSWATHDEDDDEDSMVPPHELVAKRLARTQISSF  117

Query  757  SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            SMCEG GRTLKGRD+S+ R+AV ++TGF
Sbjct  118  SMCEGIGRTLKGRDLSKTRNAVLTKTGF  145



>gb|AAD29777.1|AF074021_9 hypothetical protein [Arabidopsis thaliana]
 emb|CAB80828.1| putative protein [Arabidopsis thaliana]
Length=202

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 60/90 (67%), Gaps = 10/90 (11%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE-------MVPPHEYLAREYGRT--S  750
            +S P+N+P+WS     DS  +   S  H+H  D +       MVPPHE++AR+  RT  S
Sbjct  78   SSAPMNVPDWSKVYG-DSKSNRRSSHLHSHAADDDDEDDDGCMVPPHEWVARKLARTQIS  136

Query  751  ANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            + SMCEG GRTLKGRD+S+VR+AV S+TGF
Sbjct  137  SFSMCEGVGRTLKGRDLSKVRNAVLSKTGF  166



>emb|CAN61164.1| hypothetical protein VITISV_001394 [Vitis vinifera]
Length=167

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 54/89 (61%), Gaps = 8/89 (9%)
 Frame = +1

Query  601  SVPVNIPNWSNFNRVD------SVESFYDSDSHTHNRDFEMVPPHEYLAREYGRT--SAN  756
            S+PVNIP+WS   R D            D D          VPPHE+LAR++ RT  ++ 
Sbjct  78   SLPVNIPDWSKILREDYRDNRRREADDDDDDEDDDGDSSSRVPPHEFLARQFARTRIASF  137

Query  757  SMCEGAGRTLKGRDMSRVRDAVWSQTGFN  843
            S+ EG GRTLKGRD+SRVR+A+W +TGF 
Sbjct  138  SVYEGIGRTLKGRDLSRVRNAIWEKTGFQ  166



>ref|XP_002285165.1| PREDICTED: uncharacterized protein LOC100253658 [Vitis vinifera]
Length=167

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 54/89 (61%), Gaps = 8/89 (9%)
 Frame = +1

Query  601  SVPVNIPNWSNFNRVD------SVESFYDSDSHTHNRDFEMVPPHEYLAREYGRT--SAN  756
            S+PVNIP+WS   R D            D D          VPPHE+LAR++ RT  ++ 
Sbjct  78   SLPVNIPDWSKILREDYRDNRRREADDDDDDEDDDGDSSSRVPPHEFLARQFARTRIASF  137

Query  757  SMCEGAGRTLKGRDMSRVRDAVWSQTGFN  843
            S+ EG GRTLKGRD+SRVR+A+W +TGF 
Sbjct  138  SVYEGIGRTLKGRDLSRVRNAIWEKTGFQ  166



>gb|ABR17234.1| unknown [Picea sitchensis]
Length=183

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 60/103 (58%), Gaps = 22/103 (21%)
 Frame = +1

Query  583  VRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEM------------VPPHEYL  726
            +RH   S PVN+P+WS    VD     +  D + +  D +M            +PPHEYL
Sbjct  88   LRHHHQSAPVNVPDWSKILGVD-----HRKDQNPYAVDVDMAADEEEEEEEERLPPHEYL  142

Query  727  AREYGR---TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            ARE+ R   ++ +S+ EG G  LKGRDMSRVR+AVW QTGF G
Sbjct  143  AREHARCRISTPSSVLEGVG--LKGRDMSRVRNAVWRQTGFLG  183



>emb|CDY29096.1| BnaC09g18220D [Brassica napus]
Length=150

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 61/89 (69%), Gaps = 9/89 (10%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE-----MVPPHEYLAREYGRT--SA  753
             +S P+N+P+WS      + +S   +  + H+RD +     MVPPHE++AR+  +T  S+
Sbjct  62   QSSAPMNVPDWSKV--YGNAKSKERTIHNLHSRDEDDDDGCMVPPHEWVARKLAKTQISS  119

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             SMCEG GRTLKGRD+S++R+AV ++TGF
Sbjct  120  FSMCEGVGRTLKGRDLSKMRNAVLTKTGF  148



>emb|CDX94568.1| BnaC09g22680D [Brassica napus]
Length=150

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 61/89 (69%), Gaps = 9/89 (10%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE-----MVPPHEYLAREYGRT--SA  753
             +S P+N+P+WS      + +S   +  + H+RD +     MVPPHE++AR+  +T  S+
Sbjct  62   QSSAPMNVPDWSKV--YGNAKSKERTIHNLHSRDEDDDDGCMVPPHEWVARKLAKTQISS  119

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             SMCEG GRTLKGRD+S++R+AV ++TGF
Sbjct  120  FSMCEGVGRTLKGRDLSKMRNAVLTKTGF  148



>gb|AFG64475.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
Length=104

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 51/94 (54%), Gaps = 7/94 (7%)
 Frame = +1

Query  580  NVRHLSTSVPVNIPNWSNFNRVD-----SVESFYDSDSHTHNRDFEMVPPHEYLAREYGR  744
            + R    S PVN+P WS  N+        V    +        D E +PPHE  AREY  
Sbjct  9    SARMYHRSAPVNVPPWSKSNQTSVKSQLMVNPGLEEVEDDDENDEERLPPHEITAREYAM  68

Query  745  TSAN--SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            +     SMCEG GRTLKGRD SRVR+AVW QTGF
Sbjct  69   SQMTTFSMCEGLGRTLKGRDQSRVRNAVWRQTGF  102



>emb|CDX94069.1| BnaC07g37030D [Brassica napus]
Length=157

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 57/88 (65%), Gaps = 7/88 (8%)
 Frame = +1

Query  598  TSVPVNIPNWSNF--NRVDSVESFYDSDSHTHNRDFE---MVPPHEYLAREYGRT--SAN  756
            +S P+N+P+WS    N   S  S +     TH+ D +   MVPPHE +A+   RT  S+ 
Sbjct  58   SSAPMNVPDWSKIYGNTKKSTRSNHLHSWATHDEDDDEDSMVPPHELVAKRLARTQISSF  117

Query  757  SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            SMCEG GRTLKGRD+S+ R+AV ++TGF
Sbjct  118  SMCEGIGRTLKGRDLSKTRNAVLTKTGF  145



>gb|AFG64465.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64466.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64467.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64468.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64469.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64470.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64471.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64472.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64473.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64474.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64476.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64477.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64478.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64479.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64480.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64481.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
 gb|AFG64482.1| hypothetical protein 2_9187_01, partial [Pinus taeda]
Length=104

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 51/94 (54%), Gaps = 7/94 (7%)
 Frame = +1

Query  580  NVRHLSTSVPVNIPNWSNFNRVDS-----VESFYDSDSHTHNRDFEMVPPHEYLAREYGR  744
            + R    S PVN+P WS  N+        V    +        D E +PPHE  AREY  
Sbjct  9    SARMYHRSAPVNVPPWSKSNQTSMKSQLMVNPGLEEVEDDDENDEERLPPHEITAREYAM  68

Query  745  TSAN--SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            +     SMCEG GRTLKGRD SRVR+AVW QTGF
Sbjct  69   SQMTTFSMCEGLGRTLKGRDQSRVRNAVWRQTGF  102



>tpg|DAA40985.1| TPA: hypothetical protein ZEAMMB73_135782 [Zea mays]
Length=192

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 56/102 (55%), Gaps = 18/102 (18%)
 Frame = +1

Query  586  RHLSTSVPVNIPNW-SNFNRVDSVESFY-----DSDSHTHNRDFE---------MVPPHE  720
            R  + S PV +P W + F   D+  S         D H   R+ +          VPPH 
Sbjct  94   RQAAASAPVEVPAWPARFAFPDADPSLLFEMEMGGDDHDEGREGDDGRQGQGAGWVPPHV  153

Query  721  YLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            YLAR   R S   + EGAGRTLKGRDMSRVRDAVWS+TGF+G
Sbjct  154  YLARRQARAS---VVEGAGRTLKGRDMSRVRDAVWSRTGFDG  192



>gb|EYU34447.1| hypothetical protein MIMGU_mgv1a023553mg [Erythranthe guttata]
Length=152

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 57/93 (61%), Gaps = 11/93 (12%)
 Frame = +1

Query  580  NVRHLST---SVPVNIPNWSNF---NRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYG  741
            +V HL+    SVPVN+P+WS              Y  D    N   + +PPHEYLAR   
Sbjct  63   HVDHLTVGPRSVPVNVPDWSKILGGEYKKRAGGEYVDDEEGGN---DKIPPHEYLART--  117

Query  742  RTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            R ++ S+ EGAGRTLKGRD+SRVR+A+W QTGF
Sbjct  118  RVASFSVHEGAGRTLKGRDLSRVRNAIWKQTGF  150



>dbj|BAJ96673.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01096.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +1

Query  559  GVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREY  738
            G++ A  + R ++ S PV +P W +  R   +E+  + D          VPPH YLAR  
Sbjct  79   GLSRAFADGRQVAASAPVQVPAWPS--RFADLET--EPDEQQQEDADGWVPPHVYLARRQ  134

Query  739  GRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             R S   + EG GRTLKGRD SRVRDAVWS+TGF G
Sbjct  135  ARAS---VVEGVGRTLKGRDASRVRDAVWSRTGFPG  167



>ref|XP_006413702.1| hypothetical protein EUTSA_v10027246mg [Eutrema salsugineum]
 gb|ESQ55155.1| hypothetical protein EUTSA_v10027246mg [Eutrema salsugineum]
Length=156

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 54/85 (64%), Gaps = 4/85 (5%)
 Frame = +1

Query  598  TSVPVNIPNWSNF--NRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRT--SANSMC  765
            +S P+N+P+WS    N   +  S +       + +  MVPPHE +AR   RT  S+ SMC
Sbjct  58   SSAPMNVPDWSKIYGNTKKNTRSSHLLIHDDDDDEDAMVPPHELVARRLARTQISSFSMC  117

Query  766  EGAGRTLKGRDMSRVRDAVWSQTGF  840
            EG GRTLKGRD+S+ R+A+ +QTGF
Sbjct  118  EGIGRTLKGRDLSKTRNAILTQTGF  142



>ref|XP_009420510.1| PREDICTED: uncharacterized protein LOC104000238 [Musa acuminata 
subsp. malaccensis]
Length=240

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 57/90 (63%), Gaps = 12/90 (13%)
 Frame = +1

Query  589  HLSTSVPVNIPNWSNFNR---VDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSAN-  756
            HL+ S+PVN+P      R   +++ +   D D H      E++PPHE +AR +GR S   
Sbjct  155  HLAQSLPVNVPVVPRRARRFEMEATDGADDGDGH------EIMPPHEIVARTFGRESPMT  208

Query  757  --SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
              S+ EGAGRTLKGRD+ RVRDAV+ QTGF
Sbjct  209  TFSVLEGAGRTLKGRDLRRVRDAVFRQTGF  238



>ref|XP_008243937.1| PREDICTED: uncharacterized protein LOC103342133 [Prunus mume]
Length=169

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 54/94 (57%), Gaps = 14/94 (15%)
 Frame = +1

Query  595  STSVPVNIPNWSN-FNRVDSVESFYDSDSHTHNRDFEM-----------VPPHEYLAREY  738
            S S+PVNIP+WSN        +   DSD      DF+            VPPHEYLAR  
Sbjct  76   SASLPVNIPDWSNILKEAYKDQRQRDSDEDRREEDFDGGDDDDDGGDGRVPPHEYLARTR  135

Query  739  GRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            G  ++ S+ EG GRTLKGRD+ RVR+A+W + GF
Sbjct  136  G--ASLSVHEGIGRTLKGRDLRRVRNAIWKKVGF  167



>ref|XP_008463944.1| PREDICTED: uncharacterized protein LOC103501949 [Cucumis melo]
Length=162

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 58/89 (65%), Gaps = 7/89 (8%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVD-----SVESFYDSDSHTHNRDFEMVPPHEYLAREYGRT--SA  753
            ++S+PVNIP+WS   + +     S E   D +      +   VPPHE+LAR+  RT  ++
Sbjct  72   ASSLPVNIPDWSKILKEEYREKRSSEYADDMEDDEDEEEEMRVPPHEFLARQMARTRIAS  131

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             S+ EG GRTLKGRD+SRVR+A+W +TGF
Sbjct  132  FSVHEGIGRTLKGRDLSRVRNAIWEKTGF  160



>gb|KHN02339.1| hypothetical protein glysoja_002363 [Glycine soja]
Length=139

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 4/82 (5%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANSMCEGA  774
            S+S+PV IP+WS   + D  E  +       + D++ VPPHEYLAR   R +++S+ EG 
Sbjct  60   SSSMPVAIPDWSKILKEDFKE--HKKREFVSDHDYDRVPPHEYLAR--TREASHSVHEGK  115

Query  775  GRTLKGRDMSRVRDAVWSQTGF  840
            GRTLKGRD+  VR+++W + GF
Sbjct  116  GRTLKGRDLRSVRNSIWKKLGF  137



>gb|ACU21467.1| unknown [Glycine max]
Length=152

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 4/82 (5%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANSMCEGA  774
            S+S+PV IP+WS   + D  E  +       + D++ VPPHEYLAR   R +++S+ EG 
Sbjct  73   SSSMPVAIPDWSKILKEDFKE--HKKREFVSDHDYDRVPPHEYLAR--TREASHSVHEGK  128

Query  775  GRTLKGRDMSRVRDAVWSQTGF  840
            GRTLKGRD+  VR+++W + GF
Sbjct  129  GRTLKGRDLRSVRNSIWKKLGF  150



>ref|XP_003539761.1| PREDICTED: uncharacterized protein LOC100812183 [Glycine max]
Length=170

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 59/87 (68%), Gaps = 8/87 (9%)
 Frame = +1

Query  598  TSVPVNIPNWSN-----FNRVDSVESFYDSDSHTHNRDFE-MVPPHEYLAREYGRTSANS  759
             SVPVNIP+WS      + R ++  S  D D+ ++N +    VPPHE+LAR   R ++ S
Sbjct  84   ASVPVNIPDWSKILGDEYRRKNNFHSDNDDDNESYNDERSGRVPPHEFLAR--NRVASFS  141

Query  760  MCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            + EG GRTLKGRD+S +R+A+W++TGF
Sbjct  142  VHEGVGRTLKGRDLSTLRNAIWAKTGF  168



>ref|XP_003554378.1| PREDICTED: uncharacterized protein LOC100808952 [Glycine max]
Length=152

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 4/82 (5%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANSMCEGA  774
            S+S+PV IP+WS   + D  E  +       + D++ VPPHEYLAR   R +++S+ EG 
Sbjct  73   SSSMPVAIPDWSKILKEDFKE--HKKREFVSDHDYDRVPPHEYLAR--TREASHSVHEGK  128

Query  775  GRTLKGRDMSRVRDAVWSQTGF  840
            GRTLKGRD+  VR+++W + GF
Sbjct  129  GRTLKGRDLRSVRNSIWKKLGF  150



>gb|KFK33927.1| hypothetical protein AALP_AA5G079000 [Arabis alpina]
Length=152

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 66/126 (52%), Gaps = 6/126 (5%)
 Frame = +1

Query  475  DDGSSLTFEDLGETTPSGVVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSNF----NR  642
            D G      DL   +P        G    V ++P   +    S+P+N+P+WS      NR
Sbjct  27   DSGYEFDESDLYSDSPDFRRKLRNGIKQSVRSSPVTTKKTIGSLPMNVPDWSKILREENR  86

Query  643  VDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAV  822
                 S  ++D      D   +PPHEYLAR   R ++ S+ EG GRTLKGRD+SRVR+A+
Sbjct  87   HSRRRSIENNDDGEDCIDGGRLPPHEYLART--RMASFSVHEGVGRTLKGRDLSRVRNAI  144

Query  823  WSQTGF  840
            + +TGF
Sbjct  145  FEKTGF  150



>ref|XP_002462928.1| hypothetical protein SORBIDRAFT_02g034690 [Sorghum bicolor]
 gb|EER99449.1| hypothetical protein SORBIDRAFT_02g034690 [Sorghum bicolor]
Length=194

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 54/96 (56%), Gaps = 12/96 (13%)
 Frame = +1

Query  586  RHLSTSVPVNIPNW-SNFNRVDSVESFYDSDSHTHNRDFEM--------VPPHEYLAREY  738
            R ++ S PV +P W + F   D+  +         + D           VPPH YLAR  
Sbjct  102  RQVAASAPVEVPAWPARFAVPDAEPALLFEMEMGDDDDEGDGKRGAGGWVPPHVYLARRQ  161

Query  739  GRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             R S   + EGAGRTLKGRDMSRVRDAVWS+TGF+G
Sbjct  162  ARAS---VVEGAGRTLKGRDMSRVRDAVWSRTGFDG  194



>ref|XP_006645063.1| PREDICTED: soluble starch synthase 2-3, chloroplastic/amyloplastic-like 
[Oryza brachyantha]
Length=221

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 55/87 (63%), Gaps = 5/87 (6%)
 Frame = +1

Query  589  HLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSAN---S  759
            H+  S PVN+P    F R+ SVE+  D      + D EM+PPHE +AR   R S     S
Sbjct  135  HIPQSAPVNVPA-PQFRRL-SVEAQMDKAEDDDDDDEEMLPPHEMVARARARDSPMTTFS  192

Query  760  MCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            + EGAGRTLKGRD+ +VR+AVW +TGF
Sbjct  193  VLEGAGRTLKGRDLRQVRNAVWRKTGF  219



>ref|XP_007206026.1| hypothetical protein PRUPE_ppa012473mg [Prunus persica]
 gb|EMJ07225.1| hypothetical protein PRUPE_ppa012473mg [Prunus persica]
Length=168

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 5/87 (6%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE---MVPPHEYLAREYGRT--SANS  759
            + S+PV IP+WS   R +  E+    D    + D E    VPPHE+LAR+  RT  ++ S
Sbjct  80   AASLPVGIPDWSKILRDEYRENRKSDDDDDGDDDVEGGVRVPPHEFLARQMARTRIASFS  139

Query  760  MCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            + EG GRTLKGRD+SRVR+A+W +TGF
Sbjct  140  VHEGVGRTLKGRDLSRVRNAIWEKTGF  166



>ref|XP_011047979.1| PREDICTED: uncharacterized protein LOC105142167 isoform X1 [Populus 
euphratica]
Length=191

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 66/109 (61%), Gaps = 19/109 (17%)
 Frame = +1

Query  571  APTN----VRHLSTSVPVNIPNWSNFNRVDSVE----------SFYDSDSHTHNR---DF  699
            +PTN    V    +S P+NIP+WS      S            ++ D D H ++    D 
Sbjct  81   SPTNHGGKVVQQQSSAPMNIPDWSKIYGKSSRNMGSWADHNGTAYDDGDYHINDDEGGDD  140

Query  700  EMVPPHEYLAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            ++VPPHE+LAR+  R+  S+ S+CEG GRTLKGRD+S+VR+A+ ++TGF
Sbjct  141  DIVPPHEWLARKLARSQISSFSVCEGIGRTLKGRDLSKVRNAILTKTGF  189



>ref|XP_006846774.1| hypothetical protein AMTR_s00148p00028850 [Amborella trichopoda]
 gb|ERN08355.1| hypothetical protein AMTR_s00148p00028850 [Amborella trichopoda]
Length=156

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 14/93 (15%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYD--------SDSHTHNRDFEMVPPHEYLAREYGRTS  750
            S S PVNIP+WS   R    E F D         +     R+ EMVPPH  +AR++ R +
Sbjct  67   SFSAPVNIPDWSKILR----EEFRDRHLERESDEEREYEEREGEMVPPHLLIARQFARAN  122

Query  751  ANSMC--EGAGRTLKGRDMSRVRDAVWSQTGFN  843
              S    EGAGRTLKGRD+SRVR+A+W +TGF 
Sbjct  123  IVSFSVHEGAGRTLKGRDLSRVRNAIWKKTGFQ  155



>ref|XP_011047980.1| PREDICTED: uncharacterized protein LOC105142167 isoform X2 [Populus 
euphratica]
 ref|XP_011047981.1| PREDICTED: uncharacterized protein LOC105142167 isoform X2 [Populus 
euphratica]
Length=189

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 66/109 (61%), Gaps = 19/109 (17%)
 Frame = +1

Query  571  APTN----VRHLSTSVPVNIPNWSNFNRVDSVE----------SFYDSDSHTHNR---DF  699
            +PTN    V    +S P+NIP+WS      S            ++ D D H ++    D 
Sbjct  79   SPTNHGGKVVQQQSSAPMNIPDWSKIYGKSSRNMGSWADHNGTAYDDGDYHINDDEGGDD  138

Query  700  EMVPPHEYLAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            ++VPPHE+LAR+  R+  S+ S+CEG GRTLKGRD+S+VR+A+ ++TGF
Sbjct  139  DIVPPHEWLARKLARSQISSFSVCEGIGRTLKGRDLSKVRNAILTKTGF  187



>ref|XP_010436451.1| PREDICTED: uncharacterized protein LOC104720202 [Camelina sativa]
Length=193

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 55/89 (62%), Gaps = 12/89 (13%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE------MVPPHEYLAREYGRT--SA  753
            +S P+NIP+W             +++SH H+   E      MVPPHE +AR   RT  S+
Sbjct  94   SSAPMNIPDWPKLYGYPK----KNTNSHLHSWGTEDDDEGSMVPPHELVARRLARTQISS  149

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             SMCEG GRTLKGRD+S+ R+AV ++TGF
Sbjct  150  FSMCEGIGRTLKGRDLSKTRNAVLTRTGF  178



>ref|XP_004153812.1| PREDICTED: uncharacterized protein LOC101208118 [Cucumis sativus]
 gb|KGN64516.1| hypothetical protein Csa_1G062910 [Cucumis sativus]
Length=177

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 60/96 (63%), Gaps = 5/96 (5%)
 Frame = +1

Query  568  AAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE---MVPPHEYLAREY  738
            A  T + +  +S PV+IP+WS         S  D D      D E   MVPPHE++A++ 
Sbjct  80   AHETQMANNRSSAPVDIPDWSKIYGKMGSSSTGDKDDVRDQEDGEDEDMVPPHEWIAQKL  139

Query  739  GRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             R+  S+ S+CEG GRTLKGRD+S+VR+A+ ++TGF
Sbjct  140  ARSRISSFSVCEGVGRTLKGRDLSKVRNAILTKTGF  175



>ref|XP_004158009.1| PREDICTED: uncharacterized protein LOC101225374 [Cucumis sativus]
Length=178

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 60/96 (63%), Gaps = 5/96 (5%)
 Frame = +1

Query  568  AAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE---MVPPHEYLAREY  738
            A  T + +  +S PV+IP+WS         S  D D      D E   MVPPHE++A++ 
Sbjct  81   AHETQMANNRSSAPVDIPDWSKIYGKMGSSSTGDKDDVRDQEDGEDEDMVPPHEWIAQKL  140

Query  739  GRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             R+  S+ S+CEG GRTLKGRD+S+VR+A+ ++TGF
Sbjct  141  ARSRISSFSVCEGVGRTLKGRDLSKVRNAILTKTGF  176



>gb|AFK35468.1| unknown [Lotus japonicus]
Length=166

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 65/131 (50%), Gaps = 25/131 (19%)
 Frame = +1

Query  487  SLTFEDLGETTPSGVVHQF-RGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESF  663
            SLT E   +  P+G      RG     +   +N   +S+S+PVNIP+WS   +       
Sbjct  46   SLTAETAKKVVPAGSRSALKRGSRKVDSGGKSNPAVVSSSLPVNIPDWSKILK-------  98

Query  664  YDSDSHTHNRDFE------------MVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSR  807
                 H  NR  +             +PPHEYLAR   R ++ S+ EG GRTLKGRD+  
Sbjct  99   ---QGHKENRGIDEYAVGDDQDGGSQLPPHEYLAR--ARGASFSVHEGKGRTLKGRDLRS  153

Query  808  VRDAVWSQTGF  840
            VR+A+W + GF
Sbjct  154  VRNAIWKKVGF  164



>ref|XP_010538971.1| PREDICTED: uncharacterized protein LOC104813134 [Tarenaya hassleriana]
Length=170

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 58/95 (61%), Gaps = 16/95 (17%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE------------MVPPHEYLAREYG  741
            +S PVN+P+WS      S  +     SH +  D +            MVPPHE++AR+  
Sbjct  76   SSAPVNVPDWSKI--YASKRNSMKKSSHLYYDDDDDDGHDDSTDDDVMVPPHEWVARKLA  133

Query  742  RT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            RT  S+ SMCEG GRTLKGRD+S+VR+AV ++TGF
Sbjct  134  RTRISSFSMCEGIGRTLKGRDLSKVRNAVLTRTGF  168



>ref|XP_007133098.1| hypothetical protein PHAVU_011G151500g [Phaseolus vulgaris]
 gb|ESW05092.1| hypothetical protein PHAVU_011G151500g [Phaseolus vulgaris]
Length=153

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 58/86 (67%), Gaps = 5/86 (6%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTH---NRDFEMVPPHEYLAREYGRT--SANSM  762
            +S P+++P+WS        +   D+ +      + D +MVPPHE++AR+  R+  S+ S+
Sbjct  66   SSEPMDVPDWSKIYGKSCTKGSRDAGACNKGGDDEDDDMVPPHEWIARKLARSQISSFSV  125

Query  763  CEGAGRTLKGRDMSRVRDAVWSQTGF  840
            CEG GRTLKGRD+S+VR+A+ ++TGF
Sbjct  126  CEGMGRTLKGRDLSKVRNAILAKTGF  151



>ref|XP_007207567.1| hypothetical protein PRUPE_ppa016754mg [Prunus persica]
 gb|EMJ08766.1| hypothetical protein PRUPE_ppa016754mg [Prunus persica]
Length=169

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 54/94 (57%), Gaps = 14/94 (15%)
 Frame = +1

Query  595  STSVPVNIPNWSN-FNRVDSVESFYDSDSHTHNRDFEM-----------VPPHEYLAREY  738
            S S+PVNIP+WSN        +   DSD      DF+            VPPHEYLAR  
Sbjct  76   SASLPVNIPDWSNILKEAYKDQRQRDSDEDRGKEDFDGGDDDDDGGDGRVPPHEYLARTR  135

Query  739  GRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            G  ++ S+ EG GRTLKGRD+ RVR+A+W + GF
Sbjct  136  G--ASFSVHEGIGRTLKGRDLRRVRNAIWKKVGF  167



>ref|NP_193928.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE84536.1| uncharacterized protein AT4G21970 [Arabidopsis thaliana]
Length=157

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 56/89 (63%), Gaps = 12/89 (13%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE------MVPPHEYLAREYGRT--SA  753
            +S P+NIP+WS         S  ++ SH H+   +      MVPPHE +A+   RT  S+
Sbjct  59   SSAPMNIPDWSKVYGY----SKKNTSSHLHSWAIDDDDEGSMVPPHELVAKRLARTQISS  114

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             SMCEG GRTLKGRD+S+ R+AV ++TGF
Sbjct  115  FSMCEGIGRTLKGRDLSKTRNAVLTRTGF  143



>ref|XP_006288768.1| hypothetical protein CARUB_v10002087mg [Capsella rubella]
 gb|EOA21666.1| hypothetical protein CARUB_v10002087mg [Capsella rubella]
Length=177

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 61/94 (65%), Gaps = 14/94 (15%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHT--HNRDFE---------MVPPHEYLAREYGR  744
            +S P+N+P+WS     DS +S     SH   H+ D +         MVPPHE++AR+  R
Sbjct  83   SSAPMNVPDWSKVYGGDS-KSTSRRSSHLRFHHGDDKDGGEDDDGCMVPPHEWVARKLAR  141

Query  745  T--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            T  S+ SMCEG GRTLKGRD+S+VR+AV S+TGF
Sbjct  142  TQISSFSMCEGVGRTLKGRDLSKVRNAVLSKTGF  175



>ref|XP_011037628.1| PREDICTED: uncharacterized protein LOC105134789 [Populus euphratica]
Length=194

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 63/107 (59%), Gaps = 23/107 (21%)
 Frame = +1

Query  589  HLSTSVPVNIPNWSNFNRVDS---VESFYD------------------SDSHTHNRDFEM  705
            H  +S PVNIP+WS     DS   + S+ D                   DS   + D ++
Sbjct  86   HQQSSAPVNIPDWSKIYGKDSRVIMASWVDDHNGIAYGDGDDDHVNDDVDSCDEDGDGDI  145

Query  706  VPPHEYLAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            VPPHE+LAR+  R+  S+ S+CEG GRTLKGRD+S+VR+A+ ++TGF
Sbjct  146  VPPHEWLARKLARSQISSFSVCEGIGRTLKGRDLSKVRNAILTKTGF  192



>ref|XP_009796302.1| PREDICTED: uncharacterized protein LOC104242882 [Nicotiana sylvestris]
Length=158

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 54/86 (63%), Gaps = 6/86 (7%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMV----PPHEYLAREYGRTSANSM  762
            +TS+PVNIP+WS     D   +     +   + D + V    PPHE LAR   R ++ SM
Sbjct  73   ATSLPVNIPDWSKILGNDYKNNCLRERNDNEDDDDDDVDSRIPPHELLART--RVASFSM  130

Query  763  CEGAGRTLKGRDMSRVRDAVWSQTGF  840
             EG GRTLKGRD+SRVR+A+W QTGF
Sbjct  131  QEGMGRTLKGRDLSRVRNAIWKQTGF  156



>gb|AFK46583.1| unknown [Lotus japonicus]
Length=166

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 67/127 (53%), Gaps = 17/127 (13%)
 Frame = +1

Query  487  SLTFEDLGETTPSGVVHQF-RGQHDGVTAAPTNVRHLSTSVPVNIPNWSNF-------NR  642
            SLT E   +  P+G      RG     +   +N   +S+S+PVNIP+WS         NR
Sbjct  46   SLTAETAKKVVPAGSRSALKRGSRKVDSGGKSNPAVVSSSLPVNIPDWSKILKQGYKENR  105

Query  643  -VDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDA  819
             +D      D D  +       +PPHEYLAR   R ++ S+ EG GRTLKGRD+  VR+A
Sbjct  106  GIDEYAVGDDQDGGSQ------LPPHEYLAR--ARGASFSVHEGKGRTLKGRDLRSVRNA  157

Query  820  VWSQTGF  840
            +W + GF
Sbjct  158  IWKKVGF  164



>ref|XP_008441031.1| PREDICTED: uncharacterized protein LOC103485264 [Cucumis melo]
 gb|ADN34054.1| hypothetical protein [Cucumis melo subsp. melo]
Length=174

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 63/93 (68%), Gaps = 5/93 (5%)
 Frame = +1

Query  577  TNVRHLSTSVPVNIPNWSN-FNRVDSVESFYDSDSHTHN--RDFEMVPPHEYLAREYGRT  747
            T + +  +S PV+IP+WS  + ++ S  +   +D        D +MVPPHE++A++  R+
Sbjct  80   TQMANNRSSAPVDIPDWSKIYGKMGSSSAGEKTDVRDQEDGEDDDMVPPHEWIAQKLARS  139

Query  748  --SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
              S+ S+CEG GRTLKGRD+S+VR+A+ ++TGF
Sbjct  140  RISSFSVCEGVGRTLKGRDLSKVRNAILTKTGF  172



>ref|XP_009612829.1| PREDICTED: uncharacterized protein LOC104106054 [Nicotiana tomentosiformis]
Length=157

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 3/83 (4%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVD-SVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANSMCEG  771
            +TS+PVNIP+WS     D       + +    +     +PPHE LAR   R ++ S+ EG
Sbjct  75   TTSLPVNIPDWSKILGNDYKNNCLRERNDDDDDDVDCRIPPHELLART--RVASFSVQEG  132

Query  772  AGRTLKGRDMSRVRDAVWSQTGF  840
             GRTLKGRD+SRVR+A+W QTGF
Sbjct  133  MGRTLKGRDLSRVRNAIWKQTGF  155



>ref|XP_002281329.1| PREDICTED: uncharacterized protein LOC100258555 [Vitis vinifera]
Length=163

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 8/88 (9%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVD------SVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSAN  756
            +TS+PVNIP+WS   R D              D    +     +PPHEYLAR   R ++ 
Sbjct  76   ATSLPVNIPDWSKILRDDYRLSQRKESDEDVDDVEEDDDHDSRIPPHEYLAR--TRVASF  133

Query  757  SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            S+ EG GRTLKGRD+SRVR+A+W + GF
Sbjct  134  SVHEGIGRTLKGRDLSRVRNAIWKKVGF  161



>ref|XP_008808441.1| PREDICTED: uncharacterized protein LOC103720500 [Phoenix dactylifera]
Length=165

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 61/107 (57%), Gaps = 22/107 (21%)
 Frame = +1

Query  586  RHLSTSVPVNIPNWSNFNR----VDSVESFYDSDSHTHNR----------------DFEM  705
            R    S PV IP+WS   +     +S    +D D    NR                D + 
Sbjct  57   RTFGQSAPVAIPDWSEIYKHKGSSESRSYRFDGDKDGQNRASDHAANDDDCEEDDDDDDK  116

Query  706  VPPHEYLAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            VPPHE+LA++  R+  S++SMCEGAGRTLKGRD+S++R+AV ++TGF
Sbjct  117  VPPHEWLAKKMARSQISSSSMCEGAGRTLKGRDLSKMRNAVLTRTGF  163



>emb|CAN66257.1| hypothetical protein VITISV_001236 [Vitis vinifera]
Length=163

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 8/88 (9%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVD------SVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSAN  756
            +TS+PVNIP+WS   R D              D    +     +PPHEYLAR   R ++ 
Sbjct  76   ATSLPVNIPDWSKILRDDYRLSQRKESDEDVDDVEEDDDHDSRIPPHEYLAR--TRVASF  133

Query  757  SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            S+ EG GRTLKGRD+SRVR+A+W + GF
Sbjct  134  SVHEGIGRTLKGRDLSRVRNAIWKKVGF  161



>ref|XP_009135481.1| PREDICTED: uncharacterized protein LOC103859660 [Brassica rapa]
 ref|XP_009135487.1| PREDICTED: uncharacterized protein LOC103859660 [Brassica rapa]
 emb|CDX79115.1| BnaA01g11820D [Brassica napus]
Length=153

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 57/88 (65%), Gaps = 11/88 (13%)
 Frame = +1

Query  598  TSVPVNIPNWSNF---NRVDSVESF--YDSDSHTHNRDFEMVPPHEYLAREYGRT--SAN  756
            +S P+N+P+WS      R + + S+  +D D   H+    MVPPHE +A+   RT  S+ 
Sbjct  58   SSAPMNVPDWSKIYGNTRSNHLHSWTTHDEDDDEHS----MVPPHELVAKMLARTQISSF  113

Query  757  SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            SMCEG GRTLKGRD+S+ R+ V ++TGF
Sbjct  114  SMCEGVGRTLKGRDLSKTRNDVLTKTGF  141



>emb|CAA18100.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79152.1| hypothetical protein [Arabidopsis thaliana]
Length=181

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 56/89 (63%), Gaps = 12/89 (13%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE------MVPPHEYLAREYGRT--SA  753
            +S P+NIP+WS         S  ++ SH H+   +      MVPPHE +A+   RT  S+
Sbjct  59   SSAPMNIPDWSKVYGY----SKKNTSSHLHSWAIDDDDEGSMVPPHELVAKRLARTQISS  114

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             SMCEG GRTLKGRD+S+ R+AV ++TGF
Sbjct  115  FSMCEGIGRTLKGRDLSKTRNAVLTRTGF  143



>ref|XP_003544880.1| PREDICTED: uncharacterized protein LOC100790453 isoform X1 [Glycine 
max]
 ref|XP_006595733.1| PREDICTED: uncharacterized protein LOC100790453 isoform X2 [Glycine 
max]
 gb|KHN11918.1| hypothetical protein glysoja_019891 [Glycine soja]
Length=190

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 58/101 (57%), Gaps = 18/101 (18%)
 Frame = +1

Query  592  LSTSVPVNIPNWSNFNRV-------------DSVESF---YDSDSHTHNRDFEMVPPHEY  723
            L  S PVNIP+WS   R              D V ++    D D   ++     +PPHE+
Sbjct  86   LQQSAPVNIPDWSKIYRTKLPKNSANSRFDGDGVANYGGGSDEDGEENDESDSKLPPHEF  145

Query  724  LAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            +AR   R+  S+ S+ EGAGRTLKGRD+S+VR+AV S+TGF
Sbjct  146  IARRLERSQISSFSVLEGAGRTLKGRDLSKVRNAVLSKTGF  186



>emb|CAA17164.1| putative protein [Arabidopsis thaliana]
Length=241

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 56/89 (63%), Gaps = 12/89 (13%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE------MVPPHEYLAREYGRT--SA  753
            +S P+NIP+WS         S  ++ SH H+   +      MVPPHE +A+   RT  S+
Sbjct  59   SSAPMNIPDWSKVYGY----SKKNTSSHLHSWAIDDDDEGSMVPPHELVAKRLARTQISS  114

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             SMCEG GRTLKGRD+S+ R+AV ++TGF
Sbjct  115  FSMCEGIGRTLKGRDLSKTRNAVLTRTGF  143



>ref|XP_011097873.1| PREDICTED: uncharacterized protein LOC105176685 [Sesamum indicum]
 ref|XP_011097874.1| PREDICTED: uncharacterized protein LOC105176685 [Sesamum indicum]
Length=186

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 59/110 (54%), Gaps = 18/110 (16%)
 Frame = +1

Query  550  QHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFY-------------DSDSHTHN  690
            +H   +  P  V H   S P+NIP+WS      S  +               + D     
Sbjct  74   RHHPNSQEPKIVHH---SAPLNIPDWSKIYGTTSKTTSKNDDGFPGSGWERDEDDKDVDG  130

Query  691  RDFEMVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             D  ++PPHE++AR   R S+ SMCEG GRTLKGRD+SRVR+AV ++TGF
Sbjct  131  EDGNVIPPHEWIAR--NRISSFSMCEGVGRTLKGRDLSRVRNAVLTKTGF  178



>ref|XP_008462513.1| PREDICTED: uncharacterized protein LOC103500846 [Cucumis melo]
Length=167

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (62%), Gaps = 12/91 (13%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVES---------FYDSDSHTHNRDFEMVPPHEYLAREYGRT  747
            + S+PVNIP+WS   R + +E+           D       + F  VPPHE+LA+   R 
Sbjct  78   AASLPVNIPDWSKILRNEYIENRRDDFEDEDGDDDGDEFEEKRFR-VPPHEFLAKT--RI  134

Query  748  SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            ++ S+ EG GRTLKGRD+SRVRDA+W +TGF
Sbjct  135  ASFSVHEGIGRTLKGRDLSRVRDAIWQKTGF  165



>gb|ABK26383.1| unknown [Picea sitchensis]
Length=172

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 54/100 (54%), Gaps = 11/100 (11%)
 Frame = +1

Query  559  GVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVES----FYDSDSHTHNRDFEMVPPHEYL  726
            G + + T +RH   S PVN+P+WS    VD  +       D        + E +PPHEYL
Sbjct  80   GDSESDTRLRHHHQSAPVNVPDWSKILGVDHRKEQNPVTVDVGMAGDEEEEERLPPHEYL  139

Query  727  AREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            ARE+ R          G  LKGRDMSRVR+AVW QTGF G
Sbjct  140  AREHARCRI-------GVGLKGRDMSRVRNAVWRQTGFLG  172



>ref|XP_008225670.1| PREDICTED: uncharacterized protein LOC103325290 [Prunus mume]
Length=166

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEM-VPPHEYLAREYGRT--SANSMC  765
            + S+PV IP+WS   R +  E+    D    + D  + VPPHE+LAR+  RT  ++ S+ 
Sbjct  80   AASLPVGIPDWSKILRDEYRENQKSDDDDDDDVDGGVRVPPHEFLARQMARTRIASFSVH  139

Query  766  EGAGRTLKGRDMSRVRDAVWSQTGF  840
            EG GRTLKGRD+SRVR+A+W +TGF
Sbjct  140  EGVGRTLKGRDLSRVRNAIWEKTGF  164



>ref|XP_010098187.1| hypothetical protein L484_007649 [Morus notabilis]
 gb|EXB74643.1| hypothetical protein L484_007649 [Morus notabilis]
Length=181

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 11/93 (12%)
 Frame = +1

Query  595  STSVPVNIPNWSNF-------NRVDSVESFYDSDSHTHNRDFE--MVPPHEYLAREYGRT  747
            + S+PVNIP+WS         NR        D D +      E   VPPHE+LAR+  RT
Sbjct  87   AASLPVNIPDWSKILRDEYRDNRTRDSIDDDDDDFNGGGDCDEGVRVPPHEFLARQMART  146

Query  748  --SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
              ++ S+ EG GRTLKGRD+SRVR+A+W +TGF
Sbjct  147  RIASFSVHEGIGRTLKGRDLSRVRNAIWEKTGF  179



>gb|EPS62644.1| hypothetical protein M569_12146, partial [Genlisea aurea]
Length=150

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 53/89 (60%), Gaps = 13/89 (15%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE-------MVPPHEYLAREYGRTSA  753
            + S+PVN+P+WS   +    E +Y         D E        +PPHE+LAR   R ++
Sbjct  66   AASLPVNVPDWSKILK----EEYYTEKRCGDGEDVEDVDYGEEKLPPHEFLAR--ARITS  119

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             S+ EG GRTLKGRD+ RVR+A+W +TGF
Sbjct  120  FSVHEGIGRTLKGRDLRRVRNAIWQKTGF  148



>emb|CBI26645.3| unnamed protein product [Vitis vinifera]
Length=226

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 60/88 (68%), Gaps = 3/88 (3%)
 Frame = +1

Query  586  RHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEM-VPPHEYLAREYGRT--SAN  756
            R +  S PV IP+WS     +S ++  ++ S   N D E  +PPHE+LA++Y R+  S+ 
Sbjct  137  RVVQQSAPVKIPDWSKIYGENSKKASSNNASWLDNNDDEGDLPPHEWLAKKYARSQISSF  196

Query  757  SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            S+ EG GRTLKGRD+SRVR+AV ++TGF
Sbjct  197  SVFEGVGRTLKGRDLSRVRNAVLTKTGF  224



>gb|KDP44049.1| hypothetical protein JCGZ_05516 [Jatropha curcas]
Length=177

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 10/92 (11%)
 Frame = +1

Query  598  TSVPVNIPNWSNF----NRVDSVESFYDSDSHTHNRDF----EMVPPHEYLAREYGRT--  747
            +S+PVNIP+WS       R +      D D      D+      VPPHE+LA++  RT  
Sbjct  85   SSLPVNIPDWSKILKDEYRENRRRDVDDDDDDVDGEDYFDGGSRVPPHEFLAKQMARTRI  144

Query  748  SANSMCEGAGRTLKGRDMSRVRDAVWSQTGFN  843
            ++ S+ EG GRTLKGRD+SRVR+A+W +TGF 
Sbjct  145  ASFSVHEGVGRTLKGRDLSRVRNAIWEKTGFQ  176



>gb|KDP29113.1| hypothetical protein JCGZ_16502 [Jatropha curcas]
Length=176

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 57/103 (55%), Gaps = 32/103 (31%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHT-HNRDFE--------------------MVP  711
            S+SVPVNIP+WS           Y  D +T HN+D +                     VP
Sbjct  83   SSSVPVNIPDWS---------KIYKEDQYTRHNKDQDDLDQESDHYGDDRDDDDRDGRVP  133

Query  712  PHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            PHEYLAR+ G  ++ S+ EG GRTLKGRD+ +VR+A+W + GF
Sbjct  134  PHEYLARKRG--ASFSVHEGIGRTLKGRDLRQVRNAIWKKVGF  174



>ref|XP_009597452.1| PREDICTED: uncharacterized protein LOC104093419 [Nicotiana tomentosiformis]
Length=162

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 60/103 (58%), Gaps = 20/103 (19%)
 Frame = +1

Query  559  GVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVES------FYDSDSHTHNRDFEMVPPHE  720
            GVTAA         S+PVN+P+WS   + +  E+               NR    +PPHE
Sbjct  71   GVTAA--------ASLPVNVPDWSKILKDEYRENRRSDSDDDFDGDDGENR----IPPHE  118

Query  721  YLAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGFN  843
            +LAR+  RT  ++ S+ EG GRTLKGRD+SRVR+A++ +TGF 
Sbjct  119  FLARQLARTRIASFSVHEGVGRTLKGRDLSRVRNAIFEKTGFQ  161



>ref|XP_002869851.1| hypothetical protein ARALYDRAFT_492672 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46110.1| hypothetical protein ARALYDRAFT_492672 [Arabidopsis lyrata subsp. 
lyrata]
Length=158

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 55/90 (61%), Gaps = 13/90 (14%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE-------MVPPHEYLAREYGRT--S  750
            +S P+NIP+WS         S  ++ SH H+   +       MVPPHE +A+   RT  S
Sbjct  59   SSAPMNIPDWSKVYGF----SKKNTRSHLHSWAIDDDDDEGSMVPPHELVAKRLARTQIS  114

Query  751  ANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            + SMCEG GRTLKGRD+S+ R+A+  +TGF
Sbjct  115  SFSMCEGIGRTLKGRDLSKTRNAILRRTGF  144



>ref|XP_008387660.1| PREDICTED: uncharacterized protein LOC103450120 [Malus domestica]
Length=179

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 59/94 (63%), Gaps = 15/94 (16%)
 Frame = +1

Query  595  STSVPVNIPNWSNF--------NRVDSVES----FYDSDSHTHNRDFEMVPPHEYLAREY  738
            S+S+PVNIP+WS           +++S E     FY +D   ++  +  VPPHEYLAR  
Sbjct  87   SSSLPVNIPDWSEILKEGYKEQRKLESGEDGGGDFYGADDD-NDSGYGRVPPHEYLARM-  144

Query  739  GRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             R ++ S+ EG GRTLKGRD+ RVR+A+W + GF
Sbjct  145  -RGASFSVHEGIGRTLKGRDLRRVRNAIWEKVGF  177



>ref|XP_003632958.1| PREDICTED: uncharacterized protein LOC100854465 [Vitis vinifera]
Length=190

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 62/102 (61%), Gaps = 22/102 (22%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNR--------VDSVESFYDSDSHTHN-----------RDFEMVPPHE  720
            +S P+NIP+WS   R        VD VE   D+  +TH             D ++VPPHE
Sbjct  88   SSAPMNIPDWSKIYRKNSRAMPWVDGVEDVNDA-GNTHQICVVDDDDDDDGDDDIVPPHE  146

Query  721  YLAREYG--RTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            ++AR+    + S+ S+CEG GRTLKGRD+S+VR+AV ++TGF
Sbjct  147  WIARKLASSQISSFSVCEGVGRTLKGRDLSKVRNAVLTKTGF  188



>gb|KDP20742.1| hypothetical protein JCGZ_21213 [Jatropha curcas]
Length=186

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 67/115 (58%), Gaps = 23/115 (20%)
 Frame = +1

Query  562  VTAAPTNVRHLSTSV-----PVNIPNWSNF------------NRVD--SVESFYDSDSHT  684
            + AA   + H + +V     PV IP+WS              +R D   V   Y+ D+  
Sbjct  71   IPAAEATILHEAQAVEQSSAPVKIPDWSKIYGKTTKMGSWAEDRTDHDPVNGPYN-DADN  129

Query  685  HNRDFE-MVPPHEYLAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             N D E MVPPHE++A++  R+  S+ S+CEG GRTLKGRD+S+VR+A+ ++TGF
Sbjct  130  ENDDGEGMVPPHEWIAKKLARSQISSFSVCEGIGRTLKGRDLSKVRNAILTKTGF  184



>gb|KCW87356.1| hypothetical protein EUGRSUZ_B03837 [Eucalyptus grandis]
Length=157

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +1

Query  601  SVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDF---EMVPPHEYLAREYGRTS--ANSMC  765
            S PVN+P      + + VE   ++      +DF   EM+PPHE +AR   R+   A S+ 
Sbjct  71   SAPVNVPVLMARRQREFVEVEDENVDVEDEKDFDGEEMLPPHEIVARRLSRSQSVACSVL  130

Query  766  EGAGRTLKGRDMSRVRDAVWSQTGF  840
            EGAGRTLKGRD+ +VR+AVW QTGF
Sbjct  131  EGAGRTLKGRDLRQVRNAVWRQTGF  155



>ref|XP_010276118.1| PREDICTED: uncharacterized protein LOC104610944 [Nelumbo nucifera]
Length=193

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 61/109 (56%), Gaps = 29/109 (27%)
 Frame = +1

Query  601  SVPVNIPNWSNFNRVDSVE---SFYDSDSH---THNRDF---------------------  699
            S PVNIP+WS   R  S     SF D  S    +H   F                     
Sbjct  83   SAPVNIPDWSKIYRKSSKGASGSFRDGSSSLRGSHKGAFLNDDGESDDAAHDDEDDDDDD  142

Query  700  EMVPPHEYLAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            +M+PPHE++AR+  R+  S+ S+CEGAGRTLKGRD+S+VR+AV ++TGF
Sbjct  143  DMIPPHEWIARKLARSQISSFSVCEGAGRTLKGRDLSKVRNAVLTRTGF  191



>ref|XP_006396678.1| hypothetical protein EUTSA_v10029023mg [Eutrema salsugineum]
 gb|ESQ38131.1| hypothetical protein EUTSA_v10029023mg [Eutrema salsugineum]
Length=168

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 57/90 (63%), Gaps = 12/90 (13%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE-------MVPPHEYLAREYGR--TS  750
            +S P+N+P+WS   +V          SH H+ D         MVPPHE++AR+  R   S
Sbjct  80   SSAPMNVPDWS---KVYGNTKSNRRSSHMHSNDDGDDDDDGCMVPPHEWVARKLARRQIS  136

Query  751  ANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            + SMCEG GRTLKGRD+S++R+AV ++TGF
Sbjct  137  SFSMCEGVGRTLKGRDLSKMRNAVLTKTGF  166



>ref|XP_008391399.1| PREDICTED: uncharacterized protein LOC103453622 [Malus domestica]
 ref|XP_008344939.1| PREDICTED: uncharacterized protein LOC103407844 [Malus domestica]
Length=178

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 54/94 (57%), Gaps = 13/94 (14%)
 Frame = +1

Query  592  LSTSVPVNIPNWSNFNRVDSVES-FYDSDSHTHNRDFEM----------VPPHEYLAREY  738
            + +S+PVNIP+WS   +    E    DSD H     +            VPPHEYLAR  
Sbjct  85   MPSSLPVNIPDWSKILKDGYKEQRKLDSDEHCGGEFYGDDEEDDGGDGRVPPHEYLARTR  144

Query  739  GRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            G  ++ S+ EG GRTLKGRD+ RVR+A+W + GF
Sbjct  145  G--ASFSVHEGIGRTLKGRDLRRVRNAIWKKVGF  176



>ref|XP_003563024.1| PREDICTED: uncharacterized protein LOC100822827 [Brachypodium 
distachyon]
Length=177

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 59/105 (56%), Gaps = 12/105 (11%)
 Frame = +1

Query  559  GVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNR---------DFEMVP  711
            G++ A  + R +++S PV +P W++     S+E   +  +    +         D   VP
Sbjct  76   GLSRAFADGRQVASSAPVAVPAWASRFAEMSLEDPPEPAAREKQQQQEEEGGADDDGWVP  135

Query  712  PHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
            PH YLAR   R S   + EG GRTLKGRD SRVRDAVWS+TGF G
Sbjct  136  PHVYLARRQARAS---VVEGVGRTLKGRDASRVRDAVWSRTGFPG  177



>ref|XP_010107536.1| hypothetical protein L484_024389 [Morus notabilis]
 gb|EXC16218.1| hypothetical protein L484_024389 [Morus notabilis]
Length=165

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 7/87 (8%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVD-----SVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANS  759
            S S+PVNIP+WS   + D      ++   D     +    + +PPHEYLAR  G  ++ S
Sbjct  79   SASLPVNIPDWSKILKDDYKDHRKIDDGDDGGDGGNGDLGDRIPPHEYLARTRG--ASLS  136

Query  760  MCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            + EG GRTLKGRD+ RVR+A+W + GF
Sbjct  137  VHEGVGRTLKGRDLRRVRNAIWKKVGF  163



>ref|XP_003543482.1| PREDICTED: uncharacterized protein LOC100814909 [Glycine max]
Length=154

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 66/122 (54%), Gaps = 19/122 (16%)
 Frame = +1

Query  502  DLGETTPSGVVHQFRGQHDGVTAAPTNVRHLSTSVPVNIPNWSN-----FNRVDSVESFY  666
            +L ++  S   H +         AP        S+PVN+P+WS      + R  +    Y
Sbjct  43   ELAKSVRSSRFHNYSSSSAARVGAPA-------SLPVNVPDWSKILGDEYGR--NQRRNY  93

Query  667  DSDSHTHNRDFE---MVPPHEYLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTG  837
            D D    + + +    VPPHE+LAR   R ++ S+ EG GRTLKGRD+SRVR+A+W++TG
Sbjct  94   DDDDEARSDEEDGVGRVPPHEFLART--RIASFSVHEGVGRTLKGRDLSRVRNAIWAKTG  151

Query  838  FN  843
            F 
Sbjct  152  FQ  153



>ref|XP_011096060.1| PREDICTED: uncharacterized protein LOC105175340 [Sesamum indicum]
Length=186

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 55/100 (55%), Gaps = 19/100 (19%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDS------------HTHNRDFE-----MVPPHEYL  726
            +S P++IP+WS   +     + +D               H    D E     MVPPHEYL
Sbjct  85   SSAPMSIPDWSKILKKQPNRNLWDDACDAHDDDVGRKLHHVKANDVESDDDDMVPPHEYL  144

Query  727  AREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            AR    T  ++ SMCEG GRTLKGRD+S +R+A+ ++TGF
Sbjct  145  ARRLASTQIASFSMCEGVGRTLKGRDLSNLRNAILTKTGF  184



>ref|XP_006352633.1| PREDICTED: SUN domain-containing protein 2-like [Solanum tuberosum]
Length=161

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 4/84 (5%)
 Frame = +1

Query  601  SVPVNIPNWSNF--NRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGR--TSANSMCE  768
            S PV IP+WS     ++    + + SD      +  ++PPHE+LA+   R   S+ S+CE
Sbjct  76   SAPVKIPDWSKIYGTKLKKEINNFGSDDDDEEIEENVMPPHEWLAKRIDRREISSFSVCE  135

Query  769  GAGRTLKGRDMSRVRDAVWSQTGF  840
            G GRTLKGRD+SRVR+AV ++TGF
Sbjct  136  GVGRTLKGRDLSRVRNAVLTKTGF  159



>ref|XP_006285893.1| hypothetical protein CARUB_v10007405mg [Capsella rubella]
 gb|EOA18791.1| hypothetical protein CARUB_v10007405mg [Capsella rubella]
Length=168

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 55/89 (62%), Gaps = 12/89 (13%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTH----NRDFE--MVPPHEYLAREYGRT--SA  753
            +S P+NIP+WS             + SH H    + D E  MVPPHE +A+   RT  S+
Sbjct  68   SSAPMNIPDWSKVYGYPK----KSTSSHLHPWATDEDDEGSMVPPHELVAKRLARTQISS  123

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             SMCEG GRTLKGRD+S+ R+AV ++TGF
Sbjct  124  FSMCEGIGRTLKGRDLSKTRNAVLTRTGF  152



>ref|XP_006292450.1| hypothetical protein CARUB_v10018671mg [Capsella rubella]
 gb|EOA25348.1| hypothetical protein CARUB_v10018671mg [Capsella rubella]
Length=168

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 60/100 (60%), Gaps = 11/100 (11%)
 Frame = +1

Query  568  AAPTNVRHLSTSVPVNIPNWSNF--------NRVDSVESFYDSDSHTHNRDF-EMVPPHE  720
            AA      +S+S+PVN+P+WS           R  S+E+  D   +       E++PPHE
Sbjct  69   AAAKTTTVVSSSLPVNVPDWSKILGKENNRHVRRKSIENDDDGGGYGGVGGGGEVLPPHE  128

Query  721  YLAREYGRTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            YLA+   R ++ S+ EG GRTLKGRDMSRVR+A+  +TGF
Sbjct  129  YLAK--TRMASFSVHEGVGRTLKGRDMSRVRNAILEKTGF  166



>ref|XP_003542862.1| PREDICTED: uncharacterized protein LOC100796416 isoform 2 [Glycine 
max]
Length=182

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 60/92 (65%), Gaps = 11/92 (12%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNR--------DFEMVPPHEYLAREYGRT-  747
            S+S P++IP+WS      S +    +D    N+        D +MVPPHE++AR+  R+ 
Sbjct  90   SSSAPMDIPDWSKIYG-KSCKKGSTADDGASNKGGDDDDDDDDDMVPPHEWIARKLARSQ  148

Query  748  -SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             S+ S+CEG GRTLKGRD+S+VR+A+ ++TGF
Sbjct  149  ISSFSVCEGMGRTLKGRDLSKVRNAILTKTGF  180



>ref|XP_010037963.1| PREDICTED: uncharacterized protein LOC104426559 [Eucalyptus grandis]
 gb|KCW49755.1| hypothetical protein EUGRSUZ_K03248 [Eucalyptus grandis]
Length=176

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 51/87 (59%), Gaps = 6/87 (7%)
 Frame = +1

Query  592  LSTSVPVNIPNWSNFNRVDSVES----FYDSDSHTHNRDFEMVPPHEYLAREYGRTSANS  759
            +++S+PVNIP+WS  N +             D    +     VPPHEYLAR  G  ++ S
Sbjct  90   VASSLPVNIPDWSKINMLRDRRKGGGRVESDDEEGEDDRDSRVPPHEYLARRRG--ASLS  147

Query  760  MCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            + EG GRTLKGRD+SRVRDA+W   G 
Sbjct  148  VHEGIGRTLKGRDLSRVRDAIWKTVGL  174



>gb|KHN37606.1| hypothetical protein glysoja_007309 [Glycine soja]
Length=182

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 60/92 (65%), Gaps = 11/92 (12%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNR--------DFEMVPPHEYLAREYGRT-  747
            S+S P++IP+WS      S +    +D    N+        D +MVPPHE++AR+  R+ 
Sbjct  90   SSSAPMDIPDWSKIYG-KSCKKGSTADDGASNKGGDDDDDDDDDMVPPHEWIARKLARSQ  148

Query  748  -SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             S+ S+CEG GRTLKGRD+S+VR+A+ ++TGF
Sbjct  149  ISSFSVCEGMGRTLKGRDLSKVRNAILTKTGF  180



>gb|EAZ04057.1| hypothetical protein OsI_26194 [Oryza sativa Indica Group]
Length=194

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 52/92 (57%), Gaps = 8/92 (9%)
 Frame = +1

Query  586  RHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE-----MVPPHEYLAREYGRTS  750
            R ++ S PV +P W       +  +F + +      D        VPPH YLAR   R+S
Sbjct  106  RQVAASAPVQVPAWPGRYADPNQAAFAEEEKRREEEDDAGDGDGWVPPHVYLARRQARSS  165

Query  751  ANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
               + EG GRTLKGRD SRVRDAVWS+TGF+G
Sbjct  166  ---VVEGVGRTLKGRDASRVRDAVWSRTGFDG  194



>ref|NP_001168585.1| hypothetical protein [Zea mays]
 gb|ACN28773.1| unknown [Zea mays]
 tpg|DAA62910.1| TPA: hypothetical protein ZEAMMB73_832563 [Zea mays]
Length=188

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 54/94 (57%), Gaps = 10/94 (11%)
 Frame = +1

Query  586  RHLSTSVPVNIPNW-SNFNRVDSVESFYDSDSHTHNRDFEM------VPPHEYLAREYGR  744
            R  + S PV +  W + F+  D+  +         + D +       VPPH YLAR   R
Sbjct  98   RQAAASAPVEVAAWPARFSVPDAEPTLLFEMEMGDDDDDKGEGDAGWVPPHVYLARRQAR  157

Query  745  TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             S   + EGAGRTLKGRDMSRVRDAVWS+TGF+G
Sbjct  158  AS---VVEGAGRTLKGRDMSRVRDAVWSRTGFDG  188



>ref|NP_001240052.1| uncharacterized protein LOC100796494 [Glycine max]
 ref|XP_006574427.1| PREDICTED: uncharacterized protein LOC100796494 isoform X1 [Glycine 
max]
 gb|ACU23421.1| unknown [Glycine max]
 gb|KHN38272.1| hypothetical protein glysoja_003937 [Glycine soja]
Length=195

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 57/104 (55%), Gaps = 21/104 (20%)
 Frame = +1

Query  592  LSTSVPVNIPNWSNFNRV----DSVESFY---------------DSDSHTHNRDFEMVPP  714
            L  S PVNIP+WS   R     +SV  F                D D   ++     +PP
Sbjct  88   LQQSAPVNIPDWSKIYRTKTPKNSVSRFDDDYDGDGAANYGGDSDEDGEENDESDSKLPP  147

Query  715  HEYLAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            HE++AR   R+  S+ S+ EGAGRTLKGRD+S+VR+ V S+TGF
Sbjct  148  HEFIARRLARSRISSFSVLEGAGRTLKGRDLSKVRNDVLSKTGF  191



>ref|XP_010425942.1| PREDICTED: uncharacterized protein LOC104710977 isoform X1 [Camelina 
sativa]
Length=155

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 56/92 (61%), Gaps = 17/92 (18%)
 Frame = +1

Query  592  LSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE---------MVPPHEYLAREYGR  744
            +++S+PVN+P+WS       +    + + H   R  E         ++PPHEYLA+   R
Sbjct  70   VASSLPVNVPDWSK------ILGKENHNRHVRRRSIENDEDGGGGELLPPHEYLAK--TR  121

Query  745  TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             ++ S+ EG GRTLKGRDMSRVR+A+  +TGF
Sbjct  122  MASFSVHEGVGRTLKGRDMSRVRNAILEKTGF  153



>ref|XP_002456678.1| hypothetical protein SORBIDRAFT_03g040710 [Sorghum bicolor]
 gb|EES01798.1| hypothetical protein SORBIDRAFT_03g040710 [Sorghum bicolor]
Length=207

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = +1

Query  562  VTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYG  741
            + A P    ++  S+PVN+P  +   +   V    +++    + D EM+PPHE +AR   
Sbjct  115  IPAVPRPAPYMPQSLPVNVP-VARLRKPPVVMVMGEAE----DEDDEMLPPHEMVARARA  169

Query  742  RTSAN---SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            R S     S+ EGAGRTLKGRD+ +VR+AVW +TGF
Sbjct  170  RESPMTTFSVLEGAGRTLKGRDLRQVRNAVWRRTGF  205



>ref|XP_008804302.1| PREDICTED: pre-rRNA-processing protein esf2-like [Phoenix dactylifera]
Length=168

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 58/103 (56%), Gaps = 23/103 (22%)
 Frame = +1

Query  601  SVPVNIPNWSNF-NRVDSVESF---YDSDSHTHNR-----------------DFEMVPPH  717
            S PV IP+WS   N   S ES    +D D    NR                 D + VPPH
Sbjct  64   SAPVAIPDWSKICNHKGSSESHGSRFDGDEAGRNRGKNTVADDDDDDDDEDDDDDKVPPH  123

Query  718  EYLAREYGRTSANS--MCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            E+LA++  R+   S  MCEGAGRTLKGRD+S+VR+AV ++TGF
Sbjct  124  EWLAKKMARSQIPSFSMCEGAGRTLKGRDLSKVRNAVLTRTGF  166



>gb|KEH36866.1| senescence regulator [Medicago truncatula]
Length=156

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 55/83 (66%), Gaps = 3/83 (4%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRT--SANSMCEG  771
            +S P+NIP+WS     +S       D        +MVPPHE++AR+  R+  S+ S+CEG
Sbjct  73   SSAPMNIPDWSKVYGKNSKNGGLHDDEDGDEDG-DMVPPHEWIARKLARSQISSFSVCEG  131

Query  772  AGRTLKGRDMSRVRDAVWSQTGF  840
             GRTLKGRD+S+VR+A+ ++TGF
Sbjct  132  MGRTLKGRDLSKVRNAILTKTGF  154



>ref|XP_009787318.1| PREDICTED: uncharacterized protein LOC104235292 [Nicotiana sylvestris]
Length=168

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 63/112 (56%), Gaps = 16/112 (14%)
 Frame = +1

Query  544  RGQHDGVTAAPTNVRHLSTSVPVNIPNWSNFNRVDSVE----------SFYDSDSHTHNR  693
            R Q D  +    +V  ++ S+PVN+P+WS   + +  E             +      NR
Sbjct  60   RKQCDTKSRRSGSVASVAASLPVNVPDWSKILKDEYREYGRRDSDDDDFNDEDGDDLENR  119

Query  694  DFEMVPPHEYLAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGFN  843
                +PPHE+LA++  RT  ++ S+ +G GRTLKGRD+SRVR+A+W +TGF 
Sbjct  120  ----IPPHEFLAKQLERTRIASFSVHDGVGRTLKGRDLSRVRNAIWEKTGFQ  167



>ref|XP_004139450.1| PREDICTED: uncharacterized protein LOC101217269 [Cucumis sativus]
 ref|XP_004160905.1| PREDICTED: uncharacterized LOC101217269 [Cucumis sativus]
 gb|KGN64850.1| hypothetical protein Csa_1G132110 [Cucumis sativus]
Length=167

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 12/91 (13%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVES---------FYDSDSHTHNRDFEMVPPHEYLAREYGRT  747
            + S+PVNIP+WS   R + +++           D       + F  VPPHE+LA+   R 
Sbjct  78   AASLPVNIPDWSKILRNEYIDNRRDDFEDEDGDDEGDEVEEKRFR-VPPHEFLAKT--RI  134

Query  748  SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            ++ S+ EG GRTLKGRD+SRVRDA+W +TGF
Sbjct  135  ASFSVHEGIGRTLKGRDLSRVRDAIWQKTGF  165



>gb|AEW08415.1| hypothetical protein 2_9289_01, partial [Pinus radiata]
 gb|AFG68822.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68823.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68824.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68825.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68826.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68827.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68828.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68829.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68830.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68831.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68832.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68834.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68835.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68836.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68837.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68838.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
 gb|AFG68839.1| hypothetical protein 2_9289_01, partial [Pinus taeda]
Length=97

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 13/97 (13%)
 Frame = +1

Query  583  VRHLSTSVPVNIPNWSNFNRVDSVESFYDSD---------SHTHNRDFEMVPPHEYLARE  735
            +RH   S PVNIP+WS   R +S       +             +++ E +PPHE +AR+
Sbjct  1    IRH--QSAPVNIPDWSRVQRRESHRRITPIEDGFGIDEDDGEEEDKEDERIPPHELIARQ  58

Query  736  YGRTSANS--MCEGAGRTLKGRDMSRVRDAVWSQTGF  840
              R+   S  + EGAGRTLKGRD+SRVR+AV ++TGF
Sbjct  59   LARSQITSFSVFEGAGRTLKGRDLSRVRNAVLTRTGF  95



>ref|XP_003597242.1| hypothetical protein MTR_2g094410 [Medicago truncatula]
 gb|AES67493.1| senescence regulator [Medicago truncatula]
Length=156

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 55/84 (65%), Gaps = 5/84 (6%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVD---SVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANSMCE  768
            +S+PVN+P+WS     D   +    YD        D E +PPHE+LAR   R ++ S+ E
Sbjct  73   SSLPVNVPDWSKILGEDYRHNRRRNYDDVDEEDEGDDEKIPPHEFLART--RMASFSVHE  130

Query  769  GAGRTLKGRDMSRVRDAVWSQTGF  840
            G GRTLKGRD+SRVR+A+W++TGF
Sbjct  131  GVGRTLKGRDLSRVRNAIWAKTGF  154



>dbj|BAK07561.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=148

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 56/95 (59%), Gaps = 13/95 (14%)
 Frame = +1

Query  589  HLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTH-----NRDFEMVPPHEYL---AREYGR  744
            H+++S PV +P W          +    + H +     + + E + PHEYL   AR  GR
Sbjct  58   HVASSAPVKVPEWP----AGRFPAGAGGEQHGYGVSCRDEEGEWMAPHEYLQAQARSSGR  113

Query  745  -TSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFNG  846
             T+A S+ EG GRTLKGRD+SRVRDAVWS TGF G
Sbjct  114  GTAAPSVFEGVGRTLKGRDLSRVRDAVWSNTGFFG  148



>ref|XP_004134973.1| PREDICTED: uncharacterized protein LOC101209587 [Cucumis sativus]
Length=178

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 66/106 (62%), Gaps = 19/106 (18%)
 Frame = +1

Query  574  PTNVRHLSTSVPVNIPNWSN-FNRVDSVESFYD------SDSHTHN--------RDFEMV  708
            P  V+   +S P++IP+WS  + R  ++ S+ +      SD+   N         +  MV
Sbjct  73   PKTVKR--SSAPLDIPDWSKIYGRNGNMGSWINDEYGLVSDAAARNGFVNDDDEEEDVMV  130

Query  709  PPHEYLAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            PPHE++AR+  RT  S+ S+CEG GRTLKGRD+S+VR+A+ ++TGF
Sbjct  131  PPHEWIARKLARTQISSFSVCEGIGRTLKGRDLSKVRNAILTKTGF  176



>ref|XP_010451289.1| PREDICTED: uncharacterized protein LOC104733411 [Camelina sativa]
Length=192

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 12/89 (13%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE------MVPPHEYLAREYGRT--SA  753
            +S P+NIP+W             +++SH H+   E      MVPPHE +A+   RT  S+
Sbjct  93   SSAPMNIPDWPKVYGYPK----KNTNSHLHSWATEDDDEGSMVPPHELVAKRLARTQISS  148

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             SMCEG GRTLKGRD+S+ R+ V ++TGF
Sbjct  149  FSMCEGIGRTLKGRDLSKTRNPVLTRTGF  177



>ref|XP_001783393.1| predicted protein [Physcomitrella patens]
 gb|EDQ51787.1| predicted protein [Physcomitrella patens]
Length=237

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 6/95 (6%)
 Frame = +1

Query  568  AAPTNVRHLSTSVPVNIPNWSNFNRVDSVESF--YDSDSHTHNRDFEMVPPHEYLAREYG  741
            ++P  + H   S PVN+P+WS     +    +   D DS   +   E +PPH ++ REY 
Sbjct  143  SSPRQMMH--QSAPVNVPDWSKILGAEKKHRWADDDVDSDKEDEQEERLPPHLHIQREYA  200

Query  742  RTSAN--SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            ++     S+CEGAGRTLKGRD+SRVR+AV  QTGF
Sbjct  201  QSQQTTFSVCEGAGRTLKGRDLSRVRNAVLRQTGF  235



>ref|XP_011089296.1| PREDICTED: uncharacterized protein LOC105170296 [Sesamum indicum]
Length=162

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 56/87 (64%), Gaps = 7/87 (8%)
 Frame = +1

Query  601  SVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEM-----VPPHEYLAREYGRT--SANS  759
            S+PVN+P+WS   + +  E+        ++ D        +PPHE+LAR+  RT  ++ S
Sbjct  74   SLPVNVPDWSKILKEEYRENRRRDSDDDYDEDEAEEEGNRIPPHEFLARQMARTRIASFS  133

Query  760  MCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            + EG GRTLKGRD+SRVR+A+W +TGF
Sbjct  134  VHEGIGRTLKGRDLSRVRNAIWQKTGF  160



>ref|XP_010514861.1| PREDICTED: uncharacterized protein LOC104790774 [Camelina sativa]
Length=152

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 58/89 (65%), Gaps = 5/89 (6%)
 Frame = +1

Query  583  VRHLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDF---EMVPPHEYLAREYGRTSA  753
            V+  ++S+P+N+P+WS     ++        S  ++ D    E++PPHEYLA+   R ++
Sbjct  64   VKTTTSSLPMNVPDWSKILGKENHSHHVRRKSIENDEDGGGGELLPPHEYLAK--TRMAS  121

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             S+ EG GRTLKGRDMSRVR+A+  +TGF
Sbjct  122  FSVHEGVGRTLKGRDMSRVRNAILEKTGF  150



>emb|CDP05737.1| unnamed protein product [Coffea canephora]
Length=189

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 57/112 (51%), Gaps = 25/112 (22%)
 Frame = +1

Query  577  TNVRHLSTSVPVNIPNWSNF------NRVDSVESFYDSDSHTHNRDFEM-----------  705
            T  + +  S PVNIP+WS            +V    D D H  N D  M           
Sbjct  77   TEPKIIQQSAPVNIPDWSKIYGSSSKKPSTTVSRLLDDDDH-GNSDGVMYNSWDSDEEEE  135

Query  706  -----VPPHEYLAREYGRTSANS--MCEGAGRTLKGRDMSRVRDAVWSQTGF  840
                 VPPHE++AR+  R+   S  +CEG GRTLKGRD+S VR+AV ++TGF
Sbjct  136  DDGSVVPPHEWIARKLARSQITSFSVCEGVGRTLKGRDLSNVRNAVLTKTGF  187



>ref|XP_004241275.1| PREDICTED: uncharacterized protein LOC101262623 [Solanum lycopersicum]
Length=163

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 12/91 (13%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVE------SFYDSDSHTHNRDFEMVPPHEYLAREYGRT--S  750
            + S+PVN+P+WS   + +  E           D    NR    +PPHE+LA++  RT  +
Sbjct  76   AASLPVNVPDWSKILKDEYREYGRRDSDDDVDDDDLDNR----IPPHEFLAKQLERTRIA  131

Query  751  ANSMCEGAGRTLKGRDMSRVRDAVWSQTGFN  843
            + S+ EG GRTLKGRD+SRVR+A+W +TGF 
Sbjct  132  SFSVHEGVGRTLKGRDLSRVRNAIWEKTGFQ  162



>ref|XP_006340195.1| PREDICTED: uncharacterized protein LOC102589274 [Solanum tuberosum]
Length=170

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 5/87 (6%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNR---VDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRT--SANS  759
            ++S+PVN+P+WS   +    ++     D D    +     +PPHE+LAR++ RT  ++ S
Sbjct  82   ASSMPVNVPDWSKILKDEYRENRRRDSDDDGEDDDDAENRIPPHEFLARQFARTRIASFS  141

Query  760  MCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            + EG GRTLKGRD+SRVR+A++ +TGF
Sbjct  142  VHEGVGRTLKGRDLSRVRNAIFEKTGF  168



>gb|EYU38536.1| hypothetical protein MIMGU_mgv1a018290mg [Erythranthe guttata]
Length=158

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 13/89 (15%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE------MVPPHEYLAREYGRTSAN  756
            + S+PVN+P+WS       + S Y        ++ E       +PPHEYLA++ G  ++ 
Sbjct  76   ANSLPVNVPDWSKI-----LGSEYKGRGPRELKEEEGDGGNDRIPPHEYLAKKRG--ASL  128

Query  757  SMCEGAGRTLKGRDMSRVRDAVWSQTGFN  843
            S+ EG GRTLKGRD+SRVRDAVW + GF 
Sbjct  129  SVHEGRGRTLKGRDLSRVRDAVWKKFGFQ  157



>ref|XP_010503169.1| PREDICTED: uncharacterized protein LOC104780370 [Camelina sativa]
Length=157

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 17/91 (19%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE---------MVPPHEYLAREYGRT  747
            ++S+PVN+P+WS       +    + + H   R  E         ++PPHEYLA+   R 
Sbjct  73   ASSLPVNVPDWSK------ILGKENHNRHVRRRSIENDEDGGGGELLPPHEYLAK--TRM  124

Query  748  SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            ++ S+ EG GRTLKGRDMSRVR+A+  +TGF
Sbjct  125  ASFSVHEGVGRTLKGRDMSRVRNAILEKTGF  155



>ref|XP_004291575.1| PREDICTED: uncharacterized protein LOC101299444 [Fragaria vesca 
subsp. vesca]
Length=171

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 56/89 (63%), Gaps = 7/89 (8%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDF-----EMVPPHEYLAREYGRT--SA  753
            + S+PV IP+WS   R +  E+    D    + D        VPPHE+LAR+  RT  ++
Sbjct  81   AASLPVGIPDWSKILRDEYRENRRSDDDDDVDEDEWSAGSVRVPPHEFLARQMARTRIAS  140

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             S+ EG GRTLKGRD+SRVR+A+W +TGF
Sbjct  141  FSVHEGVGRTLKGRDLSRVRNAIWEKTGF  169



>ref|XP_009767681.1| PREDICTED: uncharacterized protein LOC104218792 [Nicotiana sylvestris]
Length=162

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 56/87 (64%), Gaps = 4/87 (5%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEM--VPPHEYLAREYGRT--SANSM  762
            + S+PVN+P+WS   + +  E+         + +     +PPHE+LAR+  RT  ++ S+
Sbjct  75   AASLPVNVPDWSKILKDEYRENRRSDSDDDFDGEDGENRIPPHEFLARQLARTRIASFSV  134

Query  763  CEGAGRTLKGRDMSRVRDAVWSQTGFN  843
             EG GRTLKGRD+SRVR+A++ +TGF 
Sbjct  135  HEGVGRTLKGRDLSRVRNAIFEKTGFQ  161



>ref|XP_006365734.1| PREDICTED: uncharacterized protein LOC102600128 [Solanum tuberosum]
Length=171

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 12/89 (13%)
 Frame = +1

Query  601  SVPVNIPNWSNFNRVDSVE------SFYDSDSHTHNRDFEMVPPHEYLAREYGRT--SAN  756
            S+PVN+P+WS   + +  E           D    NR    +PPHE+LA++  RT  ++ 
Sbjct  86   SLPVNVPDWSKILKDEYREYGRRDSDDDLDDDDLDNR----IPPHEFLAKQLERTRIASF  141

Query  757  SMCEGAGRTLKGRDMSRVRDAVWSQTGFN  843
            S+ EG GRTLKGRD+SRVR+A+W +TGF 
Sbjct  142  SVHEGVGRTLKGRDLSRVRNAIWEKTGFQ  170



>ref|XP_009593461.1| PREDICTED: uncharacterized protein LOC104090119 [Nicotiana tomentosiformis]
Length=167

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (59%), Gaps = 16/95 (17%)
 Frame = +1

Query  595  STSVPVNIPNWSNFNRVDSVE----------SFYDSDSHTHNRDFEMVPPHEYLAREYGR  744
            + S+PVN+P+WS   + +  E             +      NR    +PPHE+LA++  R
Sbjct  76   AASLPVNVPDWSKILKDEYREYGRRDSDDDDFNDEDGDDLENR----IPPHEFLAKQLER  131

Query  745  T--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGFN  843
            T  ++ S+ EG GRTLKGRD+SRVR+A+W +TGF 
Sbjct  132  TRIASFSVHEGVGRTLKGRDLSRVRNAIWEKTGFQ  166



>ref|XP_004155672.1| PREDICTED: uncharacterized LOC101209587 [Cucumis sativus]
 gb|KGN49111.1| hypothetical protein Csa_6G513750 [Cucumis sativus]
Length=197

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 66/106 (62%), Gaps = 19/106 (18%)
 Frame = +1

Query  574  PTNVRHLSTSVPVNIPNWSN-FNRVDSVESFYD------SDSHTHN--------RDFEMV  708
            P  V+   +S P++IP+WS  + R  ++ S+ +      SD+   N         +  MV
Sbjct  92   PKTVKR--SSAPLDIPDWSKIYGRNGNMGSWINDEYGLVSDAAARNGFVNDDDEEEDVMV  149

Query  709  PPHEYLAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            PPHE++AR+  RT  S+ S+CEG GRTLKGRD+S+VR+A+ ++TGF
Sbjct  150  PPHEWIARKLARTQISSFSVCEGIGRTLKGRDLSKVRNAILTKTGF  195



>gb|KDP34425.1| hypothetical protein JCGZ_12706 [Jatropha curcas]
Length=238

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  589  HLSTSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSANSMCE  768
            H   S PVN+P  S   R    E F + D +    D EM+PPHE +AR      A S+ E
Sbjct  154  HQPQSAPVNVPVLSMAMRRRHKE-FDEIDENEDEGDGEMLPPHEIVARAQSPMLACSVLE  212

Query  769  GAGRTLKGRDMSRVRDAVWSQTGF  840
            G GRTLKGRD+ +VR+AVW +TGF
Sbjct  213  GVGRTLKGRDLRQVRNAVWRRTGF  236



>ref|XP_010439392.1| PREDICTED: uncharacterized protein LOC104722843 [Camelina sativa]
Length=161

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 12/89 (13%)
 Frame = +1

Query  598  TSVPVNIPNWSNFNRVDSVESFYDSDSHTHNRDFE------MVPPHEYLAREYGRT--SA  753
            +  P+NIP+W             +++SH H+   E      MVPPHE +AR   RT  S+
Sbjct  62   SPAPMNIPDWPKVYGYPK----KNTNSHLHSWATEDDDEGSMVPPHELVARRLARTQISS  117

Query  754  NSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
             SMCEG GRTLKGRD+S+ R+ V ++TGF
Sbjct  118  FSMCEGIGRTLKGRDLSKTRNPVLTRTGF  146



>ref|XP_004251136.1| PREDICTED: uncharacterized protein LOC101259309 [Solanum lycopersicum]
Length=173

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 61/99 (62%), Gaps = 5/99 (5%)
 Frame = +1

Query  559  GVTAAPTNVRHLSTSVPVNIPNWSNFNR---VDSVESFYDSDSHTHNRDFEMVPPHEYLA  729
            GVT         ++S+PVN+P+WS   +    ++     D D    +     +PPHE+LA
Sbjct  73   GVTVKSAAAVAAASSMPVNVPDWSKILKDEYRENRRRDSDDDGEDDDDAENRIPPHEFLA  132

Query  730  REYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            R++ RT  ++ S+ EG GRTLKGRD+SRVR+A++ +TGF
Sbjct  133  RQFARTRIASFSVHEGVGRTLKGRDLSRVRNAIFEKTGF  171



>ref|XP_010046638.1| PREDICTED: uncharacterized protein LOC104435621 [Eucalyptus grandis]
 gb|KCW88812.1| hypothetical protein EUGRSUZ_A01148 [Eucalyptus grandis]
Length=167

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 12/88 (14%)
 Frame = +1

Query  604  VPVNIPNWSNFNRVD---------SVESFYDSDSHTHNRDFEMVPPHEYLAREYGRTSAN  756
            +PVNIP+W+   + D           E F  SD    + D + VPPHE+LAR  G  ++ 
Sbjct  81   LPVNIPDWAKILQGDYGEHQRGREGAEVFGGSDGEVED-DGDRVPPHEFLARRRG--ASL  137

Query  757  SMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            S+ EG GRTLKGRD+ RVR+A+W + GF
Sbjct  138  SVHEGVGRTLKGRDLRRVRNAIWKKVGF  165



>ref|XP_002448198.1| hypothetical protein SORBIDRAFT_06g022820 [Sorghum bicolor]
 gb|EES12526.1| hypothetical protein SORBIDRAFT_06g022820 [Sorghum bicolor]
Length=189

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 51/94 (54%), Gaps = 15/94 (16%)
 Frame = +1

Query  601  SVPVNIPNWSNF--------NRVDSVESFYDSDSHTHNRDF-----EMVPPHEYLAREYG  741
            S+P+NIP+W            R    E   D D H   R       EMVPPHE   R   
Sbjct  96   SLPMNIPDWQKILGVEYRDHYRAGEWEPDADDDDHGRARGGGGAGAEMVPPHELAWRS--  153

Query  742  RTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGFN  843
            R ++ S+ EG GRTLKGRD+SRVRDAVW +TGF 
Sbjct  154  RAASMSVHEGIGRTLKGRDLSRVRDAVWKKTGFE  187



>ref|XP_010647511.1| PREDICTED: uncharacterized protein LOC100853717 [Vitis vinifera]
 emb|CBI23543.3| unnamed protein product [Vitis vinifera]
Length=99

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 59/98 (60%), Gaps = 22/98 (22%)
 Frame = +1

Query  610  VNIPNWSNFNR--------VDSVESFYDSDSHTHN-----------RDFEMVPPHEYLAR  732
            +NIP+WS   R        VD VE   D+  +TH             D ++VPPHE++AR
Sbjct  1    MNIPDWSKIYRKNSRAMPWVDGVEDVNDA-GNTHQICVVDDDDDDDGDDDIVPPHEWIAR  59

Query  733  EYG--RTSANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            +    + S+ S+CEG GRTLKGRD+S+VR+AV ++TGF
Sbjct  60   KLASSQISSFSVCEGVGRTLKGRDLSKVRNAVLTKTGF  97



>ref|XP_010923848.1| PREDICTED: uncharacterized protein LOC105046820 [Elaeis guineensis]
Length=169

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 60/107 (56%), Gaps = 22/107 (21%)
 Frame = +1

Query  586  RHLSTSVPVNIPNWSNFNR----VDSVESFYDSDS--------HTHNRDFE--------M  705
            R    S PV IP+WS   R     +S    +D D         H  N +           
Sbjct  61   RTFRQSAPVAIPDWSEIYRHKGSSESHSYRFDGDKDGQYCRPDHASNDEDYEEEDDDDDK  120

Query  706  VPPHEYLAREYGRT--SANSMCEGAGRTLKGRDMSRVRDAVWSQTGF  840
            VPPHE+LA++  R+  S++SMCEGAGRTLKGRD+S++R+AV ++TGF
Sbjct  121  VPPHEWLAKKMARSQISSSSMCEGAGRTLKGRDLSKMRNAVLTRTGF  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2568068928256