BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84012_g1_i1 len=1210 path=[1188:0-1209]

Length=1210
                                                                      Score     E

gb|AFB77929.1|  pectin methylesterase                                   527   2e-180   
gb|KHG08631.1|  Pectinesterase 3                                        526   5e-180   
gb|AFW03475.1|  pectin methylesterase 1                                 525   1e-179   
gb|AFW03480.1|  pectin methylesterase 1                                 525   2e-179   
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    513   6e-175   
ref|XP_002304257.2|  pectinesterase family protein                      510   7e-174   Populus trichocarpa [western balsam poplar]
ref|NP_001274969.1|  pectin methyl esterase                             508   4e-173   
emb|CAB95025.1|  pectin methylesterase                                  507   2e-172   Nicotiana tabacum [American tobacco]
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    507   2e-172   
ref|XP_007024771.1|  Pectin methylesterase 3 isoform 2                  503   3e-172   
ref|XP_002265171.1|  PREDICTED: pectinesterase                          505   2e-171   Vitis vinifera
gb|AFI23411.1|  pectin methylesterase                                   504   4e-171   
gb|AAO85706.1|  pectin methyl-esterase                                  502   1e-170   Nicotiana benthamiana
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  502   1e-170   
gb|AFQ23194.1|  pectin methylesterase                                   500   9e-170   
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     500   1e-169   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    499   2e-169   Citrus sinensis [apfelsine]
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     498   5e-169   
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                     496   1e-168   
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         497   2e-168   
ref|NP_001275859.1|  pectinesterase 1 precursor                         491   3e-166   
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     491   3e-166   
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...    491   4e-166   
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    489   1e-165   Citrus sinensis [apfelsine]
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     485   7e-164   
ref|XP_008228105.1|  PREDICTED: pectinesterase                          482   1e-162   
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   480   1e-161   
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             479   1e-161   
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   479   1e-161   
ref|XP_002532944.1|  Pectinesterase-3 precursor, putative               479   1e-161   Ricinus communis
emb|CAC01624.1|  putative pectin methylesterase                         479   2e-161   Populus tremula x Populus tremuloides
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             478   4e-161   
ref|XP_003627458.1|  Pectinesterase                                     475   6e-160   
ref|XP_011012638.1|  PREDICTED: pectinesterase-like                     472   7e-159   
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     472   7e-159   
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                     472   2e-158   
ref|XP_007012502.1|  Pectin methylesterase 3                            468   2e-157   
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                     466   3e-156   
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...    466   4e-156   
ref|XP_004303758.1|  PREDICTED: pectinesterase/pectinesterase inh...    464   9e-156   
ref|XP_010273801.1|  PREDICTED: pectinesterase                          464   1e-155   
emb|CDX97564.1|  BnaA05g25150D                                          463   3e-155   
gb|AFW03476.1|  pectin methylesterase 2                                 461   3e-155   
ref|XP_010501842.1|  PREDICTED: pectinesterase/pectinesterase inh...    463   4e-155   
ref|XP_009146386.1|  PREDICTED: pectinesterase/pectinesterase inh...    463   4e-155   
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                     462   7e-155   
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...    462   1e-154   
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg             461   2e-154   
gb|AFB77928.1|  pectin methylesterase                                   460   3e-154   
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1              460   3e-154   
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...    460   6e-154   
gb|AER38243.1|  PME2                                                    457   8e-154   
ref|XP_010479961.1|  PREDICTED: pectinesterase 2-like                   459   2e-153   
gb|EYU21270.1|  hypothetical protein MIMGU_mgv1a003278mg                457   6e-153   
ref|XP_006407094.1|  hypothetical protein EUTSA_v10020354mg             457   6e-153   
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                        457   8e-153   
gb|AFW03481.1|  pectin methylesterase 2                                 454   9e-153   
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             456   9e-153   
emb|CDX98441.1|  BnaC05g39340D                                          456   1e-152   
ref|XP_002885033.1|  ATPME3                                             456   1e-152   
ref|XP_010501045.1|  PREDICTED: pectinesterase 2-like                   457   1e-152   
ref|NP_001265901.1|  pectinesterase 3-like                              455   4e-152   
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             455   5e-152   
gb|KDP33985.1|  hypothetical protein JCGZ_07556                         454   6e-152   
ref|XP_006297218.1|  hypothetical protein CARUB_v10013226mg             455   1e-151   
gb|KFK38797.1|  hypothetical protein AALP_AA3G161500                    452   9e-151   
ref|NP_188048.1|  pectin methylesterase 3                               452   9e-151   Arabidopsis thaliana [mouse-ear cress]
gb|AAC72288.1|  putative pectin methylesterase                          449   7e-150   Arabidopsis thaliana [mouse-ear cress]
emb|CDY33228.1|  BnaC01g37010D                                          447   4e-149   
gb|AAC50023.1|  ATPME2 precursor                                        447   4e-149   Arabidopsis thaliana [mouse-ear cress]
emb|CDX75765.1|  BnaC03g38480D                                          443   5e-149   
ref|XP_009135376.1|  PREDICTED: pectinesterase/pectinesterase inh...    446   1e-148   
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3              444   2e-148   Linum usitatissimum
emb|CDY51798.1|  BnaC06g41940D                                          445   2e-148   
ref|XP_009116991.1|  PREDICTED: pectinesterase/pectinesterase inh...    445   3e-148   
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative               444   6e-148   Ricinus communis
ref|NP_175786.1|  pectin methylesterase 2                               444   7e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008340373.1|  PREDICTED: pectinesterase 3-like                   444   7e-148   
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     443   1e-147   
ref|XP_009117000.1|  PREDICTED: pectinesterase/pectinesterase inh...    443   2e-147   
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     442   2e-147   
emb|CDY08206.1|  BnaA05g14130D                                          443   2e-147   
ref|XP_004168887.1|  PREDICTED: pectinesterase 3-like                   441   7e-147   
gb|KFK35693.1|  hypothetical protein AALP_AA4G024900                    440   2e-146   
ref|XP_009123661.1|  PREDICTED: pectinesterase 2                        441   3e-146   
ref|XP_002891774.1|  ATPME2                                             439   7e-146   
ref|XP_006599763.1|  PREDICTED: pectinesterase/pectinesterase inh...    436   9e-146   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          436   5e-145   
ref|XP_008460358.1|  PREDICTED: pectinesterase-like                     435   1e-144   
ref|XP_007135363.1|  hypothetical protein PHAVU_010G123100g             451   1e-143   
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     432   3e-143   
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                     432   4e-143   
emb|CDY33229.1|  BnaC01g37020D                                          431   8e-143   
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                     429   6e-142   
gb|KDP33984.1|  hypothetical protein JCGZ_07555                         429   6e-142   
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                     427   3e-141   
ref|XP_004144447.1|  PREDICTED: pectinesterase 3-like                   425   7e-141   
gb|KDO73733.1|  hypothetical protein CISIN_1g008261mg                   424   3e-140   
emb|CDY39109.1|  BnaA01g29470D                                          423   7e-140   
ref|XP_006452919.1|  hypothetical protein CICLE_v10007806mg             424   9e-140   
ref|NP_001275846.1|  putative thermostable pectinesterase               424   2e-139   
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1          419   4e-138   
emb|CDY60700.1|  BnaA01g37100D                                          414   2e-136   
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          411   3e-135   
gb|AAK69696.1|AF355057_1  putative pectin methylesterase LuPME5         409   1e-134   Linum usitatissimum
ref|XP_004154436.1|  PREDICTED: pectinesterase/pectinesterase inh...    395   3e-129   
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg                397   3e-129   
ref|XP_004139621.1|  PREDICTED: pectinesterase/pectinesterase inh...    395   5e-129   
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                390   6e-128   
ref|XP_008368265.1|  PREDICTED: pectinesterase 3-like                   384   2e-127   
ref|XP_010937249.1|  PREDICTED: pectinesterase-like                     390   6e-127   
gb|KGN44619.1|  hypothetical protein Csa_7G343850                       383   3e-124   
ref|XP_008800482.1|  PREDICTED: pectinesterase-like isoform X1          377   1e-121   
ref|XP_010534984.1|  PREDICTED: pectinesterase-like                     373   2e-120   
ref|XP_010939846.1|  PREDICTED: pectinesterase-like                     372   7e-120   
ref|XP_004139620.1|  PREDICTED: pectinesterase 3-like                   367   5e-118   
ref|XP_004170129.1|  PREDICTED: pectinesterase 3-like                   367   5e-118   
ref|XP_002324773.2|  hypothetical protein POPTR_0018s05360g             358   1e-117   Populus trichocarpa [western balsam poplar]
ref|XP_006385198.1|  putative pectin methylesterase LuPME5 family...    364   6e-117   
ref|XP_008458040.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    365   1e-116   
ref|XP_006369078.1|  hypothetical protein POPTR_0001s162502g            356   1e-116   
emb|CAC18727.1|  putative pectin methylesterase                         362   2e-116   Populus tremula x Populus tremuloides
gb|KDO53765.1|  hypothetical protein CISIN_1g018173mg                   355   3e-116   
emb|CAC18726.1|  putative pectin methylesterase                         361   1e-115   Populus tremula x Populus tremuloides
ref|XP_011047860.1|  PREDICTED: pectinesterase-like                     358   1e-114   
ref|XP_003627459.1|  Pectinesterase                                     351   2e-114   
ref|XP_006389479.1|  putative pectin methylesterase LuPME5 family...    357   5e-114   
ref|XP_002309641.2|  putative pectin methylesterase LuPME5 family...    352   2e-112   Populus trichocarpa [western balsam poplar]
ref|XP_011069392.1|  PREDICTED: pectinesterase-like                     346   5e-112   
ref|XP_006385197.1|  hypothetical protein POPTR_0003s00980g             351   7e-112   
ref|XP_002516188.1|  Pectinesterase-3 precursor, putative               344   2e-109   Ricinus communis
ref|XP_011047961.1|  PREDICTED: pectinesterase-like                     341   2e-108   
ref|XP_011048629.1|  PREDICTED: pectinesterase-like                     343   2e-108   
emb|CAC18725.1|  putative pectin methylesterase                         343   2e-108   Populus tremula x Populus tremuloides
ref|XP_009409132.1|  PREDICTED: pectinesterase-like                     341   5e-108   
ref|XP_006369080.1|  putative pectin methylesterase LuPME5 family...    342   8e-108   
ref|XP_006372149.1|  hypothetical protein POPTR_0018s12530g             342   1e-107   
ref|XP_006369081.1|  hypothetical protein POPTR_0001s16280g             342   1e-107   
ref|XP_011003715.1|  PREDICTED: pectinesterase-like                     338   6e-107   
ref|XP_011039647.1|  PREDICTED: pectinesterase-like                     337   1e-106   
gb|EPS74082.1|  hypothetical protein M569_00674                         332   4e-105   
ref|XP_011039646.1|  PREDICTED: pectinesterase-like                     327   6e-103   
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     326   3e-102   
ref|XP_011039649.1|  PREDICTED: pectinesterase-like isoform X2          325   4e-102   
ref|XP_011039648.1|  PREDICTED: pectinesterase-like isoform X1          325   5e-102   
ref|XP_006387527.1|  putative pectin methylesterase LuPME5 family...    325   6e-102   
ref|XP_006382081.1|  hypothetical protein POPTR_0006s27270g             324   1e-101   
gb|ABZ89800.1|  pectin methylesterase-like protein                      322   3e-100   Taiwania cryptomerioides
gb|ABG46324.1|  putative pectin methylesterase                          315   4e-100   Picea abies
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     320   6e-100   
ref|XP_010096537.1|  Pectinesterase 3                                   311   3e-99    
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     317   8e-99    
gb|AGG23325.1|  pectin methylesterase 1                                 317   1e-98    
gb|ACQ85264.1|  pectin methylesterase                                   317   1e-98    Musa acuminata AAA Group [Cavendish banana]
ref|XP_010534985.1|  PREDICTED: pectinesterase-like                     317   3e-98    
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               313   2e-97    Ricinus communis
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     314   2e-97    
gb|AAL24278.1|  AT3g14310/MLN21_9                                       307   5e-97    Arabidopsis thaliana [mouse-ear cress]
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    312   8e-97    
gb|KHN15840.1|  Pectinesterase/pectinesterase inhibitor U1              305   2e-96    
emb|CBI27741.3|  unnamed protein product                                303   6e-96    
gb|ACN40984.1|  unknown                                                 310   8e-96    Picea sitchensis
gb|AHB84678.1|  pectin methylesterase                                   307   8e-95    
gb|ABK24761.1|  unknown                                                 306   1e-94    Picea sitchensis
emb|CBI27756.3|  unnamed protein product                                305   1e-94    
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     305   4e-94    
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            304   5e-94    
ref|XP_002277473.1|  PREDICTED: pectinesterase                          305   5e-94    Vitis vinifera
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    305   6e-94    
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             304   9e-94    Populus trichocarpa [western balsam poplar]
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     304   1e-93    
dbj|BAD95369.1|  pectin methylesterase like protein                     296   7e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     301   1e-92    
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     301   1e-92    
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     297   4e-91    
ref|XP_010321856.1|  PREDICTED: pectinesterase                          294   7e-90    
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             295   8e-90    
dbj|BAJ96804.1|  predicted protein                                      293   1e-89    
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    293   1e-89    
gb|KGN44975.1|  Pectinesterase                                          293   4e-89    
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...    292   7e-89    
gb|EEC82670.1|  hypothetical protein OsI_27314                          291   8e-89    Oryza sativa Indica Group [Indian rice]
ref|NP_001060620.1|  Os07g0675100                                       291   1e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    291   2e-88    
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          290   2e-88    Sorghum bicolor [broomcorn]
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     290   3e-88    
gb|EEC70505.1|  hypothetical protein OsI_01594                          289   5e-88    Oryza sativa Indica Group [Indian rice]
gb|EEE54425.1|  hypothetical protein OsJ_01485                          289   7e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     288   2e-87    
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     286   5e-87    
gb|ABQ42392.1|  pectin methylesterase-like protein                      287   7e-87    Taiwania cryptomerioides
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         282   7e-87    
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     286   8e-87    
emb|CDP15270.1|  unnamed protein product                                286   1e-86    
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     285   2e-86    
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             284   2e-86    
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     282   3e-86    
ref|XP_002463382.1|  hypothetical protein SORBIDRAFT_02g042780          285   3e-86    Sorghum bicolor [broomcorn]
ref|XP_004958677.1|  PREDICTED: pectinesterase 3-like                   285   4e-86    
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             284   7e-86    
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     282   2e-85    
ref|XP_007204488.1|  hypothetical protein PRUPE_ppa019698mg             281   2e-85    
ref|XP_009796151.1|  PREDICTED: putative pectinesterase/pectinest...    281   4e-85    
gb|EPS62329.1|  pectinesterase                                          281   4e-85    
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   279   8e-85    
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     281   9e-85    
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                     280   1e-84    
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     278   1e-84    
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   278   2e-84    
ref|XP_004290811.1|  PREDICTED: probable pectinesterase/pectinest...    280   2e-84    
ref|XP_008242331.1|  PREDICTED: pectinesterase-like                     279   4e-84    
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    278   5e-84    
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     277   7e-84    
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    278   1e-83    
ref|XP_002265217.1|  PREDICTED: pectinesterase 3                        278   2e-83    Vitis vinifera
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 276   3e-83    
ref|XP_009594432.1|  PREDICTED: putative pectinesterase/pectinest...    276   4e-83    
ref|XP_006658118.1|  PREDICTED: pectinesterase 3-like                   276   8e-83    
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     274   9e-83    
ref|XP_011092101.1|  PREDICTED: putative pectinesterase/pectinest...    274   1e-82    
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     274   4e-82    
emb|CDP03036.1|  unnamed protein product                                275   4e-82    
ref|XP_010035249.1|  PREDICTED: probable pectinesterase/pectinest...    274   5e-82    
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   271   9e-82    
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   271   1e-81    
ref|XP_008653464.1|  PREDICTED: pectinesterase-like                     273   1e-81    
gb|EPS67019.1|  pectinesterase                                          265   1e-81    
ref|XP_010556724.1|  PREDICTED: pectinesterase-like                     272   1e-81    
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   270   2e-81    
ref|XP_010273808.1|  PREDICTED: pectinesterase 3                        272   2e-81    
ref|XP_006344697.1|  PREDICTED: putative pectinesterase/pectinest...    270   2e-81    
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     270   3e-81    
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     272   3e-81    
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     270   3e-81    
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        270   3e-81    
ref|XP_010271283.1|  PREDICTED: pectinesterase                          270   3e-81    
sp|P83218.1|PME_DAUCA  RecName: Full=Pectinesterase; Short=PE; Al...    263   6e-81    Daucus carota [carrots]
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   269   6e-81    
ref|XP_009766961.1|  PREDICTED: probable pectinesterase/pectinest...    270   9e-81    
ref|NP_001146685.1|  pectinesterase precursor                           270   1e-80    Zea mays [maize]
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     267   1e-80    
ref|XP_009348912.1|  PREDICTED: pectinesterase-like                     268   3e-80    
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      267   3e-80    
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    267   3e-80    
ref|XP_009343376.1|  PREDICTED: pectinesterase-like                     268   4e-80    
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     268   4e-80    
ref|XP_011036906.1|  PREDICTED: putative pectinesterase/pectinest...    268   4e-80    
ref|XP_010043041.1|  PREDICTED: putative pectinesterase/pectinest...    268   4e-80    
gb|KDP23440.1|  hypothetical protein JCGZ_23273                         267   6e-80    
ref|XP_008392665.1|  PREDICTED: pectinesterase-like                     268   6e-80    
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          267   7e-80    
ref|XP_007134831.1|  hypothetical protein PHAVU_010G079900g             266   8e-80    
ref|XP_009612569.1|  PREDICTED: probable pectinesterase/pectinest...    267   1e-79    
ref|XP_007146997.1|  hypothetical protein PHAVU_006G088000g             266   1e-79    
ref|XP_006465803.1|  PREDICTED: pectinesterase 3-like                   268   1e-79    
ref|XP_002872846.1|  predicted protein                                  266   2e-79    
ref|XP_004498516.1|  PREDICTED: probable pectinesterase/pectinest...    268   2e-79    
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     265   2e-79    
gb|EYU33116.1|  hypothetical protein MIMGU_mgv1a022674mg                265   2e-79    
ref|XP_010456049.1|  PREDICTED: probable pectinesterase/pectinest...    266   2e-79    
ref|XP_006408049.1|  hypothetical protein EUTSA_v10020457mg             266   2e-79    
ref|XP_004306939.1|  PREDICTED: probable pectinesterase/pectinest...    265   3e-79    
ref|XP_008795812.1|  PREDICTED: putative pectinesterase/pectinest...    266   3e-79    
ref|XP_004230262.1|  PREDICTED: putative pectinesterase/pectinest...    266   3e-79    
ref|XP_010267633.1|  PREDICTED: probable pectinesterase/pectinest...    267   3e-79    
ref|XP_007052106.1|  Pectinesterase 2                                   265   3e-79    
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     266   3e-79    Vitis vinifera
ref|XP_007031047.1|  Plant invertase/pectin methylesterase inhibi...    265   3e-79    
pdb|1GQ8|A  Chain A, Pectin Methylesterase From Carrot                  258   4e-79    
gb|EYU25006.1|  hypothetical protein MIMGU_mgv1a022121mg                266   4e-79    
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...    266   4e-79    
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     264   4e-79    
ref|XP_010049073.1|  PREDICTED: probable pectinesterase/pectinest...    266   4e-79    
ref|XP_007136533.1|  hypothetical protein PHAVU_009G053000g             266   4e-79    
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                        264   5e-79    
gb|KHN43320.1|  Putative pectinesterase/pectinesterase inhibitor 22     264   6e-79    
ref|XP_008245555.1|  PREDICTED: putative pectinesterase/pectinest...    265   6e-79    
gb|KFK37971.1|  hypothetical protein AALP_AA3G053500                    265   7e-79    
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg             264   7e-79    
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                        264   7e-79    
ref|XP_008797350.1|  PREDICTED: pectinesterase 3                        266   7e-79    
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   264   7e-79    
ref|XP_002512462.1|  Pectinesterase PPE8B precursor, putative           264   8e-79    
ref|XP_002865971.1|  pectinesterase family protein                      265   9e-79    
ref|XP_006382445.1|  pectinesterase family protein                      263   1e-78    
emb|CBI36883.3|  unnamed protein product                                264   1e-78    
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    262   1e-78    
ref|XP_010546740.1|  PREDICTED: putative pectinesterase/pectinest...    265   1e-78    
ref|NP_192141.1|  probable pectinesterase/pectinesterase inhibito...    263   1e-78    
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    264   2e-78    
ref|XP_006396439.1|  hypothetical protein EUTSA_v10029374mg             263   2e-78    
ref|XP_003554631.1|  PREDICTED: putative pectinesterase/pectinest...    263   2e-78    
ref|XP_010056340.1|  PREDICTED: pectinesterase 2-like                   262   2e-78    
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    264   2e-78    
ref|XP_010917368.1|  PREDICTED: pectinesterase 3 isoform X2             265   2e-78    
ref|NP_200149.1|  pectin methylesterase PCR fragment F                  264   2e-78    
emb|CDP17209.1|  unnamed protein product                                264   3e-78    
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...    264   3e-78    
ref|XP_006828588.1|  hypothetical protein AMTR_s00129p00047530          263   3e-78    
ref|XP_010917367.1|  PREDICTED: pectinesterase 3 isoform X1             265   3e-78    
ref|NP_001042866.1|  Os01g0312500                                       259   3e-78    
ref|XP_004494573.1|  PREDICTED: putative pectinesterase/pectinest...    263   3e-78    
ref|XP_009147217.1|  PREDICTED: putative pectinesterase/pectinest...    263   3e-78    
gb|KEH29121.1|  pectinesterase/pectinesterase inhibitor                 262   4e-78    
ref|XP_010921646.1|  PREDICTED: putative pectinesterase/pectinest...    263   4e-78    
emb|CAN78759.1|  hypothetical protein VITISV_000562                     262   4e-78    
emb|CDP20872.1|  unnamed protein product                                261   6e-78    
gb|KDP40628.1|  hypothetical protein JCGZ_24627                         263   6e-78    
ref|XP_008450601.1|  PREDICTED: putative pectinesterase/pectinest...    260   7e-78    
ref|XP_011023723.1|  PREDICTED: putative pectinesterase/pectinest...    262   7e-78    
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     261   8e-78    
emb|CDY12333.1|  BnaA06g20110D                                          261   9e-78    
gb|KDP28780.1|  hypothetical protein JCGZ_14551                         261   1e-77    
gb|EYU25005.1|  hypothetical protein MIMGU_mgv1a003670mg                262   1e-77    
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    262   1e-77    
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g             263   1e-77    
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    262   2e-77    
ref|XP_010445741.1|  PREDICTED: probable pectinesterase/pectinest...    262   2e-77    
ref|XP_007207382.1|  hypothetical protein PRUPE_ppa004437mg             260   2e-77    
gb|EYU40533.1|  hypothetical protein MIMGU_mgv1a019770mg                259   2e-77    
ref|XP_008450600.1|  PREDICTED: putative pectinesterase/pectinest...    261   2e-77    
ref|XP_011101135.1|  PREDICTED: probable pectinesterase/pectinest...    261   2e-77    
ref|XP_004302271.1|  PREDICTED: putative pectinesterase/pectinest...    261   2e-77    
ref|XP_008783207.1|  PREDICTED: probable pectinesterase/pectinest...    261   2e-77    
ref|XP_009404434.1|  PREDICTED: probable pectinesterase/pectinest...    261   3e-77    
ref|XP_010552690.1|  PREDICTED: probable pectinesterase/pectinest...    260   3e-77    
ref|XP_006279604.1|  hypothetical protein CARUB_v10026136mg             261   3e-77    
ref|XP_006426799.1|  hypothetical protein CICLE_v10025232mg             261   3e-77    
gb|AER38244.1|  PME5                                                    259   3e-77    
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   259   3e-77    
gb|ABJ99595.1|  pectinesterase inhibitor                                261   3e-77    
ref|XP_006367330.1|  PREDICTED: probable pectinesterase/pectinest...    261   3e-77    
ref|XP_008343201.1|  PREDICTED: pectinesterase 2                        259   4e-77    
ref|XP_006841646.1|  hypothetical protein AMTR_s00003p00238240          261   4e-77    
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    260   4e-77    
ref|XP_004235526.1|  PREDICTED: pectinesterase 3                        261   4e-77    
ref|XP_004135600.1|  PREDICTED: putative pectinesterase/pectinest...    260   4e-77    
ref|XP_004231483.1|  PREDICTED: probable pectinesterase/pectinest...    261   4e-77    
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          259   4e-77    
emb|CBI29628.3|  unnamed protein product                                259   5e-77    
ref|XP_007038413.1|  Pectinesterase                                     259   5e-77    
ref|XP_004157240.1|  PREDICTED: putative pectinesterase/pectinest...    259   5e-77    
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   259   5e-77    
emb|CDY02461.1|  BnaA08g00680D                                          253   6e-77    
emb|CDP08022.1|  unnamed protein product                                259   6e-77    
gb|KFK26958.1|  hypothetical protein AALP_AA8G315400                    260   6e-77    
ref|XP_009338231.1|  PREDICTED: putative pectinesterase/pectinest...    259   7e-77    
ref|XP_010659655.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    259   7e-77    
ref|NP_001268091.1|  pectin methylesterase PME1 precursor               259   7e-77    
ref|XP_009127175.1|  PREDICTED: probable pectinesterase/pectinest...    260   8e-77    
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        259   8e-77    
emb|CDY49170.1|  BnaA02g10290D                                          257   8e-77    
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     260   8e-77    
ref|XP_002318977.1|  pectinesterase family protein                      259   8e-77    
emb|CAN60612.1|  hypothetical protein VITISV_003251                     259   8e-77    
emb|CBI39536.3|  unnamed protein product                                260   9e-77    
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               256   9e-77    
ref|XP_003517028.1|  PREDICTED: pectinesterase 2-like                   258   9e-77    
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    260   9e-77    
emb|CDY38712.1|  BnaC01g27850D                                          259   1e-76    
gb|EYU24929.1|  hypothetical protein MIMGU_mgv1a025888mg                257   1e-76    
ref|NP_192139.1|  Probable pectinesterase/pectinesterase inhibito...    258   1e-76    
gb|KHN21590.1|  Putative pectinesterase/pectinesterase inhibitor 6      258   1e-76    
gb|KHN47892.1|  Pectinesterase 2                                        258   1e-76    
ref|XP_003626198.1|  Pectinesterase                                     259   1e-76    
gb|ABJ99594.1|  pectinesterase inhibitor                                260   1e-76    
ref|XP_006580437.1|  PREDICTED: probable pectinesterase/pectinest...    258   1e-76    
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   258   1e-76    
ref|XP_002872845.1|  pectinesterase family protein                      256   1e-76    
ref|XP_010482728.1|  PREDICTED: probable pectinesterase/pectinest...    259   1e-76    
ref|XP_010654104.1|  PREDICTED: pectinesterase                          258   1e-76    
gb|EYU42198.1|  hypothetical protein MIMGU_mgv1a019879mg                257   2e-76    
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     258   2e-76    
ref|XP_006433467.1|  hypothetical protein CICLE_v10000816mg             258   2e-76    
emb|CDO97716.1|  unnamed protein product                                257   2e-76    
ref|NP_189913.3|  probable pectinesterase/pectinesterase inhibito...    258   2e-76    
gb|EYU19492.1|  hypothetical protein MIMGU_mgv1a025514mg                259   2e-76    
ref|XP_004511148.1|  PREDICTED: probable pectinesterase/pectinest...    259   3e-76    
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     257   3e-76    
ref|XP_010464091.1|  PREDICTED: putative pectinesterase/pectinest...    258   3e-76    
ref|XP_010442899.1|  PREDICTED: probable pectinesterase/pectinest...    259   3e-76    
emb|CDO97788.1|  unnamed protein product                                260   3e-76    
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     256   3e-76    
ref|XP_009414355.1|  PREDICTED: putative pectinesterase/pectinest...    257   4e-76    
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                     258   4e-76    
gb|AFW03479.1|  pectin methylesterase 5                                 256   4e-76    
gb|KHG19575.1|  Uncharacterized protein F383_07269                      256   5e-76    
gb|KHN35617.1|  Pectinesterase 2                                        256   5e-76    
ref|XP_003521947.1|  PREDICTED: pectinesterase 2-like                   256   5e-76    
ref|XP_010674080.1|  PREDICTED: putative pectinesterase/pectinest...    257   5e-76    
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   256   5e-76    
gb|KDP33979.1|  hypothetical protein JCGZ_07550                         255   6e-76    
gb|AFI23414.1|  pectin methylesterase                                   258   6e-76    
ref|XP_003588521.1|  Pectinesterase                                     258   7e-76    
ref|XP_002877272.1|  pectinesterase family protein                      256   8e-76    
ref|XP_002884521.1|  pectinesterase family protein                      256   8e-76    
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     257   8e-76    
ref|XP_006401715.1|  hypothetical protein EUTSA_v10013056mg             258   8e-76    
ref|XP_009359675.1|  PREDICTED: probable pectinesterase/pectinest...    256   9e-76    
ref|XP_011070723.1|  PREDICTED: LOW QUALITY PROTEIN: pectinesterase     255   1e-75    
ref|XP_004293266.1|  PREDICTED: pectinesterase/pectinesterase inh...    256   1e-75    
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   256   1e-75    
ref|XP_003559807.1|  PREDICTED: pectinesterase-like                     257   1e-75    
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     256   1e-75    
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    256   1e-75    
ref|XP_006289196.1|  hypothetical protein CARUB_v10002644mg             256   1e-75    
ref|XP_009378667.1|  PREDICTED: pectinesterase 2-like                   255   1e-75    
ref|XP_010044212.1|  PREDICTED: pectinesterase                          256   1e-75    
ref|XP_009761202.1|  PREDICTED: pectinesterase                          256   1e-75    
ref|XP_011024825.1|  PREDICTED: probable pectinesterase/pectinest...    257   2e-75    
gb|AFW03484.1|  pectin methylesterase 5                                 255   2e-75    
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                257   2e-75    
gb|KHN47891.1|  Pectinesterase 2                                        254   2e-75    
emb|CDX96216.1|  BnaC02g14350D                                          253   2e-75    
ref|XP_008242145.1|  PREDICTED: probable pectinesterase/pectinest...    256   2e-75    
ref|XP_010925933.1|  PREDICTED: probable pectinesterase/pectinest...    256   2e-75    
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    256   2e-75    
ref|XP_002322401.1|  putative pectin methylesterase family protein      254   2e-75    
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     256   2e-75    
ref|XP_006396438.1|  hypothetical protein EUTSA_v10029453mg             255   2e-75    
ref|XP_003521940.1|  PREDICTED: pectinesterase 2-like                   254   2e-75    
ref|XP_006578909.1|  PREDICTED: probable pectinesterase/pectinest...    256   3e-75    
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     255   3e-75    
ref|XP_011093902.1|  PREDICTED: pectinesterase/pectinesterase inh...    254   3e-75    
ref|XP_008370416.1|  PREDICTED: putative pectinesterase/pectinest...    254   3e-75    
ref|XP_002875955.1|  pectinesterase family protein                      256   4e-75    
ref|XP_010273802.1|  PREDICTED: pectinesterase/pectinesterase inh...    253   4e-75    
ref|NP_187213.1|  putative pectinesterase/pectinesterase inhibito...    254   5e-75    
ref|XP_006441080.1|  hypothetical protein CICLE_v10019376mg             256   5e-75    
emb|CDY27749.1|  BnaA05g31580D                                          254   5e-75    
emb|CBI24286.3|  unnamed protein product                                251   5e-75    
ref|XP_004303759.1|  PREDICTED: pectinesterase 3-like                   255   5e-75    
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       255   5e-75    
ref|XP_009606551.1|  PREDICTED: pectinesterase 3                        255   5e-75    
ref|XP_010259196.1|  PREDICTED: pectinesterase 2-like                   254   5e-75    
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    253   6e-75    
ref|XP_011010931.1|  PREDICTED: pectinesterase 2-like                   254   6e-75    
ref|XP_004502642.1|  PREDICTED: probable pectinesterase/pectinest...    256   6e-75    
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   253   6e-75    
ref|XP_009604014.1|  PREDICTED: probable pectinesterase/pectinest...    255   6e-75    
ref|XP_002317777.2|  hypothetical protein POPTR_0012s02170g             256   7e-75    
ref|XP_009111299.1|  PREDICTED: probable pectinesterase/pectinest...    254   7e-75    
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               253   7e-75    
ref|XP_006374102.1|  hypothetical protein POPTR_0015s01610g             255   8e-75    
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    255   9e-75    
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     253   9e-75    
ref|XP_002304256.1|  pectinesterase family protein                      255   9e-75    
ref|XP_011036546.1|  PREDICTED: pectinesterase 3-like                   255   1e-74    
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     254   1e-74    
ref|XP_002321999.2|  pectin methylesterase family protein               255   1e-74    
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        253   1e-74    
gb|KHF97563.1|  Pectinesterase/pectinesterase inhibitor PPE8B           253   1e-74    
gb|KFK33850.1|  hypothetical protein AALP_AA5G068300                    253   1e-74    
emb|CAN83663.1|  hypothetical protein VITISV_017689                     253   1e-74    
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        253   1e-74    
ref|XP_006342896.1|  PREDICTED: pectinesterase 3-like                   254   1e-74    
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     253   1e-74    
gb|AFW03478.1|  pectin methylesterase 4                                 253   1e-74    
gb|KHN44643.1|  Putative pectinesterase/pectinesterase inhibitor 61     255   2e-74    
emb|CDY05190.1|  BnaC05g46130D                                          253   2e-74    
ref|XP_010541676.1|  PREDICTED: probable pectinesterase/pectinest...    253   2e-74    
ref|XP_009119880.1|  PREDICTED: probable pectinesterase/pectinest...    254   2e-74    
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   252   2e-74    
ref|XP_010486018.1|  PREDICTED: putative pectinesterase/pectinest...    253   2e-74    
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   252   2e-74    
ref|XP_010544633.1|  PREDICTED: probable pectinesterase/pectinest...    252   2e-74    
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   249   2e-74    
gb|KDP22414.1|  hypothetical protein JCGZ_26245                         252   2e-74    
ref|XP_003528738.1|  PREDICTED: pectinesterase 3                        254   2e-74    
ref|XP_011093901.1|  PREDICTED: probable pectinesterase/pectinest...    252   2e-74    
emb|CBI24285.3|  unnamed protein product                                250   3e-74    
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   257   3e-74    
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   251   3e-74    
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250          253   3e-74    
ref|XP_003526711.1|  PREDICTED: probable pectinesterase/pectinest...    253   3e-74    
ref|XP_004297462.1|  PREDICTED: probable pectinesterase/pectinest...    252   4e-74    
ref|NP_190491.1|  putative pectinesterase/pectinesterase inhibito...    253   4e-74    
ref|XP_009614349.1|  PREDICTED: probable pectinesterase/pectinest...    253   4e-74    
ref|XP_006360163.1|  PREDICTED: probable pectinesterase/pectinest...    253   4e-74    
gb|AFW03483.1|  pectin methylesterase 4                                 251   4e-74    
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                   251   4e-74    
ref|XP_009111300.1|  PREDICTED: probable pectinesterase/pectinest...    251   4e-74    
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    253   5e-74    
ref|XP_006297279.1|  hypothetical protein CARUB_v10013297mg             253   5e-74    
gb|AAZ20274.1|  putative pectin methylesterase                          239   5e-74    
ref|XP_006404164.1|  hypothetical protein EUTSA_v10010220mg             253   5e-74    
ref|XP_006296700.1|  hypothetical protein CARUB_v10013399mg             252   6e-74    
ref|XP_004234932.2|  PREDICTED: probable pectinesterase/pectinest...    251   6e-74    
ref|XP_007204565.1|  hypothetical protein PRUPE_ppa003852mg             251   6e-74    
ref|XP_009773400.1|  PREDICTED: pectinesterase 1                        253   6e-74    
emb|CAN76835.1|  hypothetical protein VITISV_043176                     250   6e-74    
ref|XP_008234745.1|  PREDICTED: probable pectinesterase/pectinest...    253   7e-74    
dbj|BAH56489.1|  pectin methylesterase 1                                251   7e-74    
gb|EYU31969.1|  hypothetical protein MIMGU_mgv1a005025mg                250   7e-74    
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   251   8e-74    
gb|AGR44473.1|  pectin methylesterase 4                                 248   8e-74    
ref|XP_011094019.1|  PREDICTED: pectinesterase-like                     253   8e-74    
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    252   9e-74    
emb|CDY35644.1|  BnaC09g29660D                                          249   9e-74    
emb|CDP00815.1|  unnamed protein product                                251   1e-73    



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   527 bits (1357),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 266/400 (67%), Positives = 319/400 (80%), Gaps = 7/400 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAA--GEANsldvsssiiksscgSTRYPDLCYSSLASTPE  1015
             FL L ASLV+++    +VAGV++      S     +++KS+C  T YPDLC+S++ + P 
Sbjct  28    FLALFASLVIVAAIIGIVAGVSSRNNSDESDTSHHAVVKSACSGTFYPDLCFSAVTTVPA  87

Query  1014  -VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQAL  838
               +KKVRSQKDVIELSL  T    E N   ++KL+ +  + T REK A  DCLETID+ L
Sbjct  88    GTAKKVRSQKDVIELSLNITTTAVEHNYFKIKKLL-ARKDLTTREKTALHDCLETIDETL  146

Query  837   FQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNG  658
              +L+ A++DL  YP+KKS+  HADDLKTLMSAAMTNQETCLDGFSH  AD   R+ + +G
Sbjct  147   DELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHEGADKKIREVLIDG  206

Query  657   QVHVEKLCSNCLSLIRNMTDTDAQNEIK-ASGNRKLKEVEGGCEWPEWLSAGDRRLLQST  481
             + +VEK+CSN L++I+NMTDTD  NE+   S NRKLKE E G  WPEWLSAGDRRLLQS+
Sbjct  207   EKYVEKMCSNALAMIKNMTDTDIANEMMLKSSNRKLKEDESGIAWPEWLSAGDRRLLQSS  266

Query  480   AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIG  301
             + TPNVVVAADGSGN++TVSEAV  AP KSSKRY+IRIKAG Y+ENV+VPK K+NIMFIG
Sbjct  267   SVTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYRENVEVPKKKSNIMFIG  326

Query  300   DGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDL  121
             DGR KT+ITG+RNV+DGSTTF+SATVA VGE+FLARDITFQNTAG SK QAVALRVGSDL
Sbjct  327   DGRTKTIITGSRNVVDGSTTFHSATVAAVGEKFLARDITFQNTAGPSKHQAVALRVGSDL  386

Query  120   SAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             SAFYNC+M AYQDTLYVHSNRQFYV CL++GTVDFIFGNA
Sbjct  387   SAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNA  426



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   526 bits (1355),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 268/400 (67%), Positives = 319/400 (80%), Gaps = 7/400 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAA--GEANsldvsssiiksscgSTRYPDLCYSSLASTPE  1015
             FL L ASLV+++    +VAGV++      S     +I+KS+C  T YPDLC+S++A+ P 
Sbjct  28    FLALFASLVIVAAIIGIVAGVSSRNNSDESDTSHHAIVKSACSGTFYPDLCFSAVATVPA  87

Query  1014  -VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQAL  838
               +KKVRSQKDVIELSL  T    E N   ++KL+ +  + T REK A  DCLETID+ L
Sbjct  88    GTAKKVRSQKDVIELSLNITTTAVEHNYFKIKKLL-ARKDLTTREKTALHDCLETIDETL  146

Query  837   FQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNG  658
              +L+ A++DL  YP+KKS+  HADDLKTLMSAAMTNQETCLDGFSH  AD   R+ + +G
Sbjct  147   DELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHEGADKKIREVLIDG  206

Query  657   QVHVEKLCSNCLSLIRNMTDTDAQNEIK-ASGNRKLKEVEGGCEWPEWLSAGDRRLLQST  481
             + +VEK+CSN L++I+NMTDTD  NE+   S NRKLKE E G  WPEWLSAGDRRLLQS+
Sbjct  207   EKYVEKMCSNALAMIKNMTDTDIANEMMLKSSNRKLKEDESGIAWPEWLSAGDRRLLQSS  266

Query  480   AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIG  301
             + TPNVVVAADGSGN++TVSEAV  AP KSSKRY+IRIKAG Y ENV+VPK K+NIMFIG
Sbjct  267   SVTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYIENVEVPKKKSNIMFIG  326

Query  300   DGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDL  121
             DGR KT+ITG+RNV+DGSTTF+SATVA VGE+FLARDITFQNTAG SK QAVALRVGSDL
Sbjct  327   DGRTKTIITGSRNVVDGSTTFHSATVAAVGEKFLARDITFQNTAGPSKHQAVALRVGSDL  386

Query  120   SAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             SAFYNC+M AYQDTLYVHSNRQFYV CL++GTVDFIFGNA
Sbjct  387   SAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNA  426



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score =   525 bits (1352),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 266/400 (67%), Positives = 319/400 (80%), Gaps = 7/400 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAA--GEANsldvsssiiksscgSTRYPDLCYSSLASTPE  1015
             FL L ASLV+++    +VAGV++      S     +++KS+C  T YPDLC+S++ + P 
Sbjct  28    FLALFASLVIVAAIIGIVAGVSSRNNSDESDTSHHAVVKSACSGTFYPDLCFSAVTTVPA  87

Query  1014  -VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQAL  838
               +KKVRSQKDVIELSL  T    E N   ++KL+ +  + T REK A  DCLETID+ L
Sbjct  88    GTAKKVRSQKDVIELSLNITTTAVEHNYFKIKKLL-ARKDLTTREKTALHDCLETIDETL  146

Query  837   FQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNG  658
              +L+ A++DL  YP+KKS+  HADDLKTLMSAAMTNQETCLDGFSH  AD   R+ + +G
Sbjct  147   DELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHEGADKKIREVLIDG  206

Query  657   QVHVEKLCSNCLSLIRNMTDTDAQNEIK-ASGNRKLKEVEGGCEWPEWLSAGDRRLLQST  481
             + +VEK+CSN L++I+NMTDTD  NE+   S NRKLKE E G  WPEWLSAGDRRLLQS+
Sbjct  207   EKYVEKMCSNALAMIKNMTDTDIANEMMLKSSNRKLKEDESGIAWPEWLSAGDRRLLQSS  266

Query  480   AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIG  301
             + TPNVVVAADGSGN++TVSEAV  AP KSSKRY+IRIKAG Y+ENV+VPK K+NIMFIG
Sbjct  267   SVTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYRENVEVPKKKSNIMFIG  326

Query  300   DGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDL  121
             DGR KT+ITG+RNV+DGSTTF+SATVAVVGE+FLARDITFQNTAG SK QAVALRVGSDL
Sbjct  327   DGRTKTIITGSRNVVDGSTTFHSATVAVVGEKFLARDITFQNTAGPSKHQAVALRVGSDL  386

Query  120   SAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             SAFYNC+M AYQDTLYVHSNRQFYV CL++GTVDFIF NA
Sbjct  387   SAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFENA  426



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   525 bits (1351),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 265/400 (66%), Positives = 319/400 (80%), Gaps = 7/400 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAA--GEANsldvsssiiksscgSTRYPDLCYSSLASTPE  1015
             FL L ASLV+++    +VAGV++      S     +++KS+C  T YPDLC+S++ + P 
Sbjct  28    FLALFASLVIVAAIIGIVAGVSSRNNSDESDTSHHAVVKSACSGTFYPDLCFSAVTAVPA  87

Query  1014  -VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQAL  838
               +KKVRSQKDVIELSL  T    E N   ++KL+ +  + T REK A  DCLETID+ L
Sbjct  88    GTAKKVRSQKDVIELSLNTTTTAVEHNYFKIKKLL-ARKDLTTREKTALHDCLETIDETL  146

Query  837   FQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNG  658
              +L+ A++DL  YP+KKS+  HADDLKTLMSAAMTNQETCLDGFSH  AD   R+ + +G
Sbjct  147   DELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHEGADKKIREVLIDG  206

Query  657   QVHVEKLCSNCLSLIRNMTDTDAQNEIK-ASGNRKLKEVEGGCEWPEWLSAGDRRLLQST  481
             + +VEK+CSN L++I+NMTDTD  NE+   S NRKLKE E G  WPEWLSAGDRRLLQS+
Sbjct  207   EKYVEKMCSNALAMIKNMTDTDIANEMMLKSSNRKLKEDESGIAWPEWLSAGDRRLLQSS  266

Query  480   AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIG  301
             + TPNVVVAADGSGN++TVSEAV  AP KSSKRY IRIKAG Y+ENV+VPK K++IMFIG
Sbjct  267   SVTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYTIRIKAGVYRENVEVPKKKSSIMFIG  326

Query  300   DGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDL  121
             DGR KT+ITG+RNV+DGSTTF+SATVAVVGE+FLAR+ITFQNTAG SK QAVALRVGSDL
Sbjct  327   DGRTKTIITGSRNVVDGSTTFHSATVAVVGEKFLAREITFQNTAGPSKHQAVALRVGSDL  386

Query  120   SAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             SAFYNC+M AYQDTLYVHSNRQFYV CL++GTVDFIFGNA
Sbjct  387   SAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNA  426



>ref|XP_009606552.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
tomentosiformis]
Length=589

 Score =   513 bits (1322),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 263/408 (64%), Positives = 320/408 (78%), Gaps = 16/408 (4%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAAGEANs---------ldvsssiiksscgSTRYPDLCYS  1036
             FL ++AS++L++    +VAGV +   NS            + +I+KS+C +T +P+LCYS
Sbjct  28    FLAVVASVLLVAAVIGVVAGVKSRSNNSNDHADIQAITSAAHAIVKSACENTLHPELCYS  87

Query  1035  SLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLE  856
             ++AS  + SKKV SQKDVIELSL  T K  + N   V+KL+ +    T REK+A  DCLE
Sbjct  88    TIASVSDFSKKVTSQKDVIELSLNITCKAVQHNFFTVEKLIKTRKGLTPREKVALHDCLE  147

Query  855   TIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNAR  676
             TID+ L +L+TA+ DL +YP+KKS+  HADDLKTL+S+A+TNQETCLDGFSH  AD   R
Sbjct  148   TIDETLDELHTAIDDLELYPNKKSLKDHADDLKTLISSAITNQETCLDGFSHDDADKKVR  207

Query  675   KPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASG---NRKLKEVEGGCEWPEWLSAG  505
             K +  GQ HVEK+CSN L++I NMTDTD  NE+K  G   NRKL+E     EWPEWLSAG
Sbjct  208   KALLKGQKHVEKMCSNALAMICNMTDTDIANEMKLKGTTTNRKLRE--DNSEWPEWLSAG  265

Query  504   DRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKS  325
             DRR+LQS+  +P+VVVAADGSGN+RTVSEAV  AP KSSKRYVIRIKAG Y+ENVDVPK 
Sbjct  266   DRRMLQSSTVSPDVVVAADGSGNFRTVSEAVAKAPEKSSKRYVIRIKAGVYRENVDVPKK  325

Query  324   KTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAV  145
             KTNIMF+GDGR  T+ITG+RNV DGSTTFNSATVA VGE+FLARDITFQNTAGA+K QAV
Sbjct  326   KTNIMFMGDGRSNTIITGSRNVKDGSTTFNSATVAAVGEKFLARDITFQNTAGAAKHQAV  385

Query  144   ALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             ALRVGSDLSAFY C++ AYQD+LYVHSNRQ++V+CLI+GTVDFIFGNA
Sbjct  386   ALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIAGTVDFIFGNA  433



>ref|XP_002304257.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE79236.2| pectinesterase family protein [Populus trichocarpa]
Length=584

 Score =   510 bits (1314),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 253/397 (64%), Positives = 315/397 (79%), Gaps = 4/397 (1%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEVS  1009
             FL +LASL+L++    +VAGV + +++  + + +I+KSSC ST YP+LCYS++A+ P  +
Sbjct  33    FLVILASLLLVTAIIAIVAGVNSHKSSKNEGTHAILKSSCSSTLYPELCYSAVATVPGAT  92

Query  1008  KKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQL  829
               + SQKDVIELS+  T K  + N   V+KL+ +T   TKREK A  DCLE ID+ L +L
Sbjct  93    SNLASQKDVIELSINLTTKAVQHNFFTVEKLI-ATKKLTKREKTALHDCLEIIDETLDEL  151

Query  828   NTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQVH  649
             + AL DL  YP+ KS+  HADDLKTL+S+A+TNQETCLDGFSH +AD   RK +  GQ+H
Sbjct  152   HEALVDLNDYPNNKSLKKHADDLKTLLSSAITNQETCLDGFSHDEADKKVRKALLKGQIH  211

Query  648   VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGG-CEWPEWLSAGDRRLLQSTAAT  472
             VEK+CSN L++I+NMTDTD  NE+K +  + ++E EG   EWPEW+S  DRRLLQS++ T
Sbjct  212   VEKMCSNVLAMIKNMTDTDVANELKTTNRKLMQEKEGNESEWPEWMSVADRRLLQSSSVT  271

Query  471   PNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGR  292
             P+VVVAADGSGNY+TVS AV  AP KSSKRY+IRIKAG Y+ENVDVPK KTNIMF+GDGR
Sbjct  272   PDVVVAADGSGNYKTVSAAVAAAPKKSSKRYIIRIKAGVYRENVDVPKDKTNIMFMGDGR  331

Query  291   GKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAF  112
               T+IT +RNV+DGSTTFNSATVA VG+ FLAR ITFQNTAG SK QAVALRVGSDLSAF
Sbjct  332   KTTIITASRNVVDGSTTFNSATVAAVGQGFLARGITFQNTAGPSKHQAVALRVGSDLSAF  391

Query  111   YNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             Y+C+M AYQDTLYVHSNRQF++ CL++GTVDFIFGNA
Sbjct  392   YDCDMLAYQDTLYVHSNRQFFINCLVAGTVDFIFGNA  428



>ref|NP_001274969.1| pectin methyl esterase [Solanum tuberosum]
 gb|AAF23892.1|AF152172_1 pectin methyl esterase [Solanum tuberosum]
Length=576

 Score =   508 bits (1309),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 257/405 (63%), Positives = 319/405 (79%), Gaps = 13/405 (3%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAAGEANs---------ldvsssiiksscgSTRYPDLCYS  1036
             +L ++AS++L++    +VAGV +   NS            + +I+KS+C +T +P+LCYS
Sbjct  18    YLAIVASVLLVAAVIGVVAGVKSRSNNSDDDADIMAISSSAHAIVKSACSNTLHPELCYS  77

Query  1035  SLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLE  856
             ++ +  + SKKV SQKDVIELSL  T+K    N   V++L+ +    T REK+A  DCLE
Sbjct  78    AIVNVTDFSKKVTSQKDVIELSLNITVKAVRRNYYAVKELIKTRKGLTPREKVALHDCLE  137

Query  855   TIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNAR  676
             T+D+ L +L+TA+ DL +YP+KKS+  HA+DLKTL+S+A+TNQETCLDGFSH +AD   R
Sbjct  138   TMDETLDELHTAVADLELYPNKKSLKEHAEDLKTLISSAITNQETCLDGFSHDEADKKVR  197

Query  675   KPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEWLSAGDRR  496
             K +  GQ HVEK+CSN L++I NMT+TD  NE+K SG+RKL  VE   EWPEWLSAGDRR
Sbjct  198   KVLLKGQKHVEKMCSNALAMICNMTNTDIANEMKLSGSRKL--VEDNGEWPEWLSAGDRR  255

Query  495   LLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTN  316
             LLQS+  TP+VVVAADGSG+Y+TVSEAV  AP KSSKRYVIRIKAG Y+ENVDVPK KTN
Sbjct  256   LLQSSTVTPDVVVAADGSGDYKTVSEAVAKAPEKSSKRYVIRIKAGVYRENVDVPKKKTN  315

Query  315   IMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALR  136
             IMF+GDGR  T+IT +RNV DGSTTF+SATVA VGE+FLARDITFQNTAGASK QAVALR
Sbjct  316   IMFMGDGRSNTIITASRNVQDGSTTFHSATVAAVGEKFLARDITFQNTAGASKHQAVALR  375

Query  135   VGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             VGSDLSAFY C++ AYQDTLYVHSNRQF+V+CL++GTVDFIFGN 
Sbjct  376   VGSDLSAFYKCDILAYQDTLYVHSNRQFFVQCLVAGTVDFIFGNG  420



>emb|CAB95025.1| pectin methylesterase [Nicotiana tabacum]
Length=579

 Score =   507 bits (1305),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 246/357 (69%), Positives = 291/357 (82%), Gaps = 5/357 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T +P+LCYS++AS  + SKKV SQKDVIELSL  T +  + N   V+KL+ +      RE
Sbjct  69    TLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNFFKVEKLIKTRKGLKPRE  128

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K+A  DCLETID+ L +L+TA++DL +YP+KKS+ AHADDLKTL+S+A+TNQETCLDGFS
Sbjct  129   KVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADDLKTLISSAITNQETCLDGFS  188

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASG---NRKLKEVEGGC  532
             H  AD   RK +  GQ HVEK+CSN L++I NMTDTD  NE K  G   NRKL+E     
Sbjct  189   HDDADKKVRKALLKGQKHVEKMCSNALAMICNMTDTDIANEQKLKGTTTNRKLRE--DNS  246

Query  531   EWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             EWPEWLSAGDRRLLQS+   P+VVVAADGSGN++TVSEAV  AP KSSKRYVIRIKAG Y
Sbjct  247   EWPEWLSAGDRRLLQSSTVRPDVVVAADGSGNFKTVSEAVAKAPEKSSKRYVIRIKAGVY  306

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
             +ENVDVPK KTNIMF+GDGR  T+ITG+RNV DGSTTF+SATVA VGE+FLARDITFQNT
Sbjct  307   RENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSATVAAVGEKFLARDITFQNT  366

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AGA+K QAVALRVGSDLSAFY C++ AYQD+LYVHSNRQ++V+CLI+GTVDFIFGNA
Sbjct  367   AGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIAGTVDFIFGNA  423



>ref|XP_009762395.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
sylvestris]
Length=589

 Score =   507 bits (1305),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 246/357 (69%), Positives = 291/357 (82%), Gaps = 5/357 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T +P+LCYS++AS  + SKKV SQKDVIELSL  T +  + N   V+KL+ +      RE
Sbjct  79    TLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNFFKVEKLIKTRKGLKPRE  138

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K+A  DCLETID+ L +L+TA++DL +YP+KKS+ AHADDLKTL+S+A+TNQETCLDGFS
Sbjct  139   KVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADDLKTLISSAITNQETCLDGFS  198

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASG---NRKLKEVEGGC  532
             H  AD   RK +  GQ HVEK+CSN L++I NMTDTD  NE K  G   NRKL+E     
Sbjct  199   HDDADKKVRKALLKGQKHVEKMCSNALAMICNMTDTDIANEQKLKGTTTNRKLRE--DNS  256

Query  531   EWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             EWPEWLSAGDRRLLQS+   P+VVVAADGSGN++TVSEAV  AP KSSKRYVIRIKAG Y
Sbjct  257   EWPEWLSAGDRRLLQSSTVRPDVVVAADGSGNFKTVSEAVAKAPEKSSKRYVIRIKAGVY  316

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
             +ENVDVPK KTNIMF+GDGR  T+ITG+RNV DGSTTF+SATVA VGE+FLARDITFQNT
Sbjct  317   RENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSATVAAVGEKFLARDITFQNT  376

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AGA+K QAVALRVGSDLSAFY C++ AYQD+LYVHSNRQ++V+CLI+GTVDFIFGNA
Sbjct  377   AGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIAGTVDFIFGNA  433



>ref|XP_007024771.1| Pectin methylesterase 3 isoform 2, partial [Theobroma cacao]
 gb|EOY27393.1| Pectin methylesterase 3 isoform 2, partial [Theobroma cacao]
Length=500

 Score =   503 bits (1296),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 244/356 (69%), Positives = 288/356 (81%), Gaps = 3/356 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDV-IELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             TRYPDLC+S +A+ P  + K    K   IELSL  T    E N   ++KL+ +    T+R
Sbjct  72    TRYPDLCFSEVAAAPAATSKKVKSKKDVIELSLNITTTAVEHNYFKIKKLL-AKKGLTER  130

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             EK A  DCLETID+ L +L+ A++DL  YP+KKS+  HADDLKTLMSAAMTNQETCLDGF
Sbjct  131   EKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGF  190

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNE-IKASGNRKLKEVEGGCE  529
             SH  AD   RK + +G+ +VE++CSN L++I+NMTDTD  NE +K S NRKLKE E G  
Sbjct  191   SHDAADKKIRKVLIDGEKYVERMCSNALAMIKNMTDTDIANEMLKTSSNRKLKEQENGIA  250

Query  528   WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
             WPEWLSAGDRRLLQS++ TP+VVVAADGSGNY+TVSEAV  AP +SSKRYVI+IKAG Y+
Sbjct  251   WPEWLSAGDRRLLQSSSVTPDVVVAADGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGVYR  310

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV+VPK KTNIMF+GDGR +T+ITG+RNV+DGSTTF+SATVAVVGERFLARDITFQNTA
Sbjct  311   ENVEVPKKKTNIMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARDITFQNTA  370

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK QAVALRVG+DLSAFY C+M AYQDTLY HSNRQFYV C+I+GTVDFIFGNA
Sbjct  371   GPSKHQAVALRVGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDFIFGNA  426



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score =   505 bits (1300),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 258/400 (65%), Positives = 313/400 (78%), Gaps = 8/400 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAAGEANs----ldvsssiiksscgSTRYPDLCYSSLAST  1021
             FL + +S++LI+    +VAGV + ++++    L    +++KS+C STRYPDLCYS++A+ 
Sbjct  58    FLLVFSSVLLIAAVVGIVAGVHSRKSSTNDVGLTAGHAVLKSACSSTRYPDLCYSAIATV  117

Query  1020  PEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQA  841
             P  SKKV SQKDVI +SL  T+   E N   ++KL+    N TKREK A  DCLETID+ 
Sbjct  118   PGASKKVTSQKDVIAVSLNITVTAVEHNYFTIEKLL-DFKNLTKREKAALHDCLETIDET  176

Query  840   LFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFN  661
             L +L+ A+ DL  YP KKS+  HADDLKTLMSAAMTNQETCLDGFSH  AD + R+ +  
Sbjct  177   LDELHVAMDDLDEYPDKKSLTQHADDLKTLMSAAMTNQETCLDGFSHDDADKHVREVLLK  236

Query  660   GQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQST  481
             GQ HVE +CSN L++I+NMTDTD   E +A  NRKL E      WP+WLSAGDRRLLQS+
Sbjct  237   GQRHVEHMCSNALAMIKNMTDTDIAREREAM-NRKLMEERDESGWPKWLSAGDRRLLQSS  295

Query  480   AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIG  301
             + TP+VVVAADGSG+Y+TVS AV  AP KSSKRY+I IKAG YKENV+V K KTNIMF+G
Sbjct  296   SVTPDVVVAADGSGDYKTVSAAVAAAPEKSSKRYIIGIKAGVYKENVEVGKKKTNIMFLG  355

Query  300   DGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDL  121
             DGR  T+ITG++NV+DGSTTFNSATVAVVGE+F+ARDITFQNTAG SK QAVALRVGSDL
Sbjct  356   DGRSNTIITGSKNVVDGSTTFNSATVAVVGEKFIARDITFQNTAGPSKHQAVALRVGSDL  415

Query  120   SAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             SAFY C+M AYQDTLYVHSNRQFY+ CL++GTVDFIFGNA
Sbjct  416   SAFYKCDMLAYQDTLYVHSNRQFYINCLVAGTVDFIFGNA  455



>gb|AFI23411.1| pectin methylesterase [Coffea arabica]
Length=587

 Score =   504 bits (1297),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 243/355 (68%), Positives = 291/355 (82%), Gaps = 3/355 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPE-VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             T YPDLC+S+LA+ P+ VS+K+ SQKDVIEL L +T    E N   V+ L+ +  N T+R
Sbjct  79    TLYPDLCFSTLANLPQAVSQKITSQKDVIELVLNHTTTTVEHNYFAVEHLIATHHNLTER  138

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             EK A  DCLETID+ L +L+  ++DL +YPSKKS+  HADDLKTLMSAAMTNQETCLDGF
Sbjct  139   EKTALHDCLETIDETLDELHQTVKDLELYPSKKSLKQHADDLKTLMSAAMTNQETCLDGF  198

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
             SH  AD + R+ + NGQVHVEKLCSN L++I+NMTDTD + E +A G RKL+E E    W
Sbjct  199   SHDDADKHVRQELSNGQVHVEKLCSNALAMIKNMTDTDMERESEAGG-RKLEEEETNG-W  256

Query  525   PEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKE  346
             P WLSAGDRRLLQS+  T +VVVAADGSG+++TVS AV+ AP KSS+RYVIRIKAG Y+E
Sbjct  257   PNWLSAGDRRLLQSSTVTADVVVAADGSGDFKTVSAAVEAAPEKSSRRYVIRIKAGVYRE  316

Query  345   NVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAG  166
             NV+VPK KTNIMF+GDGR KT+IT +RNV+DGSTTF+SATVA VGERFLARD+TFQNTAG
Sbjct  317   NVEVPKKKTNIMFLGDGRTKTIITASRNVVDGSTTFHSATVAAVGERFLARDLTFQNTAG  376

Query  165   ASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             +SK QAVALRVGSDLSAFY C++ A+QDTLY HSNRQFY+ CLI+GTVDFIFGN 
Sbjct  377   SSKHQAVALRVGSDLSAFYQCDILAHQDTLYAHSNRQFYINCLIAGTVDFIFGNG  431



>gb|AAO85706.1| pectin methyl-esterase [Nicotiana benthamiana]
Length=579

 Score =   502 bits (1293),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 244/357 (68%), Positives = 289/357 (81%), Gaps = 5/357 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T +P+LCYS++AS  + SKKV SQKDVIELSL  T +  + N   V+KL+ +      RE
Sbjct  69    TLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNFFKVEKLIKTRKGLKPRE  128

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K+A  DCLETID+ L +L+TA++DL +YP+KKS+ AHAD LKTL+S+A+TNQETCLDGFS
Sbjct  129   KVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADGLKTLISSAITNQETCLDGFS  188

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASG---NRKLKEVEGGC  532
             H  AD   RK +  GQ HVEK+CSN L++I NMTDTD  NE K  G   NRKL+E     
Sbjct  189   HDDADKKVRKALLKGQKHVEKMCSNALAMICNMTDTDIANEQKLKGTTTNRKLRE--DNS  246

Query  531   EWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             EWPEWL AGDRRLLQS+   P+VVVAADGSGN++TVSEAV  AP KSSKRYVIRIKAG Y
Sbjct  247   EWPEWLPAGDRRLLQSSTVRPDVVVAADGSGNFKTVSEAVAKAPEKSSKRYVIRIKAGVY  306

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
             +ENVDVPK KTNIMF+GDGR  T+ITG+RNV DGSTTF+SATVA VGE+FLARDITFQNT
Sbjct  307   RENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSATVAAVGEKFLARDITFQNT  366

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AGA+K QAVALRVGSDLSAFY C++ AYQD+LYVHSNRQ++V+CLI+GTVDFIFGNA
Sbjct  367   AGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIAGTVDFIFGNA  423



>ref|XP_007024770.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
 gb|EOY27392.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
Length=582

 Score =   502 bits (1293),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 244/356 (69%), Positives = 288/356 (81%), Gaps = 3/356 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDV-IELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             TRYPDLC+S +A+ P  + K    K   IELSL  T    E N   ++KL+ +    T+R
Sbjct  72    TRYPDLCFSEVAAAPAATSKKVKSKKDVIELSLNITTTAVEHNYFKIKKLL-AKKGLTER  130

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             EK A  DCLETID+ L +L+ A++DL  YP+KKS+  HADDLKTLMSAAMTNQETCLDGF
Sbjct  131   EKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGF  190

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNE-IKASGNRKLKEVEGGCE  529
             SH  AD   RK + +G+ +VE++CSN L++I+NMTDTD  NE +K S NRKLKE E G  
Sbjct  191   SHDAADKKIRKVLIDGEKYVERMCSNALAMIKNMTDTDIANEMLKTSSNRKLKEQENGIA  250

Query  528   WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
             WPEWLSAGDRRLLQS++ TP+VVVAADGSGNY+TVSEAV  AP +SSKRYVI+IKAG Y+
Sbjct  251   WPEWLSAGDRRLLQSSSVTPDVVVAADGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGVYR  310

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV+VPK KTNIMF+GDGR +T+ITG+RNV+DGSTTF+SATVAVVGERFLARDITFQNTA
Sbjct  311   ENVEVPKKKTNIMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARDITFQNTA  370

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK QAVALRVG+DLSAFY C+M AYQDTLY HSNRQFYV C+I+GTVDFIFGNA
Sbjct  371   GPSKHQAVALRVGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDFIFGNA  426



>gb|AFQ23194.1| pectin methylesterase [Theobroma cacao]
Length=582

 Score =   500 bits (1287),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 243/356 (68%), Positives = 287/356 (81%), Gaps = 3/356 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDV-IELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             TRYPDLC+S +A+ P  + K    K   IELSL  T    E N   ++KL+ +    T+R
Sbjct  72    TRYPDLCFSEVAAAPAATSKKVKSKKDVIELSLNITTTAVEHNYFKIKKLL-AKKGLTER  130

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             EK A  DCLETID+ L +L+ A++DL  YP+KKS+  HADDLKTLMSAAMTNQETCLDGF
Sbjct  131   EKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGF  190

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNE-IKASGNRKLKEVEGGCE  529
             SH  AD   RK + +G+ +VE++CSN L++I+NMTDTD  NE +K S NRKLKE E G  
Sbjct  191   SHDAADKKIRKVLIDGEKYVERMCSNALAMIKNMTDTDIANEMLKTSSNRKLKEQENGIA  250

Query  528   WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
             WPEWLSAGDRRLLQS++ TP+VVVAADGSGNY+TVSEAV  AP +SSKRYVI+IKAG Y+
Sbjct  251   WPEWLSAGDRRLLQSSSVTPDVVVAADGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGVYR  310

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV+VPK KTNIMF+GDGR +T+ITG+RNV+DGSTTF+SATVAVVGERFLAR ITFQNTA
Sbjct  311   ENVEVPKKKTNIMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARSITFQNTA  370

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK QAVALRVG+DLSAFY C+M AYQDTLY HSNRQFYV C+I+GTVDFIFGNA
Sbjct  371   GPSKHQAVALRVGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDFIFGNA  426



>ref|XP_011031815.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=580

 Score =   500 bits (1287),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 254/399 (64%), Positives = 312/399 (78%), Gaps = 7/399 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEVS  1009
             FL +LASL+L++    +  GV +   +  + + +I+KSSC ST YP+LCYS++A+ P  +
Sbjct  28    FLVILASLLLVTTIIAIATGVNSHRNSKNEGTHAILKSSCSSTLYPELCYSAVATVPGAT  87

Query  1008  KKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQL  829
               + SQKDVIELS+  T K  + N   V+KL+ +T   +KREK A  DCLE ID+ L +L
Sbjct  88    SNLASQKDVIELSINLTTKAVQHNFFTVEKLI-ATKKLSKREKTALHDCLEIIDETLDEL  146

Query  828   NTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQVH  649
             + AL DL  YP+ KS+  HADDLKTL+S+A+TNQETCLDGFSH +AD   RK +  GQ+H
Sbjct  147   HEALVDLNEYPNNKSLKKHADDLKTLLSSAITNQETCLDGFSHDEADKKVRKALLKGQIH  206

Query  648   VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKL--KEVEGG-CEWPEWLSAGDRRLLQSTA  478
             VEK+CSN L++I+NMTDTD  NE+K + NRKL  +E EG   EWPEW+S  DRRLLQS++
Sbjct  207   VEKMCSNVLAMIKNMTDTDVANELKIT-NRKLMQQEKEGNESEWPEWMSVADRRLLQSSS  265

Query  477   ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGD  298
              TP+VVVAADGSGNY+TVS AV  AP KSSKRY+IRIKAG Y+ENVDVPK KTNIMF+GD
Sbjct  266   VTPDVVVAADGSGNYKTVSAAVAAAPKKSSKRYIIRIKAGVYRENVDVPKDKTNIMFMGD  325

Query  297   GRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLS  118
             GR  T+IT +RNV+DGSTTFNSATVA VG+ FLAR ITFQNTAG SK QAVALRVGSDLS
Sbjct  326   GRKTTIITASRNVVDGSTTFNSATVAAVGQGFLARGITFQNTAGPSKHQAVALRVGSDLS  385

Query  117   AFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AFY+C+M AYQDTLYVHSNRQF++ C I+GTVDFIFGNA
Sbjct  386   AFYDCDMLAYQDTLYVHSNRQFFINCFIAGTVDFIFGNA  424



>sp|P83948.1|PME3_CITSI RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Citrus sinensis]
Length=584

 Score =   499 bits (1285),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 244/358 (68%), Positives = 288/358 (80%), Gaps = 9/358 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYPDLC+S++A+ PE SKKV SQKDVIE+SL  T    E N   +QKL+   TN TKRE
Sbjct  76    TRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTTAVEHNYFGIQKLL-KRTNLTKRE  134

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K+A  DCLETID+ L +L+ A++DL  YP+KKS+  HADDLKTLMSAAMTNQ TCLDGFS
Sbjct  135   KVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMTNQGTCLDGFS  194

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE----VEGG  535
             H  A+ + R  + +GQVHVEK+CSN L++I+NMTDTD    ++ S NRKL E    V+G 
Sbjct  195   HDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMM-IMRTSNNRKLIEETSTVDG-  252

Query  534   CEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
               WP WLS GDRRLLQS++ TPNVVVAADGSGN++TV+ +V  AP   +KRY+IRIKAG 
Sbjct  253   --WPAWLSTGDRRLLQSSSVTPNVVVAADGSGNFKTVAASVAAAPQGGTKRYIIRIKAGV  310

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y+ENV+V K   NIMFIGDGR +T+ITG+RNV+DGSTTF SATVAVVGE FLARDITFQN
Sbjct  311   YRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQN  370

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             TAG SK QAVALRVG+DLSAFYNC+M AYQDTLYVHSNRQF+V CLI+GTVDFIFGNA
Sbjct  371   TAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGNA  428



>ref|XP_008348472.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=585

 Score =   498 bits (1282),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 255/404 (63%), Positives = 307/404 (76%), Gaps = 12/404 (3%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAAGEANsldvsssiikssc----gSTRYPDLCYSSLAST  1021
             F++L A+++L+     +V GV + + NS D +     +       ST YPDLC+S+LA  
Sbjct  28    FISLFATILLVGAVIGIVTGVKSSKNNSDDETIEASHAIVKSSCSSTLYPDLCFSTLALH  87

Query  1020  PEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTN-YTKREKIAFGDCLETIDQ  844
             PE SKKV SQKDVIELSL  T    +     V+KL+ S  N  TKREK A  DCLETID+
Sbjct  88    PEASKKVSSQKDVIELSLNITTTAVQHIFFTVEKLLKSRKNKLTKREKGALHDCLETIDE  147

Query  843   ALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIF  664
              L +L+ A++DL  YP+ K++V HADDLKTL S+A+TNQETCL+GFSH   D   RK + 
Sbjct  148   TLDELHEAVEDLHEYPNNKTLVQHADDLKTLJSSAITNQETCLNGFSHDGGDKKVRKVLL  207

Query  663   NGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV---EGGCEWPEWLSAGDRRL  493
              G+ H+EKLCSN L++I+NMTDTD  NE+K + NRKLKE    E G  WPEWLS  DRRL
Sbjct  208   AGEEHIEKLCSNVLAMIKNMTDTDIANEMKMNVNRKLKENMVDEHG--WPEWLSVADRRL  265

Query  492   LQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNI  313
             LQS++ TPNVVVAADG+GNY+TVSEAV  AP KSS RYVI+IKAG Y+ENVDVPK KTNI
Sbjct  266   LQSSSVTPNVVVAADGTGNYKTVSEAVAAAPEKSSSRYVIKIKAGIYRENVDVPKKKTNI  325

Query  312   MFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRV  133
             MF+GDGR  T+IT +RNV+DGSTTFNSATVA VGE+FLARDITFQNTAG SK QAVALRV
Sbjct  326   MFLGDGRVNTIITASRNVVDGSTTFNSATVAAVGEKFLARDITFQNTAGPSKHQAVALRV  385

Query  132   GSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             GSDLSAFY C++ AYQD+LYVHSNRQF+  CL++GTVDFIFGNA
Sbjct  386   GSDLSAFYRCDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGNA  429



>ref|XP_011072691.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=551

 Score =   496 bits (1276),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 244/356 (69%), Positives = 289/356 (81%), Gaps = 2/356 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVS-TTNYTKR  886
             T YP+LCYS++A +   +KKV S+KDVI LSL  TI   + N   ++KL+ +  +N T+R
Sbjct  53    TLYPELCYSAIADSLSDNKKVTSKKDVIILSLNVTISSVQRNYFAIEKLLYAGKSNLTER  112

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             EK A  DCLETID+ L +L+TA++DL+ YP KKSI  HADDLKTL+S+A+TNQETCLDGF
Sbjct  113   EKTALHDCLETIDETLDELHTAVKDLKEYPLKKSIREHADDLKTLLSSAITNQETCLDGF  172

Query  705   SHCKADHNARKPIFNGQV-HVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE  529
             S+ K+D + R+ +  GQV  VEKLCSN L+++ NMTDTD +NE K +G RKL   E G  
Sbjct  173   SYGKSDKHVREVLVGGQVLRVEKLCSNSLAMLTNMTDTDMENERKLNGGRKLVAAEDGSG  232

Query  528   WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
             WPEWLSAGDRRLLQS++  P+VVVAADGSGNYRTV  AV  AP +SS+RYVIRIKAG Y+
Sbjct  233   WPEWLSAGDRRLLQSSSVRPDVVVAADGSGNYRTVGAAVAAAPERSSRRYVIRIKAGVYR  292

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV+VPK KTNIMF+GDGR  T+ITG+ NV DGSTTFNSATVA VGERFLARDITFQNTA
Sbjct  293   ENVEVPKKKTNIMFMGDGRSNTIITGSTNVRDGSTTFNSATVAAVGERFLARDITFQNTA  352

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK QAVALRVGSDLSAFY C+M AYQDTLYVHSNRQF+V+CLISGTVDFIFGNA
Sbjct  353   GPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSNRQFFVQCLISGTVDFIFGNA  408



>gb|KDP40627.1| hypothetical protein JCGZ_24626 [Jatropha curcas]
Length=581

 Score =   497 bits (1279),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 249/385 (65%), Positives = 309/385 (80%), Gaps = 7/385 (2%)
 Frame = -2

Query  1140  MVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKN  961
             +V GV + + ++   S +I+KSSC STR+P+LC+S++AS P  +  + SQKDVIELS+  
Sbjct  43    IVTGVNSNKKDNTSQSHAILKSSCSSTRFPELCFSAVASVPGATANLASQKDVIELSINL  102

Query  960   TIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSI  781
             T    + N   V+KL+ +T   TKREK A  DCLETID+ L +L+ A +DL  YP+KKS+
Sbjct  103   TTTAVQHNFFTVEKLI-ATRKLTKREKTALHDCLETIDETLDELHKAAEDLEEYPNKKSL  161

Query  780   VAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMT  601
               HADDLKTL+S+A+TNQETCLDGFSH +AD   R+ + +GQVHVEK+CSN L++I+NMT
Sbjct  162   SQHADDLKTLLSSAITNQETCLDGFSHDEADKRIREALLDGQVHVEKMCSNALAMIKNMT  221

Query  600   DTDAQNEIK--ASGNRKLKEVEGGCE---WPEWLSAGDRRLLQSTAATPNVVVAADGSGN  436
             DTD  +E+K  A+ NRKLKE EG  +   WPEWLSAGDRRLLQS++ TP+VVVAADGSG 
Sbjct  222   DTDIADELKLAATTNRKLKE-EGKNQESGWPEWLSAGDRRLLQSSSVTPDVVVAADGSGK  280

Query  435   YRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVI  256
             Y+ + +AV  APSKSSKRY+IRIKAG Y+ENV+VPKSKTNIMF+GDGR  T+IT +RNV 
Sbjct  281   YKKIQDAVNAAPSKSSKRYIIRIKAGVYRENVEVPKSKTNIMFLGDGRKTTIITASRNVA  340

Query  255   DGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTL  76
             DGSTTFNSATVA VG+ FLA+DITF+NTAG SK QAVALRVGSDLSAFY C+M AYQDTL
Sbjct  341   DGSTTFNSATVAAVGQGFLAKDITFENTAGPSKHQAVALRVGSDLSAFYQCDMLAYQDTL  400

Query  75    YVHSNRQFYVKCLISGTVDFIFGNA  1
             YVHSNRQF++ CL++GTVDFIFGNA
Sbjct  401   YVHSNRQFFINCLVAGTVDFIFGNA  425



>ref|NP_001275859.1| pectinesterase 1 precursor [Citrus sinensis]
 ref|XP_006426800.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
 gb|AAB57670.1| pectinesterase [Citrus sinensis]
 gb|ESR40040.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
Length=584

 Score =   491 bits (1264),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 244/358 (68%), Positives = 287/358 (80%), Gaps = 9/358 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYPDLC+S++A+ PE SKKV SQKDVIE+SL  T    E N   +QKL+   TN TKRE
Sbjct  76    TRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTTAVEHNYFGIQKLL-KRTNLTKRE  134

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K+A  DCLETID+ L +L+ A++DL  YP+KKS+  HADDLKTLMSAAMTNQ TCLDGFS
Sbjct  135   KVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMTNQGTCLDGFS  194

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE----VEGG  535
             H  A+ + R  + +GQVHVEK+CSN L++I+NMTDTD    ++ S NRKL E    V+G 
Sbjct  195   HDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMM-IMRTSNNRKLTEETSTVDG-  252

Query  534   CEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
               WP WLS GDRRLLQS++ TPN VVAADGSGN++TV+ AV  AP   +KRY+IRIKAG 
Sbjct  253   --WPAWLSPGDRRLLQSSSVTPNAVVAADGSGNFKTVAAAVAAAPQGGTKRYIIRIKAGV  310

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y+ENV+V K   NIMFIGDGR +T+ITG+RNV+DGSTTF SATVAVVGE FLARDITFQN
Sbjct  311   YRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQN  370

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             TAG SK QAVALRVG+DLSAFYNC+M AYQDTLYVHSNRQF+V CLI+GTVDFIFGNA
Sbjct  371   TAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGNA  428



>ref|XP_009767827.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=593

 Score =   491 bits (1264),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 256/417 (61%), Positives = 311/417 (75%), Gaps = 17/417 (4%)
 Frame = -2

Query  1203  KMARTQEFLTLLASLVLISG--DMVAGVAAGEANsldvsssiiksscgST---------R  1057
             K+ + + FL+L+AS++LI+    +V GV     NS + +     S    T          
Sbjct  22    KVKKPKLFLSLIASVLLIAAVIGVVIGVNYSRKNSSNQAQIQAISLATHTIVKSSCSITL  81

Query  1056  YPDLCYSSLAST-PEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREK  880
             +  LCYS++A+  P  SKKV +QKDVIELSL  T K  + N   + KL+ +    T+REK
Sbjct  82    HQQLCYSTIANNIPNFSKKVTNQKDVIELSLNITTKAVQRNYYAIDKLIKTRKGLTEREK  141

Query  879   IAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSH  700
             IA  DCLETID+ + +L+TA++DL  YP+ K++  HADDLKTL+SAA+TNQETCLDGFSH
Sbjct  142   IALHDCLETIDETIDELHTAVEDLEKYPNAKALRQHADDLKTLISAAITNQETCLDGFSH  201

Query  699   CKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIK--ASG--NRKLKEVEGGC  532
              +AD   RK +  GQV+VEKLCSN L++I+NMTDTD QNE+K  +SG  NRKL E   G 
Sbjct  202   DEADKKVRKVLLKGQVYVEKLCSNALAMIKNMTDTDIQNEMKLGSSGKVNRKLNEESSGT  261

Query  531   EWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
              WPEWLS GDRRLLQS + T +VVVAADGSG+Y+TV+EAV NAP KSSKRYVIRIKAG Y
Sbjct  262   -WPEWLSTGDRRLLQSPSVTADVVVAADGSGDYKTVAEAVANAPEKSSKRYVIRIKAGVY  320

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
             KENV+V K K NIMF+GDGR  T+ITG+RNV DGSTTF+SATVA VGE FLARDITF+NT
Sbjct  321   KENVEVSKKKKNIMFMGDGRENTIITGSRNVKDGSTTFHSATVAAVGEGFLARDITFENT  380

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG  K QAVALRVG+DLSAFY C+M  YQDTLYVHSNRQF+V+C ISGTVDFIFGNA
Sbjct  381   AGHEKHQAVALRVGADLSAFYKCDMLGYQDTLYVHSNRQFFVQCFISGTVDFIFGNA  437



>ref|NP_001233857.1| pectinesterase/pectinesterase inhibitor U1 precursor [Solanum 
lycopersicum]
 sp|Q43143.1|PMEU1_SOLLC RecName: Full=Pectinesterase/pectinesterase inhibitor U1; Includes: 
RecName: Full=Pectinesterase inhibitor U1; AltName: Full=Pectin 
methylesterase inhibitor U1; Includes: RecName: Full=Pectinesterase 
U1; Short=PE U1; AltName: Full=Pectin methylesterase 
U1; Flags: Precursor [Solanum lycopersicum]
 gb|AAD09283.1| pectin methylesterase [Solanum lycopersicum]
 gb|AAL02367.1| pectin methylesterase [Solanum lycopersicum]
Length=583

 Score =   491 bits (1263),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 252/408 (62%), Positives = 314/408 (77%), Gaps = 16/408 (4%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAAGEANs---------ldvsssiiksscgSTRYPDLCYS  1036
             +L ++AS++L++    +VAGV +   NS            + +I+KS+C +T +P+LCYS
Sbjct  22    YLAIVASVLLVAAVIGVVAGVKSHSKNSDDHADIMAISSSAHAIVKSACSNTLHPELCYS  81

Query  1035  SLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLE  856
             ++ +  + SKKV SQKDVIELSL  T+K    N   V++L+ +    T REK+A  DCLE
Sbjct  82    AIVNVSDFSKKVTSQKDVIELSLNITVKAVRRNYYAVKELIKTRKGLTPREKVALHDCLE  141

Query  855   TIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNAR  676
             T+D+ L +L+TA++DL +YP+KKS+  H +DLKTL+S+A+TNQETCLDGFSH +AD   R
Sbjct  142   TMDETLDELHTAVEDLELYPNKKSLKEHVEDLKTLISSAITNQETCLDGFSHDEADKKVR  201

Query  675   KPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASG---NRKLKEVEGGCEWPEWLSAG  505
             K +  GQ HVEK+CSN L++I NMTDTD  NE+K S    NRKL  VE   EWPEWLSAG
Sbjct  202   KVLLKGQKHVEKMCSNALAMICNMTDTDIANEMKLSAPANNRKL--VEDNGEWPEWLSAG  259

Query  504   DRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKS  325
             DRRLLQS+  TP+VVVAADGSG+Y+TVSEAV+ AP KSSKRYVIRIKAG Y+ENVDVPK 
Sbjct  260   DRRLLQSSTVTPDVVVAADGSGDYKTVSEAVRKAPEKSSKRYVIRIKAGVYRENVDVPKK  319

Query  324   KTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAV  145
             KTNIMF+GDG+  T+IT +RNV DGSTTF+SATV  V  + LARDITFQNTAGASK QAV
Sbjct  320   KTNIMFMGDGKSNTIITASRNVQDGSTTFHSATVVRVAGKVLARDITFQNTAGASKHQAV  379

Query  144   ALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AL VGSDLSAFY C+M AYQDTLYVHSNRQF+V+CL++GTVDFIFGN 
Sbjct  380   ALCVGSDLSAFYRCDMLAYQDTLYVHSNRQFFVQCLVAGTVDFIFGNG  427



>sp|O04886.1|PME1_CITSI RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57667.1| pectinesterase [Citrus sinensis]
Length=584

 Score =   489 bits (1259),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 243/358 (68%), Positives = 286/358 (80%), Gaps = 9/358 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYPDLC+S++A+ PE SKKV SQKDVIE+SL  T    E N   +QKL+   TN TKRE
Sbjct  76    TRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTTAVEHNYFGIQKLL-KRTNLTKRE  134

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K+A  DCLETID+ L +L+ A++DL  YP+KKS+  HADDLKTLMSAAMTNQ TCLDGFS
Sbjct  135   KVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMTNQGTCLDGFS  194

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE----VEGG  535
             H  A+ + R  + +GQVHVEK+CSN L++I+NMTDTD    ++ S NRKL E    V+G 
Sbjct  195   HDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMM-IMRTSNNRKLTEETSTVDG-  252

Query  534   CEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
               WP WLS GDRRLLQS++ TPN VVAADGSGN++TV+ AV  AP   +KRY+IRIKAG 
Sbjct  253   --WPAWLSPGDRRLLQSSSVTPNAVVAADGSGNFKTVAAAVAAAPQGGTKRYIIRIKAGV  310

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y+ENV+V K   NIMFIGDGR +T+ITG+RNV+DGSTTF SAT AVVGE FLARDITFQN
Sbjct  311   YRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATAAVVGEGFLARDITFQN  370

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             TAG SK QAVALRVG+DLSAFYNC+M AYQDTLYVHSNRQF+V CLI+GTVDFIFGNA
Sbjct  371   TAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGNA  428



>ref|XP_009601611.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=592

 Score =   485 bits (1249),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 243/359 (68%), Positives = 286/359 (80%), Gaps = 6/359 (2%)
 Frame = -2

Query  1062  TRYPDLCYSSLAST-PEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             T + +LCYS++A+  P  SKKV +QKDVIELSL  T K  + N   + KLV +    T+R
Sbjct  79    TLHQELCYSTIANNIPNSSKKVTNQKDVIELSLNITTKAVQRNYYAIDKLVKTRKGLTER  138

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             EKIA  DCLETID+ + +L+TA++DL  YP+ KS+  HADDLKTL+SAA+TNQETCLDGF
Sbjct  139   EKIALHDCLETIDETIDELHTAVEDLEKYPNAKSLRQHADDLKTLISAAITNQETCLDGF  198

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIK--ASGN--RKLKEVEG  538
             SH +AD   RK +  GQV+VEKLCSN L++I+NMTDTD QNE+K  ASG   RKL E   
Sbjct  199   SHDEADKKVRKILLKGQVYVEKLCSNALAMIKNMTDTDIQNEMKLVASGKVKRKLNEESS  258

Query  537   GCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
             G  WPEWLS GDRRLLQS + T +VVVAADGSG+Y+TV+EAV NAP KSSKRYVIRIKAG
Sbjct  259   GT-WPEWLSTGDRRLLQSPSVTADVVVAADGSGDYKTVAEAVANAPEKSSKRYVIRIKAG  317

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              YKE+V+V K K NIMF+GDGR  T+ITG+RNV DGSTTF+SATVA VGE FLARDITF+
Sbjct  318   VYKESVEVSKKKKNIMFMGDGRENTIITGSRNVKDGSTTFHSATVAAVGEGFLARDITFE  377

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             NTAG  K QAVALRVG+DLSAFY C+M  YQDTLYVHSNRQF+V+C ISGTVDFIFGNA
Sbjct  378   NTAGHEKHQAVALRVGADLSAFYKCDMLGYQDTLYVHSNRQFFVQCFISGTVDFIFGNA  436



>ref|XP_008228105.1| PREDICTED: pectinesterase [Prunus mume]
Length=587

 Score =   482 bits (1240),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 261/415 (63%), Positives = 312/415 (75%), Gaps = 19/415 (5%)
 Frame = -2

Query  1203  KMARTQEFLTLLASLVLISGDMVAGVAAG----------EANsldvsssiiksscgSTRY  1054
             K  + Q F+ L+A+++L+    + G+A G          ++ +   S +I+KSSC ST Y
Sbjct  22    KKNKKQLFIALVAAILLVGA--LIGIATGVKSQNKNSGDDSEASAASHAILKSSCSSTLY  79

Query  1053  PDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIA  874
             PDLC+S+LA+ P  +KKV SQKDVIELSL  T    E N   V+KL+ S    TKREK+A
Sbjct  80    PDLCFSTLAA-PGAAKKVSSQKDVIELSLNITTTAVEHNFFAVKKLLKSRKKLTKREKVA  138

Query  873   FGDCLETIDQALFQLNTALQDLRVYPSKK-SIVAHADDLKTLMSAAMTNQETCLDGFSHC  697
               DCLE ID+ L +L+ A+ DL  YP+KK S+  +ADDLKTL+S+A+TNQETCLDGFSH 
Sbjct  139   LHDCLENIDETLDELHAAVADLHEYPNKKKSLTQYADDLKTLISSAITNQETCLDGFSHD  198

Query  696   KADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV---EGGCEW  526
              AD   RK +  GQVHVE+LCSN L++IRNMTD D  N  K + NRKLKE    E G  W
Sbjct  199   DADKKVRKVLEKGQVHVEQLCSNALAMIRNMTDNDIANASKMNVNRKLKEEVVEEKG--W  256

Query  525   PEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKE  346
             PEWLS  DRRLLQS+  TPNVVVAADGSGNY+TVSEAV  AP KSS RYVIRIKAG Y+E
Sbjct  257   PEWLSVADRRLLQSSTVTPNVVVAADGSGNYKTVSEAVAAAPEKSSTRYVIRIKAGVYRE  316

Query  345   NVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAG  166
             NVDVPK KTNIMF+GDGR  T+IT +RNV+DGSTTFNSATVA VGE+F+ARDITFQNTAG
Sbjct  317   NVDVPKKKTNIMFLGDGRTSTIITASRNVVDGSTTFNSATVAAVGEKFIARDITFQNTAG  376

Query  165   ASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
              SK QAVALRVGSDLSAFY  ++ AYQD+LYVHSNRQF+  CL++GTVDFIFGNA
Sbjct  377   PSKHQAVALRVGSDLSAFYRVDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGNA  431



>ref|XP_004141734.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN45437.1| hypothetical protein Csa_7G447990 [Cucumis sativus]
Length=595

 Score =   480 bits (1235),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 252/406 (62%), Positives = 306/406 (75%), Gaps = 13/406 (3%)
 Frame = -2

Query  1182  FLTLLASLVLISG---DMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEV  1012
              +  L S +LI G    +VAG     +     S +I+KS+C ST YPD+CYS+++ +   
Sbjct  35    LIVTLCSTLLIVGAVIGIVAGTTKSSSKYSGESHAIVKSTCSSTLYPDMCYSAISRSEGA  94

Query  1011  SKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQ  832
               KV++QKDVIE+S+  T+K  E N   V+KL     N + RE+IA  DCLETID+ L +
Sbjct  95    MLKVKNQKDVIEISINITVKAVEENYFRVKKLC-GLKNISHRERIALHDCLETIDETLDE  153

Query  831   LNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQV  652
             L+ A+ DL  YP+KKS+  HADDLKTL+S+A+TNQETCLDGFSH  AD N R  +  GQ+
Sbjct  154   LHKAIVDLNEYPNKKSLNQHADDLKTLLSSAITNQETCLDGFSHDDADKNLRDKLKEGQM  213

Query  651   HVEKLCSNCLSLIRNMTDTDAQN---EIKASGNRKLKEVEG------GCEWPEWLSAGDR  499
              VE +CSN L++I+NMTDTD  N   ++  + NRKL   E       G +WPEWLSAGDR
Sbjct  214   EVEHMCSNALAMIKNMTDTDIANYEAKMGITKNRKLMAEEDDNNNDDGIQWPEWLSAGDR  273

Query  498   RLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKT  319
             RLLQS++ TPNVVVAADGSGN+RTV+ AV  AP +SSKRYVIRIKAG Y+ENV+VPK KT
Sbjct  274   RLLQSSSVTPNVVVAADGSGNFRTVAAAVAAAPVRSSKRYVIRIKAGVYRENVEVPKKKT  333

Query  318   NIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVAL  139
             NIMFIGDGR  T+ITG+RNV+DGSTTFNSAT+A VGE FLARDITFQNTAG SK QAVAL
Sbjct  334   NIMFIGDGRRNTIITGSRNVVDGSTTFNSATMAAVGEGFLARDITFQNTAGPSKHQAVAL  393

Query  138   RVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             RVG+DLSAFY C+M AYQDTLYVHSNRQFY+ CL+SGTVDFIFGNA
Sbjct  394   RVGADLSAFYQCDMLAYQDTLYVHSNRQFYINCLVSGTVDFIFGNA  439



>ref|XP_006388348.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
 gb|ERP47262.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
Length=579

 Score =   479 bits (1233),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 243/398 (61%), Positives = 303/398 (76%), Gaps = 6/398 (2%)
 Frame = -2

Query  1182  FLTLLASLVLIS--GDMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEVS  1009
             FL   A+  L++    +V GV + +    + + +I+KS+C ST YP+LCYS++A+ P V+
Sbjct  28    FLASFAAFFLVATIAAVVTGVNSHKNGKNEGAHAILKSACSSTLYPELCYSAIATVPGVT  87

Query  1008  KKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQL  829
               + S KDVIELS+  T K  + N   V+KL+ + T  TKREK A  DCLETID+ L +L
Sbjct  88    SNLASLKDVIELSINLTTKTVQQNYFTVEKLI-AKTKLTKREKTALHDCLETIDETLDEL  146

Query  828   NTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQVH  649
             + A  D+  YP+KKS+   AD+LKTL+S+A+TNQETCLDGFSH  AD   RK +  GQ H
Sbjct  147   HEAQVDINGYPNKKSLKEQADNLKTLLSSAITNQETCLDGFSHDGADKKVRKALLKGQTH  206

Query  648   VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE--WPEWLSAGDRRLLQSTAA  475
             VEK+CSN L++IRNMTDTD  NE++ + NRKLKE + G E  WPEW+S  DRRLLQS++ 
Sbjct  207   VEKMCSNALAMIRNMTDTDIANELQNT-NRKLKEEKEGNERVWPEWMSVADRRLLQSSSV  265

Query  474   TPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDG  295
             TPNVVVAADGSG+Y+TVSEAV   P KSS RYVI+IKAG Y+ENV+VPK K N+MF+GDG
Sbjct  266   TPNVVVAADGSGDYKTVSEAVAAVPKKSSTRYVIQIKAGVYRENVEVPKDKHNVMFLGDG  325

Query  294   RGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSA  115
             R  T+IT +RNV+DGSTTF SATVA VG+ FLAR +TF+NTAG SK QAVALRVGSDLSA
Sbjct  326   RKTTIITASRNVVDGSTTFKSATVAAVGQGFLARGVTFENTAGPSKHQAVALRVGSDLSA  385

Query  114   FYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             FY C+M AYQDTLY HSNRQF++ CLI+GTVDFIFGNA
Sbjct  386   FYECDMLAYQDTLYAHSNRQFFINCLIAGTVDFIFGNA  423



>ref|XP_004172115.1| PREDICTED: pectinesterase 3-like, partial [Cucumis sativus]
Length=592

 Score =   479 bits (1234),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 252/406 (62%), Positives = 306/406 (75%), Gaps = 13/406 (3%)
 Frame = -2

Query  1182  FLTLLASLVLISG---DMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEV  1012
              +  L S +LI G    +VAG     +     S +I+KS+C ST YPD+CYS+++ +   
Sbjct  32    LIVTLCSTLLIVGAVIGIVAGTTKSSSKYSGESHAIVKSTCSSTLYPDMCYSAISRSEGA  91

Query  1011  SKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQ  832
               KV++QKDVIE+S+  T+K  E N   V+KL     N + RE+IA  DCLETID+ L +
Sbjct  92    MLKVKNQKDVIEISINITVKAVEENYFRVKKLC-GLKNISHRERIALHDCLETIDETLDE  150

Query  831   LNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQV  652
             L+ A+ DL  YP+KKS+  HADDLKTL+S+A+TNQETCLDGFSH  AD N R  +  GQ+
Sbjct  151   LHKAIVDLNEYPNKKSLNQHADDLKTLLSSAITNQETCLDGFSHDDADKNLRDKLKEGQM  210

Query  651   HVEKLCSNCLSLIRNMTDTDAQN---EIKASGNRKLKEVEG------GCEWPEWLSAGDR  499
              VE +CSN L++I+NMTDTD  N   ++  + NRKL   E       G +WPEWLSAGDR
Sbjct  211   EVEHMCSNALAMIKNMTDTDIANYEAKMGITKNRKLMAEEDDNNNDDGIQWPEWLSAGDR  270

Query  498   RLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKT  319
             RLLQS++ TPNVVVAADGSGN+RTV+ AV  AP +SSKRYVIRIKAG Y+ENV+VPK KT
Sbjct  271   RLLQSSSVTPNVVVAADGSGNFRTVAAAVAAAPVRSSKRYVIRIKAGVYRENVEVPKKKT  330

Query  318   NIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVAL  139
             NIMFIGDGR  T+ITG+RNV+DGSTTFNSAT+A VGE FLARDITFQNTAG SK QAVAL
Sbjct  331   NIMFIGDGRRNTIITGSRNVVDGSTTFNSATMAAVGEGFLARDITFQNTAGPSKHQAVAL  390

Query  138   RVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             RVG+DLSAFY C+M AYQDTLYVHSNRQFY+ CL+SGTVDFIFGNA
Sbjct  391   RVGADLSAFYQCDMLAYQDTLYVHSNRQFYINCLVSGTVDFIFGNA  436



>ref|XP_002532944.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF29428.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=577

 Score =   479 bits (1233),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 254/401 (63%), Positives = 310/401 (77%), Gaps = 9/401 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAAGEANsldvsssiikssc-gSTRYPDLCYSSLASTPEV  1012
             FL L AS+++I+    +V GV + + ++    S  I  S   +TRYPDLC+S++AS P  
Sbjct  28    FLALFASVLIIATVTAIVTGVNSNKKDTTASPSHSILKSSCSTTRYPDLCFSAVASAPGA  87

Query  1011  SKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQ  832
             + K+ S KDVIE+SL  T    E N   V+KL       TKREK A  DCLETID+ L +
Sbjct  88    TSKLVSLKDVIEVSLNLTTTAVEHNFFTVEKLA-KRKGLTKREKTALHDCLETIDETLDE  146

Query  831   LNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQV  652
             L+ A+ DL+ YP+KKS+  HADDLKTL+S+A+TNQETCLDGFSH  AD + R+ +  GQV
Sbjct  147   LHKAMDDLKEYPNKKSLSQHADDLKTLLSSAITNQETCLDGFSHDGADKHIREALLAGQV  206

Query  651   HVEKLCSNCLSLIRNMTDTDAQNEIKASG--NRKLKEVEGGCE--WPEWLSAGDRRLLQS  484
             HVEK+CSN L++I+NMTDTD  NE+K SG  NRKLKE E   E  WPEWLSAGDRRLLQS
Sbjct  207   HVEKMCSNALAMIKNMTDTDIANELKLSGSKNRKLKE-EKDQESVWPEWLSAGDRRLLQS  265

Query  483   TAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFI  304
             ++ TPNVVVAADGSG+Y+TVS AV  APSKSSKRY+IRIKAG YKENV+VPK KTN+MF+
Sbjct  266   SSVTPNVVVAADGSGDYKTVSAAVAAAPSKSSKRYIIRIKAGVYKENVEVPKGKTNLMFL  325

Query  303   GDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSD  124
             GDGR  T+ITG+RNV+DGSTTFNSATVA VG+ FLAR +TF+N AG SK QAVALRVG+D
Sbjct  326   GDGRKTTIITGSRNVVDGSTTFNSATVAAVGQGFLARGVTFENKAGPSKHQAVALRVGAD  385

Query  123   LSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             L+AFY C+M AYQDTLYVHSNRQF++ C I+GTVDFIFGN+
Sbjct  386   LAAFYECDMIAYQDTLYVHSNRQFFINCYIAGTVDFIFGNS  426



>emb|CAC01624.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=579

 Score =   479 bits (1232),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 242/398 (61%), Positives = 305/398 (77%), Gaps = 6/398 (2%)
 Frame = -2

Query  1182  FLTLLASLVLIS--GDMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEVS  1009
              L   A+L L++    +VAGV + +    + + +++KS+C ST YP+LCYS++A+ P V+
Sbjct  28    LLASFAALFLVATIAAVVAGVNSHKNGENEGAHAVLKSACSSTLYPELCYSAIATVPGVT  87

Query  1008  KKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQL  829
               + S KDVIELS+  T K  + N   V+KL+ + T  TKREK A  DCLETID+ L +L
Sbjct  88    GNLASLKDVIELSINLTTKTVQQNYFTVEKLI-AKTKLTKREKTALHDCLETIDETLDEL  146

Query  828   NTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQVH  649
             + A  D+  YP+KKS+   AD+L TL+S+A+TNQETCLDGFSH  AD   RK +  GQ H
Sbjct  147   HEAQVDISGYPNKKSLKEQADNLITLLSSAITNQETCLDGFSHDGADKKVRKALLKGQTH  206

Query  648   VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE--WPEWLSAGDRRLLQSTAA  475
             VEK+CSN L++I+NMTDTD  NE++ + NRKLKE + G E  WPEW+S  DRRLLQS++ 
Sbjct  207   VEKMCSNALAMIKNMTDTDIANELQNT-NRKLKEEKEGNERVWPEWMSVADRRLLQSSSV  265

Query  474   TPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDG  295
             TPNVVVAADGSG+Y+TVSEAV  AP KSSKRY+I+IKAG Y+ENV+VPK K NIMF+GDG
Sbjct  266   TPNVVVAADGSGDYKTVSEAVAAAPKKSSKRYIIQIKAGVYRENVEVPKDKHNIMFLGDG  325

Query  294   RGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSA  115
             R  T+IT +RNV+DGSTTF SATVA VG+ FLAR +TF+NTAG SK QAVALRVGSDLSA
Sbjct  326   RKTTIITASRNVVDGSTTFKSATVAAVGQGFLARGVTFENTAGPSKHQAVALRVGSDLSA  385

Query  114   FYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             FY C+M AYQDTLYVHSNRQF++ C ++GTVDFIFGNA
Sbjct  386   FYECDMLAYQDTLYVHSNRQFFINCFVAGTVDFIFGNA  423



>ref|XP_007217169.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
 gb|EMJ18368.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
Length=587

 Score =   478 bits (1230),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 258/413 (62%), Positives = 305/413 (74%), Gaps = 15/413 (4%)
 Frame = -2

Query  1203  KMARTQEFLTLLASLVLISG--DMVAGVAAGEANsldvsssiikssc------gSTRYPD  1048
             K  + Q F+ L+A+++L+     +V GV +   NS + S +   S         ST YPD
Sbjct  22    KKNKKQLFIALVAAILLVGAVIGIVTGVKSQNKNSGEDSEASAASHAILKSSCSSTLYPD  81

Query  1047  LCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFG  868
             LC+S+LA+ P  +KKV SQKDVIELSL  T      N   V+KL+ S    TKREK+A  
Sbjct  82    LCFSTLAA-PGAAKKVSSQKDVIELSLNITTTAVGHNFFAVKKLLKSRKKLTKREKVALH  140

Query  867   DCLETIDQALFQLNTALQDLRVYPSK-KSIVAHADDLKTLMSAAMTNQETCLDGFSHCKA  691
             DCLE ID+ L +L+ A+ DL  YP+K K +  +ADDLKTL+S+A+TNQETCLDGFSH  A
Sbjct  141   DCLENIDETLDELHAAVADLHEYPNKNKPLTQYADDLKTLISSAITNQETCLDGFSHDDA  200

Query  690   DHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV---EGGCEWPE  520
             D   RK +  GQVHVE+LCSN L++IRNMTD D  N  K + NRKLKE    E G  WPE
Sbjct  201   DKKVRKVLEKGQVHVEQLCSNALAMIRNMTDNDIANASKMNVNRKLKEEVVEEKG--WPE  258

Query  519   WLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENV  340
             WLS  DRRLLQS+  TPNVVVAADGSGNY+TVSEAV  AP KSS RYVIRIKAG Y+ENV
Sbjct  259   WLSVADRRLLQSSTVTPNVVVAADGSGNYKTVSEAVAAAPEKSSTRYVIRIKAGVYRENV  318

Query  339   DVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGAS  160
             DVPK KTNIMF+GDGR  T+IT +RNV+DGSTTFNSATVA VGE+FLARDITFQNTAG S
Sbjct  319   DVPKKKTNIMFLGDGRTSTIITASRNVVDGSTTFNSATVAAVGEKFLARDITFQNTAGPS  378

Query  159   KEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             K QAVALRVGSDLSAFY  ++ AYQD+LYVHSNRQF+  CL++GTVDFIFGNA
Sbjct  379   KHQAVALRVGSDLSAFYRVDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGNA  431



>ref|XP_003627458.1| Pectinesterase [Medicago truncatula]
 gb|AET01934.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=589

 Score =   475 bits (1223),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 231/360 (64%), Positives = 283/360 (79%), Gaps = 7/360 (2%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC+S+++S P ++ K+ + KDVI LSL  T +  E N   V+KL++  +  TKRE
Sbjct  75    TLYPELCFSAISSEPNITHKITNHKDVISLSLNITTRAVEHNYFTVEKLLLRKS-LTKRE  133

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             KIA  DCLETID+ L +L  A  DL +YPSKK++  HADDLKTL+S+A+TNQ TCLDGFS
Sbjct  134   KIALHDCLETIDETLDELKEAQNDLVLYPSKKTLYQHADDLKTLISSAITNQVTCLDGFS  193

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTD-AQNE-----IKASGNRKLKEVE  541
             H  AD   RK +  GQ+HVE +CSN L++ +NMTD D A+ E     + ++ NRKL E E
Sbjct  194   HDDADKEVRKVLQEGQIHVEHMCSNALAMTKNMTDKDIAEFEQTNMVLGSNKNRKLLEEE  253

Query  540   GGCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKA  361
              G  WPEW+SAGDRRLLQ +    +VVVAADGSGN++TVSEAV  AP KSSKRYVI+IKA
Sbjct  254   NGVGWPEWISAGDRRLLQGSTVKADVVVAADGSGNFKTVSEAVAAAPLKSSKRYVIKIKA  313

Query  360   GTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITF  181
             G YKENV+VPK KTNIMF+GDGR  T+ITG+RNV+DGSTTF+SATVA+VG  FLARDITF
Sbjct  314   GVYKENVEVPKKKTNIMFLGDGRTNTIITGSRNVVDGSTTFHSATVAIVGGNFLARDITF  373

Query  180   QNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             QNTAG +K QAVALRVG+DLSAFYNC++ AYQDTLYVH+NRQF+V C ISGTVDFIFGN+
Sbjct  374   QNTAGPAKHQAVALRVGADLSAFYNCDIIAYQDTLYVHNNRQFFVNCFISGTVDFIFGNS  433



>ref|XP_011012638.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=573

 Score =   472 bits (1214),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 243/402 (60%), Positives = 301/402 (75%), Gaps = 9/402 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAAGEA-----NsldvsssiiksscgSTRYPDLCYSSLAS  1024
             FL+L +S++L++    +VAGV + +      N   V+ +I+KSSC ST YP LC+SS+++
Sbjct  17    FLSLFSSILLVAAIVSIVAGVTSSKNSTESNNDHQVAYTILKSSCSSTLYPHLCFSSISA  76

Query  1023  TPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQ  844
              P+ + K++S+KDVI+LSL  T+     +   +QKL  +  ++T+RE  A  DCL  +++
Sbjct  77    VPDATSKIKSKKDVIDLSLNRTMSATRHSYFKIQKLTFTRRSFTERENTALHDCLVMLNE  136

Query  843   ALFQLNTALQDLRVYPS-KKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPI  667
              L QL+ A Q+L+ YPS KKS+  HADDLK L+SA MTNQETCLDGFSH KAD   R+  
Sbjct  137   TLDQLSKAYQELQDYPSLKKSLSVHADDLKILLSATMTNQETCLDGFSHEKADKKVRELF  196

Query  666   FNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQ  487
              + ++HV  + S  L++I+N+TDTD   E   S  RKL+E E G EWPEWLSAGDRRLLQ
Sbjct  197   IDEEMHVYHMSSIALAIIKNVTDTDMAKEQSLSSGRKLEE-ENGTEWPEWLSAGDRRLLQ  255

Query  486   STAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMF  307
             +T  TPNVVVAADGSGNYRTVSEAV  AP  SS RY+IRIKAG Y+ENVDVP  KTNIMF
Sbjct  256   ATTVTPNVVVAADGSGNYRTVSEAVAAAPESSSSRYIIRIKAGVYRENVDVPSRKTNIMF  315

Query  306   IGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGS  127
             +GDGR  T+IT +RNV+DGSTTFNSATVA VG  FLARDITFQN+AG SK QAVA+RVGS
Sbjct  316   MGDGRTTTIITASRNVVDGSTTFNSATVAAVGGGFLARDITFQNSAGPSKHQAVAIRVGS  375

Query  126   DLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             DLSAFY C M AYQDTLYVHS RQFYV C+I G+VDFIFGNA
Sbjct  376   DLSAFYRCGMIAYQDTLYVHSLRQFYVSCIIIGSVDFIFGNA  417



>ref|XP_011048630.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=579

 Score =   472 bits (1215),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 228/356 (64%), Positives = 282/356 (79%), Gaps = 4/356 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LCYS++A+ P V+  + S +DVIELS+  T K  + N   V+KL+ + T  TKRE
Sbjct  70    TLYPELCYSAIATVPGVTSNLASLRDVIELSINLTTKTVQQNFFTVEKLI-AKTKLTKRE  128

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+ A  D+  YP+KKS+   AD+L TL+S+A+TNQETCLDGFS
Sbjct  129   KTALHDCLETIDETLDELHEAQVDIIGYPNKKSLKEQADNLITLLSSAITNQETCLDGFS  188

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE--  529
             H  AD   R+ +  GQ HVEK+CSN L++I+NMTDTD  N+++ + NRKLKE + G E  
Sbjct  189   HDGADKKVREALLKGQTHVEKMCSNALAMIKNMTDTDIANKLQKT-NRKLKEEKEGNERV  247

Query  528   WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
             WPEW+S  DRRLLQS++ TPNVVVAADGSG+Y TVSEAV  AP+KSS RY+I+IKAG Y+
Sbjct  248   WPEWMSVADRRLLQSSSVTPNVVVAADGSGDYETVSEAVAAAPNKSSTRYIIQIKAGVYR  307

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV+VPK+K NIMF+G+GR  T+IT +RNV+DGSTTF SATVA VG+ FLAR +TFQNTA
Sbjct  308   ENVEVPKNKHNIMFLGEGRNTTIITASRNVVDGSTTFKSATVAAVGQGFLARGVTFQNTA  367

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK QAVALRVGSDLSAFY C+M AYQDTLYVHSNRQF++ CLI+GTVDFIFGNA
Sbjct  368   GPSKHQAVALRVGSDLSAFYECDMLAYQDTLYVHSNRQFFINCLIAGTVDFIFGNA  423



>ref|XP_008462453.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=598

 Score =   472 bits (1214),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 237/363 (65%), Positives = 281/363 (77%), Gaps = 10/363 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YPD+CYS+++ +     KV+SQKDVIE+S+  T+K  E N   V+KL     N + RE
Sbjct  81    TLYPDMCYSAISKSEGAMLKVKSQKDVIEVSINITVKAVEENYFRVKKLC-GLKNISHRE  139

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             KIA  DCLETID+ L +L+ A+ DL  YP+KKS+  HADDLKTL+S+A+TNQETCLDGFS
Sbjct  140   KIALHDCLETIDETLDELHKAIVDLNEYPNKKSLNQHADDLKTLLSSAITNQETCLDGFS  199

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN---EIKASGNRKL------K  550
             H  AD   R  +  GQ+ VE +CSN L++I+NMTDTD  N   ++  + NRKL       
Sbjct  200   HDNADKTLRDKLKAGQMEVEHMCSNALAMIKNMTDTDIANYEAKMGITKNRKLMAEEEDN  259

Query  549   EVEGGCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIR  370
                   +WPEWLSAGDRRLLQS++ TPNVVVAADGSGN+RTV+ AV  AP KSSKRYVIR
Sbjct  260   NNNDEIQWPEWLSAGDRRLLQSSSVTPNVVVAADGSGNFRTVAAAVAAAPEKSSKRYVIR  319

Query  369   IKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARD  190
             IKAG Y+ENV+VPK KTNIMF+GDGR  T+ITG+RNV+DGSTTF SATVA VGE FLARD
Sbjct  320   IKAGVYRENVEVPKKKTNIMFMGDGRRNTIITGSRNVVDGSTTFKSATVAAVGEGFLARD  379

Query  189   ITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIF  10
             ITFQNTAG SK QAVALRVG+DLSAFY C+M AYQDTLYVHSNRQFY+ CL+SGTVDFIF
Sbjct  380   ITFQNTAGPSKHQAVALRVGADLSAFYQCDMLAYQDTLYVHSNRQFYINCLVSGTVDFIF  439

Query  9     GNA  1
             GNA
Sbjct  440   GNA  442



>ref|XP_007012502.1| Pectin methylesterase 3 [Theobroma cacao]
 gb|EOY30121.1| Pectin methylesterase 3 [Theobroma cacao]
Length=573

 Score =   468 bits (1205),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 224/355 (63%), Positives = 279/355 (79%), Gaps = 3/355 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S++++ P+   K++S KDVI  S+  TI   ++N  +++KL+ +  N  KRE
Sbjct  65    TLYPELCLSTISAAPDAETKIKSPKDVIVTSMNLTITAVQSNYLSIKKLISTNKNLPKRE  124

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPS-KKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             K A  DCLE  D+ L +L  A QDL  YP+  KSI  HAD+LKTL+SAAMTNQETCLDGF
Sbjct  125   KTALNDCLELEDETLDELYKAEQDLSDYPTFNKSISQHADELKTLLSAAMTNQETCLDGF  184

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
             SH  AD   R+ + +GQ+HV  +CSN L++I+N+TDTD  ++   SG R+L+E +   EW
Sbjct  185   SHDSADKKVRQALIDGQMHVFHMCSNALAMIKNLTDTDMASQGYPSG-RQLEE-QDETEW  242

Query  525   PEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKE  346
             PEWLSAGDRRLLQ+   TP+V VAADGSG++RTVSEAV  AP +S++RY+I+IKAG YKE
Sbjct  243   PEWLSAGDRRLLQAPTVTPDVTVAADGSGDFRTVSEAVAAAPERSTRRYIIKIKAGVYKE  302

Query  345   NVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAG  166
             NVDVP+ KTN+MF+GDGR  T+IT +RNV+DGSTTFNSATVA VG+ FLARDITFQNTAG
Sbjct  303   NVDVPRGKTNLMFVGDGRVNTIITASRNVVDGSTTFNSATVAAVGDGFLARDITFQNTAG  362

Query  165   ASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
              SK QAVALRVGSDLSAFY C+M AYQDTLYVHS RQFYV+CL++GTVDFIFGNA
Sbjct  363   PSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSLRQFYVQCLVAGTVDFIFGNA  417



>ref|XP_010029512.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=587

 Score =   466 bits (1198),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 240/361 (66%), Positives = 281/361 (78%), Gaps = 7/361 (2%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVS-TTNYTKR  886
             TRYPDLCYS++A+ P  +  + +QKDVIE SL  T    E N   V+KL+   + + TKR
Sbjct  71    TRYPDLCYSAVAAFPGAAAGLATQKDVIEASLNITTVAVEHNFFAVEKLLSKRSKSLTKR  130

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSK-KSIVAHADDLKTLMSAAMTNQETCLDG  709
             EK A  DCLETID+ L +L  A +DL  YPS  KS+  HADDLKTLMS+A+TNQETCLDG
Sbjct  131   EKRALHDCLETIDETLDELREAERDLSSYPSAAKSLKQHADDLKTLMSSAITNQETCLDG  190

Query  708   FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRK-LKE---VE  541
             FSH  AD   RK +  GQVHVEK+CSN L++I+NMTD D + E KA+ NRK LKE   V+
Sbjct  191   FSHEDADRQVRKALAKGQVHVEKMCSNALAMIKNMTDADMEAERKAAANRKMLKEEDLVQ  250

Query  540   GG-CEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIK  364
             G    WPEWLSAGDRRLLQSTA  P+VVVAADG+G Y+T+SEAV  AP KSSKRYVI+I 
Sbjct  251   GDKSGWPEWLSAGDRRLLQSTAVIPDVVVAADGTGKYKTISEAVAAAPEKSSKRYVIKIN  310

Query  363   AGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDIT  184
             AG Y+ENV VPK KTN+MFIGDGR  T+ITG+R+V  G TTF SATVAVVGERFLA+ IT
Sbjct  311   AGVYRENVQVPKKKTNLMFIGDGRTTTIITGDRSVKGGFTTFESATVAVVGERFLAKSIT  370

Query  183   FQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGN  4
             FQNTAG S  QAVALRVG+DLSAFY C++ AYQDTLYVH+NRQF+VKCLI+GTVDFIFGN
Sbjct  371   FQNTAGPSNHQAVALRVGADLSAFYECDILAYQDTLYVHNNRQFFVKCLIAGTVDFIFGN  430

Query  3     A  1
             A
Sbjct  431   A  431



>ref|XP_003528739.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=598

 Score =   466 bits (1198),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 226/364 (62%), Positives = 281/364 (77%), Gaps = 11/364 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LCYS++AS P V+ K+ + +DVI+LSLK T +  E N   V+KL     + TKRE
Sbjct  80    TFYPELCYSAIASEPNVTHKITTNRDVIQLSLKITFRAVEQNYFTVKKLFTEHDDLTKRE  139

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L  A  +L +YP+KK++  HADDLKTL+SAA+TNQ TCLDGFS
Sbjct  140   KTALHDCLETIDETLDELREAQHNLELYPNKKTLYQHADDLKTLISAAITNQVTCLDGFS  199

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-----EIKASG-----NRKL  553
             H  AD + RK +  GQVHVE +CSN L++ +NMTD+D  N      ++ +G     NRKL
Sbjct  200   HDDADKHVRKALEKGQVHVEHMCSNALAMTKNMTDSDIANYEYNMRVENNGQNGNSNRKL  259

Query  552   KEVEGGCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVI  373
               VE   EWPEW+SA DRRLLQ++    +V VAADGSG+++TV+EAV  AP KSSKR+VI
Sbjct  260   L-VENDVEWPEWISAADRRLLQASTVKADVTVAADGSGDFKTVTEAVDAAPLKSSKRFVI  318

Query  372   RIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLAR  193
             RIKAG Y+ENV+VPK K NIMF+GDGR  T+IT +RNV+DGSTTF+SATVAVVG  FLAR
Sbjct  319   RIKAGVYRENVEVPKKKNNIMFLGDGRTNTIITASRNVVDGSTTFHSATVAVVGSNFLAR  378

Query  192   DITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFI  13
             D+TFQNTAG SK QAVALRVG DLSAF+NC++ A+QDTLYVH+NRQF+VKCLI+GTVDFI
Sbjct  379   DLTFQNTAGPSKHQAVALRVGGDLSAFFNCDILAFQDTLYVHNNRQFFVKCLIAGTVDFI  438

Query  12    FGNA  1
             FGN+
Sbjct  439   FGNS  442



>ref|XP_004303758.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1-like [Fragaria 
vesca subsp. vesca]
Length=578

 Score =   464 bits (1194),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 245/406 (60%), Positives = 296/406 (73%), Gaps = 16/406 (4%)
 Frame = -2

Query  1182  FLTLLASLVLISGDMVAGVAAG-------EANsldvsssiiksscgSTRYPDLCYSSLAS  1024
             FL  +A+++L++   V G+A G         N    ++  I        YP+LC+S+LA+
Sbjct  21    FLAFIATVLLVAA--VIGIATGVQNKNSNSDNETLSAAHAIVKIMQLHPYPELCFSTLAT  78

Query  1023  TPEVSKKVRSQKDVIELSLKNTIKIAETNR-ANVQKLVVSTTNYTKREKIAFGDCLETID  847
                 +  V S KDVI LSL  TI   E N     + +     + TKRE+ A  DCLETID
Sbjct  79    X-AATTNVTSFKDVIGLSLNITITAVEHNFFTIKKLIKKLVKSLTKRERCALHDCLETID  137

Query  846   QALFQLNTALQDLRVYPS-KKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKP  670
             + L +L+ A++DL  YPS  K++ AHADDLKTL+S+A+TNQETCLDGFSH +AD   RK 
Sbjct  138   ETLDELHEAVKDLFQYPSINKTLTAHADDLKTLISSAITNQETCLDGFSHAEADKIVRKS  197

Query  669   IFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKA---SGNRKLKEVEGGCEWPEWLSAGDR  499
             +  GQ +VEKLCSN L++I+NMTD D  NE+KA   + NRKLKE E    WPEWLSA DR
Sbjct  198   LEKGQKYVEKLCSNALAMIKNMTDNDIANEMKAMSSTTNRKLKE-ERSEGWPEWLSAADR  256

Query  498   RLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKT  319
              LLQS+  TPNV+VAADGSGNY+TVSEAV  APSKS+ RYVIRIKAG Y+ENVDVPK+KT
Sbjct  257   HLLQSSTVTPNVIVAADGSGNYKTVSEAVAAAPSKSTSRYVIRIKAGVYRENVDVPKAKT  316

Query  318   NIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVAL  139
             NIMF+GDGR  T+ITG+RNV+DG TTFNSATVA VG  FLARDITFQNTAG SK QAVAL
Sbjct  317   NIMFLGDGRTTTIITGSRNVVDGDTTFNSATVAAVGAGFLARDITFQNTAGPSKHQAVAL  376

Query  138   RVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             RVGSDLSAFY C++ AYQD+LYVHSNRQF+  C I+GTVDFIFGNA
Sbjct  377   RVGSDLSAFYRCDILAYQDSLYVHSNRQFFEGCFIAGTVDFIFGNA  422



>ref|XP_010273801.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=580

 Score =   464 bits (1193),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 242/399 (61%), Positives = 297/399 (74%), Gaps = 7/399 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAA--GEANsldvsssiiksscgSTRYPDLCYSSLASTPE  1015
             FL L+AS +L++    +VAGVA+    +     + +I+KSSC ST YPDLCYS++A+ P 
Sbjct  28    FLFLIASFLLVASVIGIVAGVASRKNSSKIPSSAHAILKSSCSSTLYPDLCYSAIATVPG  87

Query  1014  VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALF  835
              +  + +QKDVIE+SL  T    E N   ++KL+ +    T+REK A  DCLE +D+ L 
Sbjct  88    AADNLSTQKDVIEISLNITTTAVEHNYFTIKKLL-AHEKLTEREKTALHDCLEMVDETLD  146

Query  834   QLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQ  655
             +L+   +DL+ YP+KKS+  HA+DLK L+SAAMTNQ+TC+DGFSH +AD   R  +  GQ
Sbjct  147   ELHETAEDLKQYPNKKSLDEHAEDLKILLSAAMTNQDTCIDGFSHEQADKEVRNALLKGQ  206

Query  654   VHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE-WPEWLSAGDRRLLQSTA  478
              HV  +CSN L++I+NMTDTD   E K    RKL E  G  + +P WLSAGDRRLLQ++ 
Sbjct  207   EHVYHMCSNALAMIKNMTDTDMAEE-KLKMGRKLGESTGEIDGFPGWLSAGDRRLLQAST  265

Query  477   ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGD  298
              TP+V VA+DGSGNY+TVSEAV  AP  S+KRY+IRIKAG YKENVDV K K NIMF+GD
Sbjct  266   VTPDVTVASDGSGNYKTVSEAVAAAPINSNKRYIIRIKAGVYKENVDVSKKKKNIMFVGD  325

Query  297   GRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLS  118
             GR  T+ITG+RNV+DGSTTF+SATVA VGE FLARDITFQNTAG SK QAVALRVGSD S
Sbjct  326   GRKNTIITGSRNVVDGSTTFHSATVAAVGEGFLARDITFQNTAGPSKHQAVALRVGSDKS  385

Query  117   AFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AFY C+M AYQDTLYVHS RQFYV CLI GTVDFIFGNA
Sbjct  386   AFYRCDMLAYQDTLYVHSLRQFYVDCLIVGTVDFIFGNA  424



>emb|CDX97564.1| BnaA05g25150D [Brassica napus]
Length=592

 Score =   463 bits (1192),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 235/371 (63%), Positives = 273/371 (74%), Gaps = 19/371 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S++A+   V  K+ SQKDVIE SL  T    E N   V+KL+  T   T RE
Sbjct  68    TLYPELCISAVATAGGV--KLTSQKDVIEASLNLTTTAVEHNYFGVKKLIKKTKGLTPRE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+ AL+DL +YP+KKS+  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  126   KTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLISSAITNQETCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKEVE--  541
             H  AD   RK +  GQ+HVE +CSN L++I+NMTDTD  N E+KA   S NRKLKE E  
Sbjct  186   HDAADKKVRKALLKGQMHVEHMCSNALAMIKNMTDTDIANFELKAKLSSNNRKLKEEETT  245

Query  540   -----------GGCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSK  394
                        G   WP WLSAGDRRLLQ +    +  VAADGSG + T+S AV  AP  
Sbjct  246   VAVDIAGAGELGADGWPTWLSAGDRRLLQGSTVKADATVAADGSGTFTTISAAVAAAPEN  305

Query  393   SSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVV  214
             S+KRYVI IKAG Y+ENVDV K K NIMF+GDGR  T+IT +RNV+DGSTTF+SATVA V
Sbjct  306   SNKRYVIHIKAGVYRENVDVAKKKKNIMFMGDGRTTTIITASRNVVDGSTTFHSATVAAV  365

Query  213   GERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLI  34
             GERFLARDITFQNTAG SK QAVALRVGSD SAFY C+M AYQDTLYVHSNRQF+VKCLI
Sbjct  366   GERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLI  425

Query  33    SGTVDFIFGNA  1
             +GTVDFIFGNA
Sbjct  426   AGTVDFIFGNA  436



>gb|AFW03476.1| pectin methylesterase 2 [Gossypium barbadense]
Length=521

 Score =   461 bits (1185),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 235/401 (59%), Positives = 302/401 (75%), Gaps = 8/401 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISGDMV----AGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPE  1015
             FL L AS++L++  +       ++  ++++   + SIIKSSC ST YP+LCYS+++S P+
Sbjct  12    FLALFASILLVTAIVTIATTVSISKKKSSNTVAAHSIIKSSCSSTLYPELCYSTISSAPD  71

Query  1014  VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVST-TNYTKREKIAFGDCLETIDQAL  838
                KV++ KDVIELSL  T+   ++N  +++KL+ +   + T+REK A  DCLE +D+ L
Sbjct  72    AETKVKNPKDVIELSLNLTVTAVQSNYLSIKKLISTQRKSLTEREKAALNDCLELVDETL  131

Query  837   FQLNTALQDLRVYPS-KKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFN  661
              +L  A  DL  YPS  KSI  HADDLK+L+SAAMTNQETCLDGFSH KAD   R+ + +
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  660   GQVHVEKLCSNCLSLIRNMTDTD-AQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQS  484
             GQ+HV  +CSN L++I+N+TDTD A      S  R+L+E +   EWP+WLS GDRRLLQ+
Sbjct  192   GQMHVFHMCSNALAMIKNLTDTDMASQGYHPSSGRQLEE-QDQTEWPKWLSEGDRRLLQA  250

Query  483   TAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFI  304
             T   PNV VAADGSG++ TVSEAV  AP +S+ RY+I+IKAG Y+ENVDVP  KTN+MF+
Sbjct  251   TTVIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDVPSKKTNLMFV  310

Query  303   GDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSD  124
             GDGR  T+IT +RNV+DGSTTF+SATVA VG+ FLARDITFQNTAG SK QAVALRVGSD
Sbjct  311   GDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKHQAVALRVGSD  370

Query  123   LSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             LSAFY C + AYQDTLYVHS RQFY +CL++G+VDFIFGNA
Sbjct  371   LSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDFIFGNA  411



>ref|XP_010501842.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Camelina 
sativa]
Length=592

 Score =   463 bits (1191),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 235/373 (63%), Positives = 276/373 (74%), Gaps = 21/373 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S++A+   V  K+ SQKDVIE SL  T    E N   V+KL+      T RE
Sbjct  66    TLYPELCISAVATAGGV--KLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKGLTPRE  123

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+ A++DL +YP+KK++  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  124   KTALHDCLETIDETLDELHDAVEDLHLYPTKKTLREHASDLKTLISSAITNQETCLDGFS  183

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKE----  547
             H  AD   RK +  GQ+HVE +CSN L++I+NMTDTD  N E KA   S NRKLKE    
Sbjct  184   HDSADKEVRKALQKGQIHVEHMCSNALAMIKNMTDTDIANFEQKAKITSNNRKLKEESQE  243

Query  546   ------VEGGCE-----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAP  400
                   + G  E     WP WLSAGDRRLLQ +    +  VAADGSG ++TV+ AV  AP
Sbjct  244   TTVAVDIAGAGELDAEGWPTWLSAGDRRLLQGSGVRADATVAADGSGTFKTVASAVAAAP  303

Query  399   SKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVA  220
               S+KRYVI IKAG Y+ENVDV K K NIMF+GDGR +T+ITGNRNV+DGSTTF+SATVA
Sbjct  304   ENSNKRYVIHIKAGVYRENVDVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATVA  363

Query  219   VVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKC  40
              VGERFLARDITFQNTAG SK QAVALRVGSD SAFYNC+M AYQDTLYVHSNRQF+VKC
Sbjct  364   AVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKC  423

Query  39    LISGTVDFIFGNA  1
             LI+GTVDFIFGNA
Sbjct  424   LIAGTVDFIFGNA  436



>ref|XP_009146386.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Brassica 
rapa]
Length=592

 Score =   463 bits (1191),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 235/371 (63%), Positives = 273/371 (74%), Gaps = 19/371 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S++A+   V  K+ SQKDVIE SL  T    E N   V+KL+  T   T RE
Sbjct  68    TLYPELCISAVATAGGV--KLTSQKDVIEASLNLTTTAVEHNYFGVKKLIKKTKGLTPRE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+ AL+DL +YP+KKS+  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  126   KTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLISSAITNQETCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKEVE--  541
             H  AD   RK +  GQ+HVE +CSN L++I+NMTDTD  N E+KA   S NRKLKE E  
Sbjct  186   HDAADKKVRKALLKGQMHVEHMCSNALAMIKNMTDTDIANFELKAKLSSNNRKLKEEETT  245

Query  540   -----------GGCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSK  394
                        G   WP WLSAGDRRLLQ +    +  VAADGSG + T+S AV  AP  
Sbjct  246   VAVDIAGAGELGADGWPTWLSAGDRRLLQGSTVKADATVAADGSGTFTTISAAVAAAPEN  305

Query  393   SSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVV  214
             S+KRYVI IKAG Y+ENVDV K K NIMF+GDGR  T+IT +RNV+DGSTTF+SATVA V
Sbjct  306   SNKRYVIHIKAGVYRENVDVAKKKKNIMFMGDGRTTTIITASRNVVDGSTTFHSATVAAV  365

Query  213   GERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLI  34
             GERFLARDITFQNTAG SK QAVALRVGSD SAFY C+M AYQDTLYVHSNRQF+VKCLI
Sbjct  366   GERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLI  425

Query  33    SGTVDFIFGNA  1
             +GTVDFIFGNA
Sbjct  426   AGTVDFIFGNA  436



>ref|XP_010029511.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=577

 Score =   462 bits (1188),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 233/361 (65%), Positives = 275/361 (76%), Gaps = 7/361 (2%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVS-TTNYTKR  886
             TRYPDLCYS++A+ P  +  + +QKDVIE SL  T    E N   V+KL+   +   TKR
Sbjct  62    TRYPDLCYSAVAAFPGAAAGLATQKDVIEASLNITTVAVEQNFFTVEKLLSKRSKRLTKR  121

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSK-KSIVAHADDLKTLMSAAMTNQETCLDG  709
             EK A  DCLETID+ L +L  A +DL  YPS  KS+  HADDLKTLMSAA+TNQETCLDG
Sbjct  122   EKRALHDCLETIDETLDELQQAARDLNSYPSAAKSLKQHADDLKTLMSAAITNQETCLDG  181

Query  708   FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE  529
             FSH  AD   R+ +  GQVHVEK+CSN L++I+NMTD D + E+KA  NR++ + E   +
Sbjct  182   FSHEDADRQVREALEKGQVHVEKMCSNALAMIKNMTDADMEAELKAPANRRMLKEEDPVQ  241

Query  528   -----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIK  364
                  WPEWLSAGDRRLLQSTA  P+ VVAADG+GNY T+SEAV  AP KSSKRYVIRIK
Sbjct  242   GDKSGWPEWLSAGDRRLLQSTAVIPDAVVAADGTGNYTTISEAVAAAPEKSSKRYVIRIK  301

Query  363   AGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDIT  184
              G Y+ENV VPK KTN+ FIGDGR  T+ITG+R+V  G TTF SATVAV+GERFLA++IT
Sbjct  302   TGVYRENVQVPKKKTNLTFIGDGRTTTIITGDRSVKGGFTTFESATVAVLGERFLAKNIT  361

Query  183   FQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGN  4
             FQNTAG S  QAVALRVG+DLSA Y C++ AYQDTLYVH NRQF+VKCLI+GTVDFIFGN
Sbjct  362   FQNTAGPSNHQAVALRVGADLSAIYECDILAYQDTLYVHKNRQFFVKCLIAGTVDFIFGN  421

Query  3     A  1
             A
Sbjct  422   A  422



>ref|XP_010465323.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Camelina 
sativa]
Length=592

 Score =   462 bits (1188),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 235/373 (63%), Positives = 276/373 (74%), Gaps = 21/373 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S++A+   V  K+ SQKDVIE SL  T    E N   V+KL+      T RE
Sbjct  66    TLYPELCISAVATAGGV--KLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKGLTPRE  123

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+ A++DL +YP+KK++  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  124   KTALHDCLETIDETLDELHEAVEDLHLYPTKKTLREHAADLKTLISSAITNQETCLDGFS  183

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKE----  547
             H  AD   RK +  GQ+HVE +CSN L++I+NMTDTD  N E KA   S NRKLKE    
Sbjct  184   HDGADKQVRKALQMGQIHVEHMCSNALAMIKNMTDTDIANFEQKAKITSNNRKLKEENQE  243

Query  546   ------VEGGCE-----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAP  400
                   + G  E     WP WLSAGDRRLLQ +    +  VAADGSG ++TV+ AV  AP
Sbjct  244   TSVAVDIAGAGELDSEGWPTWLSAGDRRLLQGSGVRADATVAADGSGKFKTVASAVAAAP  303

Query  399   SKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVA  220
               S+KRYVI IKAG Y+ENVDV K K NIMF+GDGR +T+ITGNRNV+DGSTTF+SATVA
Sbjct  304   ENSNKRYVIHIKAGVYRENVDVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATVA  363

Query  219   VVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKC  40
              VGERFLARDITFQNTAG SK QAVALRVGSD SAFYNC+M AYQDTLYVHSNRQF+VKC
Sbjct  364   AVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKC  423

Query  39    LISGTVDFIFGNA  1
             LI+GTVDFIFGNA
Sbjct  424   LIAGTVDFIFGNA  436



>ref|XP_006392745.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
 gb|ESQ30031.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
Length=584

 Score =   461 bits (1185),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 233/363 (64%), Positives = 278/363 (77%), Gaps = 12/363 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTK-R  886
             TRYP+LC+S++AST    KK+ S KDVIE SL  T  + + N   V+KL+       + R
Sbjct  69    TRYPELCFSAVAST---GKKLTSHKDVIEASLNLTTNVVKHNYFAVKKLITKRKGGLRAR  125

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             E  A  DCLETID+ L +L+ A++DL  YP  KS+  HADDLKTL+S+A+TNQETCLDGF
Sbjct  126   EATALHDCLETIDETLDELHVAVEDLHQYPKGKSLRKHADDLKTLISSAITNQETCLDGF  185

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIK----ASGNRKLKEVE  541
             S+  AD   RK +  GQVHVE +CSN L++I+NMTDTD  N E+K    +S NRKLKEV 
Sbjct  186   SYDDADRKVRKALMKGQVHVEHMCSNALAMIKNMTDTDIANFELKDRSTSSNNRKLKEVT  245

Query  540   G---GCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIR  370
             G   G  WP WLS GDRRLLQ +    +V VAADGSG++RT++ AV  AP KS+KR+VI 
Sbjct  246   GDLDGEGWPNWLSVGDRRLLQGSTVKADVTVAADGSGDFRTIAAAVAAAPEKSNKRFVIH  305

Query  369   IKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARD  190
             IKAG Y+ENV+V K K N+MF+GDGRGKT+ITG+RNV+DGSTTF+SATVA VGERFLARD
Sbjct  306   IKAGVYRENVEVTKKKKNVMFLGDGRGKTIITGSRNVVDGSTTFHSATVAAVGERFLARD  365

Query  189   ITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIF  10
             ITFQNTAG SK QAVALRVGSD SAFYNC+M AYQDTLYVHSNRQF+VKC I GTVDFIF
Sbjct  366   ITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIIGTVDFIF  425

Query  9     GNA  1
             GNA
Sbjct  426   GNA  428



>gb|AFB77928.1| pectin methylesterase [Gossypium hirsutum]
Length=567

 Score =   460 bits (1183),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 235/401 (59%), Positives = 302/401 (75%), Gaps = 8/401 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISGDMV----AGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPE  1015
             FL L AS++L++  +       ++  ++++   + SIIKSSC ST YP+LCYS+++S P+
Sbjct  12    FLALFASILLVTAIVTIATTVSISKKKSSNTVAAHSIIKSSCSSTLYPELCYSTISSAPD  71

Query  1014  VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVST-TNYTKREKIAFGDCLETIDQAL  838
                KV++ KDVIELSL  T+   ++N  +++KL+ +   + T+REK A  DCLE +D+ L
Sbjct  72    AETKVKNPKDVIELSLNLTVTAVQSNYLSIKKLISTQRKSLTEREKAALNDCLELVDETL  131

Query  837   FQLNTALQDLRVYPS-KKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFN  661
              +L  A  DL  YPS  KSI  HADDLK+L+SAAMTNQETCLDGFSH KAD   R+ + +
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  660   GQVHVEKLCSNCLSLIRNMTDTD-AQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQS  484
             GQ+HV  +CSN L++I+N+TDTD A      S  R+L+E +   EWP+WLS GDRRLLQ+
Sbjct  192   GQMHVFHMCSNALAMIKNLTDTDMASQGYHPSSGRQLEE-QDQTEWPKWLSEGDRRLLQA  250

Query  483   TAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFI  304
             T   PNV VAADGSG++ TVSEAV  AP +S+ RY+I+IKAG Y+ENVDVP  KTN+MF+
Sbjct  251   TTVIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDVPSKKTNLMFV  310

Query  303   GDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSD  124
             GDGR  T+IT +RNV+DGSTTF+SATVA VG+ FLARDITFQNTAG SK QAVALRVGSD
Sbjct  311   GDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKHQAVALRVGSD  370

Query  123   LSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             LSAFY C + AYQDTLYVHS RQFY +CL++G+VDFIFGNA
Sbjct  371   LSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDFIFGNA  411



>gb|KHF97383.1| Pectinesterase/pectinesterase inhibitor U1 [Gossypium arboreum]
Length=567

 Score =   460 bits (1183),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 235/401 (59%), Positives = 302/401 (75%), Gaps = 8/401 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISGDMV----AGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPE  1015
             FL L AS++L++  +       ++  ++++   + SIIKSSC ST YP+LCYS+++S P+
Sbjct  12    FLALFASILLVTAIVTIATTVSISKKKSSNTVAAHSIIKSSCSSTLYPELCYSTISSAPD  71

Query  1014  VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVST-TNYTKREKIAFGDCLETIDQAL  838
                KV++ KDVIELSL  T+   ++N  +++KL+ +   + T+REK A  DCLE +D+ L
Sbjct  72    AETKVKNPKDVIELSLNLTVTAVQSNYLSIKKLISTRRKSLTEREKAALNDCLELVDETL  131

Query  837   FQLNTALQDLRVYPS-KKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFN  661
              +L  A  DL  YPS  KSI  HADDLK+L+SAAMTNQETCLDGFSH KAD   R+ + +
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  660   GQVHVEKLCSNCLSLIRNMTDTD-AQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQS  484
             GQ+HV  +CSN L++I+N+TDTD A      S  R+L+E +   EWP+WLS GDRRLLQ+
Sbjct  192   GQMHVFHMCSNALAMIKNLTDTDMASQGYHPSSGRQLEE-QDQTEWPKWLSEGDRRLLQA  250

Query  483   TAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFI  304
             T   PNV VAADGSG++ TVSEAV  AP +S+ RY+I+IKAG Y+ENVDVP  KTN+MF+
Sbjct  251   TTVIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDVPSKKTNLMFV  310

Query  303   GDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSD  124
             GDGR  T+IT +RNV+DGSTTF+SATVA VG+ FLARDITFQNTAG SK QAVALRVGSD
Sbjct  311   GDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKHQAVALRVGSD  370

Query  123   LSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             LSAFY C + AYQDTLYVHS RQFY +CL++G+VDFIFGNA
Sbjct  371   LSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDFIFGNA  411



>ref|XP_010534986.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
 ref|XP_010534987.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
Length=587

 Score =   460 bits (1183),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 229/364 (63%), Positives = 276/364 (76%), Gaps = 11/364 (3%)
 Frame = -2

Query  1059  RYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREK  880
             RY DLC S+++++     ++ SQ+DVIE SL  T    E N   ++KL+      TKREK
Sbjct  68    RYQDLCVSAISTSALTGVELTSQRDVIEASLNITTTAVEHNYFTIKKLLEKRKGLTKREK  127

Query  879   IAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSH  700
              A  DCLETID+ L +L+ A+ DL  YP KKS+  HADDLKTL+S+A+TNQETCLDGFSH
Sbjct  128   TALHDCLETIDETLDELHEAMDDLNEYPDKKSLRQHADDLKTLISSAITNQETCLDGFSH  187

Query  699   CKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKASGN-RKLKE----VEG  538
               AD   RK +  GQ+HVE +CSN L++I+NMTDTD  N E+KA+ + RKL E    V G
Sbjct  188   DDADKKVRKALEKGQIHVEHMCSNALAMIKNMTDTDIANFELKANNHHRKLVEDPAAVVG  247

Query  537   GCE-----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVI  373
             G E     WP+WLSAGDRRLLQST    +  VAADGSGN+RTV+  V  AP  S+KRYVI
Sbjct  248   GGEMDGDGWPKWLSAGDRRLLQSTTVKADATVAADGSGNFRTVAAGVAAAPENSNKRYVI  307

Query  372   RIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLAR  193
              IKAG Y+ENV+V K K NIMF+GDGR +T+ITG+RNV+DGSTTF+SATVA VGERFLAR
Sbjct  308   HIKAGVYRENVEVAKKKKNIMFMGDGRTRTIITGSRNVVDGSTTFHSATVAAVGERFLAR  367

Query  192   DITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFI  13
             DITFQNTAG SK QAVALRVGSD SAFY C++ AYQD+LYVHSNRQF+VKCL++GTVDFI
Sbjct  368   DITFQNTAGPSKHQAVALRVGSDFSAFYQCDILAYQDSLYVHSNRQFFVKCLVTGTVDFI  427

Query  12    FGNA  1
             FGNA
Sbjct  428   FGNA  431



>gb|AER38243.1| PME2 [Gossypium barbadense]
Length=521

 Score =   457 bits (1176),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 234/401 (58%), Positives = 301/401 (75%), Gaps = 8/401 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISGDMV----AGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPE  1015
             FL L AS++L++  +       ++  ++++   + SIIKSSC ST YP+LCYS+++S P+
Sbjct  12    FLALFASILLVTAIVTIATTVSISKKKSSNTVAAHSIIKSSCSSTLYPELCYSTISSAPD  71

Query  1014  VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVST-TNYTKREKIAFGDCLETIDQAL  838
                KV++ K VIELSL  T+   ++N  +++KL+ +   + T+REK A  DCLE +D+ L
Sbjct  72    AETKVKNPKGVIELSLNLTVTAVQSNYLSIKKLISTQRKSLTEREKAALNDCLELVDETL  131

Query  837   FQLNTALQDLRVYPS-KKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFN  661
              +L  A  DL  YPS  KSI  HADDLK+L+SAAMTNQETCLDGFSH KAD   R+ + +
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  660   GQVHVEKLCSNCLSLIRNMTDTD-AQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQS  484
             GQ+HV  +CSN L++I+N+TDTD A      S  R+L+E +   EWP+WLS GDRRLLQ+
Sbjct  192   GQMHVFHMCSNALAMIKNLTDTDMASQGYHPSSGRQLEE-QDQTEWPKWLSEGDRRLLQA  250

Query  483   TAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFI  304
             T   PNV VAADGSG++ TVSEAV  AP +S+ RY+I+IKAG Y+ENVDVP  KTN+MF+
Sbjct  251   TTVIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDVPSKKTNLMFV  310

Query  303   GDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSD  124
             GDGR  T+IT +RNV+DGSTTF+SATVA VG+ FLARDITFQNTAG SK QAVALRVGSD
Sbjct  311   GDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKHQAVALRVGSD  370

Query  123   LSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             LSAFY C + AYQDTLYVHS RQFY +CL++G+VDFIFGNA
Sbjct  371   LSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDFIFGNA  411



>ref|XP_010479961.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score =   459 bits (1180),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 229/362 (63%), Positives = 272/362 (75%), Gaps = 10/362 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YPDLC+S++A+T    K++ SQKDVIE SL  T K    N   V+KL+      T RE
Sbjct  79    TLYPDLCFSAVAATG--GKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTARE  136

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
               A  DCLETID+ L +L+ A++DL  YP +KS+  HADDLKTL+S+A+TNQ TCLDGFS
Sbjct  137   VTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDGFS  196

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTD-AQNEI----KASGNRKLKEVEG  538
             +  AD   RK +  GQVHVE +CSN L++I+NMTDTD A+ E+        NRKLKE+ G
Sbjct  197   YDNADKQVRKALLKGQVHVEHMCSNALAMIKNMTDTDIAKFELIDKSSTPTNRKLKEITG  256

Query  537   ---GCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
                G  WP WLS GDRRLLQ +    +  VAADGSG++RT+  AV  AP KS+KR+VI I
Sbjct  257   DLDGEGWPHWLSVGDRRLLQGSTVKADATVAADGSGDFRTIVAAVAAAPEKSNKRFVIHI  316

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             KAG Y+ENV+V K K NIMF+GDGRGKT+IT +RNV+DGSTTF+SATVA VGERFLARDI
Sbjct  317   KAGVYRENVEVTKKKKNIMFLGDGRGKTIITASRNVVDGSTTFHSATVAAVGERFLARDI  376

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             TFQNTAG SK QAVALRVGSD SAFYNC+M AYQDTLYVHSNRQF+VKC I GTVDFIFG
Sbjct  377   TFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIIGTVDFIFG  436

Query  6     NA  1
             NA
Sbjct  437   NA  438



>gb|EYU21270.1| hypothetical protein MIMGU_mgv1a003278mg [Erythranthe guttata]
Length=594

 Score =   457 bits (1177),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 236/364 (65%), Positives = 285/364 (78%), Gaps = 11/364 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSK-KVRSQKDVIELSLKNTIKIAETNRANVQKLVVS------T  904
             T YP+LCYS++A + +  K KV+S+KDVI LSL  T      N   ++KL+        +
Sbjct  76    TLYPELCYSAIADSLDGGKEKVKSKKDVIILSLNVTTAAVRRNYFAIEKLLAGGGGGAKS  135

Query  903   TNYTKREKIAFGDCLETIDQALFQLNTALQDLRVYPS-KKSIVAHADDLKTLMSAAMTNQ  727
              N T+REK A  DCLETI + L +L+ A++DL+ YPS KKS+  HAD LKTL+S+A+TNQ
Sbjct  136   GNLTEREKSALHDCLETIGETLDELHAAVEDLKEYPSLKKSVKNHADYLKTLISSAITNQ  195

Query  726   ETCLDGFSHCKADHNARKPIFNGQV-HVEKLCSNCLSLIRNMTDTDAQNEIKA-SGNRKL  553
             ETCLDGFSH K D +AR+ +  GQV  VEKLCSN L++I NMTDTD +NE +  +  RKL
Sbjct  196   ETCLDGFSHGKTDRHAREILVGGQVVRVEKLCSNSLAMICNMTDTDIENEKRGLTSGRKL  255

Query  552   KEVEGGCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVI  373
                EGG  WPEWLS+GDRRLLQS+  TP+VVVAADGSG++RTVS AV  AP KS++RYVI
Sbjct  256   V-AEGGGGWPEWLSSGDRRLLQSSTVTPDVVVAADGSGDHRTVSAAVAAAPEKSNRRYVI  314

Query  372   RIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLAR  193
             RIKAG Y+ENVDV K KTNIMF+GDGR  T+ITG++NV DGSTTFNSATVAVVGE+FLAR
Sbjct  315   RIKAGVYRENVDVGKKKTNIMFVGDGRSTTIITGSKNVQDGSTTFNSATVAVVGEKFLAR  374

Query  192   DITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFI  13
             DITFQNTAG +K QAVALRVGSDLSAFY C++ AYQDTLYVHSNR F+V+CLI+GTVDFI
Sbjct  375   DITFQNTAGPTKHQAVALRVGSDLSAFYRCDILAYQDTLYVHSNRHFFVQCLIAGTVDFI  434

Query  12    FGNA  1
             FGN 
Sbjct  435   FGNG  438



>ref|XP_006407094.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
 gb|ESQ48547.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
Length=592

 Score =   457 bits (1176),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 234/371 (63%), Positives = 279/371 (75%), Gaps = 19/371 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S++A++ +V  K+ SQKDVIE SL  T    E N   V+KL+ +    T RE
Sbjct  68    TLYPELCVSAVATSGDV--KLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNRKGLTPRE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+ A++DL +YP+KK++  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  126   KTALHDCLETIDETLDELHEAVEDLHLYPTKKTLREHAGDLKTLISSAITNQETCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKEVE--  541
             H  AD   RK +  GQ+HVE +CSN L++I+NMTDTD  N E+KA   S NRKLKE E  
Sbjct  186   HDAADKKVRKALMKGQIHVEHMCSNALAMIKNMTDTDIANFELKAKLTSNNRKLKEEETT  245

Query  540   ------GGCE-----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSK  394
                   G  E     WP WLSAGDRRLLQ +    +  VAADGSG ++TV+ AV  AP  
Sbjct  246   ASINIAGAGELDSEGWPTWLSAGDRRLLQGSTVKADATVAADGSGTFKTVAAAVAAAPEN  305

Query  393   SSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVV  214
             S+KRYVI IKAG Y+ENV+V K K NIMF+GDGR +T+IT NRNV+DGSTTF+SATVA V
Sbjct  306   SNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTRTIITANRNVVDGSTTFHSATVAAV  365

Query  213   GERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLI  34
             GERFLARDITFQNTAG SK QAVALRVGSD SAFYNC+M AYQDTLYVHSNRQF+VKCLI
Sbjct  366   GERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLI  425

Query  33    SGTVDFIFGNA  1
             +GTVDFIFGNA
Sbjct  426   AGTVDFIFGNA  436



>ref|XP_010462289.1| PREDICTED: pectinesterase 2 [Camelina sativa]
Length=584

 Score =   457 bits (1175),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 228/362 (63%), Positives = 272/362 (75%), Gaps = 10/362 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC+S++A+T    K++ SQKDVIE SL  T K    N   V+KL+      T RE
Sbjct  69    TLYPELCFSAVAATG--GKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTARE  126

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
               A  DCLETID+ L +L+ A++DL  YP +KS+  HADDLKTL+S+A+TNQ TCLDGFS
Sbjct  127   VTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDGFS  186

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTD-AQNEI----KASGNRKLKEVEG  538
             +  AD   RK +  GQVHVE +CSN L++I+NMTDTD A+ E+        NRKLKE+ G
Sbjct  187   YDNADKQVRKALLKGQVHVEHMCSNALAMIKNMTDTDIAKFELIDKSSTPTNRKLKEITG  246

Query  537   ---GCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
                G  WP WLS GDRRLLQ +    +  VAADGSG++RT+  AV  AP KS+KR+VI I
Sbjct  247   ELDGEGWPHWLSVGDRRLLQGSTVKADATVAADGSGDFRTIVAAVTAAPEKSNKRFVIHI  306

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             KAG Y+ENV+V K K NIMF+GDGRGKT+IT +RNV+DGSTTF+SATVA VGERFLARDI
Sbjct  307   KAGVYRENVEVTKKKKNIMFLGDGRGKTIITASRNVVDGSTTFHSATVAAVGERFLARDI  366

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             TFQNTAG SK QAVALRVGSD SAFYNC+M AYQDTLYVHSNRQF+VKC I GTVDFIFG
Sbjct  367   TFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIIGTVDFIFG  426

Query  6     NA  1
             NA
Sbjct  427   NA  428



>gb|AFW03481.1| pectin methylesterase 2, partial [Gossypium hirsutum]
Length=521

 Score =   454 bits (1169),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 233/401 (58%), Positives = 300/401 (75%), Gaps = 8/401 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISGDMV----AGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPE  1015
             FL L AS++L++  +       ++  ++++   + SIIKSSC ST YP+LCYS+++S P+
Sbjct  12    FLALFASILLVTAIVTIATTVSISKKKSSNTVAAHSIIKSSCSSTLYPELCYSTISSAPD  71

Query  1014  VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVST-TNYTKREKIAFGDCLETIDQAL  838
                KV++ KDV ELSL  T+   ++N  +++KL+ +   + T+REK A  DCLE +D+ L
Sbjct  72    AETKVKNPKDVTELSLNLTVTAVQSNYLSIKKLISTQRKSLTEREKAALNDCLELVDETL  131

Query  837   FQLNTALQDLRVYPS-KKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFN  661
              +L  A  DL  YPS  KSI  HAD LK+L+SAAMTNQETCLDGFSH KAD   R+ + +
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADVLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  660   GQVHVEKLCSNCLSLIRNMTDTD-AQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQS  484
             GQ+HV  +CSN L++I+N+TDTD A      S  R+L+E +   EWP+WLS GDRRLLQ+
Sbjct  192   GQMHVFHMCSNALAMIKNLTDTDMASQGYHPSSGRQLEE-QDQTEWPKWLSEGDRRLLQA  250

Query  483   TAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFI  304
             T   PNV VAADGSG++ TVSEAV  AP +S+ RY+I+IKAG Y+ENVDVP  KTN+MF+
Sbjct  251   TTVIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDVPSKKTNLMFV  310

Query  303   GDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSD  124
             GDGR  T+IT +RNV+DGSTTF+SATVA VG+ FLARDITFQNTAG SK QAVALRVGSD
Sbjct  311   GDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKHQAVALRVGSD  370

Query  123   LSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             LSAFY C + AYQDTLYVHS RQFY +CL++G+VDFIFGNA
Sbjct  371   LSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDFIFGNA  411



>ref|XP_007139063.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
 gb|ESW11057.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
Length=580

 Score =   456 bits (1174),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 236/401 (59%), Positives = 293/401 (73%), Gaps = 8/401 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISGDMVAGVAAGEANsldvsssiikssc----gSTRYPDLCYSSLASTPE  1015
              L  LA+ + I+  +VAGV++ + ++ + SS+   +       ST YP+LC SS+AS P 
Sbjct  25    LLFALAATLFIALAVVAGVSSRKNSAHNASSTSSHAIIKSACSSTLYPELCLSSIASEPG  84

Query  1014  VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALF  835
              + KV + K+VIE SL  T+ I E N   V+KL+      TKR+K A  DCLETID+ L 
Sbjct  85    KADKVSTHKNVIEQSLNITVGIVERNYFTVEKLL-RKKGLTKRQKTALHDCLETIDETLD  143

Query  834   QLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQ  655
             +L+ A+ +L+ YPSKKS+  HA+DLKTLMS+A+TNQETCLDGFSH +AD   R+ +  GQ
Sbjct  144   ELHKAIDELKEYPSKKSLSHHAEDLKTLMSSAITNQETCLDGFSHDQADKRLRQHLQAGQ  203

Query  654   VHVEKLCSNCLSLIRNMTDTDAQNEIKAS-GNRKLKEVEGGCE--WPEWLSAGDRRLLQS  484
             VH E LCSN L++ +N+TD D    +  +  N + K +E   E  WP W+SA DRRLLQ+
Sbjct  204   VHAEHLCSNALAMTKNLTDNDMAMAMSNNVENERRKTMEDPHEIVWPHWISAADRRLLQT  263

Query  483   TAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFI  304
                 P+VVVAADGSGN+RTVS AV  AP KSSKRYVIRIKAG Y+ENVDV K KTNIMF+
Sbjct  264   GTVKPDVVVAADGSGNFRTVSAAVAAAPEKSSKRYVIRIKAGVYRENVDVSKKKTNIMFL  323

Query  303   GDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSD  124
             GDGR  T+IT +RNV+DGSTTFNSATV VVGERFL RDITFQNTAG SK QAVALRVG+D
Sbjct  324   GDGRTNTIITASRNVVDGSTTFNSATVVVVGERFLGRDITFQNTAGPSKHQAVALRVGAD  383

Query  123   LSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             LSAFY C+  AYQDTLYVHSNRQF+  C I+G+VDFIFGN+
Sbjct  384   LSAFYRCDFLAYQDTLYVHSNRQFFSNCYIAGSVDFIFGNS  424



>emb|CDX98441.1| BnaC05g39340D [Brassica napus]
Length=572

 Score =   456 bits (1173),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 228/355 (64%), Positives = 267/355 (75%), Gaps = 7/355 (2%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S++A+   V  K+ SQKDVIE SL  T    E N   V+KL+ +T   T RE
Sbjct  68    TLYPELCISAVATAGGV--KLMSQKDVIEASLNLTTTAVEHNYFGVKKLIKNTKGLTPRE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+ AL+DL +YP+KKS+  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  126   KTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLISSAITNQETCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKASGNRKLKEVEGGCEW  526
             H  AD   RK +  GQ+HVE +CSN L++I+NMTDTD  N E+KA    KL        W
Sbjct  186   HDAADKKVRKALLKGQMHVEHMCSNALAMIKNMTDTDIANFELKA----KLTSNNRADGW  241

Query  525   PEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKE  346
             P WLSAGDRRLLQ +    +  VAADGSG + T+S AV  AP  S+KRYVI IKAG Y+E
Sbjct  242   PTWLSAGDRRLLQGSTVKADATVAADGSGTFTTISAAVAAAPENSNKRYVIHIKAGVYRE  301

Query  345   NVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAG  166
             NVDV K K NIMF+GDGR  T+IT +RNV+DGSTTF+SATVA VGERFLARDITFQNTAG
Sbjct  302   NVDVAKKKKNIMFMGDGRTTTIITASRNVVDGSTTFHSATVAAVGERFLARDITFQNTAG  361

Query  165   ASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
              SK QAVALRVGSD SAFY C+M AYQDTLYVHSNRQF+VKCLI+GTVDFIFGNA
Sbjct  362   PSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGNA  416



>ref|XP_002885033.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61292.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   456 bits (1174),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 232/372 (62%), Positives = 280/372 (75%), Gaps = 20/372 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYP+LC S++A+T  V  ++ SQKDVIE SL  TI   E N  NV+KL+      T RE
Sbjct  65    TRYPELCISAVANTGGV--EITSQKDVIEASLNLTIIAVEHNYFNVKKLIKKRKGLTPRE  122

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+  ++DL +YP++K++  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  123   KTALHDCLETIDETLDELHETVEDLHLYPARKTLREHAGDLKTLISSAITNQETCLDGFS  182

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKE----  547
             H  AD   RK +  GQ+HVE +CSN L++I+NMTDTD  N E KA   S NRKLKE    
Sbjct  183   HDDADKQVRKALLKGQIHVEHMCSNALAMIKNMTDTDIANFEQKAKITSNNRKLKEENQE  242

Query  546   -----VEGGCE-----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPS  397
                  + G  E     WP WLSAGDRRLLQ ++   +  VAADGSG ++TV+ AV  AP 
Sbjct  243   TTVADIAGAGELDAEGWPTWLSAGDRRLLQGSSVKADATVAADGSGTFKTVAAAVAAAPE  302

Query  396   KSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAV  217
              S+KRYVI IKAG Y+ENV+V K K NIMF+GDGR +T+ITG+RNV+DGSTTF+SATVA 
Sbjct  303   NSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTRTIITGSRNVVDGSTTFHSATVAA  362

Query  216   VGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCL  37
             VGERFLARDITFQNTAG SK QAVALRVGSD SAFYNC+M AYQDTLYVHSNRQF++KC+
Sbjct  363   VGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFIKCI  422

Query  36    ISGTVDFIFGNA  1
             I+GTVDFIFGNA
Sbjct  423   IAGTVDFIFGNA  434



>ref|XP_010501045.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score =   457 bits (1175),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 226/362 (62%), Positives = 269/362 (74%), Gaps = 10/362 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YPDLC+S++A+T    K++ SQKDVIE SL  T K    N   V+KL+      T RE
Sbjct  79    TLYPDLCFSAVAATG--GKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTARE  136

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
               A  DCLE ID+ L  L+ A++DL  YP +KS+  HADDLKTL+S+A+TNQ TCLDGFS
Sbjct  137   VTALHDCLEMIDETLDGLHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDGFS  196

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQ-----NEIKASGNRKLKEVEG  538
             +  AD   RK +  GQVHVE +CSN L++I+NMTDTD       N+     NRKLKE+ G
Sbjct  197   YDNADKQVRKALLKGQVHVEHMCSNALAMIKNMTDTDIAKFELINKSSTPTNRKLKEITG  256

Query  537   GCE---WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
               +   WP WLS G+RRLLQ +    +  VAADGSG++RT+  AV  AP KS+KR+VI I
Sbjct  257   DLDSEGWPHWLSVGERRLLQGSTVNADATVAADGSGDFRTIVAAVAAAPEKSNKRFVIHI  316

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             KAG Y+ENV+V K K NIMF+GDGRGKT+ITG+RNV+DGSTTF+SATVA VGERFLARDI
Sbjct  317   KAGVYRENVEVTKKKKNIMFLGDGRGKTIITGSRNVVDGSTTFHSATVAAVGERFLARDI  376

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             TFQNTAG SK QAVALRVGSD SAFYNC+M AYQDTLYVHSNRQF+VKC I GTVDFIFG
Sbjct  377   TFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIIGTVDFIFG  436

Query  6     NA  1
             NA
Sbjct  437   NA  438



>ref|NP_001265901.1| pectinesterase 3-like [Cicer arietinum]
 emb|CAE76633.2| pectin methylesterase [Cicer arietinum]
Length=584

 Score =   455 bits (1170),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 230/356 (65%), Positives = 274/356 (77%), Gaps = 3/356 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YPDLC+S+++S P ++ K+ + KDVI LSL  T +  E N   V+ L+    N ++RE
Sbjct  74    TLYPDLCFSAISSEPNITHKINNHKDVISLSLNITTRAVEHNFFTVENLL-RRKNLSERE  132

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             KIA  DCLETID  L +L  A +DL +YP+KK++  HADDLKTL+SAA+TNQ TCLDGFS
Sbjct  133   KIALHDCLETIDDTLDELKEAQRDLVLYPNKKTLYQHADDLKTLISAAITNQVTCLDGFS  192

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQ--NEIKASGNRKLKEVEGGCE  529
             H  AD   RK +  GQVHVE +CSN L++ +NMTD D     E     NRKL E E G  
Sbjct  193   HDGADKQVRKVLEQGQVHVEHMCSNALAMTKNMTDKDIAKFEENNNKKNRKLLEEENGVN  252

Query  528   WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
             WPEW+SAGDRRLLQ  A   +VVVAADGSGN++TVSEAV  AP KSSKRYVI+IKAG YK
Sbjct  253   WPEWISAGDRRLLQGAAVKADVVVAADGSGNFKTVSEAVAGAPLKSSKRYVIKIKAGVYK  312

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV+VPK K+NIMF+GDG+  T+IT +RNV+DGSTTF+SATVAVVG  FLARDITFQNTA
Sbjct  313   ENVEVPKKKSNIMFLGDGKKNTIITASRNVVDGSTTFHSATVAVVGGNFLARDITFQNTA  372

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK QAVALRVG DLSAFYNC++ AYQDTLYVH+NRQF+V C ISGTVDFIFGN+
Sbjct  373   GPSKHQAVALRVGGDLSAFYNCDIIAYQDTLYVHNNRQFFVNCFISGTVDFIFGNS  428



>ref|XP_006307088.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
 gb|EOA39986.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
Length=584

 Score =   455 bits (1170),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 287/406 (71%), Gaps = 19/406 (5%)
 Frame = -2

Query  1167  ASLVLISGDMVAGVAAGEANsldvsssiiksscg---------STRYPDLCYSSLASTPE  1015
             A++ LI    + GVAA ++N          SS           ST YP+LCYS++A++  
Sbjct  25    ATIALILFATIVGVAATKSNQNKNQQITTISSTSHAVLKSVCSSTLYPELCYSAVAASG-  83

Query  1014  VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALF  835
               K++ S KDVIE SL  T K    N   V+KL+      T RE  A  DCLETID+ L 
Sbjct  84    -GKELTSHKDVIEASLNLTTKAVTHNYFAVKKLITKRKGLTAREVTALHDCLETIDETLD  142

Query  834   QLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQ  655
             +L+ A +DL +YP++KS+  HADDLKTL+S+A+TNQ TCLDGFS+  AD   RK +  GQ
Sbjct  143   ELHEAKEDLHMYPTQKSLRKHADDLKTLISSAITNQGTCLDGFSYDNADKKVRKALLKGQ  202

Query  654   VHVEKLCSNCLSLIRNMTDTDAQN-EIK----ASGNRKLKEVEG---GCEWPEWLSAGDR  499
             VHVE +CSN L++I+NMTDTD  N E++     S NRKL E+ G   G  WP WLS GDR
Sbjct  203   VHVEHMCSNALAMIKNMTDTDIANFELRDKSSTSNNRKLMEITGDLDGEGWPHWLSVGDR  262

Query  498   RLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKT  319
             RLLQ +    +  VAADGSG+++T+  AV  AP KSSKR+VI IKAG Y+ENV+V K K 
Sbjct  263   RLLQGSTVKADATVAADGSGDFKTIVAAVAAAPEKSSKRFVIHIKAGVYRENVEVSKKKK  322

Query  318   NIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVAL  139
             NIMF+GDGRGKT+IT +RNV+DGSTTF+SATVA VGE FLARDITFQNTAG SK QAVAL
Sbjct  323   NIMFLGDGRGKTIITASRNVVDGSTTFHSATVAAVGEGFLARDITFQNTAGPSKHQAVAL  382

Query  138   RVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             RVGSD SAFYNC+M AYQDTLYVHSNRQF+VKC I GTVDFIFGNA
Sbjct  383   RVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIVGTVDFIFGNA  428



>gb|KDP33985.1| hypothetical protein JCGZ_07556 [Jatropha curcas]
Length=583

 Score =   454 bits (1169),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 230/414 (56%), Positives = 302/414 (73%), Gaps = 13/414 (3%)
 Frame = -2

Query  1206  KKMARTQEFLTLLASLVLISG--DMVAGVAAGEANsldvsssiikssc------gSTRYP  1051
             K   R +  L L AS++LI+    +VAGVA+ ++ ++  ++    +         +T YP
Sbjct  15    KSKTRKKLLLGLFASILLITAIVSIVAGVASRKSTTISANAHHQAAHVVLKSSCSTTLYP  74

Query  1050  DLCYSSLASTPE-VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIA  874
             +LC+S++++ P+    K++S +DVI+LSL  T    +   + ++KL  S TNYT+RE+IA
Sbjct  75    ELCFSTISTLPDDAVTKIKSTRDVIDLSLNVTKDSVKQTYSKIEKLAYSGTNYTQRERIA  134

Query  873   FGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCK  694
             F DCL  +++ L ++N    +L+ Y SK++I  HAD LK L+SAAMTNQETCLDGFS+  
Sbjct  135   FHDCLLVLNETLDEINKVEDELKEYSSKETISQHADVLKILLSAAMTNQETCLDGFSYDT  194

Query  693   ADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN---EIKASGNRKLKEVEGGCEWP  523
             AD   R+   + + HV +LCSN L++I+N+TDTD  N   +  +S  RKL+E E   EWP
Sbjct  195   ADKEIRQLFLDDERHVYRLCSNSLAMIKNLTDTDMSNNNEQHSSSSERKLEE-ENELEWP  253

Query  522   EWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKEN  343
             +W+SAGDRRLLQ+ + TPNVVVAADGSGN+RTV EAV  AP   + RY+I+IKAG Y+EN
Sbjct  254   KWMSAGDRRLLQAGSVTPNVVVAADGSGNFRTVKEAVDAAPEGLTTRYIIKIKAGVYREN  313

Query  342   VDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGA  163
             V+VPK KTNIMF+GDGR  T+ITG+RNV+DGSTTFNSATVA VG+ FLARDITFQNTAG 
Sbjct  314   VEVPKKKTNIMFLGDGRTNTIITGSRNVVDGSTTFNSATVAAVGDGFLARDITFQNTAGP  373

Query  162   SKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             SK QAVALRVGSD SAFY C+M AYQDTLYVHS RQFYV C++ G+VDFIFGNA
Sbjct  374   SKHQAVALRVGSDQSAFYRCDMIAYQDTLYVHSLRQFYVSCIVIGSVDFIFGNA  427



>ref|XP_006297218.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
 gb|EOA30116.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
Length=623

 Score =   455 bits (1171),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 235/373 (63%), Positives = 276/373 (74%), Gaps = 21/373 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S++A+   V  ++ SQKDVIE SL  T    E N   V+KL+      T RE
Sbjct  97    TLYPELCISAVATAGGV--ELTSQKDVIEASLNLTKTAVEHNYFTVRKLIKKRKGLTPRE  154

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+ A++DL +YP+KK++  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  155   KTALHDCLETIDETLDELHDAVEDLHLYPTKKTLRQHAGDLKTLISSAITNQETCLDGFS  214

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKE----  547
             H  AD   RK +  GQ+HVE +CSN L++I+NMTDTD  N E KA   S NRKLKE    
Sbjct  215   HDGADKQVRKALLKGQIHVEHMCSNALAMIKNMTDTDIANFEAKAKVTSNNRKLKEENQE  274

Query  546   ------VEGGCE-----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAP  400
                   + G  E     WP WLSAGDRRLLQ T    +  VAADGSG ++TV+ AV  AP
Sbjct  275   TTVAVDIAGAGELDAQGWPTWLSAGDRRLLQGTGVRADATVAADGSGTFKTVAAAVAAAP  334

Query  399   SKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVA  220
               S+KRYVI IKAG Y+ENVDV K K NIMF+GDGR +T+ITGNRNV+DGSTTF+SATVA
Sbjct  335   ENSNKRYVIHIKAGVYRENVDVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATVA  394

Query  219   VVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKC  40
              VGERFLARDITFQNTAG SK QAVALRVGSD SAFYNC+M AYQDTLYVHSNRQF+VKC
Sbjct  395   AVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKC  454

Query  39    LISGTVDFIFGNA  1
             LI+GTVDFIFGNA
Sbjct  455   LIAGTVDFIFGNA  467



>gb|KFK38797.1| hypothetical protein AALP_AA3G161500 [Arabis alpina]
Length=593

 Score =   452 bits (1162),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 231/372 (62%), Positives = 282/372 (76%), Gaps = 20/372 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S+LA++ +V  K+ SQKDVIE SL  T  + E N   V+KL+ +    T RE
Sbjct  68    TLYPELCISALATSGDV--KLTSQKDVIEASLNLTTTVVEHNYFTVKKLIKNRKGLTPRE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+ A++DL VYP+KK++  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  126   KTALHDCLETIDETLDELHEAVEDLHVYPNKKTLREHAGDLKTLISSAITNQETCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKEVE--  541
             H +AD   RK +  GQ HVE++CSN L++I+NMTDTD  N ++KA   + NRKLKE E  
Sbjct  186   HDEADKKVRKALLKGQKHVERMCSNALAMIKNMTDTDIANFDLKAKLTTNNRKLKEEEET  245

Query  540   -------GGCE-----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPS  397
                    G  E     WP WLSAGDRRLLQ +    +  VAADGSG ++T++ AV  AP+
Sbjct  246   TVAVDIAGAGELDSEGWPTWLSAGDRRLLQGSTVRADATVAADGSGQFKTIAAAVAAAPA  305

Query  396   KSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAV  217
              S+KRYVI IKAG Y+ENV+V K+K NIMF+GDGR +T+IT +RNV+DGSTTF+SATVA 
Sbjct  306   NSNKRYVIHIKAGVYRENVEVAKTKKNIMFMGDGRTRTIITASRNVVDGSTTFHSATVAA  365

Query  216   VGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCL  37
             VGERFLARDITFQNTAG SK QAVALRVGSD SAFY C+M AYQDTLYVHSNRQF+VKCL
Sbjct  366   VGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCL  425

Query  36    ISGTVDFIFGNA  1
             I+GTVDFIFGNA
Sbjct  426   IAGTVDFIFGNA  437



>ref|NP_188048.1| pectin methylesterase 3 [Arabidopsis thaliana]
 sp|O49006.2|PME3_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 3; Includes: 
RecName: Full=Pectinesterase inhibitor 3; AltName: Full=Pectin 
methylesterase inhibitor 3; Includes: RecName: Full=Pectinesterase 
3; Short=PE 3; AltName: Full=Pectin methylesterase 
27; Short=AtPME27; AltName: Full=Pectin methylesterase 
3; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01037.1| pectinesterase [Arabidopsis thaliana]
 gb|AAK59769.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAK97722.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAN28889.1| At3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AEE75500.1| pectin methylesterase 3 [Arabidopsis thaliana]
Length=592

 Score =   452 bits (1162),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 231/373 (62%), Positives = 276/373 (74%), Gaps = 21/373 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYP+LC S++ +   V  ++ SQKDVIE S+  TI   E N   V+KL+      T RE
Sbjct  66    TRYPELCISAVVTAGGV--ELTSQKDVIEASVNLTITAVEHNYFTVKKLIKKRKGLTPRE  123

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+  ++DL +YP+KK++  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  124   KTALHDCLETIDETLDELHETVEDLHLYPTKKTLREHAGDLKTLISSAITNQETCLDGFS  183

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKE----  547
             H  AD   RK +  GQ+HVE +CSN L++I+NMTDTD  N E KA   S NRKLKE    
Sbjct  184   HDDADKQVRKALLKGQIHVEHMCSNALAMIKNMTDTDIANFEQKAKITSNNRKLKEENQE  243

Query  546   ------VEGGCE-----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAP  400
                   + G  E     WP WLSAGDRRLLQ +    +  VAADGSG ++TV+ AV  AP
Sbjct  244   TTVAVDIAGAGELDSEGWPTWLSAGDRRLLQGSGVKADATVAADGSGTFKTVAAAVAAAP  303

Query  399   SKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVA  220
               S+KRYVI IKAG Y+ENV+V K K NIMF+GDGR +T+ITG+RNV+DGSTTF+SATVA
Sbjct  304   ENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTRTIITGSRNVVDGSTTFHSATVA  363

Query  219   VVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKC  40
              VGERFLARDITFQNTAG SK QAVALRVGSD SAFYNC+M AYQDTLYVHSNRQF+VKC
Sbjct  364   AVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKC  423

Query  39    LISGTVDFIFGNA  1
             LI+GTVDFIFGNA
Sbjct  424   LIAGTVDFIFGNA  436



>gb|AAC72288.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=592

 Score =   449 bits (1156),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 230/373 (62%), Positives = 275/373 (74%), Gaps = 21/373 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYP+LC S++ +      ++ SQKDVIE S+  TI   E N   V+KL+      T RE
Sbjct  66    TRYPELCISAVVTAGAC--ELTSQKDVIEASVNLTITAVEHNYFTVKKLIKKRKGLTPRE  123

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+  ++DL +YP+KK++  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  124   KTALHDCLETIDETLDELHETVEDLHLYPTKKTLREHAGDLKTLISSAITNQETCLDGFS  183

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKE----  547
             H  AD   RK +  GQ+HVE +CSN L++I+NMTDTD  N E KA   S NRKLKE    
Sbjct  184   HDDADKQVRKALLKGQIHVEHMCSNALAMIKNMTDTDIANFEQKAKITSNNRKLKEENQE  243

Query  546   ------VEGGCE-----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAP  400
                   + G  E     WP WLSAGDRRLLQ +    +  VAADGSG ++TV+ AV  AP
Sbjct  244   TTVAVDIAGAGELDSEGWPTWLSAGDRRLLQGSGVKRDATVAADGSGTFKTVAAAVAAAP  303

Query  399   SKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVA  220
               S+KRYVI IKAG Y+ENV+V K K NIMF+GDGR +T+ITG+RNV+DGSTTF+SATVA
Sbjct  304   ENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTRTIITGSRNVVDGSTTFHSATVA  363

Query  219   VVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKC  40
              VGERFLARDITFQNTAG SK QAVALRVGSD SAFYNC+M AYQDTLYVHSNRQF+VKC
Sbjct  364   AVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKC  423

Query  39    LISGTVDFIFGNA  1
             LI+GTVDFIFGNA
Sbjct  424   LIAGTVDFIFGNA  436



>emb|CDY33228.1| BnaC01g37010D [Brassica napus]
Length=592

 Score =   447 bits (1151),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 229/371 (62%), Positives = 277/371 (75%), Gaps = 19/371 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S++A++  V  K+ SQKDVIE SL  T    E N   V+KL+ +    T RE
Sbjct  68    TLYPELCISAVATSGGV--KLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNRKGLTPRE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+  L+DL++YP+KK++  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  126   KTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQETCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKEVE--  541
             H  AD   RK +  GQVHVE +CSN L++I+NMTDTD  N E+KA   S NRKLKE E  
Sbjct  186   HDDADKKVRKVLLKGQVHVEHMCSNALAMIKNMTDTDIANFELKAKSFSNNRKLKEEETT  245

Query  540   ------GGCE-----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSK  394
                   G  E     WP WLSAGDRRLLQ ++   +  VAA+GSG ++T++ AV  AP  
Sbjct  246   VSVDISGAGEVDAEGWPTWLSAGDRRLLQGSSVRADATVAANGSGKFKTIAAAVAAAPDN  305

Query  393   SSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVV  214
             S +RYVI IKAG Y+ENVDV K K NIMF+GDGR +T+ITGNRNV+DGSTTF+SATVA V
Sbjct  306   SKRRYVIHIKAGVYRENVDVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATVAAV  365

Query  213   GERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLI  34
             GE FLARDITFQNTAG SK QAVALRVGSD SAFY C++ AYQDTLYVHSNRQ+++KCLI
Sbjct  366   GESFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDILAYQDTLYVHSNRQYFIKCLI  425

Query  33    SGTVDFIFGNA  1
             +GTVDFIFGNA
Sbjct  426   AGTVDFIFGNA  436



>gb|AAC50023.1| ATPME2 precursor, partial [Arabidopsis thaliana]
Length=582

 Score =   447 bits (1150),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 223/365 (61%), Positives = 270/365 (74%), Gaps = 13/365 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC+S++A+T    K++ SQK+VIE SL  T K  + N   V+KL+      T RE
Sbjct  64    TLYPELCFSAVAATG--GKELTSQKEVIEASLNLTTKAVKHNYFAVKKLIAKRKGLTPRE  121

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
               A  DCLETID+ L +L+ A++DL  YP +KS+  HADDLKTL+S+A+TNQ TCLDGFS
Sbjct  122   VTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDGFS  181

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN--------EIKASGNRKLKE  547
             +  AD   RK +  GQVHVE +CSN L++I+NMT+TD  N         +     RKLKE
Sbjct  182   YDDADRKVRKALLKGQVHVEHMCSNALAMIKNMTETDIANFELRDKFFNLHQQQQRKLKE  241

Query  546   VEGGCE---WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYV  376
             V G  +   WP+WLS GDRRLLQ +    +  VA DGSG++   S AV  AP KS+KR+V
Sbjct  242   VTGDLDSDGWPKWLSVGDRRLLQGSTIKADATVADDGSGDFDNGSAAVAAAPEKSNKRFV  301

Query  375   IRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLA  196
             I IKAG Y+ENV+V K KTNIMF+GDGRGKT+ITG+RNV+DGSTTF+SATVA VGERFLA
Sbjct  302   IHIKAGVYRENVEVTKKKTNIMFLGDGRGKTIITGSRNVVDGSTTFHSATVAAVGERFLA  361

Query  195   RDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDF  16
             RDITFQNTAG SK QAVALRVGSD SAFY C+M AYQDTLYVHSNRQF+VKC I+GTVDF
Sbjct  362   RDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMFAYQDTLYVHSNRQFFVKCHITGTVDF  421

Query  15    IFGNA  1
             IFGNA
Sbjct  422   IFGNA  426



>emb|CDX75765.1| BnaC03g38480D [Brassica napus]
Length=479

 Score =   443 bits (1140),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 232/371 (63%), Positives = 274/371 (74%), Gaps = 19/371 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYP+LC S+LA++  V  K+ SQKDVIE SL  T    E N   V+KL+      T RE
Sbjct  57    TRYPELCISTLATSGGV--KLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKGLTPRE  114

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+ A++DL++YP+KKS+  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  115   KTALHDCLETIDETLDELHEAVEDLQLYPNKKSLREHAGDLKTLISSAITNQETCLDGFS  174

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKEVE--  541
             H +AD   RK +  GQ+HVE +CSN L++I+NMTDTD  N E+KA   S NRKLKE E  
Sbjct  175   HDRADKKIRKALLKGQMHVEYMCSNALAMIKNMTDTDIANFELKAKLTSNNRKLKEEETT  234

Query  540   ------GGCE-----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSK  394
                   G  E     WP WLSAGDR LLQ +    +  VAADGSG + TV+ AV  AP  
Sbjct  235   VAVDIAGTRELDAEGWPTWLSAGDRGLLQGSTVEADATVAADGSGTFTTVAAAVVAAPEN  294

Query  393   SSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVV  214
             S+KRYVI IKAG Y+ENV+V K K NIMF+GDGR  T+IT +RNV+DGSTTF+SATVA V
Sbjct  295   SNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTTTIITASRNVVDGSTTFHSATVAAV  354

Query  213   GERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLI  34
              ERFLARDITFQNTAG SK QAVALRVGSD SAFY C+M AYQDTLYVHSNRQF+V CLI
Sbjct  355   DERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVNCLI  414

Query  33    SGTVDFIFGNA  1
             +GTVDFIFGNA
Sbjct  415   AGTVDFIFGNA  425



>ref|XP_009135376.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=591

 Score =   446 bits (1148),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 232/373 (62%), Positives = 273/373 (73%), Gaps = 24/373 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYP+LC S++A++  V  ++ SQKDVIE SL  T  + E N   V+KL+      T RE
Sbjct  68    TRYPELCISAVATSGGV--ELTSQKDVIEASLNLTKTVVEHNYFTVKKLIKKRKGLTPRE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+ A++DL +YP+KKS+  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  126   KTALHDCLETIDETLDELHEAVEDLHLYPNKKSLREHAGDLKTLISSAITNQETCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKE----  547
             H  AD   RK +F GQ+HVE +CSN L++I+NMTDTD  N E+KA   S NRKLKE    
Sbjct  186   HDGADKKVRKALFKGQMHVEHMCSNALAMIKNMTDTDITNFELKAKFTSNNRKLKEETTV  245

Query  546   -----------VEGGCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAP  400
                         EG   WP WLSAGDRRLLQ +    +  VAADGSG + TV+ AV  AP
Sbjct  246   AVDMASVGDLDAEG---WPTWLSAGDRRLLQGSTVEADATVAADGSGTFTTVAAAVAAAP  302

Query  399   SKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVA  220
               S+KRYVI IKAG Y+ENVDV K K NIMF+GDGR  T+IT +RN +DG  TF+SATVA
Sbjct  303   ENSNKRYVIHIKAGVYRENVDVAKKKKNIMFMGDGRTTTIITASRNAVDGWPTFSSATVA  362

Query  219   VVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKC  40
             VVGERFLARDITFQNTAG SKEQAVALRVGSD SAFY C+M AYQDTLYVHSNRQF+V C
Sbjct  363   VVGERFLARDITFQNTAGPSKEQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVNC  422

Query  39    LISGTVDFIFGNA  1
             LI GTVDFIFGNA
Sbjct  423   LIVGTVDFIFGNA  435



>gb|AAG17110.1|AF188895_1 putative pectin methylesterase 3 [Linum usitatissimum]
Length=555

 Score =   444 bits (1143),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/357 (63%), Positives = 265/357 (74%), Gaps = 10/357 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TR+PDLC+SSLAS P V   + +Q DVI+ S+  T      N A V K + + T+ T R 
Sbjct  50    TRHPDLCFSSLASAP-VHVSLNTQMDVIKASINVTCTSVLRNIAAVNKALSTRTDLTPRS  108

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             + A  DC+ET+  +L +L+ AL +L  YP+KKSI  HADDLKTL+SAA TNQETCLDGFS
Sbjct  109   RSALKDCVETMSTSLDELHVALAELDEYPNKKSITRHADDLKTLLSAATTNQETCLDGFS  168

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE--  529
             H  ++   RK +  G V VEK+C N L +I NMT+TD  +   A         EGG    
Sbjct  169   HDDSEKKVRKTLETGPVRVEKMCGNALGMIVNMTETDMASATNAV------NTEGGSSGS  222

Query  528   WPEWLSAGDRRLLQS-TAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             WP W+  GDRRLLQ+ T  TPNVVVAADGSG YR VSEAV  APSKSSKRYVIRIKAG Y
Sbjct  223   WPIWMKGGDRRLLQAGTTVTPNVVVAADGSGKYRRVSEAVAAAPSKSSKRYVIRIKAGIY  282

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
             +ENV+VPK KTNIMF+GDGR  T+ITGN+NV+DGSTTFNSATVAVVG+ FLARDITFQNT
Sbjct  283   RENVEVPKDKTNIMFVGDGRSNTIITGNKNVVDGSTTFNSATVAVVGQGFLARDITFQNT  342

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG SK QAVALRVG+DL+AFY C+  AYQDTLYVHSNRQF++ CL+ GTVDFIFGN+
Sbjct  343   AGPSKHQAVALRVGADLAAFYRCDFLAYQDTLYVHSNRQFFINCLVVGTVDFIFGNS  399



>emb|CDY51798.1| BnaC06g41940D [Brassica napus]
Length=585

 Score =   445 bits (1145),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 232/364 (64%), Positives = 274/364 (75%), Gaps = 13/364 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC+S++A+T    KK+ S KDVIE SL  T    + N   V+KL+      T RE
Sbjct  69    TLYPELCFSAVAAT---GKKLTSDKDVIEASLNLTTNAVKHNYFAVKKLITKRKGLTARE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
               A  DCLE ID+ L +L+ AL+DL  YP  KS+  HADDLKTL+S+A+TNQ TCLDGFS
Sbjct  126   LTALHDCLEIIDETLDELHVALEDLHQYPKGKSLRKHADDLKTLISSAITNQGTCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIK----ASGNRKLKE-VE  541
             + KAD   RK +  GQVHVE +CSN L++I+NMTDTD  N E+K    ++ NRKLKE + 
Sbjct  186   YDKADRKLRKALLKGQVHVEHMCSNALAMIKNMTDTDIANFELKDKSGSTNNRKLKEELT  245

Query  540   G---GCEWPEWLSAGDRRLLQ-STAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVI  373
             G   G  WP WLS GDRRLLQ ST    +  VAADGSG++ TV+ AV  AP KS+KRYVI
Sbjct  246   GDLDGEGWPNWLSIGDRRLLQGSTGVNADATVAADGSGDFTTVAAAVAAAPEKSNKRYVI  305

Query  372   RIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLAR  193
              IKAG Y+ENV+V K K NIMF+GDGRGKT+ITG RNV+DGSTTF+SATVA VGERFLAR
Sbjct  306   HIKAGVYRENVEVSKKKKNIMFLGDGRGKTIITGKRNVVDGSTTFHSATVAAVGERFLAR  365

Query  192   DITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFI  13
             D+TFQNTAG SK QAVALRVGSD SAFYNC+M AYQDTLYVHSNRQF+VKC I+GTVDFI
Sbjct  366   DMTFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIAGTVDFI  425

Query  12    FGNA  1
             FGNA
Sbjct  426   FGNA  429



>ref|XP_009116991.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score =   445 bits (1145),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 229/371 (62%), Positives = 276/371 (74%), Gaps = 19/371 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T Y +LC S++A++  V  K+ SQKDVIE SL  T    E N   V+KL+ +    T RE
Sbjct  68    TLYTELCISAVATSGGV--KLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNMKGLTPRE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+  L+DL++YP+KK++  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  126   KTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQETCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKEVE--  541
             H  AD   RK +  GQVHVE +CSN L++I+NMTD D  N E+KA   S NRKLKE E  
Sbjct  186   HDDADKKVRKVLLKGQVHVEHMCSNALAMIKNMTDPDIANFELKAKSFSNNRKLKEEETT  245

Query  540   ------GGCE-----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSK  394
                   G  E     WP WLSAGDRRLLQ ++   +  VAA+GSG ++T++ AV  AP  
Sbjct  246   VSVDIAGAGEVDAEGWPTWLSAGDRRLLQGSSVRADATVAANGSGKFKTIAAAVAAAPDN  305

Query  393   SSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVV  214
             S +RYVI IKAG Y+ENV+V K K NIMF+GDGR +T+ITGNRNV+DGSTTF+SATVA V
Sbjct  306   SKRRYVIHIKAGVYRENVEVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATVAAV  365

Query  213   GERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLI  34
             GERFLARDITFQNTAG SK QAVALRVGSD SAFY C+M AYQDTLYVHSNRQ++VKCLI
Sbjct  366   GERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQYFVKCLI  425

Query  33    SGTVDFIFGNA  1
             +GTVDFIFGNA
Sbjct  426   AGTVDFIFGNA  436



>ref|XP_002516186.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46188.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=589

 Score =   444 bits (1143),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 233/408 (57%), Positives = 295/408 (72%), Gaps = 15/408 (4%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAAGEA------NsldvsssiiksscgSTRYPDLCYSSLA  1027
             FL L AS++L++    +VA VA+ ++      N  + + +I+KSSC ST YPDLC+S+++
Sbjct  27    FLGLFASVLLVATVIGIVASVASRKSSVGTINNGHEAAHAIVKSSCSSTLYPDLCFSTIS  86

Query  1026  STP-EVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETI  850
             + P + +  +++ KDVI LSL  T          +Q L ++  +YT RE  A  DCL+T+
Sbjct  87    ALPADATSTIKTTKDVIILSLNVTESSVYQTYLKIQGLTLARRSYTPREVTALKDCLQTL  146

Query  849   DQALFQLNTALQDLRVYPS-KKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARK  673
              + + ++   +Q L+ YPS K SI  HAD+LK L+SAAMTNQETCLDGFSH +AD   R+
Sbjct  147   SETVDEIRKVVQLLKEYPSLKNSISEHADELKILISAAMTNQETCLDGFSHDRADEKVRE  206

Query  672   PIFNGQVHVEKLCSNCLSLIRNMTDTDAQNE----IKASGNRKLKEVEGGCEWPEWLSAG  505
                  + HV +LC N L++I+ MTDTD  NE       S  R+LKE E G EWPEWL AG
Sbjct  207   FFLGDERHVHRLCGNALAMIKTMTDTDMANEQALSSSPSSERRLKE-ENGIEWPEWLPAG  265

Query  504   DRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKS  325
             DRRLLQ+T  TPNVVVAADGSGNYRTVSEAV  APS+SS RY+IRIKAG Y+ENVD+P S
Sbjct  266   DRRLLQATTLTPNVVVAADGSGNYRTVSEAVAAAPSRSSTRYIIRIKAGVYRENVDIPSS  325

Query  324   KTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAV  145
             KTN+MF+GDGR  T+ITG+R+V+ GSTTFNSATVAV  + FLARD+TFQNTAG S  QAV
Sbjct  326   KTNLMFVGDGRTTTIITGSRSVVGGSTTFNSATVAVNADGFLARDVTFQNTAGPSGHQAV  385

Query  144   ALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             ALRV +DLSAFY C+M A+QDTLYVH  RQFYV C++ GTVDFIFGNA
Sbjct  386   ALRVSADLSAFYRCDMIAFQDTLYVHRLRQFYVSCIVIGTVDFIFGNA  433



>ref|NP_175786.1| pectin methylesterase 2 [Arabidopsis thaliana]
 sp|Q42534.2|PME2_ARATH RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase 2; Short=AtPME2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02856.1|AC009324_5 pectinesterase 2 [Arabidopsis thaliana]
 gb|AAK32805.1|AF361637_1 At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AAM91439.1| At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AEE33007.1| pectin methylesterase 2 [Arabidopsis thaliana]
Length=587

 Score =   444 bits (1142),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 226/365 (62%), Positives = 276/365 (76%), Gaps = 13/365 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC+S++A+T    K++ SQK+VIE SL  T K  + N   V+KL+      T RE
Sbjct  69    TLYPELCFSAVAATG--GKELTSQKEVIEASLNLTTKAVKHNYFAVKKLIAKRKGLTPRE  126

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
               A  DCLETID+ L +L+ A++DL  YP +KS+  HADDLKTL+S+A+TNQ TCLDGFS
Sbjct  127   VTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDGFS  186

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA-------SGNRKLKE  547
             +  AD   RK +  GQVHVE +CSN L++I+NMT+TD  N E++        + NRKLKE
Sbjct  187   YDDADRKVRKALLKGQVHVEHMCSNALAMIKNMTETDIANFELRDKSSTFTNNNNRKLKE  246

Query  546   VEGGCE---WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYV  376
             V G  +   WP+WLS GDRRLLQ +    +  VA DGSG++ TV+ AV  AP KS+KR+V
Sbjct  247   VTGDLDSDGWPKWLSVGDRRLLQGSTIKADATVADDGSGDFTTVAAAVAAAPEKSNKRFV  306

Query  375   IRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLA  196
             I IKAG Y+ENV+V K KTNIMF+GDGRGKT+ITG+RNV+DGSTTF+SATVA VGERFLA
Sbjct  307   IHIKAGVYRENVEVTKKKTNIMFLGDGRGKTIITGSRNVVDGSTTFHSATVAAVGERFLA  366

Query  195   RDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDF  16
             RDITFQNTAG SK QAVALRVGSD SAFY C+M AYQDTLYVHSNRQF+VKC I+GTVDF
Sbjct  367   RDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMFAYQDTLYVHSNRQFFVKCHITGTVDF  426

Query  15    IFGNA  1
             IFGNA
Sbjct  427   IFGNA  431



>ref|XP_008340373.1| PREDICTED: pectinesterase 3-like [Malus domestica]
Length=573

 Score =   444 bits (1141),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 234/402 (58%), Positives = 286/402 (71%), Gaps = 20/402 (5%)
 Frame = -2

Query  1182  FLTLLASLVLISGD--MVAGVAAGEANsldvsssiikssc----gSTRYPDLCYSSLAST  1021
             F +L A+++L+     +V GV + + NS D ++    +       ST YP+LC+S+LA  
Sbjct  28    FJSLFATILLVGAXVGIVTGVKSSKNNSDDETNEASHAIVKSSCSSTLYPELCFSTLALH  87

Query  1020  PEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTN-YTKREKIAFGDCLETIDQ  844
             PE +KKV SQKD IELSL  T K  + N   V+KL+ S  N  TKREK A  DCLETID+
Sbjct  88    PEAAKKVSSQKDXIELSLNITTKAVQHNFFTVEKLLKSRKNKLTKREKGALHDCLETIDE  147

Query  843   ALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIF  664
              L +L+ A++DL  YP+KK++  HADDLKTL+S+A+TNQETCLDGFSH  AD   RK   
Sbjct  148   TLDELHDAVEDLHEYPNKKTLTQHADDLKTLISSAITNQETCLDGFSHDDADKKVRKVFL  207

Query  663   NGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE-VEGGCEWPEWLSAGDRRLLQ  487
              GQVHVEKLCSN L++I+NMTDTD  NE+K + NRKLKE V     WPEWLS  DRRLLQ
Sbjct  208   AGQVHVEKLCSNALAMIKNMTDTDIANEMKTNVNRKLKEDVVDEHGWPEWLSVADRRLLQ  267

Query  486   STAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMF  307
             S++ TPNVVVAADGSGNY+TVS AV  AP KSSKRYVIRIKAG Y+ENVDVPK KTNIMF
Sbjct  268   SSSVTPNVVVAADGSGNYKTVSAAVAAAPEKSSKRYVIRIKAGVYRENVDVPKKKTNIMF  327

Query  306   IGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGS  127
             +GDGR  T+IT ++NV+DGSTTFNSATV      F    + F   +   +         S
Sbjct  328   MGDGRKNTIITASKNVVDGSTTFNSATVGKPNSLFF---LXFHVPSFYER---------S  375

Query  126   DLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             DLSAFY C++ AYQD+LYVHSNRQF+  CL++GTVDFIFGNA
Sbjct  376   DLSAFYRCDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGNA  417



>ref|XP_010261668.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=576

 Score =   443 bits (1139),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 222/356 (62%), Positives = 267/356 (75%), Gaps = 7/356 (2%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YPDLCYS++A+ P     + +QKD+IE+SL  T    E N   ++K ++ + N TKRE
Sbjct  70    TLYPDLCYSAIATVPGAMDNLSTQKDIIEMSLNITTTAVEHNYFTIEK-IIGSKNLTKRE  128

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPS-KKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             K A  DCLE +D+ L +L+    DL+ YPS KKSI  HADDLK L+SAAMTNQE+C+DGF
Sbjct  129   KTALHDCLEMVDETLDELHKTADDLKDYPSSKKSIFQHADDLKILVSAAMTNQESCIDGF  188

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTD-AQNEIKASGNRKLKEVEGGCE  529
             SH  AD + RK +  GQ HV ++CSN L++I+NMTDTD AQ + KA    K +  E   E
Sbjct  189   SHDNADKDVRKKLLAGQEHVYRMCSNALAMIKNMTDTDMAQEQYKA----KRRVEESSEE  244

Query  528   WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
             +P WLS GDR+LLQ++   P+V VAADGSG+Y TVSEAV  AP KS KRY+IRIKAG Y+
Sbjct  245   FPAWLSWGDRKLLQASMLVPDVTVAADGSGHYTTVSEAVAAAPEKSHKRYIIRIKAGVYR  304

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV+VPK KTNIM +GDGR  T+ITG R+V+DGSTTF SA+VA VGE FLARDITFQNTA
Sbjct  305   ENVNVPKKKTNIMMVGDGRINTIITGRRSVVDGSTTFRSASVAAVGEGFLARDITFQNTA  364

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK+QAVALRVGSD SAFY C + AYQDTLYVHS RQFYV  LI GTVDFIFGNA
Sbjct  365   GPSKDQAVALRVGSDKSAFYRCNIIAYQDTLYVHSLRQFYVDSLIVGTVDFIFGNA  420



>ref|XP_009117000.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score =   443 bits (1140),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 228/371 (61%), Positives = 275/371 (74%), Gaps = 19/371 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S++A++  V  K+ SQKDVIE SL  T    E N   V+KL+ +    T RE
Sbjct  68    TLYPELCISAVATSGGV--KLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKNMKGLTPRE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+  L+DL++YP+KK++  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  126   KTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQETCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKE----  547
             H  AD   RK +  GQVHVE +CSN L++I+NMTDTD  N E+KA   S NRKLKE    
Sbjct  186   HDDADKKVRKFLLKGQVHVEHMCSNALAMIKNMTDTDIANFELKAKLSSNNRKLKEEKTP  245

Query  546   ----VEGGCE-----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSK  394
                 + G  E     WP WLSAGDRRLLQ ++   +  VAA+GSG ++T++ AV  AP  
Sbjct  246   EAVDIAGSEELDAKGWPTWLSAGDRRLLQGSSVRADATVAANGSGKFKTIAAAVAAAPDN  305

Query  393   SSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVV  214
             S +RYVI IKAG Y+ENV+V K K NIMF+GDGR +T+ITGNRNV+DGSTTF+SATVA V
Sbjct  306   SKRRYVIHIKAGVYRENVEVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATVAAV  365

Query  213   GERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLI  34
             GERFLARDITFQNTAG SK QAVALRVGSD SAFY C+M AYQDTLYVHS RQF+VK L 
Sbjct  366   GERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSKRQFFVKGLT  425

Query  33    SGTVDFIFGNA  1
             +GTVDFIFGNA
Sbjct  426   AGTVDFIFGNA  436



>ref|XP_010047424.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=564

 Score =   442 bits (1137),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 219/362 (60%), Positives = 270/362 (75%), Gaps = 8/362 (2%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEV-SKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             T YPDLC S L S+P + S  +++ KDV+ L+L  TI   + N   ++K+  + +  T R
Sbjct  48    TLYPDLCLSQLTSSPSLTSDAMKTPKDVVALALNLTITSVQHNYFTIKKVAATRSGLTVR  107

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPS--KKSIVAHADDLKTLMSAAMTNQETCLD  712
             E+ A  DCLE +D+ L ++   L DL  YP+   KS+   A+D+KTL+SAAMTNQE+CLD
Sbjct  108   ERTALHDCLEMVDETLDEVRETLADLLAYPNGGSKSVSELAEDMKTLLSAAMTNQESCLD  167

Query  711   GFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV--EG  538
             GFSH  AD   R+ +  GQ+HV  LCS+ L++++N+TD DA N+   S NR+LKE   E 
Sbjct  168   GFSHDSADKKVREALLGGQMHVFHLCSHALAMVKNITDADAANKRLPSSNRRLKEEIKEE  227

Query  537   GCE---WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
             G E   WP+WLSAGDRRLLQST  TP+V VAADGSG+YRTVSEAV+ AP +S +RYVI+I
Sbjct  228   GQEPIQWPQWLSAGDRRLLQSTTVTPDVTVAADGSGDYRTVSEAVEAAPERSERRYVIKI  287

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             KAG Y+ENV+V   KTN+MF+GDGR  T+ITG+RNV+DGSTTFNSATVAVVGE FLARDI
Sbjct  288   KAGVYRENVEVTSRKTNLMFVGDGRTTTIITGSRNVVDGSTTFNSATVAVVGEGFLARDI  347

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             TF+NTAG SK QAVALRV SD SAFY C M AYQDTLYVHS RQFY  C I+GTVDFIFG
Sbjct  348   TFENTAGPSKHQAVALRVNSDFSAFYRCCMLAYQDTLYVHSLRQFYFGCFIAGTVDFIFG  407

Query  6     NA  1
             NA
Sbjct  408   NA  409



>emb|CDY08206.1| BnaA05g14130D [Brassica napus]
Length=585

 Score =   443 bits (1139),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 231/364 (63%), Positives = 273/364 (75%), Gaps = 13/364 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC+S++A+T    KK+ S KDVIE SL  T    + N   V+KL+      T RE
Sbjct  69    TLYPELCFSAVAAT---GKKLTSDKDVIEASLNLTTNAVKHNYFAVKKLITKRKGLTARE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
               A  DCLE ID+ L +L+ AL+DL  YP  KS+  HADDLKTL+S+A+TNQ TCLDGFS
Sbjct  126   VTALHDCLEIIDETLDELHVALEDLDQYPKGKSLRKHADDLKTLISSAITNQGTCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTD-AQNEIK----ASGNRKLKEVE-  541
             + KAD   RK +  GQVHVE +CSN L++I+NMT+TD A+ E+K    ++ NRKLKE   
Sbjct  186   YDKADRKLRKALLKGQVHVEHMCSNALAMIKNMTETDIAKFELKDKSSSTKNRKLKEELT  245

Query  540   ---GGCEWPEWLSAGDRRLLQ-STAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVI  373
                 G  WP WLS GDRRLLQ ST    +  VAADGSG++ TV+ AV  AP KS+KRYVI
Sbjct  246   DDLDGEGWPNWLSIGDRRLLQGSTGVNADATVAADGSGDFTTVAAAVAAAPEKSNKRYVI  305

Query  372   RIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLAR  193
              IKAG Y+ENV+V K K NIMF+GDGRGKT+ITG RNV+DGSTTF+SATVA VGERFLAR
Sbjct  306   HIKAGVYRENVEVSKKKKNIMFLGDGRGKTIITGKRNVVDGSTTFHSATVAAVGERFLAR  365

Query  192   DITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFI  13
             DITFQNTAG SK QAVALRVGSD SAFYNC+M AYQDTLYVHSNRQF+VKC I+GTVDFI
Sbjct  366   DITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIAGTVDFI  425

Query  12    FGNA  1
             FGNA
Sbjct  426   FGNA  429



>ref|XP_004168887.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN58477.1| hypothetical protein Csa_3G646640 [Cucumis sativus]
Length=561

 Score =   441 bits (1133),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 219/362 (60%), Positives = 274/362 (76%), Gaps = 13/362 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC +++++         S K+ IE S+  TI   + N   VQKL+ +  N TKR+
Sbjct  49    TLYPELCETTISTAVG-----SSSKEAIEASVNITISAVKDNYKRVQKLLKTVKNLTKRQ  103

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             KIAF DCLET ++ L +L   ++D+  YP KKS+  +ADDLKTL+S+ +TNQETC+DGFS
Sbjct  104   KIAFHDCLETGEETLRELYEVVEDVNEYPKKKSLSRYADDLKTLLSSTITNQETCVDGFS  163

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTD-----AQNEIKASGNRKLKE--V  544
             H K D   R+ +  G +H+EKLCS  L+LI+N+TDTD       N       ++L+E  +
Sbjct  164   HDKGDKKVRESLKEGLIHIEKLCSIALALIKNLTDTDIANLNNNNNNNHLNRKQLEEKKM  223

Query  543   EGGCEWPEWLSAGDRRLLQ-STAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
             E G +WP+W+S  DRRLLQ S+ ATP+VVVAADGSG++RT+SEAV  APS+SS+RY+IRI
Sbjct  224   EDGIKWPDWMSPKDRRLLQASSTATPDVVVAADGSGDFRTISEAVAAAPSRSSRRYIIRI  283

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             KAG Y+ENV+V  SK NIMF GDGR  T+ITGNRNV+DGSTTFNSATVA VGERFLARD+
Sbjct  284   KAGVYRENVNVASSKRNIMFWGDGRVNTIITGNRNVVDGSTTFNSATVAAVGERFLARDV  343

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             TFQNTAG SK QAVALRVGSDLSAFY C+M AYQDTLYVHSNRQFYV+C+I GT+DFIFG
Sbjct  344   TFQNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSNRQFYVQCIIVGTIDFIFG  403

Query  6     NA  1
             NA
Sbjct  404   NA  405



>gb|KFK35693.1| hypothetical protein AALP_AA4G024900 [Arabis alpina]
Length=588

 Score =   440 bits (1132),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 229/414 (55%), Positives = 282/414 (68%), Gaps = 27/414 (7%)
 Frame = -2

Query  1176  TLLASLVLISGDMVAGVAAGEANsldvsssiiksscg---------STRYPDLCYSSLAS  1024
             +++ +L+L S   V G+ AG++N          S+           ST YP+LC+S++++
Sbjct  24    SVILALLLFSA--VVGIVAGKSNQTKNQKIKTLSTTSHVVIKSFCSSTLYPELCFSAVST  81

Query  1023  TPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQ  844
             T    KK+ SQKDVIE SL  T      N  +V+K +      T RE  A  DCLET+D+
Sbjct  82    T---GKKLTSQKDVIEASLNLTRNAVTNNYLDVKKQLAKRKGLTVREVTALHDCLETMDE  138

Query  843   ALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIF  664
              L +L  A++DL +YP+ KS+  H+DDLKTL+S+A+TNQETCLDG S+  AD   RK + 
Sbjct  139   TLDELYKAVKDLHIYPNGKSLRKHSDDLKTLISSAITNQETCLDGLSYNDADRKVRKVLL  198

Query  663   NGQVHVEKLCSNCLSLIRNMTDTD-------AQNEIKASGNRKLKEVE------GGCEWP  523
              GQVHVE +CSN L++ +NMTD D       A+       NRKL EV        G  WP
Sbjct  199   KGQVHVEHMCSNALAMTKNMTDRDIAIFELNAKPTTTTKNNRKLTEVTLAGGDLDGEGWP  258

Query  522   EWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKEN  343
              WL AGDRRLLQ +   P+  VAADGSG++          P KS+KR+VI IKAG Y EN
Sbjct  259   NWLPAGDRRLLQDSTVKPDATVAADGSGDFTXXXXXXXXXPEKSAKRFVIYIKAGVYSEN  318

Query  342   VDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGA  163
             V+V K KTN+MF+GDGRGKT+ITG+RNV+DGSTTF+SATVA VGERFLARDITFQNTAG 
Sbjct  319   VEVTKKKTNLMFLGDGRGKTIITGSRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGP  378

Query  162   SKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             SK QAVALRVGSD SAFYNCEM AYQDTLYVHSNRQF+VKCLI+GTVDFIFGNA
Sbjct  379   SKHQAVALRVGSDFSAFYNCEMLAYQDTLYVHSNRQFFVKCLITGTVDFIFGNA  432



>ref|XP_009123661.1| PREDICTED: pectinesterase 2 [Brassica rapa]
Length=604

 Score =   441 bits (1133),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 234/380 (62%), Positives = 277/380 (73%), Gaps = 26/380 (7%)
 Frame = -2

Query  1062  TRYPDLCYSSLAST-------------PEVS---KKVRSQKDVIELSLKNTIKIAETNRA  931
             T YP+LC+S++A+T             P V+   KK+ S KDVIE SL  T    + N  
Sbjct  69    TLYPELCFSAVAATGKKLTPDKDVIEAPAVAATGKKLTSDKDVIEASLNLTTNAVKHNYF  128

Query  930   NVQKLVVSTTNYTKREKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTL  751
              V+KL+      T RE  A  DCLE ID+ L +L+ AL+DL  YP  KS+  HADDLKTL
Sbjct  129   AVKKLITKRKGLTAREVTALHDCLEIIDETLDELHVALEDLDQYPKGKSLRKHADDLKTL  188

Query  750   MSAAMTNQETCLDGFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIK  574
             +S+A+TNQ TCLDGFS+ KAD   RK +  GQVHVE +CSN L++I+NMT+TD  N E+K
Sbjct  189   ISSAITNQGTCLDGFSYDKADRKLRKALLKGQVHVEHMCSNALAMIKNMTETDIANFELK  248

Query  573   ----ASGNRKLKE-VEG---GCEWPEWLSAGDRRLLQ-STAATPNVVVAADGSGNYRTVS  421
                 ++ NRKLKE + G   G  WP WLS GDRRLLQ ST    +  VAADGSG++ TV+
Sbjct  249   DKSSSTNNRKLKEELTGDLDGEGWPNWLSIGDRRLLQGSTGVNADATVAADGSGDFTTVA  308

Query  420   EAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTT  241
              AV  AP KS+KRYVI IKAG Y+ENV+V K K NIMF+GDGRGKT+ITG RNV+DGSTT
Sbjct  309   AAVAAAPEKSNKRYVIHIKAGVYRENVEVSKKKKNIMFLGDGRGKTIITGKRNVVDGSTT  368

Query  240   FNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSN  61
             F+SATVA VGERFLARDITFQNTAG SK QAVALRVGSD SAFYNC+M AYQDTLYVHSN
Sbjct  369   FHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSN  428

Query  60    RQFYVKCLISGTVDFIFGNA  1
             RQF+VKC I+GTVDFIFGNA
Sbjct  429   RQFFVKCHIAGTVDFIFGNA  448



>ref|XP_002891774.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68033.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
Length=586

 Score =   439 bits (1129),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 222/365 (61%), Positives = 271/365 (74%), Gaps = 13/365 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC+S++A+T    K++ SQK+VIE SL  T K  + N   V+KL+      T RE
Sbjct  68    TLYPELCFSTVAATG--GKQLTSQKEVIEASLNLTTKAVKHNYFAVKKLIAKRKGLTPRE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
               A  DCLETID+ L +L+ A++D+  YP +KS+  HADDLKTL+S+A+TNQ TCLDGFS
Sbjct  126   VTALHDCLETIDETLDELHVAVEDIHQYPKQKSLRKHADDLKTLISSAITNQGTCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN--------EIKASGNRKLKE  547
             +  AD   RK +  GQVHVE +CSN L++I+NMT+TD  N            + NRKLKE
Sbjct  186   YDDADRKVRKVLLKGQVHVEHMCSNALAMIKNMTETDIANFELRDKSSSFTNNNNRKLKE  245

Query  546   VEGGCE---WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYV  376
             V G  +   WP WLS GDRRLLQ +    +  VAADGSG++ TV+ AV  AP KS+KR+V
Sbjct  246   VTGDLDSEGWPMWLSVGDRRLLQGSTIKADATVAADGSGDFTTVAAAVAAAPEKSNKRFV  305

Query  375   IRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLA  196
             I IKAG Y+ENV+V K K NIMF+GDG+GKT+ITG+RNV+DGSTTF+SATVA VGE FLA
Sbjct  306   IHIKAGVYRENVEVTKKKKNIMFLGDGQGKTIITGSRNVVDGSTTFHSATVAAVGENFLA  365

Query  195   RDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDF  16
             RDITFQNTAG SK QAVALRVGSD SAFY C+M AYQDTLYVHSNRQF+VKC I+GTVDF
Sbjct  366   RDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMFAYQDTLYVHSNRQFFVKCHITGTVDF  425

Query  15    IFGNA  1
             IFGNA
Sbjct  426   IFGNA  430



>ref|XP_006599763.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=492

 Score =   436 bits (1120),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 217/336 (65%), Positives = 260/336 (77%), Gaps = 8/336 (2%)
 Frame = -2

Query  990  KDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQLNTALQD  811
            +DVI+LSL  T +  E N   V+KL+ +  + TKRE  A  DCLETID+ L +L  A  D
Sbjct  3    RDVIQLSLSITFRAVERNYFTVKKLL-TKHDLTKRETTALHDCLETIDETLDELREAQHD  61

Query  810  LRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQVHVEKLCS  631
            L +YP+KK++  HADDLKTL+SAA+TNQ TCLDGFSH  AD + RK +  GQVHVE +CS
Sbjct  62   LELYPNKKTLYQHADDLKTLISAAITNQVTCLDGFSHDDADKHVRKELEKGQVHVEHMCS  121

Query  630  NCLSLIRNMTDTDAQN-EIK-----ASGNRKLKEVEGGCEWPEWLSAGDRRLLQSTAATP  469
            N L++ +NMTD D  N E K      + NRKL  VE G EWPEW+SA DRRLLQ+     
Sbjct  122  NALAMTKNMTDGDIANYEYKMKVENTNSNRKLL-VENGVEWPEWISAADRRLLQAATVKA  180

Query  468  NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRG  289
            +V VAADGSG+++TV+EAVK AP KSSKRYVIRIK G Y+ENV+V K KTNIMF+GDGR 
Sbjct  181  DVTVAADGSGDFKTVTEAVKAAPLKSSKRYVIRIKGGVYRENVEVDKKKTNIMFLGDGRT  240

Query  288  KTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFY  109
             T+IT +RNV+DGSTTF+SATVAVVG  FLARDITFQNTAG SK QAVALRVG DLSAF+
Sbjct  241  NTIITASRNVVDGSTTFHSATVAVVGANFLARDITFQNTAGPSKHQAVALRVGGDLSAFF  300

Query  108  NCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
            NC+  A+QDTLYVH+NRQF+VKCLI+GTVDFIFGN+
Sbjct  301  NCDFLAFQDTLYVHNNRQFFVKCLITGTVDFIFGNS  336



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   436 bits (1121),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 228/360 (63%), Positives = 269/360 (75%), Gaps = 9/360 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC+SSL++ P  ++K  SQKDVIE +L  +I   E     ++KL     +  + E
Sbjct  52    TLYPELCFSSLSAFPAAAEKASSQKDVIEAALNLSITAGEHAYFKLKKLY-GRKDVLEAE  110

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
               A  DCLE +D+ L +L    ++L +YPSKKSI  HA DLKTL+S AMTNQETCLDGFS
Sbjct  111   HTALHDCLELVDETLDELRKTDEELELYPSKKSISDHASDLKTLLSGAMTNQETCLDGFS  170

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE------VE  541
             H K     RK I  G V+VEKL SN L++I+NMTDTD   E  A+G RKL+E        
Sbjct  171   HIKGG-GVRKIISGGCVYVEKLISNALAMIKNMTDTDMAAERSAAG-RKLEENNLPESFA  228

Query  540   GGCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKA  361
             G   +P W+SAGDRRLLQS++ TPNVVVAADGSG+++TV+ AV  AP KSSKRYVIRIKA
Sbjct  229   GEDGFPAWMSAGDRRLLQSSSVTPNVVVAADGSGDFKTVAAAVAAAPEKSSKRYVIRIKA  288

Query  360   GTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITF  181
             G Y+ENV+VPK KTNIMF+GDGR KT+ITG++NV DGSTTF SATVA VGERFLARDITF
Sbjct  289   GVYRENVEVPKKKTNIMFLGDGRMKTIITGSKNVKDGSTTFRSATVAAVGERFLARDITF  348

Query  180   QNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             QNTAG SK QAVALRVGSD SAFY C+M AYQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  349   QNTAGPSKHQAVALRVGSDFSAFYRCDMIAYQDTLYVHSLRQFYRECFIYGTVDFIFGNA  408



>ref|XP_008460358.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=559

 Score =   435 bits (1118),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 219/360 (61%), Positives = 274/360 (76%), Gaps = 11/360 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC +++++         S K+ IE S+  TI     N   V+KL+ +  + TKRE
Sbjct  49    TLYPELCETTISTAVG-----SSSKEAIEASVNITIGAVGDNYRRVKKLLKTENSLTKRE  103

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             KIA  DCLET ++ L +L   ++D+  YP+KKS+  +ADDLKTL+S+A+TNQETCLDGFS
Sbjct  104   KIALHDCLETGEETLRELYEVVEDVNEYPNKKSLSRYADDLKTLLSSAITNQETCLDGFS  163

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGN---RKLKE--VEG  538
             H KAD   R+ +  G +H+EKLCS  L+LI+N+TDTD  N    + +   ++LKE   + 
Sbjct  164   HDKADKKVRESLKEGLIHIEKLCSIALALIKNLTDTDIANLNNNNNHLSRKQLKEKNTDD  223

Query  537   GCEWPEWLSAGDRRLLQ-STAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKA  361
                WP+W+S  DRRLLQ S+ ATP+VVVAADGSG++RT+SEAV  APS+SS+RY+IRIKA
Sbjct  224   RINWPDWMSPNDRRLLQASSTATPDVVVAADGSGDFRTISEAVAAAPSRSSQRYIIRIKA  283

Query  360   GTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITF  181
             G Y+ENV+V  SK NIMF GDGR  T+ITGNRNV+DGSTTFNSATVA VGERFLARD+TF
Sbjct  284   GVYRENVNVASSKRNIMFWGDGRVNTIITGNRNVVDGSTTFNSATVAAVGERFLARDVTF  343

Query  180   QNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             QNTAG SK QAVALRVGSDLSAFY C+M AYQDTLYVHSNRQFYV+C+I GT+DFIFGNA
Sbjct  344   QNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSNRQFYVQCIIVGTIDFIFGNA  403



>ref|XP_007135363.1| hypothetical protein PHAVU_010G123100g [Phaseolus vulgaris]
 gb|ESW07357.1| hypothetical protein PHAVU_010G123100g [Phaseolus vulgaris]
Length=1192

 Score =   451 bits (1159),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 234/367 (64%), Positives = 280/367 (76%), Gaps = 14/367 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T Y +LC+S++AS P V+ KV S +DVI+LSLK T +  E N   V+KL  +    TKRE
Sbjct  90    TFYSELCFSAVASEPNVTHKVTSHRDVIQLSLKITTRAVEHNYFTVKKLS-TKGGLTKRE  148

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L  A  DL +YP+KK++  HADDLKTL+SAA+TNQ TCLDGFS
Sbjct  149   KTALHDCLETIDETLDELREAQHDLELYPNKKTLYQHADDLKTLISAAITNQVTCLDGFS  208

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN--------EIKASGNRKLKE  547
             H  AD   RK +  GQVHVE++CSN L++ +NMTDTD  N        +  A  NRKL  
Sbjct  209   HEDADKRVRKALEEGQVHVERMCSNALAMTKNMTDTDIANFEQTTKLRDNNAGQNRKLLA  268

Query  546   VEG-----GCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKR  382
              E      G  WPEW+SA DRRLLQ+ A   +VVVAADGSG+++TVSEAV+ AP KSSKR
Sbjct  269   EESNANGDGVVWPEWISAADRRLLQAAAVNADVVVAADGSGDFKTVSEAVEAAPLKSSKR  328

Query  381   YVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERF  202
             +VIRIKAG Y+ENV+VPK KTNIMF+GDGR  T+IT +RNV+DGSTTF+SATVAVVG  F
Sbjct  329   FVIRIKAGVYRENVEVPKKKTNIMFLGDGRTSTIITASRNVVDGSTTFHSATVAVVGGNF  388

Query  201   LARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTV  22
             LARDITFQNTAGASK QAVALRVG DLSAFYNC++ AYQDTLYVH+NRQF+V CLI+GTV
Sbjct  389   LARDITFQNTAGASKHQAVALRVGGDLSAFYNCDILAYQDTLYVHNNRQFFVNCLIAGTV  448

Query  21    DFIFGNA  1
             DFIFGN+
Sbjct  449   DFIFGNS  455


 Score =   237 bits (604),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 141/358 (39%), Positives = 206/358 (58%), Gaps = 17/358 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYP  C+SS++S PE      S     EL  K ++++A    ++    + +      R 
Sbjct  695   TRYPSSCFSSISSLPE------SNTTDPELLFKLSLRVAIDELSSFPSKLRANAEQDARL  748

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLD--G  709
             + A   C      AL +LN ++  L     + +  A   +++T +SAA+T+Q+TCLD  G
Sbjct  749   QKAIDVCSSVFGDALDRLNDSISALGTVAGRIASSASVSNVETWLSAALTDQDTCLDAVG  808

Query  708   FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE  529
               +  A   A + I     +  +  SN L+++  +    ++ E      R L        
Sbjct  809   ELNSTAARGALQEIETAMRNSTEFASNSLAIVTKILGLLSRFETPIHHRRLLG-------  861

Query  528   WPEWLSAGDRRLLQ--STAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
             +PEWL A +RRLL+  +  +TP+ VVA DGSG ++T+ EA+K    KS +R+ + +K G 
Sbjct  862   FPEWLGAAERRLLEEKNNDSTPDAVVAKDGSGQFKTIGEALKLVKKKSEERFSVYVKEGR  921

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y EN+D+ K+  N+M  GDG+ KT + G+RN +DG+ TF +AT AV G+ F+A+DI F N
Sbjct  922   YVENIDLDKNTWNVMIYGDGKDKTFVVGSRNFMDGTPTFETATFAVKGKGFIAKDIGFVN  981

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
              AGASK QAVALR GSD S F+ C    +QDTLY HSNRQFY  C I+GT+DFIFGNA
Sbjct  982   NAGASKHQAVALRSGSDRSVFFRCSFDGFQDTLYAHSNRQFYRDCDITGTIDFIFGNA  1039



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score =   432 bits (1111),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 217/359 (60%), Positives = 266/359 (74%), Gaps = 6/359 (2%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC+S+++S      K+   KDVIE  L  TI   + N   +Q ++ +    + RE
Sbjct  65    TLYPELCFSAVSSREGEEAKITKPKDVIEAVLNFTITTVQHNYFTLQHIIKTRLGLSPRE  124

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLE +D  L +L+ +  DL+ Y   KSI   ADDL TL+SAAMTNQETC+DGFS
Sbjct  125   KAALHDCLEMVDDTLDELHKSALDLQDYSLNKSISQQADDLITLLSAAMTNQETCIDGFS  184

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE--  529
             H  AD   RK + +GQ+   +LCSN L++I+N+TDTD      A+G R+L+E E      
Sbjct  185   HDGADKKIRKGLMDGQMQAFRLCSNVLAMIKNLTDTDMAAAASAAG-RQLREEEEEATAT  243

Query  528   ---WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
                WPEWLSAGDRRLLQ++  T +V VAADGSGNY+TV EAV +AP +SSKRY+IRIKAG
Sbjct  244   AIEWPEWLSAGDRRLLQASTVTADVTVAADGSGNYKTVGEAVASAPERSSKRYIIRIKAG  303

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              YKENV+VPK KTNIMF+GDGR  T+IT +RNV+DGSTTF+SATVAVVG+ FLARDITFQ
Sbjct  304   VYKENVEVPKKKTNIMFVGDGRTNTIITASRNVVDGSTTFHSATVAVVGDGFLARDITFQ  363

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             NTAG SK QAVALRVGSDLSAFY C++ AYQDTLYVHS RQF+V CL++GTVDFIFGNA
Sbjct  364   NTAGPSKHQAVALRVGSDLSAFYRCDVLAYQDTLYVHSLRQFFVGCLVAGTVDFIFGNA  422



>ref|XP_010047425.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=585

 Score =   432 bits (1110),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 216/364 (59%), Positives = 263/364 (72%), Gaps = 10/364 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEV-SKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             T YPDLC S L S+P + S  V++ KDVI LSL  TI   + N  +++K+       T R
Sbjct  67    TLYPDLCLSQLTSSPSLASNAVKTPKDVIALSLNLTIAYVQHNYFSIKKVAAVRPGLTAR  126

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPS--KKSIVAHADDLKTLMSAAMTNQETCLD  712
             E+ A  DCLE +D+ L ++   L +L  YP+   KS    A+D+KTL+SAAMTNQETCLD
Sbjct  127   ERTALHDCLEMVDETLDEVRETLAELLAYPNGGNKSASELAEDMKTLLSAAMTNQETCLD  186

Query  711   GFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGG-  535
             GFSH  AD   R+ +  GQ+HV  LCSN L++++NMTD D  NE + S +   +  E   
Sbjct  187   GFSHDSADKKVREALLGGQMHVFHLCSNALAMVKNMTDADVANERRLSSSSNRRLKEETK  246

Query  534   ------CEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVI  373
                     WPEWLSAGDRRLLQST  TP+V VAADG+GNYRTVS AV  AP  S++RYVI
Sbjct  247   EEEEDPVRWPEWLSAGDRRLLQSTTVTPDVTVAADGTGNYRTVSAAVAAAPEGSARRYVI  306

Query  372   RIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLAR  193
             +IKAG Y+ENV+VPK K N+MF+GD R  T+ITG+RNV+DGSTTF SATVAVVG+ FLAR
Sbjct  307   KIKAGVYRENVEVPKKKVNLMFMGDDRKTTIITGSRNVVDGSTTFKSATVAVVGDGFLAR  366

Query  192   DITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFI  13
             DITFQNTAG SK QAVALRVG+D SAF+ C+M AYQDTLYVHS RQFYV CL++GTVDFI
Sbjct  367   DITFQNTAGPSKHQAVALRVGADFSAFHRCDMLAYQDTLYVHSLRQFYVGCLVAGTVDFI  426

Query  12    FGNA  1
             FGNA
Sbjct  427   FGNA  430



>emb|CDY33229.1| BnaC01g37020D [Brassica napus]
Length=570

 Score =   431 bits (1107),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 222/357 (62%), Positives = 269/357 (75%), Gaps = 13/357 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S++A +  V  K+ SQKDVIE SL  T    E N   V+KL+ +    T RE
Sbjct  68    TLYPELCVSAVAISGGV--KLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKNKKGLTPRE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+  L+DL++YP+KK++  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  126   KTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQETCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA--SGNRKLKEVEGGC  532
             H  AD   R  +  GQ     +CSN L++I+NMTDTD  N E+KA  S N +L + EG  
Sbjct  186   HDDADKKVRNFLLKGQ----HMCSNALAMIKNMTDTDIANFELKAKLSSNNQL-DAEG--  238

Query  531   EWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
              WP WLSAGDRRLLQ ++   +  VAA+GSG ++T++ AV  AP  S +RYVI IKAG Y
Sbjct  239   -WPTWLSAGDRRLLQGSSVRADATVAANGSGKFKTIAAAVAAAPDNSKRRYVIHIKAGVY  297

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
             +ENV+V K K NIMF+GDGR +T+ITGNRNV+DGSTTF+SATVA VGERFLARDITFQNT
Sbjct  298   RENVEVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATVAAVGERFLARDITFQNT  357

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG SK QAVALRVGSD SAFY C+M AYQDTLYVHSNRQF+VKCLI+GTVDFIFGNA
Sbjct  358   AGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGNA  414



>ref|XP_010047423.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=578

 Score =   429 bits (1102),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 213/357 (60%), Positives = 266/357 (75%), Gaps = 3/357 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKK-VRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             T YPDLC S L S+P  +   V++ KDVI L+L  TI   + N   ++K+  +    T R
Sbjct  67    TLYPDLCLSQLTSSPSSTSLAVKTPKDVIALALNLTIAYVQHNYFTIKKVAAARPGLTAR  126

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPS--KKSIVAHADDLKTLMSAAMTNQETCLD  712
             ++ A  DCLE +D+ L +++  L +L VYP+   KS+   A+D+KTL+SAAMTNQ+TC++
Sbjct  127   DRTALHDCLEMVDETLDEVHKTLVELLVYPNGGNKSVSELAEDMKTLLSAAMTNQDTCVN  186

Query  711   GFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGC  532
             G S   AD   R+ +  GQ+HV  LCSN L++++NMTD D  NE  +S NR+LKE     
Sbjct  187   GLSDESADKEVREALLGGQMHVFHLCSNALAMVKNMTDADVANERLSSSNRRLKEEGDPI  246

Query  531   EWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
              WPEWLS GDRRLLQST  TP+V VAADG+G+YRTVS AV  AP  S++RYVI+IKAG Y
Sbjct  247   RWPEWLSVGDRRLLQSTTVTPDVTVAADGTGDYRTVSAAVAAAPEGSARRYVIKIKAGVY  306

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
             KENV+VPK K N+MF+GD R  T+ITG+RNV+DGSTTF+SATVAVVGE FLARDITFQNT
Sbjct  307   KENVEVPKKKVNLMFVGDDRTTTIITGSRNVVDGSTTFHSATVAVVGEGFLARDITFQNT  366

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG SK QAVALRVG+D SAF+ C+M AYQDTLYVHS RQFYV CL++GTVDFIFGNA
Sbjct  367   AGPSKHQAVALRVGADFSAFHRCDMLAYQDTLYVHSLRQFYVGCLVAGTVDFIFGNA  423



>gb|KDP33984.1| hypothetical protein JCGZ_07555 [Jatropha curcas]
Length=583

 Score =   429 bits (1102),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 223/415 (54%), Positives = 294/415 (71%), Gaps = 14/415 (3%)
 Frame = -2

Query  1206  KKMARTQEFLTLLASLVLISG--DMVAGVAA-----GEANsldvsssiiksscgSTRYPD  1048
             K M + +  L L AS++LI+    M+A VA+      +      + +IIKSSC +T YPD
Sbjct  14    KNMNKKKLLLILFASILLITAIVSMIACVASRKNSTAKNEYHQAAHAIIKSSCSATLYPD  73

Query  1047  LCYSSLASTPEVS-KKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAF  871
             LC+S++++ P  +  KVR+ +DVI LSL  T +        + ++       T REKIAF
Sbjct  74    LCFSTISTLPNAAISKVRNTRDVIGLSLNVTKESVTKAYLKINRISSGLKKLTPREKIAF  133

Query  870   GDCLETIDQALFQLNTALQDLRVYPS-KKSIVAHADDLKTLMSAAMTNQETCLDGFSHCK  694
             GDC E ++Q + Q+N   + L  YPS KKSI  HA++ K L+SAA+TNQETC+DGFS  +
Sbjct  134   GDCFELLNQTIVQINKVARKLHSYPSLKKSIAEHAEEFKILLSAALTNQETCIDGFSSYE  193

Query  693   ADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN----EIKASGNRKLKEVEGGCEW  526
              D   R+     + +V +LCSN L+LI++MTDTD  N    +  +S +RKL+E + G EW
Sbjct  194   VDKKVRQLFLADERYVYRLCSNALALIKHMTDTDMVNSKEEQHSSSSDRKLEE-DNGIEW  252

Query  525   PEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKE  346
             P+W+S  DRRLLQ+ + TP+V+VAADGSGNY+TV+EAV  APS+S+ RY+I+IKAG Y+E
Sbjct  253   PKWMSTKDRRLLQARSLTPHVIVAADGSGNYKTVTEAVNAAPSRSTSRYIIKIKAGVYRE  312

Query  345   NVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAG  166
              ++VP SKTNIMF GDG  KT+IT N+NV+DGSTTFNSATVA VG+ FLARD+TFQN+AG
Sbjct  313   TLEVPNSKTNIMFFGDGSSKTIITYNKNVVDGSTTFNSATVAAVGDGFLARDLTFQNSAG  372

Query  165   ASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
              SK QAVALRVGSD SAFY C   A+QDTLYVH+ RQFYVKC+I GT+DFIFGN 
Sbjct  373   PSKHQAVALRVGSDKSAFYRCSFIAFQDTLYVHTLRQFYVKCVIIGTIDFIFGNG  427



>ref|XP_010685210.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=592

 Score =   427 bits (1098),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 213/376 (57%), Positives = 271/376 (72%), Gaps = 23/376 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPE-VSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             T+YPDLCYS++AS P   + K+ +QKDVI  SL  T    E N   V+KL+ +  N T R
Sbjct  62    TKYPDLCYSAIASAPSSTTTKISTQKDVIAASLNLTTLAVEHNFFTVEKLIETRKNLTVR  121

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSK-------------KSIVAHADDLKTLMS  745
             E+ A  DCLE+ID+ L +L   LQDL  Y                KS+  +ADD+KTL+S
Sbjct  122   ERNALHDCLESIDETLDELRRTLQDLLSYTHTNNNNNNNNNNKRGKSLKDYADDMKTLVS  181

Query  744   AAMTNQETCLDGFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASG  565
             AAMT+QETCLDGFSH +AD + R+ + +GQVHVE +CSN L++I+NMTD D   E  A+ 
Sbjct  182   AAMTDQETCLDGFSHNRADRHVRETLQSGQVHVEHMCSNALAMIKNMTDIDMAAE-AATK  240

Query  564   NRKLKEVEGGCE--------WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVK  409
              R+L   +            WP W+S+GD+R+LQ      + VVAADGSG++R+++EAVK
Sbjct  241   KRQLYTDDDDDGGDHFYKFGWPRWMSSGDKRMLQEGPEKADAVVAADGSGDFRSIAEAVK  300

Query  408   NAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSA  229
              AP KS KRYVIRIKAG Y+ENV+V K K N+MFIG+GR KT+ITG +NV+DGSTTF+SA
Sbjct  301   AAPDKSKKRYVIRIKAGVYQENVEVGKKKMNLMFIGEGRTKTIITGKKNVVDGSTTFDSA  360

Query  228   TVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFY  49
             TVA+ G+ FLARD+TF+NTAG SK QAVALRVG+DL+AFY C++ AYQDTLYVH NRQF+
Sbjct  361   TVAITGDNFLARDLTFENTAGPSKHQAVALRVGADLAAFYQCDILAYQDTLYVHKNRQFF  420

Query  48    VKCLISGTVDFIFGNA  1
             VKCLI+GTVDFIFGNA
Sbjct  421   VKCLIAGTVDFIFGNA  436



>ref|XP_004144447.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
Length=556

 Score =   425 bits (1093),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 214/362 (59%), Positives = 269/362 (74%), Gaps = 18/362 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC +++++         S K+ IE S+  TI   + N   VQKL+ +  N TKR+
Sbjct  49    TLYPELCETTISTAVG-----SSSKEAIEASVNITISAVKDNYKRVQKLLKTVKNLTKRQ  103

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             KIAF DCLET ++ L +L   ++D+  YP KKS+  +ADDLKTL+S+ +TNQETC+DGFS
Sbjct  104   KIAFHDCLETGEETLRELYEVVEDVNEYPKKKSLSRYADDLKTLLSSTITNQETCVDGFS  163

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTD-----AQNEIKASGNRKLKE--V  544
             H K D   R+ +  G +H+EKLCS  L+LI+N+TDTD       N       ++L+E  +
Sbjct  164   HDKGDKKVRESLKEGLIHIEKLCSIALALIKNLTDTDIANLNNNNNNNHLNRKQLEEKKM  223

Query  543   EGGCEWPEWLSAGDRRLLQ-STAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
             E G +WP+W+S  DRRLLQ S+ ATP+VVVAADGSG++RT+SEAV  APS+SS+RY+IRI
Sbjct  224   EDGIKWPDWMSPKDRRLLQASSTATPDVVVAADGSGDFRTISEAVAAAPSRSSRRYIIRI  283

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             KAG Y+ENV+V  SK NIMF GDGR  T+ITGNRNV+DGST     TVA VGERFLARD+
Sbjct  284   KAGVYRENVNVASSKRNIMFWGDGRVNTIITGNRNVVDGST-----TVAAVGERFLARDV  338

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             TFQNTAG SK QAVALRVGSDLSAFY C+M AYQDTLYVHSNRQFYV+C+I GT+DFIFG
Sbjct  339   TFQNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSNRQFYVQCIIVGTIDFIFG  398

Query  6     NA  1
             NA
Sbjct  399   NA  400



>gb|KDO73733.1| hypothetical protein CISIN_1g008261mg [Citrus sinensis]
Length=572

 Score =   424 bits (1091),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 268/359 (75%), Gaps = 6/359 (2%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSK-KVRSQKDVIELSLKNTIKIAETNRANVQKLVVS-TTNYTK  889
             T YP+LC+S+L++ P  +  KV S KDVI LSL  TI   + N   ++KL+ +  +  TK
Sbjct  59    TLYPELCFSALSAAPAAAVSKVNSPKDVIRLSLNLTITAVQHNYFAIKKLITTRKSTLTK  118

Query  888   REKIAFGDCLETIDQALFQLNTALQDLRVYPS---KKSIVAHADDLKTLMSAAMTNQETC  718
             REK +  DCLE +D+ L +L     +L+ YP+    KSI   AD+LK L+SAAMTNQETC
Sbjct  119   REKTSLHDCLEMVDETLDELYKTEHELQGYPAAANNKSIAEQADELKILVSAAMTNQETC  178

Query  717   LDGFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEG  538
             LDGFSH +AD   R+ +  GQ+HV  +CSN L++I+NMTD D   +I      K + ++ 
Sbjct  179   LDGFSHERADKKIREELMEGQMHVFHMCSNALAMIKNMTDGDIGKDI-VDHYSKARRLDD  237

Query  537   GCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
               +WPEWLSAGDRRLLQ+T   P+V VAADGSGNY TV+ AV  AP  SS+RY+IRIKAG
Sbjct  238   ETKWPEWLSAGDRRLLQATTVVPDVTVAADGSGNYLTVAAAVAAAPEGSSRRYIIRIKAG  297

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              Y+ENV+VPK K N+MFIGDGR  T+ITG+RNV+DGSTTFNSATVAVVG+ FLARDITFQ
Sbjct  298   EYRENVEVPKKKINLMFIGDGRSTTIITGSRNVVDGSTTFNSATVAVVGDGFLARDITFQ  357

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             NTAG SK QAVALRVGSDLSAFY C+M AYQDTLYVHS RQFY  C+I+GTVDFIFGNA
Sbjct  358   NTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSLRQFYTSCIIAGTVDFIFGNA  416



>emb|CDY39109.1| BnaA01g29470D [Brassica napus]
Length=558

 Score =   423 bits (1087),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 217/355 (61%), Positives = 260/355 (73%), Gaps = 21/355 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S++A++  V  K+ SQKDVIE SL  T    E N   V+KL+ +    T RE
Sbjct  68    TLYPELCISAVATSGGV--KLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNRKGLTPRE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+  L+DL++YP+KK++  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  126   KTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQETCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKASGNRKLKEVEGGCEW  526
             H  AD   RK +  GQVHVE +CSN L++I+NMTDTD  N E+KA         EG   W
Sbjct  186   HDDADKKVRKVLLKGQVHVEHMCSNALAMIKNMTDTDIANFELKAKSFSN-NHAEG---W  241

Query  525   PEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKE  346
             P WLSAGDRRLLQ               G ++T++ AV  AP    +RYVI IKAG Y+E
Sbjct  242   PTWLSAGDRRLLQG--------------GKFKTIAAAVAAAPDNGKRRYVIHIKAGVYRE  287

Query  345   NVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAG  166
             NV+V K K NIMF+GDGR +T+ITGNRNV+DGSTTF+SATVA VGERFLARDITFQNTAG
Sbjct  288   NVEVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATVAAVGERFLARDITFQNTAG  347

Query  165   ASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
              SK QAVALRVGSD SAFY C+M AYQDTLYVHSNRQ++VKCLI+GTVDFIFGNA
Sbjct  348   PSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQYFVKCLIAGTVDFIFGNA  402



>ref|XP_006452919.1| hypothetical protein CICLE_v10007806mg [Citrus clementina]
 gb|ESR66159.1| hypothetical protein CICLE_v10007806mg [Citrus clementina]
Length=594

 Score =   424 bits (1089),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 268/359 (75%), Gaps = 6/359 (2%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSK-KVRSQKDVIELSLKNTIKIAETNRANVQKLVVS-TTNYTK  889
             T YP+LC+S+L++ P  +  KV S KDVI LSL  TI   + N   ++KL+ +  +  TK
Sbjct  81    TLYPELCFSALSAAPAAAVSKVNSPKDVIRLSLNLTITAVQHNYFAIKKLITTRKSTLTK  140

Query  888   REKIAFGDCLETIDQALFQLNTALQDLRVYPS---KKSIVAHADDLKTLMSAAMTNQETC  718
             REK +  DCLE +D+ L +L     +L+ YP+    KSI   AD+LK L+SAAMTNQETC
Sbjct  141   REKTSLHDCLEMVDETLDELYKTEHELQGYPAAANNKSIAEQADELKILVSAAMTNQETC  200

Query  717   LDGFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEG  538
             LDGFSH +AD   R+ +  GQ+HV  +CSN L++I+NMTD D   +I      K + ++ 
Sbjct  201   LDGFSHERADKKIREELMEGQMHVFHMCSNALAMIKNMTDGDIGKDI-VDHYSKARRLDD  259

Query  537   GCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
               +WPEWLSAGDRRLLQ+T   P+V VAADGSGNY TV+ AV  AP  SS+RY+IRIKAG
Sbjct  260   ETKWPEWLSAGDRRLLQATTVVPDVTVAADGSGNYLTVAAAVAAAPEGSSRRYIIRIKAG  319

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              Y+ENV+VPK K N+MFIGDGR  T+ITG+RNV+DGSTTFNSATVAVVG+ FLARDITFQ
Sbjct  320   EYRENVEVPKKKINLMFIGDGRTTTIITGSRNVVDGSTTFNSATVAVVGDGFLARDITFQ  379

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             NTAG SK QAVALRVGSDLSAFY C+M AYQDTLYVHS RQFY  C+I+GTVDFIFGNA
Sbjct  380   NTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSLRQFYTSCIIAGTVDFIFGNA  438



>ref|NP_001275846.1| putative thermostable pectinesterase [Citrus sinensis]
 gb|AAK84485.1| putative thermostable pectinesterase [Citrus sinensis]
 gb|AAK84486.1| putative thermostable pectinesterase [Citrus sinensis]
Length=631

 Score =   424 bits (1090),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 268/359 (75%), Gaps = 6/359 (2%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSK-KVRSQKDVIELSLKNTIKIAETNRANVQKLVVS-TTNYTK  889
             T YP+LC+S+L++ P  +  KV S KDVI LSL  TI   + N   ++KL+ +  +  TK
Sbjct  118   TLYPELCFSALSAAPAAAVSKVNSPKDVIRLSLNLTITAVQHNYFAIKKLITTRKSTLTK  177

Query  888   REKIAFGDCLETIDQALFQLNTALQDLRVYPS---KKSIVAHADDLKTLMSAAMTNQETC  718
             REK +  DCLE +D+ L +L     +L+ YP+    KSI   AD+LK L+SAAMTNQETC
Sbjct  178   REKTSLHDCLEMVDETLDELYKTEHELQGYPAAANNKSIAEQADELKILVSAAMTNQETC  237

Query  717   LDGFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEG  538
             LDGFSH +AD   R+ +  GQ+HV  +CSN L++I+NMTD D   +I      K + ++ 
Sbjct  238   LDGFSHERADKKIREELMEGQMHVFHMCSNALAMIKNMTDGDIGKDI-VDHYSKARRLDD  296

Query  537   GCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
               +WPEWLSAGDRRLLQ+T   P+V VAADGSGNY TV+ AV  AP  SS+RY+IRIKAG
Sbjct  297   ETKWPEWLSAGDRRLLQATTVVPDVTVAADGSGNYLTVAAAVAAAPEGSSRRYIIRIKAG  356

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              Y+ENV+VPK K N+MFIGDGR  T+ITG+RNV+DGSTTFNSATVAVVG+ FLARDITFQ
Sbjct  357   EYRENVEVPKKKINLMFIGDGRTTTIITGSRNVVDGSTTFNSATVAVVGDGFLARDITFQ  416

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             NTAG SK QAVALRVGSDLSAFY C+M AYQDTLYVHS RQFY  C+I+GTVDFIFGNA
Sbjct  417   NTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSLRQFYTSCIIAGTVDFIFGNA  475



>ref|XP_011078159.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
Length=567

 Score =   419 bits (1076),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 213/356 (60%), Positives = 262/356 (74%), Gaps = 3/356 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSL-ASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             T YP LC S++ A+    S  ++S KDV+  +L  TI   E N   V+KL  S  + T R
Sbjct  57    TLYPKLCVSTINAAATAASVAIKSSKDVLITALNYTISTVERNYFTVKKLGRSRKSLTTR  116

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKK-SIVAHADDLKTLMSAAMTNQETCLDG  709
             EK A  DCLE ID  L +L  +  +L+ +  K  S+  H ++L  L+SAA TNQE+CLDG
Sbjct  117   EKGALHDCLEMIDDTLDELRRSAAELKDFGFKNYSLADHKENLMILLSAAQTNQESCLDG  176

Query  708   FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE  529
             FSH KAD   R+ +  GQ+HV +L SN +++I+N+TDT+      +S  R+L E     E
Sbjct  177   FSHDKADKVVRRALVVGQMHVFRLVSNVMAIIKNLTDTEMAKNSYSSPERRLGE-NTNSE  235

Query  528   WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
             WPEWLSAGDRRLLQ++  TP+V VAADGSGN+RTVS AV  AP  SS+RYVIRIKAG Y+
Sbjct  236   WPEWLSAGDRRLLQASTVTPDVTVAADGSGNFRTVSAAVAAAPGGSSRRYVIRIKAGVYR  295

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV++P+SKTN+MF+GDGR  T+ITGNRNV+DGSTTFNSATVAVVG+RFLARDITFQNTA
Sbjct  296   ENVEIPRSKTNLMFVGDGRTTTIITGNRNVVDGSTTFNSATVAVVGDRFLARDITFQNTA  355

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK QAVALRV +DL AFY C+M AYQDTLYVHS RQFY  C+I+GTVDFIFGNA
Sbjct  356   GPSKHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCIIAGTVDFIFGNA  411



>emb|CDY60700.1| BnaA01g37100D [Brassica napus]
Length=556

 Score =   414 bits (1064),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 217/357 (61%), Positives = 262/357 (73%), Gaps = 27/357 (8%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S++A++  V  K+ SQKDVIE SL  T    E N   V+KL+ +    T RE
Sbjct  68    TLYPELCISAVATSGGV--KLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKNMKGLTPRE  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DCLETID+ L +L+  L+DL++YP+KK++  HA DLKTL+S+A+TNQETCLDGFS
Sbjct  126   KTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQETCLDGFS  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKA--SGNRKLKEVEGGC  532
             H  AD   RK +  GQ     +CSN L++I+NMTDTD  N E+KA  S N +L + +G  
Sbjct  186   HDDADKKVRKFLLKGQ----HMCSNALAMIKNMTDTDIANFELKAKLSSNNQL-DAKG--  238

Query  531   EWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
              WP WLSAGDRRLLQ               G ++T++ AV  AP  S +RYVI IKAG Y
Sbjct  239   -WPTWLSAGDRRLLQG--------------GKFKTIAAAVAAAPDNSKRRYVIHIKAGVY  283

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
             +ENV+V K K NIMF+GDGR +T+ITGNRNV+DGSTTF+SATVA VGERFLARDITFQNT
Sbjct  284   RENVEVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATVAAVGERFLARDITFQNT  343

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG SK QAVALRVGSD SAFY C+M AYQDTLYVHSNRQF+VKCLI+GTVDFIFGNA
Sbjct  344   AGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGNA  400



>ref|XP_011078160.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=567

 Score =   411 bits (1056),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 211/356 (59%), Positives = 259/356 (73%), Gaps = 3/356 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSL-ASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             T YP LC S++ A+    S  ++S KDV+  +L  TI   E N   V+KLV S  + T R
Sbjct  57    TLYPKLCVSTINAAATAASVAIKSSKDVLITALNYTISTVERNYFTVKKLVRSRKSLTTR  116

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKK-SIVAHADDLKTLMSAAMTNQETCLDG  709
             EK A  DCLE ID  L +L  +  +L+ +  K  S+  H ++L  L+SAA TNQE+CLDG
Sbjct  117   EKGALHDCLEMIDDTLDELRRSAAELKDFGFKNYSLADHKENLMILLSAAQTNQESCLDG  176

Query  708   FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE  529
             FSH KAD   R+ +  GQ+HV +L SN +++I+N+TDT+      +S  R+L E     E
Sbjct  177   FSHDKADKVVRRALVVGQMHVFRLVSNVMAIIKNLTDTEMAKNSYSSPERRLGE-NTNSE  235

Query  528   WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
             WPEWLSAGDRRLLQ++  TP+V VAADGSGN+RTVS AV  AP  SS+RYVIRIKAG Y+
Sbjct  236   WPEWLSAGDRRLLQASTVTPDVTVAADGSGNFRTVSAAVAAAPGGSSRRYVIRIKAGVYR  295

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV++P+SKTN+MF+GDGR  T+ITGNRN    STTFNSATVAVVG+RFLARDITFQNTA
Sbjct  296   ENVEIPRSKTNLMFVGDGRTTTIITGNRNGTSCSTTFNSATVAVVGDRFLARDITFQNTA  355

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK QAVALRV +DL AFY C+M AYQDTLYVHS RQFY  C+I+GTVDFIFGNA
Sbjct  356   GPSKHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCIIAGTVDFIFGNA  411



>gb|AAK69696.1|AF355057_1 putative pectin methylesterase LuPME5 [Linum usitatissimum]
Length=553

 Score =   409 bits (1051),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/359 (57%), Positives = 262/359 (73%), Gaps = 9/359 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVS-TTNYTKR  886
             T YP+LC+S+ +++  V   +++  DV++LSL  TI   + N   ++K++ S + + TKR
Sbjct  43    TLYPELCHSAASASAAVLSDIKTTTDVVDLSLNATIAAVQANNQAIKKIISSRSLSLTKR  102

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             EK A  DC+E   + + +    +++L  +  KKS     +DLKTL+SAAMTNQETCLDGF
Sbjct  103   EKAALADCIELCGETMDEPVKTIEEL--HGKKKSAAERGEDLKTLLSAAMTNQETCLDGF  160

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKA----SGNRKLKEVEG  538
             SH K D   R+ +  GQ +V ++CSN L+++ N+T+ +   E K     S  RK+ E E 
Sbjct  161   SHDKGDKKVRELLAAGQTNVGRMCSNSLAMVENITEEEVFREGKTASFLSEGRKMGEEED  220

Query  537   GCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
             G  WP W+SAGDRRLLQ+   TPNVVVAADGSGN+RTVS+AV  AP  S+ RYVIRIKAG
Sbjct  221   G--WPRWISAGDRRLLQAGTVTPNVVVAADGSGNFRTVSQAVAAAPEGSTSRYVIRIKAG  278

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              Y+E + VPK KTN+MF+GDGR  T+ITG+ NV+DGSTTFNSATVAVVG+RF+ARD+TFQ
Sbjct  279   VYRETLVVPKKKTNLMFVGDGRTSTIITGSMNVVDGSTTFNSATVAVVGDRFMARDLTFQ  338

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             NTAG SK QAVALRV +D +AFY C+M AYQDTLYVHS RQFYV C I+GTVDFIFGNA
Sbjct  339   NTAGPSKHQAVALRVNADFTAFYRCDMLAYQDTLYVHSLRQFYVSCFIAGTVDFIFGNA  397



>ref|XP_004154436.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1-like [Cucumis 
sativus]
Length=553

 Score =   395 bits (1015),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 199/357 (56%), Positives = 263/357 (74%), Gaps = 5/357 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP LC+S+++S    S  + S KD++ELSL   +  A+ N  N++KL +S     KR+
Sbjct  46    TLYPQLCHSTISSILGTSN-LLSLKDIVELSLSVAMDAAKLNNENIKKLSMSGNIVGKRD  104

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             +IA  DC++T D+ +++L+ A+QD   YP+KKS+ ++ADDLKT +S+A+TNQ TCLDG S
Sbjct  105   RIALHDCVKTTDRTIYELDKAIQDFSEYPNKKSLASYADDLKTFLSSAITNQVTCLDGLS  164

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMT-DTDAQNEIKASG-NRKLKEVEGGCE  529
             H K +    + I N    V KLCSN L+L++ +T D    +E    G +R+ +++E G +
Sbjct  165   HDKTEKRVLRLIENTHNQVTKLCSNALALVKKLTTDVALTDEKSLDGESRRREDLENGIK  224

Query  528   WPEWLSAGDRRLLQSTAA-TPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             WPEW+S  D+ LL S++    +VVVAADG+GNY+TVSEAVK APSK+S RY+I+IKAG Y
Sbjct  225   WPEWMSIQDQMLLDSSSEEAADVVVAADGTGNYKTVSEAVKAAPSKNS-RYIIKIKAGVY  283

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
             +ENVDVP SK NIMF GDGR  T+IT +R+   G +TFNSATV  VG+ FLARDITFQNT
Sbjct  284   RENVDVPSSKRNIMFWGDGRSNTIITADRSHGSGWSTFNSATVVAVGDGFLARDITFQNT  343

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG++  QAVALRVGSD SAFY C M AYQDTLYVHSNRQF+VKC+++GTVDFIFGNA
Sbjct  344   AGSANGQAVALRVGSDHSAFYRCSMLAYQDTLYVHSNRQFFVKCVVAGTVDFIFGNA  400



>gb|EYU29496.1| hypothetical protein MIMGU_mgv1a003055mg [Erythranthe guttata]
Length=611

 Score =   397 bits (1020),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 208/359 (58%), Positives = 259/359 (72%), Gaps = 8/359 (2%)
 Frame = -2

Query  1062  TRYPDLCYSSLA-STPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKL-VVSTTNYTK  889
             T YP+LC  ++  + P  S K  S +DV+  +L  TI   E N   V+K+    + + T 
Sbjct  100   TLYPELCIWTIQEAAPAASMK--SSRDVLITALNYTIYTVERNYFTVKKVGSTRSKSLTA  157

Query  888   REKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVA-HADDLKTLMSAAMTNQETCLD  712
             REK A  DCLE ID  L +L     +L+ Y  K   +A H + + +L+SAA TNQE+CLD
Sbjct  158   REKGALHDCLEVIDDTLEELRDTEMELKDYGYKNYTIADHKEKIMSLLSAAQTNQESCLD  217

Query  711   GFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTD-AQ-NEIKASGNRKLKEVEG  538
             GFSH  AD   RK +  GQ HV KL SN L++I+N+ DT+ AQ N   A+  R+L E   
Sbjct  218   GFSHYNADKVVRKVLLAGQKHVFKLVSNVLAIIKNLADTEMAQLNSSPAAEGRRLGEESS  277

Query  537   GCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
             G EWPEW+SAGDRRLLQS+  TP+V VAADGSGN+RT++ AV  AP +S++RYVIRIKAG
Sbjct  278   G-EWPEWMSAGDRRLLQSSTVTPDVTVAADGSGNFRTIAAAVAAAPERSTRRYVIRIKAG  336

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              Y+ENV++ + KTN+MF+GDGR  T+ITG+RNV+DGSTTFNSATVAV+G+ FLARDITFQ
Sbjct  337   VYRENVEISRRKTNLMFVGDGRSTTIITGSRNVVDGSTTFNSATVAVIGDGFLARDITFQ  396

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             NTAG SK QAVALRV +DL AFY C+M AYQDTLYVHS RQFY  CLI+GTVDFIFGNA
Sbjct  397   NTAGPSKHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCLIAGTVDFIFGNA  455



>ref|XP_004139621.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1-like [Cucumis 
sativus]
Length=553

 Score =   395 bits (1014),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 199/357 (56%), Positives = 263/357 (74%), Gaps = 5/357 (1%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP LC+S+++S    S  + S KD++ELSL   +  A+ N  N++KL +S     KR+
Sbjct  46    TLYPQLCHSTISSILGTSN-LLSLKDIVELSLSVAMDAAKLNNENIKKLSMSGNIVGKRD  104

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             +IA  DC++T D+ +++L+ A+QD   YP+KKS+ ++ADDLKT +S+A+TNQ TCLDG S
Sbjct  105   RIALHDCVKTTDRTIYELDKAIQDFSEYPNKKSLASYADDLKTFLSSAITNQVTCLDGLS  164

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMT-DTDAQNEIKASG-NRKLKEVEGGCE  529
             H K +    + I N    V KLCSN L+L++ +T D    +E    G +R+ +++E G +
Sbjct  165   HDKTEKRVLRLIENTHNQVTKLCSNALALVQKLTTDVALTDEKSLDGESRRREDLENGIK  224

Query  528   WPEWLSAGDRRLLQSTAA-TPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             WPEW+S  D+ LL S++    +VVVAADG+GNY+TVSEAVK APSK+S RY+I+IKAG Y
Sbjct  225   WPEWMSIQDQMLLDSSSEEAADVVVAADGTGNYKTVSEAVKAAPSKNS-RYIIKIKAGVY  283

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
             +ENVDVP SK NIMF GDGR  T+IT +R+   G +TFNSATV  VG+ FLARDITFQNT
Sbjct  284   RENVDVPSSKRNIMFWGDGRSNTIITADRSHGSGWSTFNSATVVAVGDGFLARDITFQNT  343

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG++  QAVALRVGSD SAFY C M AYQDTLYVHSNRQF+VKC+++GTVDFIFGNA
Sbjct  344   AGSANGQAVALRVGSDHSAFYRCSMLAYQDTLYVHSNRQFFVKCVVAGTVDFIFGNA  400



>gb|EYU29495.1| hypothetical protein MIMGU_mgv1a005211mg [Erythranthe guttata]
Length=493

 Score =   390 bits (1002),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 200/338 (59%), Positives = 246/338 (73%), Gaps = 5/338 (1%)
 Frame = -2

Query  1002  VRSQKDVIELSLKNTIKIAETNRANVQKL-VVSTTNYTKREKIAFGDCLETIDQALFQLN  826
             ++S +DV+  +L  TI   E N   V+K+      + T REK A  DCLE ID  L +L 
Sbjct  1     MKSSRDVLLTALNYTIYTVERNYFTVKKVGSRRRGSLTAREKGALHDCLEVIDDTLDELR  60

Query  825   TALQDLRVYPSKKSIVA-HADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQVH  649
              +  +L+ Y  K   +A H + L TL+SAA TNQE+CLDGFSH  AD   RK +  GQ H
Sbjct  61    YSEMELKDYGFKNYTLADHKERLMTLLSAAQTNQESCLDGFSHENADKVVRKVLLAGQKH  120

Query  648   VEKLCSNCLSLIRNMTDTDAQ--NEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQSTAA  475
             V KL SN L++I+N+ D +    N   A+  R+L E EG  EWP+WLS GDRRLLQ++  
Sbjct  121   VFKLVSNVLAIIKNLADAEMARLNSSPAAAGRRLGE-EGYGEWPDWLSFGDRRLLQASTV  179

Query  474   TPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDG  295
              P+V VAADGSGNYRTVS AV  AP +SS+RYVIRIKAG Y+ENV++PKSKTN+MF+GDG
Sbjct  180   KPDVTVAADGSGNYRTVSAAVAAAPERSSRRYVIRIKAGVYRENVEIPKSKTNLMFVGDG  239

Query  294   RGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSA  115
             +  T+ITG+RNV+DGSTTFNSATVAVVG+ FLARD+TFQN+AG SK QAVALRV +DLSA
Sbjct  240   QATTIITGSRNVVDGSTTFNSATVAVVGDGFLARDLTFQNSAGPSKHQAVALRVNADLSA  299

Query  114   FYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             F+ C M AYQDTLYVHS RQFY  C ++GTVDFIFGNA
Sbjct  300   FHRCGMIAYQDTLYVHSLRQFYTGCYVAGTVDFIFGNA  337



>ref|XP_008368265.1| PREDICTED: pectinesterase 3-like [Malus domestica]
Length=375

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 201/336 (60%), Positives = 245/336 (73%), Gaps = 8/336 (2%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAAGEANsldvsssiikssc----gSTRYPDLCYSSLAST  1021
             F++L A+++L+     +V GV + + NS D ++    +       ST YP+LC+S+LA  
Sbjct  28    FISLFATILLVGAIVGIVTGVKSSKNNSDDETNEASHAIVKSSCSSTLYPELCFSTLALH  87

Query  1020  PEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTN-YTKREKIAFGDCLETIDQ  844
             PE +KKV SQKDVIELSL  T K  + N   V+KL+ S  N  TKREK A  DCLETID+
Sbjct  88    PEAAKKVSSQKDVIELSLNITTKAVQHNFFTVEKLLKSRKNKLTKREKGALHDCLETIDE  147

Query  843   ALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIF  664
              L +L+ A++DL  YP+KK++  HADDLKTL+S+A+TNQETCLDGFSH  AD   RK   
Sbjct  148   TLDELHDAVEDLHEYPNKKTLTQHADDLKTLISSAITNQETCLDGFSHDDADKKVRKVFL  207

Query  663   NGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE-VEGGCEWPEWLSAGDRRLLQ  487
              GQVHVEKLCSN L++I+NMTDTD  NE+K + NRKLKE V     WPEWLS  DRRLLQ
Sbjct  208   AGQVHVEKLCSNALAMIKNMTDTDIANEMKTNVNRKLKEDVVDEHGWPEWLSVADRRLLQ  267

Query  486   STAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMF  307
             S++ TPNVVVAADGSGNY+TVS AV  AP KSSKRYVIRIKAG Y+ENVDVPK KTNIMF
Sbjct  268   SSSVTPNVVVAADGSGNYKTVSAAVAAAPEKSSKRYVIRIKAGVYRENVDVPKKKTNIMF  327

Query  306   IGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFL  199
             +GDGR  T+IT ++NV+DGSTTFNSATV      F 
Sbjct  328   MGDGRKNTIITASKNVVDGSTTFNSATVGKPNSLFF  363



>ref|XP_010937249.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=582

 Score =   390 bits (1003),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 198/365 (54%), Positives = 250/365 (68%), Gaps = 15/365 (4%)
 Frame = -2

Query  1059  RYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREK  880
             R+PDLCYS++A+TP +   +   KDVI  SL  TI   E +  +V++L  +  N T RE+
Sbjct  63    RFPDLCYSAIAATPPLVHTISKPKDVIHASLNLTITAIERSFRHVERLSAAAANLTARER  122

Query  879   IAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSH  700
              A  DCLE  D++L +L     DLR YP+ K +  HA DL+ L+SAAMTNQE+C DGFSH
Sbjct  123   TALHDCLEMFDESLDELRLTDADLRAYPAGKPLRRHALDLEILVSAAMTNQESCADGFSH  182

Query  699   CKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTD-------AQNEIKASGNRKLK---  550
                D   R  + +G +HV ++C N L++I+NMT  D           I   G R L    
Sbjct  183   GDVDRRLRSELVSGLMHVTRMCRNALAMIKNMTGADIAAAEAVVDGSIGTRGRRMLGFNI  242

Query  549   EVEGGCEWPEWLSAGDRR-LLQSTAAT-PNVVVAADGSGNYRTVSEAVKNAPSKSSKRYV  376
             + EG    P+W+   DRR LLQ+      N VVAADGSG+Y+TV +AV  AP+KS  R+V
Sbjct  243   DEEG---LPDWIEKKDRRRLLQAAGEVKANAVVAADGSGDYKTVGKAVAAAPAKSKTRWV  299

Query  375   IRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLA  196
             IRIKAGTY+ENV+VPK KTN+MFIGDGR  T+ITG+RNV+DGSTTF+SAT+AVVG  FLA
Sbjct  300   IRIKAGTYEENVEVPKKKTNLMFIGDGRKTTIITGSRNVVDGSTTFHSATLAVVGAGFLA  359

Query  195   RDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDF  16
             R ++ QNTAG SK QAVALRV SDLSAFY+C++ AYQDTLY+HS R F+  CLI GTVDF
Sbjct  360   RGLSIQNTAGPSKHQAVALRVSSDLSAFYDCDIIAYQDTLYLHSLRHFFRSCLIQGTVDF  419

Query  15    IFGNA  1
             IFGN 
Sbjct  420   IFGNG  424



>gb|KGN44619.1| hypothetical protein Csa_7G343850 [Cucumis sativus]
Length=581

 Score =   383 bits (984),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 198/385 (51%), Positives = 263/385 (68%), Gaps = 33/385 (9%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP LC+S+++S    S  + S KD++ELSL   +  A+ N  N++KL +S     KR+
Sbjct  46    TLYPQLCHSTISSILGTSN-LLSLKDIVELSLSVAMDAAKLNNENIKKLSMSGNIVGKRD  104

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             +IA  DC++T D+ +++L+ A+QD   YP+KKS+ ++ADDLKT +S+A+TNQ TCLDG S
Sbjct  105   RIALHDCVKTTDRTIYELDKAIQDFSEYPNKKSLASYADDLKTFLSSAITNQVTCLDGLS  164

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKA----------------  571
             H K +    + I N    V KLCSN L+L++ +T   A  + K+                
Sbjct  165   HDKTEKRVLRLIENTHNQVTKLCSNALALVKKLTTDVALTDEKSLVVHDFPYKITSISSQ  224

Query  570   --------------SGNRKLKEVEGGCEWPEWLSAGDRRLLQSTAA-TPNVVVAADGSGN  436
                             +R+ +++E G +WPEW+S  D+ LL S++    +VVVAADG+GN
Sbjct  225   IDDPKIVLFSNQEDGESRRREDLENGIKWPEWMSIQDQMLLDSSSEEAADVVVAADGTGN  284

Query  435   YRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVI  256
             Y+TVSEAVK APSK+S RY+I+IKAG Y+ENVDVP SK NIMF GDGR  T+IT +R+  
Sbjct  285   YKTVSEAVKAAPSKNS-RYIIKIKAGVYRENVDVPSSKRNIMFWGDGRSNTIITADRSHG  343

Query  255   DGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTL  76
              G +TFNSATV  VG+ FLARDITFQNTAG++  QAVALRVGSD SAFY C M AYQDTL
Sbjct  344   SGWSTFNSATVVAVGDGFLARDITFQNTAGSANGQAVALRVGSDHSAFYRCSMLAYQDTL  403

Query  75    YVHSNRQFYVKCLISGTVDFIFGNA  1
             YVHSNRQF+VKC+++GTVDFIFGNA
Sbjct  404   YVHSNRQFFVKCVVAGTVDFIFGNA  428



>ref|XP_008800482.1| PREDICTED: pectinesterase-like isoform X1 [Phoenix dactylifera]
Length=585

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/361 (53%), Positives = 249/361 (69%), Gaps = 11/361 (3%)
 Frame = -2

Query  1059  RYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREK  880
             RYPDLCYS++A+ P + + +   KDVI  S+  TI   + +  +V++L  S  N T RE+
Sbjct  70    RYPDLCYSAVAANPALVQTISKPKDVIHASINLTITAIQRSFRHVERLSASHANLTTRER  129

Query  879   IAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSH  700
              A  DCLE  D++L +L     DLR YP+ K +  HA DL+ L+SA+MTNQE+C DGFS+
Sbjct  130   TALHDCLEMFDESLDELRLTDADLRAYPAGKPLRRHALDLEILVSASMTNQESCSDGFSY  189

Query  699   CKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV------EG  538
                +   R+ I +G  HV  +C N L++I+NM D D      A+  R  + +      EG
Sbjct  190   EDVERRLRREILSGLTHVTHMCRNALAMIKNMIDADIAAADVAADGRGRRMLGFDIDEEG  249

Query  537   GCEWPEWLSAGDRR-LLQSTAAT-PNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIK  364
                +P+W+   DRR LLQ+T     N VVA DGSG+Y+TV EAV  AP+KS  R+VI+I 
Sbjct  250   ---FPDWMEKKDRRRLLQATGEVKANAVVAPDGSGDYKTVGEAVAAAPAKSKTRWVIQIT  306

Query  363   AGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDIT  184
             AGTY+ENV+VPK KTN+MFIG+GR  T+ITG+RNV+DGSTTF SAT+AVVGE FLAR + 
Sbjct  307   AGTYEENVEVPKKKTNLMFIGEGRKTTIITGSRNVVDGSTTFRSATLAVVGEGFLARGLR  366

Query  183   FQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGN  4
              QNTAG SK QAVALRVGSDLSAFY+C++  YQDTLY+HS R F+  CLI GTVDFIFGN
Sbjct  367   IQNTAGPSKHQAVALRVGSDLSAFYDCDIIGYQDTLYLHSLRHFFRSCLIQGTVDFIFGN  426

Query  3     A  1
             A
Sbjct  427   A  427



>ref|XP_010534984.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=567

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 206/411 (50%), Positives = 271/411 (66%), Gaps = 14/411 (3%)
 Frame = -2

Query  1197  ARTQEFLTLLASLVLISGDMVAGVAAGEANsldvsssiiksscg--STRYPDLCYSSLAS  1024
             ++T + L  L   ++I+   VAG +    N+   +SS         ST  PDLCY ++AS
Sbjct  3     SQTNKNLLFLFGFLVITAISVAGESKPNKNTTLSASSKAVVRSSCSSTPLPDLCYFAVAS  62

Query  1023  TPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQ  844
                  + + SQKDVI+  L  T    + + + V+ L+++    + R   A  DC+E I+ 
Sbjct  63    I--AGQNITSQKDVIKALLDVTAYAVKESYSTVKGLLITGIGLSPRANTAVNDCVENIEV  120

Query  843   ALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIF  664
              L  L  A   L  YP+  +   HA DLKTL+S+A+TNQE+CL+GFS+  AD   R  I+
Sbjct  121   TLEDLQGAAAKLLSYPNGGTGRNHAGDLKTLVSSAITNQESCLEGFSYDIADMVIRSIIY  180

Query  663   NGQVHVEKLCSNCLSLIRNMTDTDAQN---EIKASGNRKLKEVEGGCE-----WPEWLSA  508
              G+V++++LC   L+LI+NMTDTD  N   + +    RKL+E           WP WLSA
Sbjct  181   TGEVYIQRLCGIALALIKNMTDTDIANSRPKARPFNKRKLEEATMAAATDKDGWPCWLSA  240

Query  507   GDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPK  328
              DRRLLQS +  PNVVVAADG+G++ TV EAV+ AP K ++RYVI+IKAG Y+ENV+VP 
Sbjct  241   DDRRLLQSKSVQPNVVVAADGTGDFTTVGEAVEAAPKKRTERYVIKIKAGVYRENVNVPS  300

Query  327   SKTNIMFIGDGRGKTVITGNRNVI--DGSTTFNSATVAVVGERFLARDITFQNTAGASKE  154
             +K N+MF+GDGR KT ITG+R+V   +  TTF SATVA VGE F+ARDITF+NTAG S +
Sbjct  301   NKMNLMFVGDGRTKTFITGDRSVGGNEDMTTFRSATVAAVGEGFMARDITFENTAGPSND  360

Query  153   QAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             QAVALRVGSD SAFY C + AYQDTLYVHS RQF+VKC +SGTVDFIFGNA
Sbjct  361   QAVALRVGSDKSAFYRCNISAYQDTLYVHSKRQFFVKCHVSGTVDFIFGNA  411



>ref|XP_010939846.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=591

 Score =   372 bits (956),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 194/365 (53%), Positives = 252/365 (69%), Gaps = 11/365 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYPDLCYS++A+TP + + +   KDVI  S+  TI   + +  +V++L  S  N T RE
Sbjct  69    TRYPDLCYSAVAATPALIQTISKPKDVIHASINLTITAIQRSFRHVERLSASYPNLTTRE  128

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             + A  DCLE  D++L +LN    DLR YP+ K +  HA DL+ L+SAAMTNQE+C DGFS
Sbjct  129   RTALHDCLEMFDESLDELNLTDADLRAYPAGKPLRRHALDLEILVSAAMTNQESCSDGFS  188

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASG--------NRKLKE  547
             +   +   R+ I +   HV ++C N L++I+NM D D       +G         R++  
Sbjct  189   YEDIEGRLRREIRSELTHVTRMCRNALAMIKNMIDADIAAAEAEAGADGGALNQGRRMSG  248

Query  546   VEGGCE-WPEWLSAGDRR-LLQSTAATP-NVVVAADGSGNYRTVSEAVKNAPSKSSKRYV  376
              +   E +P+W+   DRR LLQ+      N VVAADGSG+Y+TV EAV  AP+KS+ R+V
Sbjct  249   FDVDEEGFPDWMEKKDRRRLLQAAGEVQVNAVVAADGSGDYKTVGEAVAAAPAKSTTRWV  308

Query  375   IRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLA  196
             IRIKAGTY+ENV+VPK KTN+MFIGDGR  T+ITG+RNV+DGSTTF+SAT+AVVG  F A
Sbjct  309   IRIKAGTYEENVEVPKKKTNLMFIGDGRTATIITGSRNVMDGSTTFHSATLAVVGTGFQA  368

Query  195   RDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDF  16
             R +  +NTAG SK QAVALRV SDLSAFY+C++  YQDTLY+HS R F+  CLI GTVDF
Sbjct  369   RGLRIENTAGPSKHQAVALRVSSDLSAFYDCDLIGYQDTLYLHSLRHFFRSCLIQGTVDF  428

Query  15    IFGNA  1
             IFGNA
Sbjct  429   IFGNA  433



>ref|XP_004139620.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
Length=575

 Score =   367 bits (942),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 193/385 (50%), Positives = 255/385 (66%), Gaps = 32/385 (8%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP LC+S+++S    S  + S KD+ E+SL   +  A+ N  N++KL+VST N +KR+
Sbjct  39    TLYPQLCHSTISSIVGTSN-LLSLKDIFEVSLSVAMDAAKHNNKNIKKLMVSTNNVSKRD  97

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             KI   DC+ET D+ +++L  A++  R YP+K+S+  +ADDLKT +S+A+TNQ TCLDG S
Sbjct  98    KIGLHDCVETTDRTIYELGKAIEVFREYPNKRSLTLYADDLKTFLSSAITNQVTCLDGLS  157

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTD----TDAQNEIKASGNRKLKEVEG-  538
             H K +    + I N  +HV KLCSN L+L++ +T     TD ++ +      K+  +   
Sbjct  158   HDKTEKRVLRLIENAHIHVTKLCSNALALVQKLTTDVALTDEKSLVVHDFPYKITSIPSQ  217

Query  537   -------------------------GCEWPEWLSAGDRRLLQSTAATPNVVVAA-DGSGN  436
                                      G +WP+W+S  D++LL+S++      V A DGSGN
Sbjct  218   MDDPKIVLFSNQEEDENRRREELEDGIKWPKWMSIEDQKLLESSSEAAAEAVVAADGSGN  277

Query  435   YRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVI  256
             Y+TV+EAV  APSK+SKRY+I+IKAG Y ENVDVP SK NIMF GDGR  T I  NR+  
Sbjct  278   YKTVAEAVAAAPSKNSKRYIIKIKAGEYWENVDVPSSKRNIMFWGDGRSNTKIISNRSHG  337

Query  255   DGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTL  76
              G +TF SAT+A VG+ FLARDITFQN AGA+  QAVALRVGSD SAFY C M AYQDTL
Sbjct  338   TGWSTFKSATLAAVGDGFLARDITFQNKAGAANGQAVALRVGSDHSAFYRCSMLAYQDTL  397

Query  75    YVHSNRQFYVKCLISGTVDFIFGNA  1
             YVHSNRQF+V C+++GTVDFIFGNA
Sbjct  398   YVHSNRQFFVNCIVAGTVDFIFGNA  422



>ref|XP_004170129.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN44621.1| Pectinesterase [Cucumis sativus]
Length=575

 Score =   367 bits (942),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 193/385 (50%), Positives = 255/385 (66%), Gaps = 32/385 (8%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP LC+S+++S    S  + S KD+ E+SL   +  A+ N  N++KL+VST N +KR+
Sbjct  39    TLYPQLCHSTISSIVGTSN-LLSLKDIFEVSLSVAMDAAKHNNKNIKKLMVSTNNVSKRD  97

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             KI   DC+ET D+ +++L  A++  R YP+K+S+  +ADDLKT +S+A+TNQ TCLDG S
Sbjct  98    KIGLHDCVETTDRTIYELGKAIEVFREYPNKRSLTLYADDLKTFLSSAITNQVTCLDGLS  157

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTD----TDAQNEIKASGNRKLKEVEG-  538
             H K +    + I N  +HV KLCSN L+L++ +T     TD ++ +      K+  +   
Sbjct  158   HDKTEKRVLRLIENAHIHVTKLCSNALALVQKLTTDIAITDEKSLVVHDFPYKITSIPSQ  217

Query  537   -------------------------GCEWPEWLSAGDRRLLQSTAATPNVVVAA-DGSGN  436
                                      G +WP+W+S  D++LL+S++      V A DGSGN
Sbjct  218   MDDPKIVLFSNQEEDENRRREELEDGIKWPKWMSIEDQKLLESSSEAAAEAVVAADGSGN  277

Query  435   YRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVI  256
             Y+TV+EAV  APSK+SKRY+I+IKAG Y ENVDVP SK NIMF GDGR  T I  NR+  
Sbjct  278   YKTVAEAVAAAPSKNSKRYIIKIKAGEYWENVDVPSSKRNIMFWGDGRSNTKIISNRSHG  337

Query  255   DGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTL  76
              G +TF SAT+A VG+ FLARDITFQN AGA+  QAVALRVGSD SAFY C M AYQDTL
Sbjct  338   TGWSTFKSATLAAVGDGFLARDITFQNKAGAANGQAVALRVGSDHSAFYRCSMLAYQDTL  397

Query  75    YVHSNRQFYVKCLISGTVDFIFGNA  1
             YVHSNRQF+V C+++GTVDFIFGNA
Sbjct  398   YVHSNRQFFVNCIVAGTVDFIFGNA  422



>ref|XP_002324773.2| hypothetical protein POPTR_0018s05360g [Populus trichocarpa]
 gb|EEF03338.2| hypothetical protein POPTR_0018s05360g [Populus trichocarpa]
Length=359

 Score =   358 bits (920),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/328 (57%), Positives = 242/328 (74%), Gaps = 9/328 (3%)
 Frame = -2

Query  1182  FLTLLASLVLISG--DMVAGVAAGEA-----NsldvsssiiksscgSTRYPDLCYSSLAS  1024
             FL+L +S++L++    +VAGV + +      N   V+ +I+KSSC ST YP LC+S+L++
Sbjct  17    FLSLFSSILLVTAIVSIVAGVTSSKNSTESNNDHQVAHTILKSSCSSTLYPHLCFSALSA  76

Query  1023  TPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQ  844
              P+ + K++S+KDVI+LSL  T+     +   +QKL  +  ++T+RE  A  DCL  +++
Sbjct  77    VPDATSKIKSKKDVIDLSLNRTMSATRHSYFKIQKLTSTRRSFTERENTALHDCLVMLNE  136

Query  843   ALFQLNTALQDLRVYPS-KKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPI  667
              L QL+ A Q+L+ YPS KKS+  HADDLK L+SAAMTNQETCLDGFSH KAD   R+  
Sbjct  137   TLDQLSKAYQELQDYPSLKKSLSVHADDLKILLSAAMTNQETCLDGFSHDKADKKVRELF  196

Query  666   FNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQ  487
              + ++HV  + S  L++I+N+TDTD   E   S  RKL+E E G EWPEWLSAGDRRLLQ
Sbjct  197   IDEEMHVYHMSSIALAIIKNVTDTDMAKEQSLSSGRKLEE-ENGTEWPEWLSAGDRRLLQ  255

Query  486   STAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMF  307
             +T  TPNVVVAADGSGNYRTVSEAV  AP +SS RY+IRIKAG Y+ENVDVP+SKTNIMF
Sbjct  256   ATTVTPNVVVAADGSGNYRTVSEAVAAAPERSSSRYIIRIKAGVYRENVDVPRSKTNIMF  315

Query  306   IGDGRGKTVITGNRNVIDGSTTFNSATV  223
             +GDGR  T+IT +RNV+DGSTTFNSATV
Sbjct  316   MGDGRTTTIITASRNVVDGSTTFNSATV  343



>ref|XP_006385198.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP62995.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=572

 Score =   364 bits (935),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 189/358 (53%), Positives = 248/358 (69%), Gaps = 6/358 (2%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYPDLCYS+  S P+ +      K VI  ++  TI    + +    K ++ST + T ++
Sbjct  61    TRYPDLCYSAATSFPDQASG-DDPKTVILNNINKTIDAINSKKIRDDK-ILSTEDLTAQQ  118

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIV--AHADDLKTLMSAAMTNQETCLDG  709
             K A  DC +  D +L  L+    +L   P+KK +   ++A +L+T +S+ ++ Q++CLDG
Sbjct  119   KTALKDCRQNYDSSLADLDNVWGELNRNPNKKKLQQKSYAAELQTKVSSCISGQQSCLDG  178

Query  708   FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMT-DTDA-QNEIKASGNRKLKEVEGG  535
             FSH       RK +   + +  K+CSN L+LI  +  DTDA  N +K +  + ++E +  
Sbjct  179   FSHSWLSRLFRKALGPSEDNAGKMCSNALALINKLIEDTDAIANRLKTTSRKLMEEDDSD  238

Query  534   CEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
               WPEWLS  DRRL QS+  TP+VVVAADGSG YRTVS AV  AP  S+KRY+I+IKAG 
Sbjct  239   EGWPEWLSVTDRRLFQSSLLTPDVVVAADGSGKYRTVSAAVAAAPKHSAKRYIIKIKAGV  298

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y+ENV+VP  KTNIMF+GDGR KT+IT +RNV+DG TT++SATVAVVG+ FLARDITFQN
Sbjct  299   YRENVEVPSEKTNIMFLGDGRKKTIITASRNVVDGGTTYHSATVAVVGQGFLARDITFQN  358

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             TAGASK QAVALRV SD +AFY C M AYQ+TLYVHSNRQF+  C I+GTVDFIFGN+
Sbjct  359   TAGASKYQAVALRVESDFAAFYKCGMLAYQNTLYVHSNRQFFTNCYIAGTVDFIFGNS  416



>ref|XP_008458040.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase-like [Cucumis 
melo]
Length=604

 Score =   365 bits (936),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 189/386 (49%), Positives = 263/386 (68%), Gaps = 34/386 (9%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP LC+S+++S    S  + S KD+++LSL   +  A+ N  N++ L+ S  N +KR+
Sbjct  68    TLYPQLCHSTISSIIGTSN-LLSLKDIVQLSLSVAMDAAKLNNGNIKNLM-SFNNVSKRD  125

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             +I   DC+++ D+ +++L+ A++D R YP+KKS+ ++ADDLKT +S+A+TNQ TCLDGF 
Sbjct  126   RIPLHDCVKSTDRTIYELDKAIEDFREYPNKKSLTSYADDLKTFLSSAITNQVTCLDGFQ  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTD----TDAQNEI--------------  577
               K +    + I N  +H  KLCSN L+L++ +T      D +N +              
Sbjct  186   DDKTEKGVLRVIENTHIHATKLCSNALALVKKLTTEIALIDEKNLVVHDFPYKITSISSQ  245

Query  576   ------------KASGNRKLKEVEGGCEWPEWLSAGDRRLLQSTAA--TPNVVVAADGSG  439
                         +   N + +++E G +WPEW+S  D++LL+S+++    +VVVA DGSG
Sbjct  246   INDLKIVLFSNQEEGENGRREDLENGIKWPEWMSIQDQKLLESSSSEAAADVVVAVDGSG  305

Query  438   NYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNV  259
             NY+TVSEAV+ APSK+SKRY+I+IKAG Y+ENVDVP SK NIMF GDGR  T+IT  R+ 
Sbjct  306   NYKTVSEAVEAAPSKNSKRYIIKIKAGVYRENVDVPSSKRNIMFWGDGRSNTIITAYRSH  365

Query  258   IDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDT  79
               G +TFNSATV  VG+ FLARDI+F+NTAG +  QAVALRVGSD SAFY C M  YQDT
Sbjct  366   GSGWSTFNSATVVAVGDGFLARDISFENTAGPANGQAVALRVGSDHSAFYRCGMLGYQDT  425

Query  78    LYVHSNRQFYVKCLISGTVDFIFGNA  1
             LYVHSNRQF+V C+++GTVDF+FGNA
Sbjct  426   LYVHSNRQFFVNCVVAGTVDFVFGNA  451



>ref|XP_006369078.1| hypothetical protein POPTR_0001s162502g, partial [Populus trichocarpa]
 gb|ERP65647.1| hypothetical protein POPTR_0001s162502g, partial [Populus trichocarpa]
Length=349

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 238/324 (73%), Gaps = 6/324 (2%)
 Frame = -2

Query  1182  FLTLLASLVLIS--GDMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEVS  1009
             FL   A+  L++    +V GV + +    + + +I+KS+C ST YP+LCYS++A+ P V+
Sbjct  28    FLASFAAFFLVATIAAVVTGVNSHKNGKNEGAHAILKSACSSTLYPELCYSAIATVPGVT  87

Query  1008  KKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQL  829
               + S KDVIELS+  T K  + N   V+KL+ + T  TKREK A  DCLETID+ L +L
Sbjct  88    SNLASLKDVIELSINLTTKTVQQNYFTVEKLI-AKTKLTKREKTALHDCLETIDETLDEL  146

Query  828   NTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQVH  649
             + AL D+  YP KKS+   AD+LKTL+S+A+TNQETCLDGFSH  AD   RK +  GQ H
Sbjct  147   HEALVDINGYPDKKSLKEQADNLKTLLSSAITNQETCLDGFSHDGADKKVRKALLKGQTH  206

Query  648   VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE--WPEWLSAGDRRLLQSTAA  475
             VEK+CSN L++IRNMTDTD  NE++ + NRKLKE + G E  WPEW+S  DRRLLQS++ 
Sbjct  207   VEKMCSNALAMIRNMTDTDIANELQNT-NRKLKEEKEGNERVWPEWMSVADRRLLQSSSV  265

Query  474   TPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDG  295
             TPNVVVAADGSG+Y+TVSEAV   P KSS RYVI+IKAG Y+ENV+VPK K N+MF+GDG
Sbjct  266   TPNVVVAADGSGDYKTVSEAVAAVPKKSSTRYVIQIKAGVYRENVEVPKDKHNVMFLGDG  325

Query  294   RGKTVITGNRNVIDGSTTFNSATV  223
             R  T+IT +RNV+DGSTTF SATV
Sbjct  326   RKTTIITASRNVVDGSTTFKSATV  349



>emb|CAC18727.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=536

 Score =   362 bits (929),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/361 (54%), Positives = 253/361 (70%), Gaps = 10/361 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYPDLCYS+ +S P+ S K    K VI  ++  TI    + +    K ++ST N TK++
Sbjct  23    TRYPDLCYSAASSFPDDSGKSGDPKAVILKNINATIDAINSKKIEANK-ILSTENPTKKQ  81

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIV--AHADDLKTLMSAAMTNQETCLDG  709
             K A  DC +  D +L  L+    +L   P+ K +   ++AD+L T +SA  +N+++C DG
Sbjct  82    KTALEDCTKNYDSSLADLDKVWGELNRNPNNKKLQQQSYADELTTKVSACKSNEDSCFDG  141

Query  708   FSHCKADHNARKPIFNG--QVHVEKLCSNCLSLIRNMTD-TDA-QNEIKASGNRKLKEVE  541
             FSH       R  IF G  + +  K+CSN L+LI+ +T+ T A  N +K + +RKLKE +
Sbjct  142   FSHSSFLRGFRD-IFLGSSEDNAGKMCSNTLALIKTLTEGTKAIANRLKTT-SRKLKEED  199

Query  540   GGCE-WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIK  364
                E WPEWLS  DRRL QS+  TP+VVVAADGSG YRTVS AV  AP  S+KRY+I+IK
Sbjct  200   DSDEGWPEWLSVTDRRLFQSSLLTPDVVVAADGSGKYRTVSAAVAAAPKHSAKRYIIKIK  259

Query  363   AGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDIT  184
             AG Y+ENV+VP  KTNIMF+GDGR KT+IT +RNV+DG TT++SATVAVVG+ FLARDIT
Sbjct  260   AGVYRENVEVPSEKTNIMFLGDGRKKTIITASRNVVDGGTTYHSATVAVVGKGFLARDIT  319

Query  183   FQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGN  4
             FQNTAGASK QAVALRV SD +AFY C + AYQ+TL+VHSNRQF+    I+GTVDFIFGN
Sbjct  320   FQNTAGASKYQAVALRVESDFAAFYKCGVVAYQNTLHVHSNRQFFTNSYIAGTVDFIFGN  379

Query  3     A  1
             +
Sbjct  380   S  380



>gb|KDO53765.1| hypothetical protein CISIN_1g018173mg [Citrus sinensis]
Length=360

 Score =   355 bits (912),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 180/285 (63%), Positives = 219/285 (77%), Gaps = 9/285 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYPDLC+S++A+ PE SKKV SQKDVIE+SL  T    E N   +QKL+   TN TKRE
Sbjct  76    TRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTTAVEHNYFGIQKLL-KRTNLTKRE  134

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K+A  DCLETID+ L +L+ A++DL  YP+KKS+  HADDLKTLMSAAMTNQ TCLDGFS
Sbjct  135   KVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMTNQGTCLDGFS  194

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE----VEGG  535
             H  A+ + R  + +GQVHVEK+CSN L++I+NMTDTD    ++ S NRKL E    V+G 
Sbjct  195   HDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMM-IMRTSNNRKLIEETSTVDG-  252

Query  534   CEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
               WP WLS GDRRLLQS++ TPNVVVAADGSGN++TV+ AV  AP   +KRY+IRIKAG 
Sbjct  253   --WPAWLSTGDRRLLQSSSVTPNVVVAADGSGNFKTVAAAVAAAPQGGTKRYIIRIKAGV  310

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVA  220
             Y+ENV+V K   NIMFIGDGR +T+ITG+RNV+DGSTTF SATV 
Sbjct  311   YRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVG  355



>emb|CAC18726.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=574

 Score =   361 bits (926),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 194/361 (54%), Positives = 251/361 (70%), Gaps = 10/361 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYPDLCYS+    P+ S      K VI  ++  TI    + +    K ++ST N TK++
Sbjct  61    TRYPDLCYSAATCFPDDSGNSGDPKAVILKNINATIDAINSKKIEANK-ILSTENPTKKQ  119

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIV--AHADDLKTLMSAAMTNQETCLDG  709
             K A  DC +  D +L  L+    +L   P+ K +   ++AD+L T +SA  +N+++C DG
Sbjct  120   KTALEDCTKNYDSSLADLDKVWGELNRNPNNKKLQQQSYADELATKVSACKSNEDSCFDG  179

Query  708   FSHCKADHNARKPIFNG--QVHVEKLCSNCLSLIRNMTD-TDA-QNEIKASGNRKLKEVE  541
             FSH       R  IF G  + +  K+CSN L+LI+ +T+ T A  N +K + +RKLKE +
Sbjct  180   FSHSSFLREFRD-IFLGSSEDNAGKMCSNTLALIKTLTEGTKAIANRLKTT-SRKLKEED  237

Query  540   GGCE-WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIK  364
                E WPEWLS  DRRL QS+  TP+VVV+ADGSG YRTVS AV  AP  S+KRY+I+IK
Sbjct  238   DSDEGWPEWLSVTDRRLFQSSLLTPDVVVSADGSGKYRTVSAAVAAAPKHSAKRYIIKIK  297

Query  363   AGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDIT  184
             AG Y+ENV+VP  KTNIMF+GDGR +T+IT +RNV+DG TT++SATVAVVG+ FLARDIT
Sbjct  298   AGVYRENVEVPSEKTNIMFLGDGRKRTIITASRNVVDGGTTYHSATVAVVGKGFLARDIT  357

Query  183   FQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGN  4
             FQNTAGASK QAVALRV SD +AFY C M AYQ+TL+VHSNRQF+  C I+GTVDFIFGN
Sbjct  358   FQNTAGASKYQAVALRVESDFAAFYKCGMVAYQNTLHVHSNRQFFTNCYIAGTVDFIFGN  417

Query  3     A  1
             +
Sbjct  418   S  418



>ref|XP_011047860.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=574

 Score =   358 bits (920),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 191/361 (53%), Positives = 247/361 (68%), Gaps = 10/361 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYPDLCYS+  S P+ S K    K VI  ++  TI    + +    K ++ST   T+++
Sbjct  61    TRYPDLCYSAATSFPDDSAKSGDPKAVILNNINATIDSINSKKIEADK-ILSTKKLTQQQ  119

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIV--AHADDLKTLMSAAMTNQETCLDG  709
             K A  DC +  DQ+L  L+     L   P+ + +   + AD L T +S+  +N+++C+DG
Sbjct  120   KTALEDCRQNYDQSLADLDKVWGGLNRNPNNQLLQQQSFADQLTTQVSSCKSNEDSCVDG  179

Query  708   FSHCKADHNARKPIFNGQVHVE--KLCSNCLSLIRNMTDTD--AQNEIKASGNRKLKEVE  541
             FSH       R  IF G    +  K+CSN L+LI+ + +    A N +K + +RKLKE +
Sbjct  180   FSHSWLSRQVRD-IFRGPSKDDAGKMCSNTLALIKKLIEETKAAANSLKTT-SRKLKEED  237

Query  540   GGCE-WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIK  364
                E WPEWLS  DRR+  S+  TP+VVVAADGSG YRTVS AV  AP  S+KRY+I+IK
Sbjct  238   DNEEGWPEWLSVTDRRVFHSSLLTPDVVVAADGSGKYRTVSAAVAAAPKHSAKRYIIKIK  297

Query  363   AGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDIT  184
             AG Y+ENV+VP  KTNIMF+GDGR KT+IT +RNV+DG TT++SATVAVVG+ FLARDIT
Sbjct  298   AGVYRENVEVPSEKTNIMFLGDGRKKTIITSSRNVVDGGTTYHSATVAVVGQGFLARDIT  357

Query  183   FQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGN  4
             FQNTAGASK QAVALRV SD +AFY C + AYQ+TLYVHSNRQF+  C I+GTVDFIFGN
Sbjct  358   FQNTAGASKYQAVALRVESDFAAFYKCGILAYQNTLYVHSNRQFFTNCYIAGTVDFIFGN  417

Query  3     A  1
             +
Sbjct  418   S  418



>ref|XP_003627459.1| Pectinesterase [Medicago truncatula]
Length=391

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/300 (58%), Positives = 221/300 (74%), Gaps = 11/300 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC+S+++S P ++ K+ + KDVI LSL  T +  E N   V+KL++  +  TKRE
Sbjct  75    TLYPELCFSAISSEPNITHKITNHKDVISLSLNITTRAVEHNYFTVEKLLLRKS-LTKRE  133

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             KIA  DCLETID+ L +L  A  DL +YPSKK++  HADDLKTL+S+A+TNQ TCLDGFS
Sbjct  134   KIALHDCLETIDETLDELKEAQNDLVLYPSKKTLYQHADDLKTLISSAITNQVTCLDGFS  193

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTD-AQNE-----IKASGNRKLKEVE  541
             H  AD   RK +  GQ+HVE +CSN L++ +NMTD D A+ E     + ++ NRKL E E
Sbjct  194   HDDADKEVRKVLQEGQIHVEHMCSNALAMTKNMTDKDIAEFEQTNMVLGSNKNRKLLEEE  253

Query  540   GGCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKA  361
              G  WPEW+SAGDRRLLQ +    +VVVAADGSGN++TVSEAV  AP KSSKRYVI+IKA
Sbjct  254   NGVGWPEWISAGDRRLLQGSTVKADVVVAADGSGNFKTVSEAVAAAPLKSSKRYVIKIKA  313

Query  360   GTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITF  181
             G YKENV+VPK KTNIMF+GDGR  T+ITG+RNV+DGSTTF+SATV     ++    ITF
Sbjct  314   GVYKENVEVPKKKTNIMFLGDGRTNTIITGSRNVVDGSTTFHSATVG----KYFFTSITF  369



>ref|XP_006389479.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP48393.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=572

 Score =   357 bits (915),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 193/361 (53%), Positives = 247/361 (68%), Gaps = 12/361 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYPDLCYS+  S P+ S+     K VI  ++  TI    + +    K ++ST   T+++
Sbjct  61    TRYPDLCYSAATSFPDASRG--DPKAVILNNINATIDAINSKKIEADK-ILSTKQLTQQQ  117

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIV--AHADDLKTLMSAAMTNQETCLDG  709
             K A  DC +  D +L  L      L+  P+   +   ++A+DL T +S+  +N+++C+DG
Sbjct  118   KTALEDCRQNYDSSLADLEKVWGGLKRNPNNGLLQQKSYAEDLTTKVSSCKSNEDSCIDG  177

Query  708   FSHCKADHNARKPIFN--GQVHVEKLCSNCLSLIRNMT-DTDA-QNEIKASGNRKLKEVE  541
             FSH       R  IF    +    K+CSN L+LI+ +  DT A  N +K + +RKLKE +
Sbjct  178   FSHSWLSRKLRD-IFRDPSEDDAGKMCSNTLALIKKLIEDTKAIANRLKTT-SRKLKEED  235

Query  540   GGCE-WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIK  364
                E WPEWLS  DRRL QS+  TP+VVVAADGSG YRTVS AV  AP  S KRY+I+IK
Sbjct  236   DSDEGWPEWLSVTDRRLFQSSLLTPDVVVAADGSGKYRTVSAAVAAAPKHSGKRYIIKIK  295

Query  363   AGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDIT  184
             AG Y+ENV+VP  KTNIMF+GDGR KT+IT +RNV+DG TT++SATVAVVG+ FLARDIT
Sbjct  296   AGVYRENVEVPSEKTNIMFLGDGRKKTIITASRNVVDGGTTYHSATVAVVGQGFLARDIT  355

Query  183   FQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGN  4
             FQNTAGASK QAVALRV SD +AFY C M AYQ+TLYVHSNRQF+  C I+GTVDFIFGN
Sbjct  356   FQNTAGASKYQAVALRVESDFAAFYKCGMLAYQNTLYVHSNRQFFTNCYIAGTVDFIFGN  415

Query  3     A  1
             +
Sbjct  416   S  416



>ref|XP_002309641.2| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|EEE93164.2| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=567

 Score =   352 bits (904),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 189/360 (53%), Positives = 240/360 (67%), Gaps = 17/360 (5%)
 Frame = -2

Query  1059  RYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTK---  889
             +YPDLC SS+++    +  ++   +     +  TI  A+ N   + K   + T+Y+K   
Sbjct  62    KYPDLCSSSISTLSGAAVTLKVPMNDFLGQINITIDAAQHNMVALSK--NNGTSYSKLDD  119

Query  888   REKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDG  709
             R+K A  DC    D  +  L   L D+  +P+KK  V    +LKT +S+  TN+ +CLDG
Sbjct  120   RQKKALNDCYGNYDMVVTDLKMVLADVNFHPNKKPAV----NLKTRLSSCATNENSCLDG  175

Query  708   FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV----E  541
             FSH K D+  RK +F G ++V   C+  L +I      D    +K + NRKLKE     E
Sbjct  176   FSHSKKDNAVRKELFAGLIYVSGKCTGALQMITGEPTADTATGLKTT-NRKLKEGNDSNE  234

Query  540   GGCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKA  361
             GG EW   LS  DRRL Q ++ TP+VVVAADGSGNY+TVS AV  AP  SSKRY+IRIKA
Sbjct  235   GGAEW---LSVTDRRLFQLSSLTPDVVVAADGSGNYKTVSAAVAAAPKYSSKRYIIRIKA  291

Query  360   GTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITF  181
             G Y+ENV+V K K+NIMF+GDGR  T+ITG+RNVI GSTT++SATVAVVG+ FLARDITF
Sbjct  292   GVYRENVEVTKEKSNIMFLGDGRKTTIITGSRNVIGGSTTYHSATVAVVGQGFLARDITF  351

Query  180   QNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             QNTAG SK QAVALRV SD +AFY C M  YQ+TLYVHSNRQF+  C I+GT+DFIFGNA
Sbjct  352   QNTAGPSKYQAVALRVESDFAAFYKCGMLGYQNTLYVHSNRQFFRNCFIAGTIDFIFGNA  411



>ref|XP_011069392.1| PREDICTED: pectinesterase-like, partial [Sesamum indicum]
Length=398

 Score =   346 bits (887),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 194/243 (80%), Gaps = 1/243 (0%)
 Frame = -2

Query  729  QETCLDGFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLK  550
            QE+CLDGFSH KAD   R+ +  GQ HV +L SN +++I+N+TDT+      +S  R+L 
Sbjct  1    QESCLDGFSHDKADKVVRRALVIGQTHVFRLVSNVMAIIKNLTDTEIAKNSYSSPERRLG  60

Query  549  EVEGGCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIR  370
            E +   EWPEWLSAGDRRLLQ++  TP+V VAADGSGN+RTVS AV  AP   S+RYVIR
Sbjct  61   E-DTNSEWPEWLSAGDRRLLQASKVTPDVTVAADGSGNFRTVSAAVAAAPEGRSRRYVIR  119

Query  369  IKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARD  190
            IKAG Y+ENV++P+ KTN+MF+GDGR  T+ITGNRNV+DGSTTFNSATVAVVG+RFLARD
Sbjct  120  IKAGVYRENVEIPRRKTNLMFVGDGRMTTIITGNRNVVDGSTTFNSATVAVVGDRFLARD  179

Query  189  ITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIF  10
            ITFQN+AG SK QAVALRV +DL AFY C M AYQDTLYVHS RQFY  C I GT+DFIF
Sbjct  180  ITFQNSAGPSKHQAVALRVNADLCAFYRCNMLAYQDTLYVHSLRQFYTGCNIVGTIDFIF  239

Query  9    GNA  1
            GNA
Sbjct  240  GNA  242



>ref|XP_006385197.1| hypothetical protein POPTR_0003s00980g [Populus trichocarpa]
 gb|ERP62994.1| hypothetical protein POPTR_0003s00980g [Populus trichocarpa]
Length=572

 Score =   351 bits (901),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 189/360 (53%), Positives = 245/360 (68%), Gaps = 10/360 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYPDLCYS+  S P+ S      K VI  ++  TI    + +    + ++ST + TK++
Sbjct  61    TRYPDLCYSAATSFPDASGG--DPKAVILKNINATIDAINSKKIKANR-ILSTEDLTKQQ  117

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIV--AHADDLKTLMSAAMTNQETCLDG  709
             K A  DC +  D +L  L      L   P+   +   ++A++L T +S+  +N+++C DG
Sbjct  118   KTALEDCRKNYDNSLADLENVWGALERNPNNHFLQQQSYAENLTTKVSSCKSNEDSCFDG  177

Query  708   FSHCKADHNARKPIFN-GQVHVEKLCSNCLSLIRNMT-DTDA-QNEIKASGNRKLKEVEG  538
             FSH       R  + +  +    K+CSN L+LI+ +  DT A  N +K + +RKLKE + 
Sbjct  178   FSHSWLSRKLRDIVRDPSEDDAGKMCSNTLALIKKLIEDTKAIANRLKTT-SRKLKEEDD  236

Query  537   GCE-WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKA  361
               E WPEWLS  DRRL  S+  TP+VVVAADGSG YRTVS AV  AP  S+KRY+I+IKA
Sbjct  237   SDEGWPEWLSVTDRRLFLSSLLTPDVVVAADGSGKYRTVSAAVAAAPKHSAKRYIIKIKA  296

Query  360   GTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITF  181
             G Y+ENV+VP  KTNIMF+GDGR KT+IT +RNV+DG TT++SATVAVVG+ FLARDITF
Sbjct  297   GVYRENVEVPSEKTNIMFLGDGRKKTIITASRNVVDGGTTYHSATVAVVGQGFLARDITF  356

Query  180   QNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             QNTAGASK QAVALRV SD +AFY C M AYQ+TLYVHSNRQF+  C I+GTVDFIFGN+
Sbjct  357   QNTAGASKYQAVALRVESDFAAFYKCGMLAYQNTLYVHSNRQFFTNCYIAGTVDFIFGNS  416



>ref|XP_002516188.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46190.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=541

 Score =   344 bits (882),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 186/342 (54%), Positives = 241/342 (70%), Gaps = 19/342 (6%)
 Frame = -2

Query  1182  FLTLLASLVLISGDMVAGVAAGEA----------NsldvsssiiksscgSTRYPDLCYSS  1033
             FL+L AS++L++   + GV AG A          N  + + +++KSSC ST YPDLC+S 
Sbjct  22    FLSLFASVLLVAA--IVGVVAGLASRRSAANTVNNVHEAAHAVVKSSCSSTLYPDLCFSE  79

Query  1032  LASTP-EVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLE  856
             +++ P +V+ K++S KDVI LSL  T          ++ L  S   Y+KRE  AF DCLE
Sbjct  80    ISALPVDVTSKIKSTKDVIHLSLNVTESSIGQTYQKIKTLTFSRRGYSKRENTAFKDCLE  139

Query  855   TIDQALFQLNTALQDLRVYPS-KKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNA  679
              + +A+ ++   +Q L+ YPS KK+I  HAD+LK L+SAAMTN E+CLDGFSH KAD   
Sbjct  140   MLTEAVNEIRNVVQVLKEYPSLKKAISEHADELKILVSAAMTNLESCLDGFSHSKADKEV  199

Query  678   RKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIK----ASGNRKLKEVEGGCEWPEWLS  511
             R+   + + H  +LCSN L++I+NMTDTD   E +    ++  RKLKE E G EWP WLS
Sbjct  200   RQFFLSDERHGHRLCSNALAMIKNMTDTDMAKEQELTSSSAAERKLKE-ENGIEWPGWLS  258

Query  510   AGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVP  331
             AGDRRLLQ+T  TPNVVVAADGSGNYRTVSEAV  APS+SS RYVIRIKAG Y+ENVD+P
Sbjct  259   AGDRRLLQATTVTPNVVVAADGSGNYRTVSEAVAAAPSRSSTRYVIRIKAGVYRENVDIP  318

Query  330   KSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGER  205
              SKTN+MF+GDG   T+ITG+R+V+ GSTTFNSATV V+G+R
Sbjct  319   SSKTNLMFVGDGSTTTIITGSRSVVGGSTTFNSATVGVLGKR  360



>ref|XP_011047961.1| PREDICTED: pectinesterase-like, partial [Populus euphratica]
Length=540

 Score =   341 bits (875),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 188/362 (52%), Positives = 248/362 (69%), Gaps = 11/362 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYPDLCYS+  S P+ S K    + VI  ++  TI    + +    K ++ST N    +
Sbjct  61    TRYPDLCYSAATSFPDDSAKSGDTEAVILSNINATIDAINSKKIEADK-ILSTKNPKDPQ  119

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIV--AHADDLKTLMSAAMTNQETCLDG  709
             K A  DC +  D +L  L+    +L+  P+K  +   ++A +L T +++  TN+++C+DG
Sbjct  120   KTALKDCRQNYDSSLADLDKVWGELKRNPNKNKLQNQSYAAELTTQVTSCKTNEDSCVDG  179

Query  708   FSHCKADHNARKPIFNG--QVHVEKLCSNCLSLIRNMT-DTDAQ--NEIKASGNRKLKEV  544
             FSH       R  +F G  + +   +CSN L+LI+ +  DTDA   N +K + +RK+KE 
Sbjct  180   FSHSSYLRIFRN-VFLGPSKENAGMMCSNALALIKKLIEDTDAAIANTLKTT-SRKVKEE  237

Query  543   EGGCEW-PEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
             +   E  PE LS  DRR+ QS+  TP+VVVAADGSG YRTVS AV  AP  S+KRY+I+I
Sbjct  238   DDSDEGRPERLSVTDRRVFQSSLLTPDVVVAADGSGKYRTVSAAVAAAPKHSAKRYIIKI  297

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             KAG Y+ENV+VP  KTNIMF+GDGR KT+IT +RNV+DG TT++SATVAVVG+ FLARDI
Sbjct  298   KAGVYRENVEVPSEKTNIMFLGDGRKKTIITSSRNVVDGGTTYHSATVAVVGQGFLARDI  357

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             TFQNTAGASK QAVALRV SD +AFY C + AYQ+TLYVHSNRQF+  C I+GTVDFIFG
Sbjct  358   TFQNTAGASKYQAVALRVESDFAAFYKCGILAYQNTLYVHSNRQFFTNCYIAGTVDFIFG  417

Query  6     NA  1
             N+
Sbjct  418   NS  419



>ref|XP_011048629.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=587

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 198/405 (49%), Positives = 267/405 (66%), Gaps = 15/405 (4%)
 Frame = -2

Query  1179  LTLLASLVLIS--GDMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEVSK  1006
             L L  SL+L++    +V  V +   N  D + SIIK SC STRYP+LCYS++A+ P  + 
Sbjct  30    LALFVSLLLVATIAAVVTPVNSQNYNKNDAAHSIIKMSCSSTRYPELCYSAIANGPGAAA  89

Query  1005  K---VRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTN---YTKREKIAFGDCLETIDQ  844
                 +  + DV+  S++   +  +TN A+++     TTN    T ++  A    ++  + 
Sbjct  90    SLAAINDENDVLTESIRAAQQAIDTNTADIE--TYKTTNKMKLTNQQNDALDASVDNNEL  147

Query  843   ALFQLNTALQDLRVYPSKKSIVAH--ADDLKTLMSAAMTNQETCLDGFSHCKADHNARKP  670
             +   L  A   L  Y ++  +       D+ T +S+ +T Q+T +DGFSH  AD   RK 
Sbjct  148   SQSDLQNAENSLLYYTNEIPLSDQDAEPDINTPLSSCITYQDTIMDGFSHTAADKQVRKD  207

Query  669   IFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE--WPEWLSAGDRR  496
             I +G  +V K+C N L++  NMT T   NE+K +  R LKE  G  E  WP+WLS  +RR
Sbjct  208   ISDGVDNVRKMCMNILAMSMNMTATRIANELKTT-KRNLKEENGRNESGWPKWLSVANRR  266

Query  495   LLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTN  316
             LLQS++ TP+VVVAADGSGNY TVS AV  AP++SSKRY+IRIKAG Y E V VP +KTN
Sbjct  267   LLQSSSLTPDVVVAADGSGNYSTVSAAVAAAPTRSSKRYIIRIKAGVYSETVQVPITKTN  326

Query  315   IMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALR  136
             +MF+GDGR KT+IT +R+V+DG T F SATVAV+GE FLARDI+FQNTAG S  QAVALR
Sbjct  327   LMFLGDGRRKTIITASRSVVDGITAFRSATVAVMGEGFLARDISFQNTAGPSGRQAVALR  386

Query  135   VGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             V SD +AFY C +  YQDTL+VH+NRQF++ CLI+GT+DFIFGN+
Sbjct  387   VSSDRAAFYKCNVLGYQDTLHVHANRQFFINCLIAGTIDFIFGNS  431



>emb|CAC18725.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=588

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 200/408 (49%), Positives = 268/408 (66%), Gaps = 20/408 (5%)
 Frame = -2

Query  1179  LTLLASLVLIS--GDMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEVSK  1006
             L L  SL+L++    +V  V +  +N    + SIIK SC STRYP+LCYS++A+ P  + 
Sbjct  30    LALFVSLLLVATLAAVVTPVNSQNSNKNGAAHSIIKMSCSSTRYPELCYSAIANGPGAAA  89

Query  1005  K---VRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTN---YTKREKIAFGDCLETIDQ  844
                 +  + DV+  S+K T +  +TN A ++     TTN    T ++  A     +  + 
Sbjct  90    SLAAINDENDVLIESIKATQQAIDTNTAGIESY--KTTNKMKLTDQQNDALDASTDNNEL  147

Query  843   ALFQLNTALQDLRVYPSKKSIVAHAD---DLKTLMSAAMTNQETCLDGFSHCKADHNARK  673
             +   L  A Q L  Y ++  +    D   D+ T +S+ +T Q+T +DGFSH  AD   RK
Sbjct  148   SQSDLQNAEQSLLYYTNEIPLSDDQDAGPDINTPLSSCITYQDTIMDGFSHTAADKEVRK  207

Query  672   PIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV----EGGCEWPEWLSAG  505
              I +G  +V K+C N L++  NMT T   NE+K +  R LKE     EGG  WP+WLS  
Sbjct  208   DISDGVDNVRKMCMNTLAMSMNMTATRTANELKTT-KRNLKEENSRNEGG--WPKWLSVA  264

Query  504   DRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKS  325
             +RRLLQS++ TP+VVVAADGSGNY TVS AV  AP++SSKRY+IRIKAG Y+E V VP +
Sbjct  265   NRRLLQSSSLTPDVVVAADGSGNYSTVSAAVAAAPTRSSKRYIIRIKAGVYRETVQVPIN  324

Query  324   KTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAV  145
             KT++MF+GDGR KT+IT +R+V+DG T F SATVA +GE FLARDI F+NTAG S  QAV
Sbjct  325   KTSLMFLGDGRRKTIITASRSVVDGITAFRSATVAAMGEGFLARDIAFENTAGPSNRQAV  384

Query  144   ALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             ALRV SD +AFY C +  YQDTL+VH+NRQF++ CLI+GTVDFIFGN+
Sbjct  385   ALRVSSDRAAFYKCNVLGYQDTLHVHANRQFFINCLIAGTVDFIFGNS  432



>ref|XP_009409132.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=568

 Score =   341 bits (874),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 188/356 (53%), Positives = 233/356 (65%), Gaps = 7/356 (2%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYP LC S+++S+P +   + S +DVI  SL  T      +  +V  L  +  N T RE
Sbjct  60    TRYPSLCVSAISSSPSLLSSISSHRDVILASLNLTASAVHRSILHVHSLSSAYANLTDRE  119

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYP--SKKSIVAHADDLKTLMSAAMTNQETCLDG  709
             + A  DCL+    +L +L     DLRV P  +K        D + L+SAAMTNQE+CLDG
Sbjct  120   RTALADCLDMFHVSLDELRRTANDLRVLPVAAKDHARPLPADPEILVSAAMTNQESCLDG  179

Query  708   FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE  529
             FSH + D   R  +     HV  +CSN LS+I+ +         K +G    KE      
Sbjct  180   FSHDQLDRRLRGSLIAELTHVMHMCSNALSMIKGLPGRGGVQRRKTTGFGVDKE-----G  234

Query  528   WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
             WP+W+   DRR + +     + VVAADG+G+Y TV EAV  APSKS KRYVIRIKAGTY 
Sbjct  235   WPKWMGEEDRRRMAAEEVAADAVVAADGTGDYSTVGEAVAAAPSKSKKRYVIRIKAGTYA  294

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV+VPK KTNIMF+GDGR  TVITG+RNV+DGSTTF SAT+AVVGE FLAR +  +NTA
Sbjct  295   ENVEVPKKKTNIMFVGDGRETTVITGSRNVVDGSTTFRSATLAVVGEGFLARGLRIENTA  354

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK QAVALRVG+DLSAFY+C++  YQDTLY+HS RQF+  CLI GTVDFIFGNA
Sbjct  355   GPSKHQAVALRVGADLSAFYDCDILGYQDTLYLHSLRQFFRGCLIQGTVDFIFGNA  410



>ref|XP_006369080.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP65649.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=623

 Score =   342 bits (877),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 199/405 (49%), Positives = 266/405 (66%), Gaps = 15/405 (4%)
 Frame = -2

Query  1179  LTLLASLVLIS--GDMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEVSK  1006
             L L  SL+L++    +V  V +  +N  D + SIIK SC STRYP+LCYS++A+ P  + 
Sbjct  66    LALFVSLLLVATIAAVVTPVNSQNSNKNDAAHSIIKMSCSSTRYPELCYSAIANGPGAAA  125

Query  1005  K---VRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTN---YTKREKIAFGDCLETIDQ  844
                 +  + DV+  S++ T +  +TN A ++     TTN    T ++  A     +  + 
Sbjct  126   SLAAINDENDVLIESIRATQQAIDTNTAGIESY--KTTNKMKLTNQQNDALDTSTDNNEL  183

Query  843   ALFQLNTALQDLRVYPSKKSIVAH--ADDLKTLMSAAMTNQETCLDGFSHCKADHNARKP  670
             +   L  A+  L  Y ++  +       D+ T +S+ +T Q+T +DGFSH  AD   RK 
Sbjct  184   SQSDLQNAINSLNYYTNEIPLSDQDTEPDINTPLSSCITYQDTIMDGFSHTAADKQVRKD  243

Query  669   IFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE--WPEWLSAGDRR  496
             I +G  +V K+C N L++  NMT T   NE+K +  R LKE     E  WP+WLS  +RR
Sbjct  244   ISDGVDNVRKMCMNTLAMNMNMTATRIANELKTT-KRNLKEENSRNESGWPKWLSVANRR  302

Query  495   LLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTN  316
             LLQS++ TP+VVVAADGSGNY TVS AV  AP++SSKRYVIRIKAG Y+E V VP +KTN
Sbjct  303   LLQSSSLTPDVVVAADGSGNYSTVSAAVAAAPTRSSKRYVIRIKAGVYRETVQVPINKTN  362

Query  315   IMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALR  136
             +MF+GDGR KT+IT +R+V+DG T F SATVA +GE FLARDI FQNTAG S  QAVALR
Sbjct  363   LMFLGDGRRKTIITASRSVVDGITAFRSATVAAMGEGFLARDIAFQNTAGPSNRQAVALR  422

Query  135   VGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             V SD +AFY C +  YQDTL+VH+NRQF++ CLI+GTVDFIFGN+
Sbjct  423   VSSDRAAFYKCNVLGYQDTLHVHANRQFFINCLIAGTVDFIFGNS  467



>ref|XP_006372149.1| hypothetical protein POPTR_0018s12530g [Populus trichocarpa]
 gb|ERP49946.1| hypothetical protein POPTR_0018s12530g [Populus trichocarpa]
Length=623

 Score =   342 bits (876),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 198/405 (49%), Positives = 266/405 (66%), Gaps = 15/405 (4%)
 Frame = -2

Query  1179  LTLLASLVLIS--GDMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEVSK  1006
             L L  SL+L++    +V  V +  +N  D + SIIK SC STRYP+LCYS++A+ P  + 
Sbjct  66    LALFVSLLLVATIAAVVTPVNSQNSNKNDAAHSIIKMSCSSTRYPELCYSAIANGPGAAA  125

Query  1005  K---VRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTN---YTKREKIAFGDCLETIDQ  844
                 +  + DV+  S++ T +  +TN A ++     TTN    T ++  A     +  + 
Sbjct  126   SLAAINDENDVLIESIRATQQAIDTNTAGIE--TYKTTNKMKLTNQQNDALDTSTDNNEL  183

Query  843   ALFQLNTALQDLRVYPSKKSIVAH--ADDLKTLMSAAMTNQETCLDGFSHCKADHNARKP  670
             +   L  A+  L  Y ++  +       D+ T +S+ +T Q+T +DGFSH  AD   RK 
Sbjct  184   SQSDLQNAINSLNYYTNEIPLSDQDTEPDINTPLSSCITYQDTIMDGFSHTAADKQVRKD  243

Query  669   IFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE--WPEWLSAGDRR  496
             I +G  +V K+C N L++  NMT T   NE+K +  R LKE     E  WP+WLS  +RR
Sbjct  244   ISDGVDNVRKMCMNTLAMNMNMTATRIANELKTT-KRNLKEENSRNESGWPKWLSVANRR  302

Query  495   LLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTN  316
             LLQS++ TP+VVVAADGSGNY TVS AV  AP++SSKRY+IRIKAG Y+E V VP +KTN
Sbjct  303   LLQSSSLTPDVVVAADGSGNYSTVSAAVAAAPTRSSKRYIIRIKAGVYRETVQVPINKTN  362

Query  315   IMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALR  136
             +MF+GDGR KT+IT +R+V+DG T F SATVA +GE FLARDI FQNTAG S  QAVALR
Sbjct  363   LMFLGDGRRKTIITASRSVVDGITAFRSATVAAMGEGFLARDIAFQNTAGPSNRQAVALR  422

Query  135   VGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             V SD +AFY C +  YQDTL+VH+NRQF++ CLI+GTVDFIFGN+
Sbjct  423   VSSDRAAFYKCNVLGYQDTLHVHANRQFFINCLIAGTVDFIFGNS  467



>ref|XP_006369081.1| hypothetical protein POPTR_0001s16280g [Populus trichocarpa]
 gb|ERP65650.1| hypothetical protein POPTR_0001s16280g [Populus trichocarpa]
Length=623

 Score =   342 bits (876),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 197/405 (49%), Positives = 265/405 (65%), Gaps = 15/405 (4%)
 Frame = -2

Query  1179  LTLLASLVLIS--GDMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEVSK  1006
             L L  SL+L++    +V  V +  +N  D + SIIK SC STRYP+LCYS++A+ P  + 
Sbjct  66    LALFVSLLLVATIAAVVTPVNSQNSNKNDAAHSIIKMSCSSTRYPELCYSAIANGPGAAA  125

Query  1005  K---VRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTN---YTKREKIAFGDCLETIDQ  844
                 +  + DV+  S++ T +  +TN A ++     TTN    T ++  A     +  + 
Sbjct  126   SLAAINDENDVLIESIRATQQAIDTNTAGIESY--KTTNKMKLTNQQNDALDTSTDNNEL  183

Query  843   ALFQLNTALQDLRVYPSKKSIVAH--ADDLKTLMSAAMTNQETCLDGFSHCKADHNARKP  670
             +   L  A+  L  Y ++  +       D+ T +S+ +T Q+T +DGFSH  AD   RK 
Sbjct  184   SQSDLQNAINSLNYYTNEIPLSDQDTEPDINTPLSSCITYQDTIMDGFSHTAADKQVRKD  243

Query  669   IFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE--WPEWLSAGDRR  496
             I +G  +V K+C N L++  NMT T   NE+K +  R LKE     E  WP+WLS  +RR
Sbjct  244   ISDGVDNVRKMCMNTLAMNMNMTATRIANELKTT-KRNLKEENSRNESGWPKWLSVANRR  302

Query  495   LLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTN  316
             LLQS++ TP+VVVAADGSGNY TVS A   AP++SSKRY+IRIKAG Y+E V VP +KTN
Sbjct  303   LLQSSSLTPDVVVAADGSGNYSTVSAAAAAAPTRSSKRYIIRIKAGVYRETVQVPINKTN  362

Query  315   IMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALR  136
             +MF+GDGR KT+IT +R+V+DG T F SATVA +GE FLARDI FQNTAG S  QAVALR
Sbjct  363   LMFLGDGRRKTIITASRSVVDGITAFRSATVAAMGEGFLARDIAFQNTAGPSNRQAVALR  422

Query  135   VGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             V SD +AFY C +  YQDTL+VH+NRQF++ CLI+GTVDFIFGN+
Sbjct  423   VSSDRAAFYKCNVLGYQDTLHVHANRQFFINCLIAGTVDFIFGNS  467



>ref|XP_011003715.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=575

 Score =   338 bits (868),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 187/362 (52%), Positives = 246/362 (68%), Gaps = 11/362 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYPDLCYS+  S P+ S K    K VI  ++  TI    + +    + ++ST N    +
Sbjct  61    TRYPDLCYSAATSFPDDSAKSGDPKAVILNNINATIDSINSKKIEADQ-ILSTKNPKDPQ  119

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIV--AHADDLKTLMSAAMTNQETCLDG  709
             K A  DC +  D +L  L+    +L+  P+K  +    +A +L T +++  TN+++C+DG
Sbjct  120   KTALKDCRQNYDSSLADLDKVWGELKRNPNKNKLQNQTYAAELTTQVTSCKTNEDSCVDG  179

Query  708   FSHCKADHNARKPIFNG--QVHVEKLCSNCLSLIRNMT-DTDAQ--NEIKASGNRKLKEV  544
             FSH       R  +F G  + +   +CSN L+LI+ +  DTDA   N +K + +RK+KE 
Sbjct  180   FSHSSYLRIFRN-VFLGPSKENAGMMCSNALALIKKLIEDTDAAIANTLKTT-SRKVKEE  237

Query  543   EGGCEW-PEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
             +   E  PE LS  DRR+  S+  TP+VVVAADGSG YRTVS AV  AP  S+KRY+I+I
Sbjct  238   DDSDEGRPERLSVTDRRVFHSSLLTPDVVVAADGSGKYRTVSAAVAAAPKHSAKRYIIKI  297

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             KAG Y+ENV+VP  KTNIMF+GDGR KT+IT +RNV+DG TT++SATVAVVG+ FLARDI
Sbjct  298   KAGVYRENVEVPSEKTNIMFLGDGRKKTIITSSRNVVDGGTTYHSATVAVVGQGFLARDI  357

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             TFQNTAGASK QAVALRV SD +AFY C + AYQ+TLYVHSNRQF+  C I+GTVDFIFG
Sbjct  358   TFQNTAGASKYQAVALRVESDFAAFYKCGILAYQNTLYVHSNRQFFTNCYIAGTVDFIFG  417

Query  6     NA  1
             N+
Sbjct  418   NS  419



>ref|XP_011039647.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=565

 Score =   337 bits (865),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/358 (49%), Positives = 234/358 (65%), Gaps = 13/358 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T+YPDLC SS+++    +  ++   +     +  +I+ A++ +  + +   +      R+
Sbjct  61    TKYPDLCSSSISTLSGAAVTLKVPMNDFLRQINISIQAAQSRKVALSR-NSTQMRLNDRQ  119

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
               A  DC    D  +  L   L  +  +P+++ +    D+LKT +S+  TN+++CLDGFS
Sbjct  120   NKALNDCCGNYDMVVTDLKQVLAAVEFHPNERQV----DNLKTRLSSCPTNEKSCLDGFS  175

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE----VEGG  535
             H   D+  RK +F     V + C+  L +I      D    +K + NRKLKE     EGG
Sbjct  176   HSHEDNKVRKKLFPDPTDVSEKCTQALKMITGEPTADTATGLKTT-NRKLKEDNDRNEGG  234

Query  534   CEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
              EW   LS  DRRL Q ++ TP+VVVAADGSGNY+TVS AV  AP  SSKRY+IRIKAG 
Sbjct  235   AEW---LSVTDRRLFQLSSLTPDVVVAADGSGNYKTVSAAVAAAPKYSSKRYIIRIKAGV  291

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y+ENV+VPK K+NIMF+GDGR  T+ITG RNV+ GSTT++SATVAV G+ FLARDITFQN
Sbjct  292   YRENVEVPKEKSNIMFLGDGRKTTIITGCRNVVGGSTTYHSATVAVEGQGFLARDITFQN  351

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             TAG SK QAVALRV SD +AFY C M  YQ+TLYVHSNRQF+  C I+GT+DFIFGNA
Sbjct  352   TAGPSKYQAVALRVESDFAAFYKCGMLGYQNTLYVHSNRQFFRNCFIAGTIDFIFGNA  409



>gb|EPS74082.1| hypothetical protein M569_00674, partial [Genlisea aurea]
Length=502

 Score =   332 bits (850),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 180/361 (50%), Positives = 230/361 (64%), Gaps = 30/361 (8%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTN-YTKR  886
             T YP+LC S++ S+P     V + +DV+  +L  T+   E N   +++     +   T R
Sbjct  9     TLYPELCVSTVGSSP----AVETAEDVMMKTLNQTVLAVERNYCTLKRTAAGKSGILTVR  64

Query  885   EKIAFGDCLETIDQALFQLN-----TALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQET  721
              + A GDC+E  + ++ +L       A   +R++    S   H + + TL+SA  TNQ T
Sbjct  65    GRNALGDCVELNEVSMEELGRCGELMAEHGMRIF----SDSGHVETILTLLSAVQTNQMT  120

Query  720   CLDGFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVE  541
             CLDG S    D N R+ +  G   V +L SN L++ RN++            N +L  +E
Sbjct  121   CLDGLS---GDENVRRLLSAGHNRVFRLASNLLAMTRNLS------------NAELPRIE  165

Query  540   GGC-EWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIK  364
                  WP WLS  DR LLQ+ + T +V VAADGSGNYRT+SEAV  APS S  R+VIRIK
Sbjct  166   QRVSRWPGWLSQADRMLLQAPSVTADVTVAADGSGNYRTISEAVSAAPSNSKTRFVIRIK  225

Query  363   AGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDIT  184
             AGTYKE V +P SK N+MF+GD    T++TG+RN IDGSTTFNSATVAVVG  FLARDIT
Sbjct  226   AGTYKEYVTIPASKQNLMFVGDSYTTTIVTGDRNYIDGSTTFNSATVAVVGTGFLARDIT  285

Query  183   FQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGN  4
             FQNTAGA+K QAVALRV +DL+AFY C + AYQDTLY HS RQFY  C ISGTVDFIFGN
Sbjct  286   FQNTAGAAKHQAVALRVNADLTAFYRCGIYAYQDTLYTHSLRQFYTNCYISGTVDFIFGN  345

Query  3     A  1
             +
Sbjct  346   S  346



>ref|XP_011039646.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=548

 Score =   327 bits (839),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 177/340 (52%), Positives = 224/340 (66%), Gaps = 10/340 (3%)
 Frame = -2

Query  1005  KVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQLN  826
             K  S K+   L +  +I  A++N   +   + ++     R+K A  DC +  D+ +  L 
Sbjct  58    KSTSSKNDFLLQVNRSIDAAQSNMVALSNKLATSKKLDVRQKTAINDCWKNNDRVVADLK  117

Query  825   TALQDLRVYPSKKSIVAHAD-DLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQVH  649
                +D++V    KS    AD DL T  ++ MT   +CLDGFSH K D   R+ + +G V 
Sbjct  118   KVFEDVKVDTKNKSPQPKADQDLNTKFASCMTGVNSCLDGFSHSKRDKKVREAL-SGIVD  176

Query  648   VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE----VEGGCEWPEWLSAGDRRLLQST  481
             V+  C   L ++ +    D    +K + NRKLKE      GG EW   LS  DRRL Q +
Sbjct  177   VKGKCQKALEMVTSKPTADMAIWLKNT-NRKLKEDSDSYGGGAEW---LSVTDRRLFQLS  232

Query  480   AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIG  301
             + TP+VVVAADGSGNY+TVS AV  AP  SSKRY+IRIKAG Y+ENV+VPK K+NIMF+G
Sbjct  233   SLTPDVVVAADGSGNYKTVSAAVAAAPKYSSKRYIIRIKAGVYRENVEVPKEKSNIMFLG  292

Query  300   DGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDL  121
             DGR  TVITG+RNV+ GSTT++SATVAV G+ FLARDITFQNTAG SK QAVALRV SD 
Sbjct  293   DGRKTTVITGSRNVVGGSTTYHSATVAVEGQGFLARDITFQNTAGPSKYQAVALRVESDF  352

Query  120   SAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             +AFY C M  YQ+TLYVHSNRQF+  C I+GT+DFIFGNA
Sbjct  353   AAFYKCGMLGYQNTLYVHSNRQFFRNCFIAGTIDFIFGNA  392



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   326 bits (835),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 180/357 (50%), Positives = 230/357 (64%), Gaps = 17/357 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YPDLC S+LA  P +S K     DVI   +  T     ++ +N    +    +   R+
Sbjct  59    TLYPDLCVSTLADIPNLSSK--PLPDVIAAVVNRTAAAVRSSASNCTSYLHRRGHMDFRQ  116

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             ++A  DCLE +DQ L  L TA+ DL    S     AH  DL+T++SAA+TNQ TCLDGF+
Sbjct  117   RLALNDCLELLDQTLDDLRTAIADLAGCNSS----AHVSDLQTVLSAAITNQYTCLDGFA  172

Query  702   HCKADHNARKPIFNGQV-HVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
             +        +P   G++ HV  L SN L++++ +       E      R    + GG  +
Sbjct  173   YVNG--GGVRPSIEGRLYHVSHLVSNSLAMVKKIRRQRRGREAFEEYGR----MSGG--F  224

Query  525   PEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             P W++  DRRLLQ+ A   +P++VVA DGSGN+ T+ EAV  AP+ S+ R+VI IKAG Y
Sbjct  225   PTWVTRKDRRLLQAAANATSPDLVVAKDGSGNFTTIGEAVAAAPNNSATRFVIYIKAGAY  284

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
              ENVDV K+K N+MFIGDG GKTV+  +RNV+DG TTF SATVAVVG+ FLARDIT +N+
Sbjct  285   FENVDVAKNKKNLMFIGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFLARDITIENS  344

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG SK QAVALRVG+DLSAFY C   AYQDTLYVHS RQFY  C + GTVDFIFGNA
Sbjct  345   AGPSKHQAVALRVGADLSAFYRCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFGNA  401



>ref|XP_011039649.1| PREDICTED: pectinesterase-like isoform X2 [Populus euphratica]
Length=548

 Score =   325 bits (833),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 176/340 (52%), Positives = 223/340 (66%), Gaps = 10/340 (3%)
 Frame = -2

Query  1005  KVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQLN  826
             K  S K+   L +  +I  A++N   +   + ++     R+K A  DC +  D+ +  L 
Sbjct  58    KSTSSKNDFLLQVNRSIDAAQSNMVALSNKLATSKKLDVRQKTAINDCWKNNDRVVADLK  117

Query  825   TALQDLRVYPSKKSIVAHAD-DLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQVH  649
                +D++V    KS    AD DL T  ++ MT   +CLDGFSH K D   R+ + +G V 
Sbjct  118   KVFEDVKVDTKNKSPQPKADQDLNTKFASCMTGVNSCLDGFSHSKRDKKVREAL-SGIVD  176

Query  648   VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE----VEGGCEWPEWLSAGDRRLLQST  481
             V+  C   L ++ +    D    +K + NRKLKE      GG EW   LS  DRRL Q +
Sbjct  177   VKGKCQKALEMVTSKPTADMAIWLKNT-NRKLKEDSDSYGGGAEW---LSVTDRRLFQLS  232

Query  480   AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIG  301
             + TP+VVVAADGSG Y+TVS AV  AP  SSKRY+IRIKAG Y+ENV+VPK K+NIMF+G
Sbjct  233   SLTPDVVVAADGSGTYKTVSAAVAAAPKYSSKRYIIRIKAGVYRENVEVPKEKSNIMFLG  292

Query  300   DGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDL  121
             DGR  TVITG+RNV+ GSTT++SATVAV G+ FLARDITFQNTAG SK QAVALRV SD 
Sbjct  293   DGRKTTVITGSRNVVGGSTTYHSATVAVEGQGFLARDITFQNTAGPSKYQAVALRVESDF  352

Query  120   SAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             +AFY C M  YQ+TLYVHSNRQF+  C I+GT+DFIFGNA
Sbjct  353   AAFYKCGMLGYQNTLYVHSNRQFFRNCFIAGTIDFIFGNA  392



>ref|XP_011039648.1| PREDICTED: pectinesterase-like isoform X1 [Populus euphratica]
Length=548

 Score =   325 bits (833),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 175/340 (51%), Positives = 223/340 (66%), Gaps = 10/340 (3%)
 Frame = -2

Query  1005  KVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQLN  826
             K  S K+   L +  +I  A++N   +   + ++     R+K A  DC +  D+ +  L 
Sbjct  58    KSTSSKNDFLLQVNRSIDAAQSNMVALSNKLATSKKLDVRQKTAINDCWKNNDRVVADLK  117

Query  825   TALQDLRVYPSKKSIVAHAD-DLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQVH  649
                +D++V    KS    AD DL T  ++ MT   +CLDGFSH K D   R+ + +G V 
Sbjct  118   KVFEDVKVDTKNKSPQPKADQDLNTKFASCMTGVNSCLDGFSHSKRDKKVREAL-SGIVD  176

Query  648   VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE----VEGGCEWPEWLSAGDRRLLQST  481
             V+  C   L ++ +    D    +K + NRKLKE      GG EW   LS  DRRL Q +
Sbjct  177   VKGKCQKALEMVTSKPTADMAIWLKNT-NRKLKEDSDSYGGGAEW---LSVTDRRLFQLS  232

Query  480   AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIG  301
             + TP+VVVAADGSG Y+TVS AV  AP  SSKRY+IRIKAG Y+ENV+VPK K+NIMF+G
Sbjct  233   SLTPDVVVAADGSGTYKTVSAAVAAAPKYSSKRYIIRIKAGVYRENVEVPKEKSNIMFLG  292

Query  300   DGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDL  121
             DGR  T+ITG+RNV+ GSTT++SATVAV G+ FLARDITFQNTAG SK QAVALRV SD 
Sbjct  293   DGRKTTIITGSRNVVGGSTTYHSATVAVEGQGFLARDITFQNTAGPSKYQAVALRVESDF  352

Query  120   SAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             +AFY C M  YQ+TLYVHSNRQF+  C I+GT+DFIFGNA
Sbjct  353   AAFYKCGMLGYQNTLYVHSNRQFFRNCFIAGTIDFIFGNA  392



>ref|XP_006387527.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP46441.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=542

 Score =   325 bits (832),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 230/346 (66%), Gaps = 18/346 (5%)
 Frame = -2

Query  1017  EVSKKVRS--QKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQ  844
             + +K V+S  QK+   L +  +I  A++N+  + K +  +     R++ A  DC E  D+
Sbjct  52    DYAKLVKSTFQKNDFLLQVNRSIDAAQSNKVALSKKLAKSMKLDVRQRTAINDCWENNDR  111

Query  843   ALFQLNTALQDLRVYPSKKSIVAHAD-DLKTLMSAAMTNQETCLDGFSHCKADHNARKPI  667
              +  L       +V+ + K    +AD DL T  ++ MT   +CLDGFSH K D   R+ +
Sbjct  112   VVTDLK------KVFGNVKVDTTNADQDLNTKFASCMTGVNSCLDGFSHSKQDKKVREAL  165

Query  666   FNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE----VEGGCEWPEWLSAGDR  499
              +  + V   C+  L +I++    D    +K + NRKLKE     EGG EW   LS  DR
Sbjct  166   -SDLIDVRGNCTKALEMIKSKPTADTATGLKTT-NRKLKEDSDSNEGGAEW---LSVTDR  220

Query  498   RLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKT  319
             RL Q ++ TP+VVVAADGSGNY+TVS AV  AP  SSKRY+IRIKAG Y+ENV+VPK K+
Sbjct  221   RLFQLSSLTPDVVVAADGSGNYKTVSAAVAAAPKYSSKRYIIRIKAGVYRENVEVPKEKS  280

Query  318   NIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVAL  139
             NIMF+GDGR  T+ITG+RNV+ GSTT++SATVAV G+ FLARDITFQNTAG SK QAVAL
Sbjct  281   NIMFLGDGRKTTIITGSRNVVGGSTTYHSATVAVEGQGFLARDITFQNTAGPSKYQAVAL  340

Query  138   RVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             RV SD +AFY C M  YQ+TLYVHSNRQF+  C I+GT+DFIFGNA
Sbjct  341   RVESDFAAFYKCGMLGYQNTLYVHSNRQFFRNCFIAGTIDFIFGNA  386



>ref|XP_006382081.1| hypothetical protein POPTR_0006s27270g [Populus trichocarpa]
 gb|ERP59878.1| hypothetical protein POPTR_0006s27270g [Populus trichocarpa]
Length=542

 Score =   324 bits (830),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 229/346 (66%), Gaps = 18/346 (5%)
 Frame = -2

Query  1017  EVSKKVRS--QKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQ  844
             + +K V+S  QK+   L +  +I  A++N+  + K +  +     R++ A  DC E  D+
Sbjct  52    DYAKLVKSTFQKNDFLLQVNRSIDAAQSNKVALSKKLAKSMKLDVRQRTAINDCWENNDR  111

Query  843   ALFQLNTALQDLRVYPSKKSIVAHAD-DLKTLMSAAMTNQETCLDGFSHCKADHNARKPI  667
              +  L       +V+   K    +AD DL T  ++ MT   +CLDGFSH K D   R+ +
Sbjct  112   VVTDLK------KVFGKVKVDTTNADQDLNTKFASCMTGVNSCLDGFSHSKQDKKVREAL  165

Query  666   FNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE----VEGGCEWPEWLSAGDR  499
              +  + V   C+  L +I++    D    +K + NRKLKE     EGG EW   LS  DR
Sbjct  166   -SDLIDVRGNCTKALEMIKSKPTADTATGLKTT-NRKLKEDNDSNEGGTEW---LSVTDR  220

Query  498   RLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKT  319
             RL Q ++ TP+VVVAADGSGNY+TVS AV  AP  SSKRY+IRIKAG Y+ENV+VPK K+
Sbjct  221   RLFQLSSLTPDVVVAADGSGNYKTVSAAVAAAPKYSSKRYIIRIKAGVYRENVEVPKEKS  280

Query  318   NIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVAL  139
             NIMF+GDGR  T+ITG+RNV+ GSTT++SATVAV G+ FLARDITFQNTAG SK QAVAL
Sbjct  281   NIMFLGDGRKTTIITGSRNVVGGSTTYHSATVAVEGQGFLARDITFQNTAGPSKYQAVAL  340

Query  138   RVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             RV SD +AFY C M  YQ+TLYVHSNRQF+  C I+GT+DFIFGNA
Sbjct  341   RVESDFAAFYKCGMLGYQNTLYVHSNRQFFRNCFIAGTIDFIFGNA  386



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   322 bits (824),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 175/366 (48%), Positives = 239/366 (65%), Gaps = 20/366 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T +P+LC SS+AS   +S K     +++E +++  I   E  +A+V++L     ++  R+
Sbjct  70    TLHPELCVSSIASYGGLSSKA-DHMEIVESAVRVGIGAVEKAKAHVRRLSRPGLDF--RQ  126

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             + A  DC+E  D  L +L   L DL+   +  S+  +ADDLKTL+S A+TNQ TCLDGF 
Sbjct  127   RGALKDCMEMFDDTLEELQDTLTDLQ-NATFMSLPKYADDLKTLLSGAITNQYTCLDGFH  185

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMT----------DTDAQNEIKASGNRKL  553
              CK   + R+ +    +++  L SN L+++ N +          D+ +    +   N  +
Sbjct  186   LCKG--HLRQDLNAELLNISHLVSNSLAMVCNFSQQANLALGNADSLSDRRRRLLSNDFM  243

Query  552   KEVEGGCEWPEWLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKSSKRY  379
                + G  +P W+SAGDRRLLQ+ A     N VVA DGSG+Y T+S AV  AP KS+ RY
Sbjct  244   SSDDHG--FPSWMSAGDRRLLQTPAQNINANAVVAKDGSGSYTTISAAVAAAPEKSTSRY  301

Query  378   VIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFL  199
             VI IK G Y+ENVD+PK+K N+MFIGDG+  TV+T NRNV+DG TTF+SAT AV G+ F+
Sbjct  302   VIHIKKGVYQENVDIPKNKHNLMFIGDGKDVTVVTANRNVVDGYTTFHSATAAVTGKGFV  361

Query  198   ARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVD  19
             ARD+TF+NTAG +K QAVALRVGSDLSAF  C  + YQDTLYVHS RQFY +C + GTVD
Sbjct  362   ARDMTFKNTAGPTKHQAVALRVGSDLSAFLRCTFEGYQDTLYVHSLRQFYRECDVYGTVD  421

Query  18    FIFGNA  1
             F+FGNA
Sbjct  422   FVFGNA  427



>gb|ABG46324.1| putative pectin methylesterase [Picea abies]
Length=393

 Score =   315 bits (807),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 236/358 (66%), Gaps = 20/358 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+ C SS++S P +SK+     +++++ +K  + IA   +AN +   +S     +R+
Sbjct  41    TLYPEFCVSSVSSFPGLSKRP-GPMEILKVVVK--LSIAAVEKANARARRLSRPGLDQRQ  97

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             + A  DC E  D+ L +L + L DL+   +  SI   A DL+TL+SAA+TNQ TC+D F+
Sbjct  98    RGALQDCFELFDETLDELYSTLSDLK-NKTFISIPQSASDLETLLSAAITNQYTCIDSFT  156

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIK---ASGNRKLKEVEGGC  532
             HCK   N ++ +  G  ++  L SN L++++N++  +A N  +   ++ NR+L   +   
Sbjct  157   HCKG--NLKQSLLGGLRNISHLVSNSLAMVKNIS-AEASNLARRTVSNQNRRLLSDQSDP  213

Query  531   EW--------PEWLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKSSKR  382
              +        P W+SAGDRRLLQ++  T  PN VVA DGSGNY  ++EAV+ AP KS  R
Sbjct  214   NFMPMDSDGFPSWMSAGDRRLLQTSTGTVKPNAVVAKDGSGNYTNITEAVEAAPEKSKTR  273

Query  381   YVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERF  202
             YVI IKAG Y ENV++ K KTN+MFIGDG   TV+TGNRNV +  TTF SATVAV+G+ F
Sbjct  274   YVIHIKAGVYAENVELHKKKTNLMFIGDGMDVTVVTGNRNVKENFTTFRSATVAVLGKGF  333

Query  201   LARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISG  28
             +ARD+TF+NTAGA+K QAVALRVGSDLSAFY C  K YQDTLY HS RQFY +  I G
Sbjct  334   IARDMTFENTAGAAKHQAVALRVGSDLSAFYRCSFKGYQDTLYAHSLRQFYREWHIYG  391



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   320 bits (820),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 236/356 (66%), Gaps = 13/356 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S+++S P+++ K  +  D+I  ++++T+    T+ +N     +        +
Sbjct  60    TLYPELCVSTVSSFPDLASK--TIPDIISATVQHTVNEVRTSASNCTGJRMKRRTLDPLQ  117

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             ++A  DCLE +D+ + +L +AL DL     K S   H +DL TL+SAAMTN+ TCLDGF 
Sbjct  118   QMALDDCLELLDETVAELKSALSDLS---PKNSPSRHYNDLGTLLSAAMTNEYTCLDGFV  174

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWP  523
             H K   N R+ I  G  ++    SN L++++ +  ++  +  KA    +   + GG  +P
Sbjct  175   HSKG--NVREEIKQGLYNISHSVSNSLAMLKKIPKSNRSS--KAEVFPEYGRMVGG--FP  228

Query  522   EWLSAGDRRLLQSTAATP--NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
              W+S  DR+LLQ++  T   ++VVA DGSGN+ T+S+AV  AP+ ++ R+VI IKAG Y 
Sbjct  229   RWVSPRDRKLLQASTNTTKFDLVVAKDGSGNFTTISDAVAAAPNSTTTRFVIYIKAGAYF  288

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENVDV K KT +MF+GDG GKTV+  NR+V+DG TTF SATVAVVG  F+ARD+TF+N+A
Sbjct  289   ENVDVDKKKTMLMFVGDGIGKTVVKANRSVVDGWTTFRSATVAVVGNGFIARDMTFENSA  348

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G +K QAVALR GSDLSAFY C    YQDTLYVHS RQFY  C I GTVDFIFGNA
Sbjct  349   GPNKHQAVALRSGSDLSAFYRCSFVGYQDTLYVHSLRQFYRDCDIYGTVDFIFGNA  404



>ref|XP_010096537.1| Pectinesterase 3 [Morus notabilis]
 gb|EXB64657.1| Pectinesterase 3 [Morus notabilis]
Length=362

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 181/339 (53%), Positives = 228/339 (67%), Gaps = 24/339 (7%)
 Frame = -2

Query  1182  FLTLLASLVLISGDMVAGVAAG---------EANsldvsssiiksscgSTRYPDLCYSSL  1030
             F+ L A+LV+++   V G+AAG          A+    + +++KS+C STRYPDLCYS++
Sbjct  25    FIALFATLVVVAA--VIGIAAGVNSRKSSVSAAHIDGATHAVLKSACSSTRYPDLCYSAV  82

Query  1029  ASTPEVS--KKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLE  856
             A++      KKV + KDVI LS+  TI   + N  +++KL       TKREK A  DCLE
Sbjct  83    AASASSGGSKKVSNLKDVIGLSVNITITAVQENYFSIKKLT-KRKGLTKREKTALHDCLE  141

Query  855   TIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNAR  676
             TID+ L +L+    DL  YP+ KS+  HADD  TL+S+A+TNQETCLDGFSH KAD + R
Sbjct  142   TIDETLDELHEVQDDLEQYPNTKSLKQHADDFLTLLSSAITNQETCLDGFSHDKADEHVR  201

Query  675   KPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEG-------GCEWPEW  517
               +  G+ HVEKLCSN L++I+NMTDTD   E K +G RKL+E  G       G  WP W
Sbjct  202   DALIKGEEHVEKLCSNVLAMIKNMTDTDIATERKTAG-RKLQEDHGVAGTEVDGEGWPVW  260

Query  516   LSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVD  337
             +SA DRRLLQS++ TPNVVVA DGSG Y   + AV  AP  S  RYVIRIKAG Y+ENVD
Sbjct  261   MSAADRRLLQSSSVTPNVVVAKDGSGGY--TAAAVAAAPDNSKTRYVIRIKAGVYRENVD  318

Query  336   VPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVA  220
             V K K NIMF+GDGR  T+IT +RNV+DGSTTFNSATV 
Sbjct  319   VSKKKKNIMFLGDGRTTTIITASRNVVDGSTTFNSATVG  357



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   317 bits (813),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 174/358 (49%), Positives = 228/358 (64%), Gaps = 15/358 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYT--K  889
             T YPDLC S+L++ P++  K  S  +VI  ++  +      +  N  K +    NYT   
Sbjct  63    TLYPDLCASTLSTIPDLHSK--SLPEVICATINASEAAVIKSAKNCTKYL-HHHNYTLDT  119

Query  888   REKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDG  709
             R++ A  DCL+   Q L +L  A  DL   P      +H D ++TL+SAA+TNQ TCLDG
Sbjct  120   RQRYALTDCLDLFSQTLDELLDATSDLTANPG-----SHVDHVQTLLSAAITNQYTCLDG  174

Query  708   FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE  529
             F++   D   R  I     HV  L SN L++++ +      +  + +     +  EG   
Sbjct  175   FAYVGKDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQKPPHPRREALEGYGEVAEG---  231

Query  528   WPEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
             +P W+S  DRRLLQ+ A   TPN++VA DGSGN+ T+SEAV  APSKS  R+VI IKAG 
Sbjct  232   FPVWVSGKDRRLLQAAANTTTPNLIVAKDGSGNFTTISEAVAAAPSKSETRFVIYIKAGA  291

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y ENV+V KS+TN+MF+GDG GKTV+  +RNV+DG TTF SATVA+VG  FL RD+T +N
Sbjct  292   YLENVEVGKSQTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIEN  351

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             +AG SK QAVALRVG+DLSAFY C    YQDTLY HS RQFY +C + GT+DFIFGNA
Sbjct  352   SAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNA  409



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   317 bits (812),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 174/358 (49%), Positives = 228/358 (64%), Gaps = 15/358 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYT--K  889
             T YPDLC S+L++ P++  K  S  +VI  ++  +      +  N  K +    NYT   
Sbjct  63    TLYPDLCASTLSTIPDLHSK--SLPEVICATINASEXAVIKSAKNCTKYL-HHHNYTLDT  119

Query  888   REKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDG  709
             R++ A  DCL+   Q L +L  A  DL   P      +H D ++TL+SAA+TNQ TCLDG
Sbjct  120   RQRYALTDCLDLFSQTLDELLDATSDLTANPG-----SHVDHVQTLLSAAITNQYTCLDG  174

Query  708   FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE  529
             F++   D   R  I     HV  L SN L++++ +      +  + +     +  EG   
Sbjct  175   FAYVGKDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQKPXHPRREALEGYGEVAEG---  231

Query  528   WPEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
             +P W+S  DRRLLQ+ A   TPN++VA DGSGN+ T+S+AV  APSKS  R+VI IKAG 
Sbjct  232   FPVWVSGKDRRLLQAAANTTTPNLIVAKDGSGNFTTISDAVAAAPSKSETRFVIYIKAGA  291

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y ENV+V KSKTN+MF+GDG GKTV+  +RNV+DG TTF SATVA+VG  FL RD+T +N
Sbjct  292   YLENVEVGKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIEN  351

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             +AG SK QAVALRVG+DLSAFY C    YQDTLY HS RQFY +C + GT+DFIFGNA
Sbjct  352   SAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNA  409



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   317 bits (811),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 174/358 (49%), Positives = 228/358 (64%), Gaps = 15/358 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYT--K  889
             T YPDLC S+L++ P++  K  S  +VI  ++  +      +  N  K +    NYT   
Sbjct  62    TLYPDLCASTLSTIPDLHSK--SLPEVICATINASEGAVIKSAKNCTKYL-HHHNYTLDT  118

Query  888   REKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDG  709
             R++ A  DCL+   Q L +L  A  DL   P      +H D ++TL+SAA+TNQ TCLDG
Sbjct  119   RQRYALTDCLDLFSQTLDELLDATSDLTANPG-----SHVDHVQTLLSAAITNQYTCLDG  173

Query  708   FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE  529
             F++   D   R  I     HV  L SN L++++ +      +  + +     +  EG   
Sbjct  174   FAYVGKDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQKPPHPRREALEGYGEVAEG---  230

Query  528   WPEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
             +P W+S  DRRLLQ+ A   TPN++VA DGSGN+ T+S+AV  APSKS  R+VI IKAG 
Sbjct  231   FPVWVSGKDRRLLQAAANTTTPNLIVAKDGSGNFTTISDAVAAAPSKSETRFVIYIKAGA  290

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y ENV+V KSKTN+MF+GDG GKTV+  +RNV+DG TTF SATVA+VG  FL RD+T +N
Sbjct  291   YLENVEVGKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIEN  350

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             +AG SK QAVALRVG+DLSAFY C    YQDTLY HS RQFY +C + GT+DFIFGNA
Sbjct  351   SAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNA  408



>ref|XP_010534985.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=589

 Score =   317 bits (811),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 173/363 (48%), Positives = 235/363 (65%), Gaps = 12/363 (3%)
 Frame = -2

Query  1053  PDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIA  874
             PDLC+S ++S      K+ SQKDVI   L   +  A  +  +V+ ++++ ++   + ++A
Sbjct  70    PDLCFSVVSSASSGGYKLTSQKDVIAAILNAAVAAARRSYVDVESVIMARSDIPAKTEVA  129

Query  873   FGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCK  694
                CLETI+  L  L  A +  R+YP+K+++   A DL  L+S+AMT QETCLDGFS   
Sbjct  130   VNVCLETIELGLEDLRDAAEAFRLYPTKENLQRQAHDLNILISSAMTYQETCLDGFSGDP  189

Query  693   ADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQN-EIKASGNRK---LKEV-EGGCE  529
              D   R+   +  + VE+L S  L +I++MT+TD  N E K+  +     +KEV E   E
Sbjct  190   FDKLVREIFSDSLIKVERLSSIILHMIKSMTETDIANFEPKSRTSTTPDLIKEVTETAAE  249

Query  528   -----WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIK  364
                  WP WLS  DRR L+S+   P+ VVAADGSG++  V+EAV+ AP+ S  RYVI+IK
Sbjct  250   VVGDGWPWWLSEKDRRFLESSEIKPDAVVAADGSGDFTMVAEAVEAAPNNSKVRYVIKIK  309

Query  363   AGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNV--IDGSTTFNSATVAVVGERFLARD  190
             AG Y+E V VP  K  +M +GDGR  T+ITGN +V      +TFNSATV V G+ FLARD
Sbjct  310   AGVYREIVRVPSKKKMLMLVGDGRLNTIITGNLSVGGTPNMSTFNSATVVVTGDHFLARD  369

Query  189   ITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIF  10
             ITF+NTAG +  QAVA+R+G+D SAFY C   AYQDTLYVHS RQF+  C ++GTVDFIF
Sbjct  370   ITFENTAGPANAQAVAIRLGADHSAFYRCGFSAYQDTLYVHSKRQFFRNCFVAGTVDFIF  429

Query  9     GNA  1
             GN+
Sbjct  430   GNS  432



>ref|XP_002523113.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF39298.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=557

 Score =   313 bits (803),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 230/356 (65%), Gaps = 13/356 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S+L+S P+++   RS + +I  ++  T+     + +N   +        K E
Sbjct  56    TLYPELCVSTLSSLPDLT--YRSLQQLISSTISRTMYEVRVSYSNCSGIKNKLRKLNKIE  113

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             ++A  DCLE   + + +LN A+ DL    S+KS+  H  DL+TL+S AMTNQ TCLDGF+
Sbjct  114   RVALNDCLELFTETMDELNVAISDLT---SRKSVSQHHHDLQTLLSGAMTNQYTCLDGFA  170

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWP  523
             + +     RK I N   ++ +  SN L++++ +   +A  E +A    +  EV+ G  +P
Sbjct  171   YSRG--RVRKTIKNSLYNISRHVSNSLAMLKKIPGVNASKESEAF--PEYGEVKHG--FP  224

Query  522   EWLSAGDRRLLQST--AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
              WLS+ D  LLQ+   A   ++VVA DG+GN+ T+S+AV  AP+ S  R+VI IK G Y 
Sbjct  225   SWLSSKDLELLQAPLNATKFDLVVAKDGTGNFSTISQAVAAAPNSSLTRFVIYIKEGAYF  284

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENVDV K KTN+MFIGDG GKTV+  NR+V+ G TTF SATVAVVG  F+A+ ITF+N+A
Sbjct  285   ENVDVDKKKTNLMFIGDGIGKTVVKANRSVVGGWTTFRSATVAVVGNGFVAKGITFENSA  344

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G    QAVALR GSDLSAFY C    YQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  345   GPDMHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNA  400



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   314 bits (804),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 177/356 (50%), Positives = 231/356 (65%), Gaps = 12/356 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S+L+S P+++ K  SQ  +I  ++  T+K  E + +N   +  +       E
Sbjct  81    TLYPELCVSTLSSFPDLTSKTISQ--MISSTVNYTVKEVEISASNCTDIRKNLKAQDPLE  138

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             + A  DCLE  D+ + +L TAL DL     K S   H +DL+TL+SAAMTNQ TCLDG S
Sbjct  139   QRALDDCLELFDETISELQTALSDLS---PKSSPSKHYNDLQTLLSAAMTNQYTCLDGLS  195

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWP  523
                 +   R+ I     ++  L SN L+++  M    A + +K     +  ++ G   +P
Sbjct  196   -LGNEQVIREEIKQNLNNISHLVSNSLAMLTKMPK--AADTLKDEVFPEYGKMAG--RFP  250

Query  522   EWLSAGDRRLLQSTAATP--NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
              W+S  DR+LLQ++  T   ++VVA DGSGN+RT+ EAV  AP+ S+ R+VI IKAGTY 
Sbjct  251   GWVSPKDRKLLQASTNTMKFDLVVAKDGSGNFRTIGEAVAAAPNSSATRFVIYIKAGTYF  310

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENVDV K KT +MF+GDG GKTV+  +RNV+DG TTF SATVAVVG  F+ARD+T +N A
Sbjct  311   ENVDVGKKKTMLMFVGDGIGKTVVKASRNVVDGWTTFRSATVAVVGNGFIARDMTIENAA  370

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK QAVALR GSDLSAFY C    YQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  371   GPSKHQAVALRSGSDLSAFYRCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNA  426



>gb|AAL24278.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
Length=388

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 158/232 (68%), Positives = 180/232 (78%), Gaps = 19/232 (8%)
 Frame = -2

Query  639  LCSNCLSLIRNMTDTDAQN-EIKA---SGNRKLKE----------VEGGCE-----WPEW  517
            +CSN L++I+NMTDTD  N E KA   S NRKLKE          + G  E     WP W
Sbjct  1    MCSNALAMIKNMTDTDIANFEQKAKITSNNRKLKEENQETTVAVDIAGAGELDSEGWPTW  60

Query  516  LSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVD  337
            LSAGDRRLLQ +    +  VAADGSG ++TV+ AV  AP  S+KRYVI IKAG Y+ENV+
Sbjct  61   LSAGDRRLLQGSGVKADATVAADGSGTFKTVAAAVAAAPENSNKRYVIHIKAGVYRENVE  120

Query  336  VPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASK  157
            V K K NIMF+GDGR +T+ITG+RNV+DGSTTF+SATVA VGERFLARDITFQNTAG SK
Sbjct  121  VAKKKKNIMFMGDGRTRTIITGSRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSK  180

Query  156  EQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             QAVALRVGSD SAFYNC+M AYQDTLYVHSNRQF+VKCLI+GTVDFIFGNA
Sbjct  181  HQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGNA  232



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   312 bits (799),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 228/356 (64%), Gaps = 13/356 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YPDLC S+++  P+++ K  +  ++I+ +L  T+     + AN   +     +Y+KRE
Sbjct  59    TLYPDLCVSTISVLPDLASK--TLPELIQATLNQTMYEVRLSSANCTGIEKRIKSYSKRE  116

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             + A  DCLE  D  L +L  AL DL   P K ++  +  DL+T +SAAMTNQ TCLDGF+
Sbjct  117   EAAINDCLELFDDTLEELKVALADLA--PKKLAVSRNYHDLQTFLSAAMTNQYTCLDGFA  174

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWP  523
               K   N R  I  G  ++    SN L +++ +   +           +LK       +P
Sbjct  175   RSKG--NVRNIIKKGLHNITHHVSNSLVMLKKVPGVNKSKSEYFPQQGRLKN-----GFP  227

Query  522   EWLSAGDRRLLQSTAATP--NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
              WLS  DR LLQ++      +++VA DG+GN+ T+++AV  AP+ S+ R+VI IKAG+Y 
Sbjct  228   SWLSRQDRILLQASVNETEFDLIVAKDGTGNFTTINDAVAAAPNNSNTRFVIYIKAGSYF  287

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV+V K K  +MF+GDG GKTV+  NRNV+DG TTF SATVAVVGE F+A+ ITF+N+A
Sbjct  288   ENVEVVKKKKMLMFVGDGIGKTVVKANRNVVDGFTTFRSATVAVVGEGFIAKGITFENSA  347

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK QAVALR GSDLSAFY C   AYQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  348   GPSKHQAVALRSGSDLSAFYKCSFVAYQDTLYVHSLRQFYRECDIYGTVDFIFGNA  403



>gb|KHN15840.1| Pectinesterase/pectinesterase inhibitor U1 [Glycine soja]
Length=362

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 176/213 (83%), Gaps = 7/213 (3%)
 Frame = -2

Query  639  LCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQSTAATPNVV  460
            +CSN L++ +NMTD      ++ S NRKL  VE G EWPEW+SA DRRLL++     +V 
Sbjct  1    MCSNALAMTKNMTD-----GLRIS-NRKLL-VENGVEWPEWISAADRRLLEAATVKADVT  53

Query  459  VAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTV  280
            VAADGSG+++TV+EAVK AP KSSKRYVIRIK G Y+ENV+V K KTNIMF+GDGR  T+
Sbjct  54   VAADGSGDFKTVTEAVKAAPLKSSKRYVIRIKGGVYRENVEVDKKKTNIMFLGDGRTNTI  113

Query  279  ITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCE  100
            IT +RNV+DGSTTF+SATVAVVG  FLARDITFQNTAG SK QAVALRVG DLSAF+NC+
Sbjct  114  ITASRNVVDGSTTFHSATVAVVGANFLARDITFQNTAGPSKHQAVALRVGGDLSAFFNCD  173

Query  99   MKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
              A+QDTLYVH+NRQF+VKCLI+GTVDFIFGN+
Sbjct  174  FLAFQDTLYVHNNRQFFVKCLITGTVDFIFGNS  206



>emb|CBI27741.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   303 bits (776),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 175/211 (83%), Gaps = 6/211 (3%)
 Frame = -2

Query  618  LIRNMTDTDAQNEIKASGNRKLKEVEGGCE-----WPEWLSAGDRRLLQSTAATPNVVVA  454
            +I+N+TDTD      A+G R+L+E E         WPEWLSAGDRRLLQ++  T +V VA
Sbjct  1    MIKNLTDTDMAAAASAAG-RQLREEEEEATATAIEWPEWLSAGDRRLLQASTVTADVTVA  59

Query  453  ADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVIT  274
            ADGSGNY+TV EAV +AP +SSKRY+IRIKAG YKENV+VPK KTNIMF+GDGR  T+IT
Sbjct  60   ADGSGNYKTVGEAVASAPERSSKRYIIRIKAGVYKENVEVPKKKTNIMFVGDGRTNTIIT  119

Query  273  GNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMK  94
             +RNV+DGSTTF+SATVAVVG+ FLARDITFQNTAG SK QAVALRVGSDLSAFY C++ 
Sbjct  120  ASRNVVDGSTTFHSATVAVVGDGFLARDITFQNTAGPSKHQAVALRVGSDLSAFYRCDVL  179

Query  93   AYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
            AYQDTLYVHS RQF+V CL++GTVDFIFGNA
Sbjct  180  AYQDTLYVHSLRQFFVGCLVAGTVDFIFGNA  210



>gb|ACN40984.1| unknown [Picea sitchensis]
Length=601

 Score =   310 bits (795),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 172/365 (47%), Positives = 235/365 (64%), Gaps = 19/365 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRAN-VQKLVVSTTNYTKR  886
             T YP+LC SS++S P +S +     +++ + L  ++ IA   +AN + +++ +    + R
Sbjct  88    TLYPELCVSSVSSFPGLSDRA-GPIEIVHVVL--SVSIAAVEKANALARIMWTRPGLSHR  144

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             ++ A  DCLE  D+ L +L   + +L+   S  S     +DL+TL+SAA+TNQ TCLD  
Sbjct  145   KRGALQDCLELFDETLDELYETVSNLK-NGSCMSAPEKVNDLETLLSAAITNQYTCLD--  201

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
                 A  N R+ +  G + +  L SN L++++N+    +   + +  NR+L   + G E+
Sbjct  202   --SSARSNLRQELQGGLMSISHLVSNSLAIVKNIATRASNVTVNSIHNRRLLSDDQGSEF  259

Query  525   --------PEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYV  376
                     P W+SA +R LLQS+     PN VVA DGSG++ ++ +AV  AP KS  RYV
Sbjct  260   MAMESDGFPSWMSAKERSLLQSSRDNIMPNAVVAKDGSGHHTSIGDAVNAAPQKSRTRYV  319

Query  375   IRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLA  196
             I IKAG Y ENV+V K KT++MFIGDG G TV+ GNRNV DG TT+ SATVAV G  F+A
Sbjct  320   IHIKAGIYWENVEVNKKKTHLMFIGDGIGATVVAGNRNVKDGYTTYRSATVAVNGNGFIA  379

Query  195   RDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDF  16
             RDITF+NTAGA+K QAVALRVGSD SAFY C  + YQDTLYVHS RQFY +C + GTVDF
Sbjct  380   RDITFENTAGAAKHQAVALRVGSDFSAFYRCSFQGYQDTLYVHSLRQFYRECNVYGTVDF  439

Query  15    IFGNA  1
             IFGNA
Sbjct  440   IFGNA  444



>gb|AHB84678.1| pectin methylesterase [Citrus reticulata]
Length=569

 Score =   307 bits (786),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 233/359 (65%), Gaps = 19/359 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEV-SKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             T YP+LC S+L S P++ SK+V    ++I +++  T+     + +N   +  S  N+   
Sbjct  67    TLYPELCVSTLLSVPDLASKRV---PELISVTINRTLSELRASSSNCSSIGQSYPNFNTL  123

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             EK A  DCLE     + +L +AL DL     KKS   H  DL+TL S AMTNQ TCLDGF
Sbjct  124   EKRAINDCLELFHDTIVELKSALNDLS---PKKSPSKHYHDLQTLFSGAMTNQYTCLDGF  180

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMT--DTDAQNEIKASGNRKLKEVEGGC  532
             ++  +D N R+ I +   ++ +  SN L +++ +   +  ++ E+     R    ++ G 
Sbjct  181   AY--SDGNVREVIKSSLYNISRHVSNSLVMLKKIPGDNMSSKYEVFPEYGR----IKRG-  233

Query  531   EWPEWLSAGDRRLLQSTAATP--NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
              +P WLS  DR+LLQ +      +++VA DGSGN+ T++EAV+ AP+KS+ R+VI IKAG
Sbjct  234   -FPTWLSLNDRKLLQKSVNLTKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFVIYIKAG  292

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              Y ENV+V K KT +MF+GDG GKT++  NR+V+DG TTF SATVAVVG  F+A+ IT +
Sbjct  293   AYFENVEVDKKKTMLMFVGDGIGKTLVKANRSVVDGWTTFRSATVAVVGTGFIAKGITVE  352

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             N+AG SK QAVALR GSDLSAFY C    YQDTLYVHS RQFY +C + GTVDFIFGNA
Sbjct  353   NSAGPSKHQAVALRSGSDLSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGNA  411



>gb|ABK24761.1| unknown [Picea sitchensis]
Length=557

 Score =   306 bits (784),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 168/356 (47%), Positives = 228/356 (64%), Gaps = 17/356 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP++CY SL  +P +       K ++ ++L   ++ A    A V + V  T+      
Sbjct  59    TLYPEICYYSL--SPHLGSSPAQPKKLLHVALMIALEEANKAFALVLRFVKQTS------  110

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
               A  DC+E +D    QL++++  L+ +  K  +   A DL+T +SA++TNQ+TCLDG S
Sbjct  111   --ALQDCMELMDITRDQLDSSIALLKRHDLKALMREQASDLQTWLSASITNQDTCLDGIS  168

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWP  523
                +   AR  + N   +V KL SN L++ +   ++        S   +L       ++P
Sbjct  169   D-YSKSIARALVENSVQNVRKLISNSLAIAKAAYESRPY----PSPALRLPSDSIKDDFP  223

Query  522   EWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
              WLS GDRRLL+++A    PNV+VA DGSGN++T+++A+  AP KS KRYVI++K GTYK
Sbjct  224   SWLSPGDRRLLRTSANDVVPNVIVAQDGSGNFKTITQAIAAAPEKSPKRYVIKVKKGTYK  283

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV V K+KTNIM IG+G   T++TG+RNVIDGSTTFNSAT A VG  F+A+D+ F NTA
Sbjct  284   ENVQVGKTKTNIMLIGEGMEATIVTGSRNVIDGSTTFNSATFAAVGNGFMAQDMAFVNTA  343

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G  K QAVALRVGSD S  Y C++ AYQDTLY HS RQFY +C ISGTVDFIFGNA
Sbjct  344   GPQKHQAVALRVGSDQSVLYRCKIAAYQDTLYAHSLRQFYRECKISGTVDFIFGNA  399



>emb|CBI27756.3| unnamed protein product [Vitis vinifera]
Length=537

 Score =   305 bits (782),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/362 (44%), Positives = 236/362 (65%), Gaps = 17/362 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP LC+++L+S P  SK   +   ++E+++  T+     + ++++ L  +  +   +E
Sbjct  69    TLYPSLCFTTLSSAPATSKNTTTLHHILEIAVNATVSSVMDSGSDIKALF-TYQDLNSQE  127

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHA-DDLKTLMSAAMTNQETCLDGF  706
             K A  DC+E  DQ L++L  A+ DL  +P           +LKTL+SAAMTN+ TC+DGF
Sbjct  128   KNALNDCMEMTDQTLYELGQAIDDLHAFPPSIGDPHRLYTNLKTLLSAAMTNENTCIDGF  187

Query  705   SHCK-ADHNARKPIFNGQVH-----VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV  544
             +  + AD  ++K +  G +      +  + SNCL++I+ M +T A  + K       ++ 
Sbjct  188   TDLEEADSESQKGL-KGHLQSVLTPISGMISNCLAIIKYM-ETIALRDRKIMNTTMPRD-  244

Query  543   EGGCEWPEWLSAGDRRLLQSTAAT-PNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
                 E+P W++A DR+L++      P++VVA+DGSG++ T+ EA+  AP+KSS R+VI+I
Sbjct  245   ----EFPAWMTAIDRKLIEMVPKIRPDIVVASDGSGHFSTIGEAISTAPNKSSNRFVIKI  300

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             KAG YKENV++P+ K NIM +G+G   TVITG+++ +DG +TF SAT+ VVG++FLARD+
Sbjct  301   KAGVYKENVEIPREKVNIMLVGEGMNSTVITGSKSFVDGFSTFTSATLTVVGDKFLARDL  360

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             T  NTAG  K QAVA+RV S+ SAFY C   +YQDTLY HS RQFY +C I GT+DFIFG
Sbjct  361   TIINTAGPEKHQAVAVRVTSN-SAFYRCNFSSYQDTLYAHSLRQFYRECTIQGTIDFIFG  419

Query  6     NA  1
             NA
Sbjct  420   NA  421



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   305 bits (781),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 170/358 (47%), Positives = 229/358 (64%), Gaps = 19/358 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S+L S P+++ K  S  + I  +L  T+     + AN    + +       E
Sbjct  59    TLYPELCVSTLVSLPDLASK--SLPEFISATLNKTMDEVRASSANCNA-IRNKIKLGPLE  115

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K+A  DC+E  D  + +L +A+ DL     +KS   H  DL+TL+S AMTNQ TCLDGF+
Sbjct  116   KVALKDCIELFDDTIAELKSAISDL---APRKSTSKHYHDLQTLLSGAMTNQYTCLDGFA  172

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNM--TDTDAQNEIKASGNRKLKEVEGGCE  529
               K     RK I  G  ++    SN L++++ +   +T         GN     V+ G  
Sbjct  173   RSKG--KVRKAIKKGLYNISHHVSNSLAMLKKIPGVNTSKSEVFPEYGN-----VKHG--  223

Query  528   WPEWLSAGDRRLLQSTA-ATP-NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
             +P WLS+ DR+LLQ++A AT  +++VA DG+GN+ T+SEAV+ AP+ S  R+VI IKAG 
Sbjct  224   FPSWLSSKDRKLLQASANATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIYIKAGA  283

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y ENV+V + K  ++FIGDG GKTV+   R+V+DG TTF SATVAVVG+ F+A+ ITF+N
Sbjct  284   YFENVEVERKKKMLVFIGDGIGKTVVKAKRSVVDGWTTFRSATVAVVGDGFIAKGITFEN  343

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             +AG SK QAVALR GSDLSAFY C    YQDTLYVHS RQFY +C + GT+DFIFGNA
Sbjct  344   SAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGNA  401



>ref|XP_006444399.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
 gb|ESR57639.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
Length=548

 Score =   304 bits (779),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 231/359 (64%), Gaps = 19/359 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEV-SKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             T YP+LC S+L S P++ SK+V    ++I +++  T+     + +N   +  S  N+   
Sbjct  46    TLYPELCVSTLLSVPDLASKRV---PELISVTINRTLSELRASSSNCSSIGQSYPNFNTL  102

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             EK A  DCLE     + +L +AL DL     KK    H  DL+TL S AMTNQ TCLDGF
Sbjct  103   EKRAINDCLELFHDTIVELKSALNDLS---PKKLPSKHYHDLQTLFSGAMTNQYTCLDGF  159

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMT--DTDAQNEIKASGNRKLKEVEGGC  532
             ++  +D N R  I +   ++ +  SN L +++ +   +  ++ E+     R    ++ G 
Sbjct  160   AY--SDGNVRDVIKSSLYNISRHVSNSLVMLKKIPGDNMSSKYEVFPEYGR----IKRG-  212

Query  531   EWPEWLSAGDRRLLQSTAATP--NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
              +P WLS  DR+LLQ +      +++VA DGSGN+ T++EAV+ AP+KS+ R+VI IKAG
Sbjct  213   -FPTWLSLNDRKLLQKSVNLTKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFVIYIKAG  271

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              Y ENV+V K KT +MF+GDG GKTV+  NR+V+DG TTF SATVAVVG  F+A+ IT +
Sbjct  272   AYFENVEVDKKKTMLMFVGDGIGKTVVKANRSVVDGWTTFRSATVAVVGTGFIAKGITVE  331

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             N+AG SK QAVALR GSDLSAFY C    YQDTLYVHS RQFY +C + GTVDFIFGNA
Sbjct  332   NSAGPSKHQAVALRSGSDLSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGNA  390



>ref|XP_002277473.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=582

 Score =   305 bits (781),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 158/362 (44%), Positives = 236/362 (65%), Gaps = 17/362 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP LC+++L+S P  SK   +   ++E+++  T+     + ++++ L  +  +   +E
Sbjct  72    TLYPSLCFTTLSSAPATSKNTTTLHHILEIAVNATVSSVMDSGSDIKALF-TYQDLNSQE  130

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHA-DDLKTLMSAAMTNQETCLDGF  706
             K A  DC+E  DQ L++L  A+ DL  +P           +LKTL+SAAMTN+ TC+DGF
Sbjct  131   KNALNDCMEMTDQTLYELGQAIDDLHAFPPSIGDPHRLYTNLKTLLSAAMTNENTCIDGF  190

Query  705   SHCK-ADHNARKPIFNGQVH-----VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV  544
             +  + AD  ++K +  G +      +  + SNCL++I+ M +T A  + K       ++ 
Sbjct  191   TDLEEADSESQKGL-KGHLQSVLTPISGMISNCLAIIKYM-ETIALRDRKIMNTTMPRD-  247

Query  543   EGGCEWPEWLSAGDRRLLQSTAAT-PNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
                 E+P W++A DR+L++      P++VVA+DGSG++ T+ EA+  AP+KSS R+VI+I
Sbjct  248   ----EFPAWMTAIDRKLIEMVPKIRPDIVVASDGSGHFSTIGEAISTAPNKSSNRFVIKI  303

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             KAG YKENV++P+ K NIM +G+G   TVITG+++ +DG +TF SAT+ VVG++FLARD+
Sbjct  304   KAGVYKENVEIPREKVNIMLVGEGMNSTVITGSKSFVDGFSTFTSATLTVVGDKFLARDL  363

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             T  NTAG  K QAVA+RV S+ SAFY C   +YQDTLY HS RQFY +C I GT+DFIFG
Sbjct  364   TIINTAGPEKHQAVAVRVTSN-SAFYRCNFSSYQDTLYAHSLRQFYRECTIQGTIDFIFG  422

Query  6     NA  1
             NA
Sbjct  423   NA  424



>ref|XP_006480001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Citrus sinensis]
Length=569

 Score =   305 bits (780),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 231/359 (64%), Gaps = 19/359 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEV-SKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             T YP+LC S+L S P++ SK+V    ++I +++  T+     + +N   +  S  N+   
Sbjct  67    TLYPELCVSTLLSVPDLASKRV---PELISVTINRTLSELRASSSNCSSIGQSYPNFNTL  123

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             EK A  DCLE     + +L +AL DL     KK    H  DL+TL S AMTNQ TCLDGF
Sbjct  124   EKRAINDCLELFHDTIVELKSALNDLS---PKKLPSKHYHDLQTLFSGAMTNQYTCLDGF  180

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMT--DTDAQNEIKASGNRKLKEVEGGC  532
             ++  +D N R  I +   ++ +  SN L +++ +   +  ++ E+     R    ++ G 
Sbjct  181   AY--SDGNVRDVIKSSLYNISRHVSNSLVMLKKIPGDNMSSKYEVFPEYGR----IKRG-  233

Query  531   EWPEWLSAGDRRLLQSTAATP--NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
              +P WLS  DR+LLQ +      +++VA DGSGN+ T++EAV+ AP+KS+ R+VI IKAG
Sbjct  234   -FPTWLSLNDRKLLQKSVNLTKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFVIYIKAG  292

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              Y ENV+V K KT +MF+GDG GKTV+  NR+V+DG TTF SATVAVVG  F+A+ IT +
Sbjct  293   AYFENVEVDKKKTMLMFVGDGIGKTVVKANRSVVDGWTTFRSATVAVVGTGFIAKGITVE  352

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             N+AG SK QAVALR GSDLSAFY C    YQDTLYVHS RQFY +C + GTVDFIFGNA
Sbjct  353   NSAGPSKHQAVALRSGSDLSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGNA  411



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   304 bits (778),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 167/356 (47%), Positives = 231/356 (65%), Gaps = 15/356 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S+L S P+++ K  S ++ I  +L  T+     + A+    + +       E
Sbjct  59    TLYPELCVSTLVSLPDLASK--SLQEFISATLNKTMDEVRASSADCNA-IRNKMKLGPLE  115

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K+A  DC+E  D  + +L +A+ +L +   +K    H  DL+TL+S AMTNQ TCLDGF+
Sbjct  116   KVALKDCIELFDDTIAELKSAISNLAL---RKPTSKHYHDLQTLLSGAMTNQYTCLDGFA  172

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWP  523
               K     RK I  G  ++    SN L++++ +   +A    K+    +   V+ G  +P
Sbjct  173   RSKG--KVRKAIKKGLYNISHHVSNSLAMLKKIPGVNAS---KSEVFPEYGNVKHG--FP  225

Query  522   EWLSAGDRRLLQSTA-ATP-NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
              WLS  DR+LLQ++A AT  +++VA DG+GN+ T+SEAV+ AP+ S  R+VI IKAG Y 
Sbjct  226   SWLSTKDRKLLQASANATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIHIKAGAYF  285

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV+V + K  ++FIGDG GKTV+  NR+V+DG TTF SATVAVVG+ F+A+ ITF+N+A
Sbjct  286   ENVEVERKKKMLVFIGDGIGKTVVKANRSVVDGWTTFRSATVAVVGDGFIAKGITFENSA  345

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK QAVALR GSDLSAFY C    YQDTLYVH+ RQFY +C I GT+DFIFGNA
Sbjct  346   GPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHTLRQFYRECDIYGTIDFIFGNA  401



>ref|XP_009771845.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=561

 Score =   304 bits (778),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 175/362 (48%), Positives = 230/362 (64%), Gaps = 14/362 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP LC S+L+  P + +K  +  ++I  ++  TI   + +  N  K++   +     E
Sbjct  46    TLYPQLCISTLSLIPNLHQK--TIPEIISSTVNATIDEVKGSTENCTKILHKMSKLDPIE  103

Query  882   KIAFGDCLETI-DQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             K A  DC+E + D  + +LNT L DL    +  S   H +DL+TL+SAAMTNQ+TCL GF
Sbjct  104   KRALDDCIELLGDSTISELNTTLYDLST-KNHNSPYKHYNDLQTLLSAAMTNQDTCLSGF  162

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV--EGGC  532
                K  HN R  + +    +E+  SN L++++ +   ++      S +   KEV  E G 
Sbjct  163   DDSK--HNLRHYVEHNLHTIEQHVSNSLAMLKKL-KPESAPGSSISSSSNSKEVFPEYGA  219

Query  531   E---WPEWLSAGDRRLLQST--AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
                 +P+WL   DR LLQ+       ++VVA DGSGN+RT++EA+  AP+ SS R+VI I
Sbjct  220   MKNGYPKWLKKKDRTLLQAPINQIKFDLVVAKDGSGNFRTINEALSAAPTSSSTRFVIYI  279

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             KAGTY E +DV + K+ IMF+GDG GKT I GNRNV+DG TTF SATVAVVG  F+AR I
Sbjct  280   KAGTYSEYIDVERKKSMIMFVGDGIGKTQIKGNRNVVDGWTTFRSATVAVVGNGFIARGI  339

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             TF+N AG SK QAVALR GSDLSAFY C   AYQDTLYVHS RQFY +C + GTVDFIFG
Sbjct  340   TFENFAGPSKHQAVALRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFG  399

Query  6     NA  1
             NA
Sbjct  400   NA  401



>dbj|BAD95369.1| pectin methylesterase like protein [Arabidopsis thaliana]
Length=381

 Score =   296 bits (757),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 174/225 (77%), Gaps = 19/225 (8%)
 Frame = -2

Query  618  LIRNMTDTDAQN-EIKA---SGNRKLKE----------VEGGCE-----WPEWLSAGDRR  496
            +I+NMTDTD  N E KA   S NRKLKE          + G  E     WP WLSAGDRR
Sbjct  1    MIKNMTDTDIANFEQKAKITSNNRKLKEENQETTVAVDIAGAGELDSEGWPTWLSAGDRR  60

Query  495  LLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTN  316
            LLQ +    +  VAADGSG ++TV+ AV  AP  S+KRYVI IKAG Y+ENV+V K K N
Sbjct  61   LLQGSGVKADATVAADGSGTFKTVAAAVAAAPENSNKRYVIHIKAGVYRENVEVAKKKKN  120

Query  315  IMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALR  136
            IMF+GDGR +T+ITG+RNV+DGSTTF+SATVA VGERFLARDITFQNTAG SK QAVALR
Sbjct  121  IMFMGDGRTRTIITGSRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALR  180

Query  135  VGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
            VGSD SAFYNC+M AYQDTLYVHSNRQF+VKCLI+GTVDFIFGNA
Sbjct  181  VGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGNA  225



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score =   301 bits (771),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 229/366 (63%), Gaps = 18/366 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNT-IKIAETNRANVQKLVVSTTNYTKR  886
             T YP+LC S+LA+ P++ KK     DVI  ++  T +++A+   +N    +    +   R
Sbjct  46    TLYPELCLSTLATVPDLHKK--PLPDVICATVNRTEVEVADM-ASNCSSFLQQGKSLPPR  102

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             +++A  DC+E +   + +L     DL+  PS  + V   D + T++S A+TNQ TCL GF
Sbjct  103   DRVAIADCIELLGTTMDELQATTSDLQ-QPSNGATVV--DHVMTVLSGAITNQHTCLSGF  159

Query  705   SHCKADHN-----ARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVE  541
             ++    +      AR  +  G  H+ ++ SN L++ + M  T   +   +   ++ +   
Sbjct  160   TYHGPRNGGQVSLARPYMEPGIRHISRMVSNTLAMAKKMRSTKPNSPSPSVQVQRRQPFT  219

Query  540   GGCE----WPEWLSAGDRRLLQSTAA--TPNVVVAADGSGNYRTVSEAVKNAPSKSSKRY  379
             G  +    +P W+  GDRRLLQ+ A+  T N VVA DGSG Y TVS AV  AP+ S  RY
Sbjct  220   GYGQMVKGFPRWVRPGDRRLLQAAASGITANAVVAKDGSGGYTTVSAAVTAAPANSKSRY  279

Query  378   VIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFL  199
             VI IKAG Y ENV+V K++ N+MFIGDG GKTVI  +RNV+DG TTF SATVAVVG  F+
Sbjct  280   VIYIKAGAYLENVEVGKNQKNLMFIGDGIGKTVIKASRNVVDGYTTFRSATVAVVGNNFI  339

Query  198   ARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVD  19
             ARD+T +N+AG SK QAVALRVG+DLSAFY C    YQDTLYVHS RQF+  C + GTVD
Sbjct  340   ARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDVYGTVD  399

Query  18    FIFGNA  1
             F+FGN+
Sbjct  400   FVFGNS  405



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 169/358 (47%), Positives = 228/358 (64%), Gaps = 19/358 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S+L S  +++ K  S  + I  +L  T+     + AN    + +       E
Sbjct  59    TLYPELCVSTLVSLSDLASK--SLPEFISATLNKTMDEVRASSANCNA-IRNKIKLGPLE  115

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K+A  DC+E  D  + +L +A+ DL     +KS   H  DL+TL+S AMTNQ TCLDGF+
Sbjct  116   KVALKDCIELFDDTIAELKSAISDL---APRKSTSKHYHDLQTLLSGAMTNQYTCLDGFA  172

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNM--TDTDAQNEIKASGNRKLKEVEGGCE  529
               K     RK I  G  ++    SN L++++ +   +T         GN     V+ G  
Sbjct  173   RSKG--KVRKAIKKGLYNISHHVSNSLAMLKKIPGVNTSKSEVFPEYGN-----VKHG--  223

Query  528   WPEWLSAGDRRLLQSTA-ATP-NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
             +P WLS+ DR+LLQ++A AT  +++VA DG+GN+ T+SEAV+ AP+ S  R+VI IKAG 
Sbjct  224   FPSWLSSKDRKLLQASANATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIYIKAGA  283

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y ENV+V + K  ++FIGDG GKTV+   R+V+DG TTF SATVAVVG+ F+A+ ITF+N
Sbjct  284   YFENVEVERKKKMLVFIGDGIGKTVVKAKRSVVDGWTTFRSATVAVVGDGFIAKGITFEN  343

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             +AG SK QAVALR GSDLSAFY C    YQDTLYVHS RQFY +C + GT+DFIFGNA
Sbjct  344   SAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGNA  401



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   297 bits (761),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 166/356 (47%), Positives = 219/356 (62%), Gaps = 12/356 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YPDLC S+L++ P++  K  S  +VI  S+  T         N    +        R+
Sbjct  65    TLYPDLCVSTLSTIPDLHAK--SLPEVICASVNTTAAAVRNAAKNCTNFLHRRGYLDPRQ  122

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             ++A  DCL+   Q L +L  A              AH DD++T++SAA+TNQ TCLDGF+
Sbjct  123   RLAVTDCLDLFSQTLDELGAASAA-----LAADPAAHVDDVQTVLSAAITNQYTCLDGFA  177

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWP  523
             +       R  I     HV  L SN L++++ +    A    + +     +  EG   +P
Sbjct  178   YVGRGGGYRPAIERRLYHVSHLVSNSLAMVKRIRRRRASRPRRGALEGYGEVSEG---FP  234

Query  522   EWLSAGDRRLLQST--AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
              W+SA DR+LLQ+   A  P++ VA DGSGN+ T+S+AV  AP+ +  R+VI +KAG Y 
Sbjct  235   AWVSAKDRKLLQAPTNATIPDLEVAKDGSGNFTTISDAVAAAPNNTDTRFVIYVKAGAYF  294

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV+V KSKTN++ IGDG GKTV+  +R+V+DG TTF SATVAVVG+ FL RDIT +N A
Sbjct  295   ENVEVGKSKTNLLLIGDGIGKTVVKASRSVVDGWTTFRSATVAVVGDGFLMRDITIENAA  354

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK QAVALRVG+DLSAFY C    YQDTLYVHS RQFY +C + GTVDFIFGNA
Sbjct  355   GPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFYRECNVYGTVDFIFGNA  410



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score =   294 bits (752),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 171/360 (48%), Positives = 224/360 (62%), Gaps = 13/360 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP LC S+L+  P + KK  S  ++I  ++  T+   +++  N   ++   +     E
Sbjct  53    TLYPKLCISTLSLIPNLHKK--SIPEIISSNVNVTMNEVKSSAENCSNILHHMSKLDPIE  110

Query  882   KIAFGDCLETI-DQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             K A  DC+E + D  + +L T L DL    S  S + H +DL+TL+S AMTNQ+TCL+G 
Sbjct  111   KRALDDCIELLGDTTIDELQTTLNDLSTKNSSNSPLKHYNDLQTLLSGAMTNQDTCLEGI  170

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE---VEGG  535
                K+ H   + I      +    SN L++++ +  T +     ++ N    E   ++ G
Sbjct  171   H--KSKHKLSQYIEKNLHTISHHVSNSLAMLKKL-KTGSSQGSSSNSNEVFPEYGTMKNG  227

Query  534   CEWPEWLSAGDRRLLQST--AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKA  361
               +P+WL   DR LLQ+       N+VVA DGSGN+ T++ A+  AP+ SS R+VI IKA
Sbjct  228   --YPKWLQKKDRTLLQAPLNQIKFNLVVAKDGSGNFTTINAALSAAPNSSSTRFVIYIKA  285

Query  360   GTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITF  181
             GTY E +DV + K+ IMFIGDG GKTVI GNRNV+DG TTF SATVAVVG  FLAR ITF
Sbjct  286   GTYFEYIDVERKKSMIMFIGDGIGKTVIKGNRNVVDGWTTFRSATVAVVGNGFLARGITF  345

Query  180   QNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             +N AG SK QAVALR GSDLSAFY C   AYQDTLYVHS RQFY  C + GTVDFIFGNA
Sbjct  346   ENYAGPSKHQAVALRSGSDLSAFYQCSFIAYQDTLYVHSLRQFYRDCDVYGTVDFIFGNA  405



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   295 bits (754),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 166/359 (46%), Positives = 228/359 (64%), Gaps = 19/359 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YPDLC S+L S P+++ K  +  ++I   + +TI     + +N   L        K E
Sbjct  100   TLYPDLCVSTLTSFPDLTSK--TVPEMIRSVVNHTIYEVTLSSSNCSSLRKKLPGLNKLE  157

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVA-HADDLKTLMSAAMTNQETCLDGF  706
             K A  DCL   D+ + +L T ++DL    S+ +I +    D +T +S AMTN  TCLDGF
Sbjct  158   KRALDDCLNLFDETVEELKTTVKDL----SQSTIGSKRYHDSQTFLSGAMTNLYTCLDGF  213

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQ--NEIKASGNRKLKEVEGGC  532
             ++ K   N R  I  G + +  L SN L++++ + +   Q  NE+      K+K+     
Sbjct  214   AYSKG--NVRDRIEEGVLEISHLVSNSLAMLKKVPEKKKQSKNEVFPEYG-KMKD-----  265

Query  531   EWPEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
              +P W+S  DR+LLQ+       ++VVA DGSGN+ T+  AV  AP+ S+ R+VI IKAG
Sbjct  266   GFPSWVSPNDRKLLQAAVNETKFDLVVAKDGSGNFTTIGAAVAAAPNSSATRFVIHIKAG  325

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              Y ENV+V + K+N+M++GDG GKTV+  +RNV+DG TTF SATVAVVG+ F+A+ ITF+
Sbjct  326   AYFENVEVIRKKSNLMWVGDGIGKTVVKASRNVVDGWTTFQSATVAVVGDGFIAKGITFE  385

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             N+AG SK QAVALR G+DLSAFY C   AYQDTLYVHS RQFY +C + GTVDFIFGNA
Sbjct  386   NSAGPSKHQAVALRSGADLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFGNA  444



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 170/363 (47%), Positives = 229/363 (63%), Gaps = 19/363 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S+LA  P++ KK     DVI  ++  T     T  AN    +    + + R+
Sbjct  58    TLYPELCLSTLADIPDLHKK--PLPDVICAAVNRTETEVTTMSANCSGYL-RERSLSGRD  114

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPS--KKSIVAHADDLKTLMSAAMTNQETCLDG  709
              +A  DC+E ++  + +L     DL   PS  ++  + HA    T++SAA+TNQ+TCL+G
Sbjct  115   HLAVTDCMELLETTMEELVATTADLES-PSAARRPTMDHA---MTVLSAAITNQQTCLEG  170

Query  708   FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKL-----KEV  544
             FS+ K     R+ +  G +H+ K+ SN L++ + +      +  + S  R+      + V
Sbjct  171   FSYQKGGE-VRRYMEPGILHIAKMVSNSLAMAKKLPGATKPSSTERSVARQPFTGYGQVV  229

Query  543   EGGCEWPEWLSAGDRRLLQSTAA--TPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIR  370
             +GG  +P W+  GDRRLLQ+ A+    N VVA DGSG + TVS AV  AP+ S  RYVI 
Sbjct  230   KGG--FPRWVRPGDRRLLQAPASGIKANAVVAKDGSGGFTTVSAAVAAAPTNSQSRYVIY  287

Query  369   IKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARD  190
             IKAG Y ENV+V K+  N+MF+GDG GKTVI  + NV+DGSTTF SATVAVVG  FLARD
Sbjct  288   IKAGAYMENVEVGKNHKNLMFMGDGMGKTVIKASLNVVDGSTTFRSATVAVVGNNFLARD  347

Query  189   ITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIF  10
             +T +N AG SK QAVALRVG+DLSAFY C    YQDTLYVHS RQF+ +C I GT+DF+F
Sbjct  348   LTIENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGTIDFVF  407

Query  9     GNA  1
             GN+
Sbjct  408   GNS  410



>ref|XP_004136014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=561

 Score =   293 bits (750),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 166/359 (46%), Positives = 230/359 (64%), Gaps = 16/359 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNT---IKIAETNRANVQKLVVSTTNYT  892
             T +PDLC+S L+S P+++    S + +   +L  T   + +A TN  N++  + S  N T
Sbjct  55    TLFPDLCFSKLSSFPQLAS--LSPEKLAGSALNFTSREVLLAYTNCTNLKTHLYSGLNPT  112

Query  891   KREKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLD  712
              R   A  DCLE +D ++ +L  ++ DL   PS+ S   H+ DL TL+SAAMTN  TC+D
Sbjct  113   DRH--ALDDCLELLDGSIAELKASIFDLA--PSQ-SPALHSHDLLTLVSAAMTNHRTCVD  167

Query  711   GFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGC  532
             GF +      +R  ++ G++   +  S  L++++ +   +    +      +   V+GG 
Sbjct  168   GFYNSSGTVRSRVELYLGKI--GQHLSIDLAMLKKIPGVNRATGVDQEMLPEYGAVKGG-  224

Query  531   EWPEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
              +P+W+S  DRRLLQ+       N+VVA DGSGN+ TVSEAV  AP+ S+ R+VI IKAG
Sbjct  225   -FPKWVSVKDRRLLQAAVNETKFNMVVAKDGSGNFTTVSEAVAAAPNASTTRFVIYIKAG  283

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              Y ENV++ ++K+N+MF+GDG GKT+I  +RNV+DG TTF SATVAVVG  F+A+ ITF+
Sbjct  284   AYFENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGTGFIAKGITFE  343

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             N AG SK QAVALR  SD SAFY C    YQDTLYVHS RQFY  C + GT+DFIFGNA
Sbjct  344   NYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRDCDVYGTIDFIFGNA  402



>gb|KGN44975.1| Pectinesterase [Cucumis sativus]
Length=614

 Score =   293 bits (750),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 164/357 (46%), Positives = 228/357 (64%), Gaps = 12/357 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKN-TIKIAETNRANVQKLVVSTTNYTKR  886
             T +PDLC+S L+S P+++     +     L+  +  + +A TN  N++  + S  N T R
Sbjct  108   TLFPDLCFSKLSSFPQLASLSPEKLAGSALNFTSREVLLAYTNCTNLKTHLYSGLNPTDR  167

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
                A  DCLE +D ++ +L  ++ DL   PS+ S   H+ DL TL+SAAMTN  TC+DGF
Sbjct  168   H--ALDDCLELLDGSIAELKASIFDLA--PSQ-SPALHSHDLLTLVSAAMTNHRTCVDGF  222

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
              +      +R  ++ G++   +  S  L++++ +   +    +      +   V+GG  +
Sbjct  223   YNSSGTVRSRVELYLGKI--GQHLSIDLAMLKKIPGVNRATGVDQEMLPEYGAVKGG--F  278

Query  525   PEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             P+W+S  DRRLLQ+       N+VVA DGSGN+ TVSEAV  AP+ S+ R+VI IKAG Y
Sbjct  279   PKWVSVKDRRLLQAAVNETKFNMVVAKDGSGNFTTVSEAVAAAPNASTTRFVIYIKAGAY  338

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
              ENV++ ++K+N+MF+GDG GKT+I  +RNV+DG TTF SATVAVVG  F+A+ ITF+N 
Sbjct  339   FENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGTGFIAKGITFENY  398

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG SK QAVALR  SD SAFY C    YQDTLYVHS RQFY  C + GT+DFIFGNA
Sbjct  399   AGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRDCDVYGTIDFIFGNA  455



>ref|XP_004171768.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=591

 Score =   292 bits (747),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 164/357 (46%), Positives = 228/357 (64%), Gaps = 12/357 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKN-TIKIAETNRANVQKLVVSTTNYTKR  886
             T +PDLC+S L+S P ++     +     L+  +  + +A TN  N++  + S  N T R
Sbjct  85    TLFPDLCFSKLSSFPLLASLSPEKLAGSALNFTSREVLLAYTNCTNLKTHLYSGLNPTDR  144

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
                A  DCLE +D ++ +L  ++ DL   PS+ S   H+ DL TL+SAAMTN  TC+DGF
Sbjct  145   H--ALDDCLELLDGSIAELKASIFDLA--PSQ-SPALHSHDLLTLVSAAMTNHRTCVDGF  199

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
              +      +R  ++ G++   +  S  L++++ +   +    +      +   V+GG  +
Sbjct  200   YNSSGTVRSRVELYLGKI--GQHLSIDLAMLKKIPGVNRATGVDQEMLPEYGAVKGG--F  255

Query  525   PEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             P+W+S  DRRLLQ+       N+VVA DGSGN+ TVSEAV  AP+ S+ R+VI IKAG Y
Sbjct  256   PKWVSVKDRRLLQAAVNETKFNMVVAKDGSGNFTTVSEAVAAAPNASTTRFVIYIKAGAY  315

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
              ENV++ ++K+N+MF+GDG GKT+I  +RNV+DG TTF SATVAVVG  F+A+ ITF+N 
Sbjct  316   FENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGTGFIAKGITFENY  375

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG SK QAVALR  SD SAFY C    YQDTLYVHS RQFY +C + GT+DFIFGNA
Sbjct  376   AGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRECDVYGTIDFIFGNA  432



>gb|EEC82670.1| hypothetical protein OsI_27314 [Oryza sativa Indica Group]
Length=579

 Score =   291 bits (746),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 175/388 (45%), Positives = 227/388 (59%), Gaps = 16/388 (4%)
 Frame = -2

Query  1158  VLISGDMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEVSKKVRSQKDVI  979
             VL++ D       GE N+    ++ +   C  T + D+C S+L++ P +++K    +DVI
Sbjct  49    VLLAAD------GGERNADAEHAAAVDRHCAGTLHRDVCVSTLSTIPNLARK--PLRDVI  100

Query  978   ELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQLNTALQDLRVY  799
                +         + +N    +        R+++A  DCLE     L  L TA  +L   
Sbjct  101   SEVVGRAASAVRASSSNCTSYLQRPRQLRTRDRLALSDCLELFGHTLDLLGTAAAELSA-  159

Query  798   PSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNAR-KPIFNGQV-HVEKLCSNC  625
                 +    A  ++T++SAAMTNQ TCLDGF+   A  + R +P   G++ HV  L SN 
Sbjct  160   -GNSTAEESAAGVQTVLSAAMTNQYTCLDGFAGPSASEDGRVRPFIQGRIYHVAHLVSNS  218

Query  624   LSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQSTAATPNVVVAADG  445
             L+++R +  T  +   +         V  G  +P W+SA DRR LQ   A  +VVVA DG
Sbjct  219   LAMVRRLP-TQRRRGAEEEPLEGYGRVRRG--FPSWVSASDRRRLQQQVAA-DVVVAKDG  274

Query  444   SGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNR  265
             SG + TVSEAV  AP+ S  RYVI IKAG Y ENV+V   KTNIMF+GDG  KTVI  +R
Sbjct  275   SGKFTTVSEAVAAAPNNSETRYVIYIKAGGYFENVEVGSEKTNIMFVGDGTWKTVIKASR  334

Query  264   NVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQ  85
             NV+D STTF SAT+AVVG  FLARDIT +N AG SK QAVALRV +DLSAFY C    YQ
Sbjct  335   NVVDNSTTFRSATLAVVGTGFLARDITVENAAGPSKHQAVALRVNADLSAFYRCSFAGYQ  394

Query  84    DTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             DTLY HS RQFY  C I GTVDFIFG+A
Sbjct  395   DTLYAHSLRQFYRDCDIYGTVDFIFGDA  422



>ref|NP_001060620.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAC83543.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAD31979.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF22534.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAG94978.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67808.1| hypothetical protein OsJ_25560 [Oryza sativa Japonica Group]
Length=579

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 175/388 (45%), Positives = 227/388 (59%), Gaps = 16/388 (4%)
 Frame = -2

Query  1158  VLISGDMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEVSKKVRSQKDVI  979
             VL++ D       GE N+    ++ +   C  T + D+C S+L++ P +++K    +DVI
Sbjct  49    VLLAAD------GGERNADAEHAAAVDRHCAGTLHRDVCVSTLSTIPNLARK--PLRDVI  100

Query  978   ELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQLNTALQDLRVY  799
                +         + +N    +        R+++A  DCLE     L  L TA  +L   
Sbjct  101   SEVVGRAASAVRASSSNCTSYLQRPRQLRTRDRLALSDCLELFGHTLDLLGTAAAELSA-  159

Query  798   PSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNAR-KPIFNGQV-HVEKLCSNC  625
                 +    A  ++T++SAAMTNQ TCLDGF+   A  + R +P   G++ HV  L SN 
Sbjct  160   -GNSTAEESAAGVQTVLSAAMTNQYTCLDGFAGPSASEDGRVRPFIQGRIYHVAHLVSNS  218

Query  624   LSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQSTAATPNVVVAADG  445
             L+++R +  T  +   +         V  G  +P W+SA DRR LQ   A  +VVVA DG
Sbjct  219   LAMVRRLP-TQRRRGAEEEPLEGYGRVRRG--FPSWVSASDRRRLQQQVAA-DVVVAKDG  274

Query  444   SGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNR  265
             SG + TVSEAV  AP+ S  RYVI IKAG Y ENV+V   KTNIMF+GDG  KTVI  +R
Sbjct  275   SGKFTTVSEAVAAAPNNSETRYVIYIKAGGYFENVEVGSEKTNIMFVGDGTWKTVIKASR  334

Query  264   NVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQ  85
             NV+D STTF SAT+AVVG  FLARDIT +N AG SK QAVALRV +DLSAFY C    YQ
Sbjct  335   NVVDNSTTFRSATLAVVGTGFLARDITVENAAGPSKHQAVALRVNADLSAFYRCSFAGYQ  394

Query  84    DTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             DTLY HS RQFY  C I GTVDFIFG+A
Sbjct  395   DTLYAHSLRQFYRDCDIYGTVDFIFGDA  422



>ref|XP_003553658.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39-like 
[Glycine max]
Length=615

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 167/361 (46%), Positives = 225/361 (62%), Gaps = 21/361 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T Y DLC S+LAS P+++ K   Q  +I   + +TI     + +N   L  +     K E
Sbjct  112   TLYSDLCVSTLASFPDLTSKTLPQ--MIRSVVNHTIYEVTLSASNCSGLRRNLPKLDKLE  169

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSI-VAHADDLKTLMSAAMTNQETCLDGF  706
             + A  DCL   D  + +L T + DL    S+ +I      D +TL+S AMTN  TCLDGF
Sbjct  170   QRALDDCLNLFDDTVSELETTIADL----SQSTIGPKRYHDAQTLLSGAMTNLYTCLDGF  225

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMT----DTDAQNEIKASGNRKLKEVEG  538
             ++ K   + R     G + +    SN L++++ +        ++NE+   G  K+K+   
Sbjct  226   AYSKG--HVRDRFEEGLLEISHHVSNSLAMLKKLPAGVKKLASKNEV-FPGYGKIKD---  279

Query  537   GCEWPEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIK  364
                +P WLS  DR+LLQ+       N++VA DG+GN+ T++EAV  AP+ S+ R+VI IK
Sbjct  280   --GFPTWLSTKDRKLLQAAVNETNFNLLVAKDGTGNFTTIAEAVAVAPNSSATRFVIHIK  337

Query  363   AGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDIT  184
             AG Y ENV+V + KTN+MF+GDG GKTV+  +RNV+DG TTF SATVAVVG+ F+A+ IT
Sbjct  338   AGAYFENVEVIRKKTNLMFVGDGIGKTVVKASRNVVDGWTTFQSATVAVVGDGFIAKGIT  397

Query  183   FQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGN  4
             F+N+AG SK QAVALR GSD SAFY C   AYQDTLYVHS RQFY  C + GTVDFIFGN
Sbjct  398   FENSAGPSKHQAVALRSGSDFSAFYKCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFGN  457

Query  3     A  1
             A
Sbjct  458   A  458



>ref|XP_002455538.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
 gb|EES00658.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
Length=576

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 170/378 (45%), Positives = 224/378 (59%), Gaps = 33/378 (9%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S+LA  P++ KK     DVI  ++ +T  +      N     +   + + R+
Sbjct  52    TLYPELCLSTLADIPDLHKK--PLPDVICAAVNHTEDVVTATSTNCS-YYLQDRSLSARD  108

Query  882   KIAFGDCLETIDQALFQLNTALQDLRV---------YPSKKSIVAHADDLKTLMSAAMTN  730
             ++A  DCLE +   + +L     DL            PS  +     D + T++SAA+TN
Sbjct  109   RLAINDCLELLSTTMDELRATTADLSTSSGGNGSAAAPSVGTRRVTMDHVMTVLSAAITN  168

Query  729   QETCLDGFSHCKADH--NARKPIFNGQVHVEKLCSNCLSLIRNM-------TDTDAQNEI  577
             Q TCLDGF++       +  +P F+   HV ++ SN L++ + +       +      E 
Sbjct  169   QYTCLDGFAYQNGGRVRHYIEPTFH---HVSRMVSNSLAMAKKLPGASPSPSSAPTTTET  225

Query  576   KASGNRKL----KEVEGGCEWPEWLSAGDRRLLQS--TAATPNVVVAADGSGNYRTVSEA  415
              A   +      + V+G   +P W+  GDRRLLQ+  TA T + VVA DGSG Y TVS A
Sbjct  226   AAVARQPFMGYGQMVKG---FPRWVRPGDRRLLQAPATAITADAVVAKDGSGGYTTVSAA  282

Query  414   VKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFN  235
             V  AP+ S KRYVI IKAG Y ENV+V K   N+MF+GDG GKTVI  +RNV+DG TTF 
Sbjct  283   VAAAPTNSKKRYVIYIKAGAYMENVEVGKKHVNLMFVGDGIGKTVIKASRNVVDGYTTFR  342

Query  234   SATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQ  55
             SATVAVVG  FLARD+T +N+AG SK QAVALRVG+DLSAFY C    YQDTLYVHS RQ
Sbjct  343   SATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQ  402

Query  54    FYVKCLISGTVDFIFGNA  1
             F+  C I GT+DF+FGNA
Sbjct  403   FFRDCDIYGTIDFVFGNA  420



>ref|XP_009765668.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=566

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 223/356 (63%), Gaps = 11/356 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             TRYP LC S+L+  P++++K  SQ     +++  T+   + +  N  ++          E
Sbjct  61    TRYPKLCVSTLSLIPDLAQKSISQIISSTINV--TVAEVKASAKNCTEIREDLPRLEPYE  118

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DC++ +D  + +L T L DL     KKS   + +DL+TL+SAAMTNQ TCLDG +
Sbjct  119   KRALEDCVQLLDNTIIELKTTLSDLH---PKKSPSQNYNDLQTLLSAAMTNQATCLDGLA  175

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWP  523
              CK   N R+ + +    +    SNCL++++ M  +   +        +   V+ G  +P
Sbjct  176   RCKK--NLRRYVQHNLHTIAHHVSNCLAMLKKMKKSSFASSKSQEIYPEYGAVKNG--FP  231

Query  522   EWLSAGDRRLLQST--AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
             +WL   DR LLQ+       ++VVA DGSGN+ T++EA+  AP+ S  R+VI IKAG Y 
Sbjct  232   KWLKKRDRALLQAPINETKIDLVVAKDGSGNFSTINEALSAAPNASRTRFVIHIKAGAYY  291

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             E ++V + K  IMF+GDG GKT+I GNR+V+DG TTF SATVAVVG  F+A+ ITF+N A
Sbjct  292   EYIEVVRRKPMIMFLGDGIGKTLIKGNRSVVDGWTTFRSATVAVVGNGFIAKGITFENFA  351

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G SK QAVA+R GSDLSAFY C   AYQDTLYVHS RQFY  C + GTVDFIFGNA
Sbjct  352   GPSKHQAVAVRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFGNA  407



>gb|EEC70505.1| hypothetical protein OsI_01594 [Oryza sativa Indica Group]
Length=565

 Score =   289 bits (740),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 174/366 (48%), Positives = 226/366 (62%), Gaps = 20/366 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S+LA  P++  K  S  DVI  ++  T         N    + ++   T R+
Sbjct  52    TLYPELCLSTLADIPDLHTK--SLPDVICGTVNRTKDAVAATSYNCSHYI-NSKYLTPRD  108

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPS-------KKSIVAH---ADDLKTLMSAAMT  733
             ++A  DC+E +D  + +L     DL   P+         S+ A     D + T +SAAMT
Sbjct  109   RLAISDCMELLDTTMDELQATTSDLES-PAVAGGNNGSASMAAKRVTMDHVMTELSAAMT  167

Query  732   NQETCLDGFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKL  553
             NQ TCLDGF + K     R  + +   HV ++ SN L++ + +     +   +       
Sbjct  168   NQYTCLDGFDY-KDGERVRHYMESSIHHVSRMVSNSLAMAKKLPGAGGETTQRQPFMGYG  226

Query  552   KEVEGGCEWPEWLSAGDRRLLQSTAA--TPNVVVAADGSGNYRTVSEAVKNAPSKSSKRY  379
             +   G   +P+W+  GDRRLLQ+ A+  TP+ VVA DGSG Y TVS AV  AP+ S+KRY
Sbjct  227   QMANG---FPKWVRPGDRRLLQAPASSITPDAVVAKDGSGGYTTVSAAVAAAPANSNKRY  283

Query  378   VIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFL  199
             VI IKAG Y ENV+V KSK N+MFIGDG GKTVI  +RNV+DGSTTF SATVAVVG  FL
Sbjct  284   VIHIKAGAYMENVEVGKSKKNLMFIGDGIGKTVIKASRNVVDGSTTFRSATVAVVGNNFL  343

Query  198   ARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVD  19
             ARD+T +N+AG SK QAVALRVG+DLSAFY C    YQDTLYVHS RQF+ +C I GT+D
Sbjct  344   ARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGTID  403

Query  18    FIFGNA  1
             FIFGN+
Sbjct  404   FIFGNS  409



>gb|EEE54425.1| hypothetical protein OsJ_01485 [Oryza sativa Japonica Group]
Length=584

 Score =   289 bits (740),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 178/382 (47%), Positives = 232/382 (61%), Gaps = 33/382 (9%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S+LA  P++  K  S  DVI  ++  T         N    + ++   T R+
Sbjct  52    TLYPELCLSTLADIPDLHTK--SLPDVICGTVNRTKDAVAATSYNCSHYI-NSKYLTPRD  108

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPS-------KKSIVAH---ADDLKTLMSAAMT  733
             ++A  DC+E +D  + +L     DL   P+         S+ A     D + T +SAAMT
Sbjct  109   RLAISDCMELLDTTMDELQATTSDLES-PAVAGGNNGSASMAAKRVTMDHVMTELSAAMT  167

Query  732   NQETCLDGFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMT--------------DT  595
             NQ TCLDGF + K     R  + +   HV ++ SN L++ + +               DT
Sbjct  168   NQYTCLDGFDY-KDGERVRHYMESSIHHVSRMVSNSLAMAKKLPGAGGGGMTPSSSSPDT  226

Query  594   DAQNEIKASGNRK--LKEVEGGCEWPEWLSAGDRRLLQSTAA--TPNVVVAADGSGNYRT  427
               Q+E   +  R+  +   +    +P+W+  GDRRLLQ+ A+  TP+ VVA DGSG Y T
Sbjct  227   ATQSESSETTQRQPFMGYGQMANGFPKWVRPGDRRLLQAPASSITPDAVVAKDGSGGYTT  286

Query  426   VSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGS  247
             VS AV  AP+ S+KRYVI IKAG Y ENV+V KSK N+MFIGDG GKTVI  +RNV+DGS
Sbjct  287   VSAAVAAAPANSNKRYVIHIKAGAYMENVEVGKSKKNLMFIGDGIGKTVIKASRNVVDGS  346

Query  246   TTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVH  67
             TTF SATVAVVG  FLARD+T +N+AG SK QAVALRVG+DLSAFY C    YQDTLYVH
Sbjct  347   TTFRSATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVH  406

Query  66    SNRQFYVKCLISGTVDFIFGNA  1
             S RQF+ +C I GT+DFIFGN+
Sbjct  407   SLRQFFRECDIYGTIDFIFGNS  428



>ref|XP_009614504.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=563

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 173/361 (48%), Positives = 226/361 (63%), Gaps = 12/361 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP LC S+L+  P + +K  +  ++I  ++  T+   + +  N   ++   +     E
Sbjct  46    TLYPQLCISTLSLIPNLHQK--TIPEIISSTVNTTVDEVKASTENCTNILHKMSKLDPIE  103

Query  882   KIAFGDCLETI-DQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             K A  DC+E + D  + +LNT L DL    +  S   H +DL+TL+SAAMTNQ+TCL GF
Sbjct  104   KRALDDCIELLGDSTISELNTTLYDLST-KNHNSPYKHYNDLQTLLSAAMTNQDTCLGGF  162

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV-EGGCE  529
                K  HN R  I +    +E+  SN L++++ +    A      S +   +   E G  
Sbjct  163   DDSK--HNLRHYIEHNLHTIEQHVSNSLAMLKKLKTGTAPGSSIPSSSNSNEVFPEYGAM  220

Query  528   ---WPEWLSAGDRRLLQST--AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIK  364
                +P+WL   DR LLQ+       ++VVA DGSGN+RT++EA+  APS SS R+VI IK
Sbjct  221   KNGYPKWLKKKDRALLQAPINQIKFDLVVAKDGSGNFRTINEALSAAPSSSSTRFVIYIK  280

Query  363   AGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDIT  184
             AGTY E +DV + K+ IMF+GDG GKT I GNRNV+DG TTF SATVAVVG  F+AR IT
Sbjct  281   AGTYFEYIDVERKKSMIMFVGDGIGKTQIKGNRNVVDGWTTFRSATVAVVGNGFIARGIT  340

Query  183   FQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGN  4
             F+N AG SK QAVALR GSDLSAFY C   AYQDTLYVHS RQFY +C + GTVDFIFGN
Sbjct  341   FENFAGPSKHQAVALRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFGN  400

Query  3     A  1
             A
Sbjct  401   A  401



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 161/357 (45%), Positives = 222/357 (62%), Gaps = 13/357 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVST-TNYTKR  886
             T Y  LC S+L++ P+++ K  S   +I  ++ +T+   + + +N   ++          
Sbjct  58    TLYKLLCVSTLSTFPDLTTK--SVPQIISYTVSHTVSEVQASSSNCTGIIKKQFKKLDAL  115

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             ++IA  DCLE  D  + +LN  + DL +   KK       DLKTL+S AMTNQ TCLDGF
Sbjct  116   QQIALDDCLELFDDTIAELNAVISDLSI---KKLSSNRYYDLKTLLSGAMTNQYTCLDGF  172

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
             +        R+ I +    + +  SN L +++ +         K+    +   ++ G  +
Sbjct  173   NDTGI---VRQEIQSRLQTISQHVSNALVMLKKIPGALKYENSKSEMFPEFGPMKNG--F  227

Query  525   PEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             P W+S+ DR+LLQS A     ++VVA DG+GN+ T+SEAV  AP+ S+ R+VI IK+G Y
Sbjct  228   PTWVSSKDRKLLQSVANGTKYDLVVAKDGTGNFTTISEAVAVAPNSSATRFVIYIKSGAY  287

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
              ENV+V + KTN+MF+GDG GKTV+  +RNV+DG TTF SATVAVVG+ F+A+ ITF+N 
Sbjct  288   FENVEVVRKKTNLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFIAQGITFENA  347

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG SK QAVA R GSD SAFY C    YQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  348   AGPSKHQAVAFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNA  404



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score =   287 bits (734),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 228/369 (62%), Gaps = 26/369 (7%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T Y +LC SS++S   +S +     ++++ ++   I   +  +A+ + L   + +   R+
Sbjct  81    TLYQELCVSSISSYEGLSSQA-GHMEILDAAVNVAINAVKKGQAHTRSLF--SRDLDSRQ  137

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             + A  DC+E  D  L +L+  L DL    +  S+  HA DL+TL+SAA+TNQ TCL+GF+
Sbjct  138   RGALNDCMEMYDDTLDELHDTLSDLH-NATFLSMPKHAADLETLLSAAITNQFTCLEGFT  196

Query  702   HCKADHNARKPIFNGQVH-VEKLCSNCLSLIRNMTDTDAQN----EIKASGNRKLKEV--  544
              CK      K    G++H V  L SN L+ + N++    Q     +  A   R L E   
Sbjct  197   LCKGH---LKQQVKGELHNVSHLVSNSLATVGNISARAKQALGIADSLADRRRLLSESFV  253

Query  543   ----EGGCEWPEWLSAGDRRLLQS--TAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKR  382
                 EG   +P W+S GDRRLLQ   T  T N VVA DGSG+Y T+S AV  AP KS+ R
Sbjct  254   STDEEG---FPSWMSVGDRRLLQVNVTNITANAVVAKDGSGHYSTISAAVDAAPEKSTTR  310

Query  381   YVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGS--TTFNSATVAVVGE  208
             ++I +K G Y+ENV++ K K  +MFIGDG G TV+T +R+V  GS  TTF+SATVAV G+
Sbjct  311   FIIYVKKGVYQENVEIHKKKHFLMFIGDGEGVTVVTASRSV-RGSNHTTFHSATVAVTGK  369

Query  207   RFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISG  28
              F+ARD+TF+NTAG S  QAVALRVGSD S FY C  K YQDTLYVHS RQF+  C I G
Sbjct  370   GFIARDMTFENTAGPSNHQAVALRVGSDFSVFYRCSFKGYQDTLYVHSLRQFFRDCDIYG  429

Query  27    TVDFIFGNA  1
             TVDFIFGNA
Sbjct  430   TVDFIFGNA  438



>gb|KDP28190.1| hypothetical protein JCGZ_13961 [Jatropha curcas]
Length=430

 Score =   282 bits (721),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 152/281 (54%), Positives = 193/281 (69%), Gaps = 13/281 (5%)
 Frame = -2

Query  834  QLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQ  655
            +L  AL DL    S+KS   H  +L+TL+SAAMTNQ TCLDGF++ +   N RK I +  
Sbjct  3    ELKVALNDLY---SRKSASQHYHELQTLLSAAMTNQYTCLDGFAYSEG--NVRKVIKSNL  57

Query  654  VHVEKLCSNCLSLIRNMTDTDAQNEIKA-SGNRKLKEVEGGCEWPEWLSAGDRRLLQS--  484
             ++    SN L +++ +   +  N+ +  +G+  +K       +P WLS+ DR+LLQ+  
Sbjct  58   YNISHHVSNSLVMLKKIPGVNISNKSEVFTGHGDIKH-----GFPSWLSSKDRKLLQAPL  112

Query  483  TAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFI  304
             A T N++VA DGSGN+ TVSEAV  AP+ S+ R+VI IKAG Y ENVDV K K  +MFI
Sbjct  113  NATTFNLIVAKDGSGNFTTVSEAVAAAPNSSNARFVIYIKAGAYFENVDVHKKKNMLMFI  172

Query  303  GDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSD  124
            GDG GKTVI  NR+V+DG TTF SATVAVVG  F+A+ ITF+N+AG S  QAVALR GSD
Sbjct  173  GDGIGKTVIKANRSVVDGWTTFRSATVAVVGNGFIAKGITFENSAGPSMHQAVALRSGSD  232

Query  123  LSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
            LSAFY C    YQDTLYVHS RQFY +C + GT+DFIFGNA
Sbjct  233  LSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGNA  273



>ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=567

 Score =   286 bits (731),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 169/362 (47%), Positives = 224/362 (62%), Gaps = 24/362 (7%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T +P+LC S+L+S P + +K  S  ++I  ++K  +     +  N   L  +       E
Sbjct  63    TLHPELCVSTLSSFPNLHRK--SIAEIISSTVKVAVGEVRDSAHNCSDLRRNVPKLEPIE  120

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DC+E + + + +L TAL DL     KKS   H +D++TL+SAAMTN++TCLDG  
Sbjct  121   KRALQDCVELLGETIAELRTALTDLS---PKKSASKHYNDIQTLLSAAMTNEDTCLDGLF  177

Query  702   HCKADHNARKPIFNGQVH-VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV--EGGC  532
             +C  ++  R       +H +    SN L+++         N+IK +     +EV  E G 
Sbjct  178   YCTKNNLTR--YVEDNLHTIAHHVSNSLAML---------NKIKRTSVSSSEEVFPEYGA  226

Query  531   ---EWPEWLSAGDRRLLQSTAATP--NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
                 +P WL   +R LLQ+  +    ++VVA DGSGN+ T++EA+  AP+ SS R+VI I
Sbjct  227   VKNGFPNWLKRRERALLQTPVSQTKLDLVVAKDGSGNFTTINEALSAAPNSSSTRFVIYI  286

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             K G+Y E V+V K KT IMF+GDG GKT I GNRN +DG TTF SATVAVVG+ FLA+ I
Sbjct  287   KEGSYFEYVEVDKKKTMIMFVGDGIGKTKIKGNRNHVDGWTTFRSATVAVVGKGFLAKGI  346

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             TF+N AG SK QAVALR  SDLSAFY C   AYQDTLYVHS RQFY  C + GTVDFIFG
Sbjct  347   TFENYAGPSKHQAVALRSSSDLSAFYQCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFG  406

Query  6     NA  1
             NA
Sbjct  407   NA  408



>emb|CDP15270.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   286 bits (732),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 165/363 (45%), Positives = 223/363 (61%), Gaps = 20/363 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YPDLC S+LA+ P++ +  R+  ++I   + +T+     ++ N  ++     N    +
Sbjct  77    TFYPDLCVSTLATFPDLRQ--RTLPEIISGMVNSTVFEVRDSKQNCTRIRRKLQNLDPLD  134

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             + A  DCL+ +D    QL  A+ DL    S KS + H  DL+TL SAAMTNQ+TCLDGF+
Sbjct  135   RRALEDCLQLLDDTFAQLKAAISDLS---SNKSALQHYMDLQTLFSAAMTNQDTCLDGFA  191

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE-------V  544
                  +  RK I      +    SN L++++ +    A     A+G    +E       V
Sbjct  192   FSGRKY-IRKFIEGRLRKISHHVSNSLAMLKRVKKQQA-----AAGAVFPEEEGEFGTPV  245

Query  543   EGGCEWPEWLSAGDRRLLQST--AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIR  370
             + G  +P WL   DR LLQ+       N+ VA DGSGN+ T+++A++ AP+ S+ R+VI 
Sbjct  246   KSGDGFPTWLKKKDRALLQAPLNQTKVNLTVAKDGSGNFTTINDALQAAPNSSTTRFVIY  305

Query  369   IKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARD  190
             IKAG Y E ++V + KT IMF+GDG GKTVI GNR+V  G TTF S+TVAVVG+ F+AR 
Sbjct  306   IKAGAYYEYIEVERRKTMIMFMGDGIGKTVIKGNRSVGAGWTTFRSSTVAVVGDGFIARG  365

Query  189   ITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIF  10
             IT +N AG S+ QAVALR GSDLSAFY C    YQDTLYVHS RQFY +C + GTVDFIF
Sbjct  366   ITVENYAGPSQHQAVALRSGSDLSAFYQCSFIGYQDTLYVHSLRQFYRECDVYGTVDFIF  425

Query  9     GNA  1
             GNA
Sbjct  426   GNA  428



>ref|XP_009628637.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=567

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 164/357 (46%), Positives = 224/357 (63%), Gaps = 13/357 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLK-NTIKIAETNRANVQKLVVSTTNYTKR  886
             TRYP LC S+L+  P++++K  SQ     +++    +K +  N  ++++ +     Y KR
Sbjct  62    TRYPKLCVSTLSLIPDLAQKSISQIISSTINVTVAEVKASARNCTDIREDLPQLEPYEKR  121

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
                A  DC++ +D  + +L T L DL     KK    + +DL+TL+SAAMTNQ TCLDG 
Sbjct  122   ---ALEDCVQLLDNTIIELRTTLSDLN---PKKPPSQNYNDLQTLLSAAMTNQATCLDGL  175

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
             +  K   N R+ + +    +    SNCLS+++ M  +   +        +   V+ G  +
Sbjct  176   ARSKK--NLRRYVQHNLHTIAHHVSNCLSMLKKMKKSSFSSSKSQEIYPEYGAVKNG--F  231

Query  525   PEWLSAGDRRLLQST--AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             P+WL   DR LLQ+       ++VVA DGSGN+ T++EA+  AP+ S+ R+VI IKAG Y
Sbjct  232   PKWLKKRDRALLQAPINETKIDLVVAKDGSGNFSTINEALSAAPNASTTRFVIYIKAGAY  291

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
              E ++V + K  IMF+GDG GKT+I GNR+V+DG TTF SATVAVVG  FLA+ ITF+N 
Sbjct  292   FEYIEVVRKKPMIMFLGDGIGKTLIKGNRSVVDGWTTFRSATVAVVGNGFLAKGITFENY  351

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG SK QAVA+R GSD SAFY C   AYQDTLYVHS RQFY  C + GTVDFIFGNA
Sbjct  352   AGPSKHQAVAVRSGSDFSAFYQCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFGNA  408



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/357 (45%), Positives = 224/357 (63%), Gaps = 14/357 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YPDLC S+LA+ P+++ K   Q  VI   + +T+   +++  N   L     N    +
Sbjct  51    TLYPDLCVSTLATFPDLTSKSVPQ--VISSVVNHTMYEVKSSFYNCSSLKKKIRNLNPLD  108

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVA-HADDLKTLMSAAMTNQETCLDGF  706
             + A  DCL+       +L T + DL    SK SI +    DL+TL+S AMTN  TCLDGF
Sbjct  109   QRALDDCLKLFQDTNLELKTTIDDL----SKSSIGSKRHHDLQTLLSGAMTNLYTCLDGF  164

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
             ++ K     R  I    + +    SN L++++ +     +   K+    +  +++ G  +
Sbjct  165   AYSKG--RVRDRIEKKLLEISHHMSNSLAMLKKVPGVKTRTS-KSEVFPEYGKMKKG--F  219

Query  525   PEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             P W+S  DR+LLQ++   +  ++VVA DG+GN+ T+ EA+  AP+ S+ R+VI IK G Y
Sbjct  220   PLWVSPKDRKLLQASVNESKFDLVVAKDGTGNFTTIGEALALAPNSSTTRFVIHIKEGAY  279

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
              ENV+V + KTN+MF+GDG GKTV+ G+RNV+DG TTF SATVAV+GE F+A+ ITF+N+
Sbjct  280   FENVEVIRKKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVLGEGFIAKGITFENS  339

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG  K QAVALR G+D SAF+ C    YQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  340   AGPEKHQAVALRSGADFSAFFRCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNA  396



>ref|XP_006355816.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=479

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 157/301 (52%), Positives = 197/301 (65%), Gaps = 11/301 (4%)
 Frame = -2

Query  885  EKIAFGDCLETI-DQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDG  709
            EK A  DC+E + D  + +L T L DL    S  S + H +DL+TL+S AMTNQ+TCL+G
Sbjct  25   EKRALDDCIELLGDTTIDELQTTLYDLSTKNSSNSPLKHYNDLQTLLSGAMTNQDTCLNG  84

Query  708  FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE---VEG  538
              + K  HN  + I      + +  SN L +++ +    AQ    ++ N    E   ++ 
Sbjct  85   IYNSK--HNLSQYIEKNLHTISQHVSNSLVMLKKLKTGSAQGS-SSNSNEVFPEYGTMKN  141

Query  537  GCEWPEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIK  364
            G  +P+WL   DR LLQ+       ++VVA DGSGN+ T++ A+  AP+ SS R+VI IK
Sbjct  142  G--YPKWLKKKDRTLLQAPVNQIKFDLVVAKDGSGNFTTINAALSAAPNSSSTRFVIYIK  199

Query  363  AGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDIT  184
            AGTY E +DV + K+ IMF+GDG GKTVI GNRNV+DG TTF SATVAVVG  FLAR IT
Sbjct  200  AGTYFEYIDVERKKSMIMFVGDGIGKTVIKGNRNVVDGWTTFRSATVAVVGNGFLARGIT  259

Query  183  FQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGN  4
            F+N AG SK QAVALR GSDLSAFY C   AYQDTLYVHS RQFY  C + GTVDFIFGN
Sbjct  260  FENYAGPSKHQAVALRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRNCDVYGTVDFIFGN  319

Query  3    A  1
            A
Sbjct  320  A  320



>ref|XP_002463382.1| hypothetical protein SORBIDRAFT_02g042780 [Sorghum bicolor]
 gb|EER99903.1| hypothetical protein SORBIDRAFT_02g042780 [Sorghum bicolor]
Length=599

 Score =   285 bits (730),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 162/364 (45%), Positives = 219/364 (60%), Gaps = 14/364 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLV---VSTTNYT  892
             T + D+C S+L++ P++++K    +DVI   +         + +N    +          
Sbjct  83    TLHRDVCASTLSAIPDLAQK--PVRDVISAVVARAAAAVRASASNCSAYLRRPAGAGALR  140

Query  891   KREKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADD-----LKTLMSAAMTNQ  727
              R+++A  DC+E +   L QL TA  +L    S  S     D+     ++T++SAA+TNQ
Sbjct  141   VRDRLALSDCVELLQHTLAQLGTAEAELSAANSSTSTSTSTDEESVAGVQTVLSAALTNQ  200

Query  726   ETCLDGFSHCKADHNAR-KPIFNGQV-HVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKL  553
              TCLDGF+   A  + R +P   G++ HV  L SN L+++R +     +   +A      
Sbjct  201   YTCLDGFAGPSASEDGRVRPYIQGRIYHVAHLVSNSLAMLRRLPQRRRRRGREALELEGY  260

Query  552   KEVEGGCEWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVI  373
               V  G  +P W+SA DRR LQ     P++VVA DGSGN+ TV EAV  AP+ S  R+VI
Sbjct  261   GRVRRG--FPSWVSAADRRRLQQQQVVPDLVVAKDGSGNFTTVGEAVAAAPNNSESRFVI  318

Query  372   RIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLAR  193
              IKAG Y ENV+V   KTN+MF+GDG  KTVI  +RNV+D STTF SAT+AVVG  FLAR
Sbjct  319   YIKAGGYFENVEVGSEKTNLMFVGDGMWKTVIKASRNVVDNSTTFRSATLAVVGTGFLAR  378

Query  192   DITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFI  13
             D+T +N AG SK QAVALRV +DL+AFY C    YQDTLY HS RQFY  C + GTVDF+
Sbjct  379   DLTVENAAGPSKHQAVALRVNADLAAFYRCSFAGYQDTLYAHSLRQFYRDCDVYGTVDFV  438

Query  12    FGNA  1
             FG+A
Sbjct  439   FGDA  442



>ref|XP_004958677.1| PREDICTED: pectinesterase 3-like [Setaria italica]
Length=598

 Score =   285 bits (729),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 162/360 (45%), Positives = 224/360 (62%), Gaps = 17/360 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T + ++C S+LAS P +++K    +DVI   +         + +N    +        R+
Sbjct  93    TLHREVCASTLASIPNLARK--PLRDVISDVVARAAAAVRASSSNCSSYLRRPRGLRVRD  150

Query  882   KIAFGDCLETIDQALFQLNTALQDLRV--YPSKKSIVAHADDLKTLMSAAMTNQETCLDG  709
             ++A  DCLE   + L QL TA  +L      +++SI      ++T++SAA+TNQ TCL+G
Sbjct  151   RLALSDCLELFGRTLGQLGTAADELSAGNRTAEESIAG----VQTVLSAALTNQYTCLEG  206

Query  708   FSHCKADHNAR-KPIFNGQV-HVEKLCSNCLSLIRNMTDTDAQNEIKA-SGNRKLKEVEG  538
             F+   A  + R +P   G++ HV  L SN L+++R +     +   +A  G  +++    
Sbjct  207   FAGPSASEDGRVRPYIQGRIYHVAHLVSNSLAMLRRLPQRRRRRGREALEGYGRVRR---  263

Query  537   GCEWPEWLSAGDRR-LLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKA  361
                +P W+SAGDRR LL+ +A   ++VVA DGSGN+ TV EAV  AP+ S  R+VI IKA
Sbjct  264   --GFPSWVSAGDRRRLLEPSAGAADLVVAKDGSGNFTTVGEAVAAAPNNSESRFVIYIKA  321

Query  360   GTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITF  181
             G Y ENV+V   KTN+MF+GDG  KTVI  +RNV+D STT+ SAT+AVVG  FLARD+T 
Sbjct  322   GGYFENVEVGPEKTNLMFVGDGMWKTVIKASRNVVDNSTTYRSATLAVVGTGFLARDLTV  381

Query  180   QNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             +N AG SK QAVALRV +DLSAFY C    YQDTLY HS RQFY  C + GTVDF+FG+A
Sbjct  382   ENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDVYGTVDFVFGDA  441



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score =   284 bits (726),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 161/359 (45%), Positives = 220/359 (61%), Gaps = 13/359 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVST-TNYTKR  886
             T Y DLC S+L++ P++S K  S   +I  ++ +T+   + + +N   ++          
Sbjct  70    TLYKDLCVSTLSTFPDLSTK--SVPQIISYTVSHTVSEVQASSSNCTGIIKKQFKKLDAL  127

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             ++IA  DCLE  D  + +L   + DL V   +K       DLKTL+S AMTNQ TCLDGF
Sbjct  128   QQIALDDCLELFDDTIAELKAVISDLSV---EKLSSDRYYDLKTLLSGAMTNQYTCLDGF  184

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE-  529
             +        R  I +    + +  SN L +++ +         K+S + ++    G    
Sbjct  185   NDTGI---VRHEIQSRLQTISQHVSNALVMLKKIPGALKYENSKSSTSSEMFPEFGPMRN  241

Query  528   -WPEWLSAGDRRLLQST--AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
              +P W+S+ DR+LLQS       ++VVA DG+GN+ T+SEAV  AP+ S+ R+VI IK+G
Sbjct  242   GFPTWVSSKDRKLLQSVVNGTKYDLVVAKDGTGNFTTISEAVAVAPNSSATRFVIYIKSG  301

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              Y ENV+V + KT +MF+GDG GKTV+  +RNV+DG TTF SATVAVVG+ F+A+ ITF+
Sbjct  302   AYFENVEVVRKKTKLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFIAQGITFE  361

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             N AG SK QAVA R GSD SAFY C    YQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  362   NAAGPSKHQAVAFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNA  420



>ref|XP_011079629.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=566

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 161/366 (44%), Positives = 223/366 (61%), Gaps = 30/366 (8%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YPDLC S++A+ PE+ +K  +  ++I  ++  T+K    + +N   L         R 
Sbjct  57    TLYPDLCVSTVAAFPELRRK--TLPEIISGTINVTMKEVRASASNCSSL---------RR  105

Query  882   KI----------AFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMT  733
             K+          A  DCLE     + +L   L +L    +  S   + DDL+TL+S AMT
Sbjct  106   KLMKKLAPLDLQALDDCLELFSDTVGELKRILAELS---AGNSPEKYYDDLQTLLSGAMT  162

Query  732   NQETCLDGFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKL  553
             NQ+TCLDGF++ K  +N R+ I      + K  SN L++++ +     +         + 
Sbjct  163   NQDTCLDGFAYSK--NNTRQLIQGRLKRITKHMSNSLAMVKKLKKRSKKKPGHGEEFPEY  220

Query  552   KEVEGGCEWPEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRY  379
              +++ G  +P WL   DRRLLQ+ A     ++VVA DGSGN+ T++EA+  AP+ S  R+
Sbjct  221   GQMKDG--YPTWLKKNDRRLLQTAANETKYDLVVAQDGSGNFTTINEALDAAPNNSDTRF  278

Query  378   VIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFL  199
             VI IK G Y E ++V + KT IMF+GDG GKT+I GNR+V+DG TTF S+TVAV+G  F+
Sbjct  279   VIYIKGGAYYEYIEVVRKKTMIMFLGDGIGKTLIKGNRSVVDGWTTFRSSTVAVLGNGFI  338

Query  198   ARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVD  19
             A+ ITF+N AG SK QAVALR G+D SAFY C   AYQDTLYVHS RQFY +C I GT+D
Sbjct  339   AKGITFENYAGPSKHQAVALRSGADFSAFYQCSFVAYQDTLYVHSLRQFYRECDIYGTID  398

Query  18    FIFGNA  1
             FIFGNA
Sbjct  399   FIFGNA  404



>ref|XP_007204488.1| hypothetical protein PRUPE_ppa019698mg [Prunus persica]
 gb|EMJ05687.1| hypothetical protein PRUPE_ppa019698mg [Prunus persica]
Length=530

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 226/358 (63%), Gaps = 22/358 (6%)
 Frame = -2

Query  1056  YPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKI  877
             +P LC+++LAS  +      +   ++E ++  T+   E+ R +++ L+     Y + E+ 
Sbjct  31    HPSLCFTALASA-KTHDHFTAFHHLLEANINQTVASVESTRQSIKGLLKLQDLYLQ-ERN  88

Query  876   AFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHC  697
             A  DCLE +DQ L++L  A+ DL  +      V++ + LKTL+SAAMTN+ TC+DGF   
Sbjct  89    ALKDCLEMLDQTLYELGQAVDDLHGFR-----VSYGN-LKTLLSAAMTNENTCIDGFFEL  142

Query  696   KADHNARKPIFNGQVH-----VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGC  532
             +   +  +   NG +      + +L S+CL++IR      A NE K    +K K+     
Sbjct  143   EEFDSENQIGLNGHLQGLLAPISELMSDCLAMIR--YQEQALNEQKRLVTKKPKK-----  195

Query  531   EWPEWLSAGDRRLLQ-STAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
              +P W+  GDR L+Q       ++VVAADG+G+Y T+ EA+K AP+ S  R+VI+IKAG 
Sbjct  196   RFPVWMLPGDRNLMQREPTMKADIVVAADGNGDYETIGEALKMAPNMSRTRFVIKIKAGV  255

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y E V++ + K NIM +GDG   T+ITG+++  DG +TF +AT+ V+G+RFLARD+T  N
Sbjct  256   YNETVEISREKANIMLVGDGMNTTIITGSKSFADGFSTFATATLTVIGDRFLARDLTITN  315

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             TAG+ K QAVA RV S+ SAFY+C   +YQDTLYVHS RQFY  C+I GT+DFIFGNA
Sbjct  316   TAGSKKFQAVAARVTSN-SAFYHCNFSSYQDTLYVHSLRQFYRDCIIEGTIDFIFGNA  372



>ref|XP_009796151.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Nicotiana sylvestris]
Length=543

 Score =   281 bits (719),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 154/354 (44%), Positives = 219/354 (62%), Gaps = 18/354 (5%)
 Frame = -2

Query  1047  LCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFG  868
             LC S + S  +    VR    V+  +++N++  A+    ++ K   ST + + R+++A  
Sbjct  54    LCLSHIQSNLDNHGHVRDPHSVLRAAIRNSLNQAKLAIQSITKF--STLSASSRDQMAIE  111

Query  867   DCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKAD  688
             DC E +D ++ +L  +L ++R   +      +  +LK  +SAA++NQ+TCL+GF     D
Sbjct  112   DCQELLDFSVTELAWSLGEMRKIRTGLKNFHYEGNLKAWLSAALSNQDTCLEGFE--GTD  169

Query  687   HNARKPIFNGQVHVEKLCSNCLSL---IRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEW  517
              +    I      V +L SN L+L   + ++     +NE     N K         +PEW
Sbjct  170   RHLENFIKGSLAQVTQLISNVLTLYVQLHSLPFKSPRNETIRYENPK---------YPEW  220

Query  516   LSAGDRRLLQSTAATPNV--VVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKEN  343
             ++ GD+ +L S+ +  +V  VVA DGSG+YR++++A+  APS SS+RYVI +K G Y EN
Sbjct  221   MTNGDKEMLTSSPSKMHVDAVVALDGSGHYRSIAQAIYEAPSYSSRRYVIYVKRGIYHEN  280

Query  342   VDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGA  163
             VD+ K KTNIM +GDG G TVITGNRN + G TTF +ATVAV G+ F+ARDITF+NTAG 
Sbjct  281   VDMKKKKTNIMLVGDGIGATVITGNRNFMQGWTTFRTATVAVSGKGFIARDITFRNTAGP  340

Query  162   SKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
                Q VALRV SDLSAF+ C M+ YQDTLY HS RQFY +C I GT+DFIFGN 
Sbjct  341   KNFQGVALRVDSDLSAFFRCSMEGYQDTLYAHSLRQFYRECNIYGTIDFIFGNG  394



>gb|EPS62329.1| pectinesterase [Genlisea aurea]
Length=560

 Score =   281 bits (719),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 163/369 (44%), Positives = 224/369 (61%), Gaps = 33/369 (9%)
 Frame = -2

Query  1062  TRYPDLCYSSLAST-PEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKR  886
             T YPDLC S++++  PE+ +K  +  ++I  ++  T+K   T  +N   L        + 
Sbjct  50    TLYPDLCVSTVSAVLPELRRK--TLPEIIAATINVTMKEVRTASSNCSSLRRKLNKKLEP  107

Query  885   EKI-AFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDG  709
              ++ A  DCLE        L+    DL+   +++    + DDL+TL+SAAMTNQ TCLDG
Sbjct  108   LELRALEDCLELFSYTASDLSKIFSDLKASSAQEK---YYDDLRTLLSAAMTNQYTCLDG  164

Query  708   FSHCKADHNARKPIFNGQV-HVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGC  532
             F++ K   N  + I  G++  +    SN L+++R +             +RKL E +   
Sbjct  165   FAYSK---NNTREIIQGRLKRISHHASNALAMVRKLKRR----------SRKLIEEDSPV  211

Query  531   -------EWPEWLSAGDRRLLQSTAATPN-----VVVAADGSGNYRTVSEAVKNAPSKSS  388
                     +P W+   DRR LQS A + N     ++VA DGSGN+ T+++A+  AP+ S+
Sbjct  212   VARMRRDGFPAWMKKSDRRFLQSAANSTNSTSYDLIVAQDGSGNFSTINDALNAAPNNSN  271

Query  387   KRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGE  208
              R+VI IK+G Y E VD+P+SKT I F+GDG GKT+I GNR+VIDG TTF SATVAVVG 
Sbjct  272   TRFVIYIKSGAYYEYVDIPRSKTLISFVGDGIGKTLIKGNRSVIDGWTTFRSATVAVVGN  331

Query  207   RFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISG  28
              F+A  IT +N AGA K QAVALR G+D SAFY C    YQDTLYV+SNRQF+ +C I G
Sbjct  332   GFIATGITIENYAGAVKHQAVALRSGADFSAFYRCSFVGYQDTLYVYSNRQFFRQCDIYG  391

Query  27    TVDFIFGNA  1
             TVDFIFGNA
Sbjct  392   TVDFIFGNA  400



>ref|XP_010056339.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
 gb|KCW73022.1| hypothetical protein EUGRSUZ_E01463 [Eucalyptus grandis]
Length=515

 Score =   279 bits (714),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 161/356 (45%), Positives = 216/356 (61%), Gaps = 37/356 (10%)
 Frame = -2

Query  1056  YPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKI  877
             YP  C   L   P+    ++ + D +++S++  ++ A+   +N   L    +N  +REK 
Sbjct  38    YPQPCEYFLTHDPK-QASIKQKSDFLKVSMQLALERAQMAHSNTHSLGSKCSN--EREKA  94

Query  876   AFGDCLETIDQALFQLN-TALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSH  700
              + DCL+  +  + +LN T + D            H D+ +T +S A+TN ETC  GF  
Sbjct  95    VWADCLQLYEHTILRLNRTIVHD----------CTH-DEAQTWLSTALTNLETCRAGFVE  143

Query  699   CKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWPE  520
                  N    + N   +V KL SN L+L  N       N  K              ++P 
Sbjct  144   LGVSGNVLPLMSN---NVSKLISNTLAL--NYAPYTTPNYTK--------------KFPT  184

Query  519   WLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKS-SKRYVIRIKAGTYK  349
             W+  GDR+LLQS++A    N++VA DGSGNY+T+SEA+  A  +S + RY+I IKAGTY 
Sbjct  185   WVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKAGTYS  244

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV+V     NIMF+GDG GKT+ITG+++V  GSTTFNSATVAVVG+ F+A+DITF+NTA
Sbjct  245   ENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRNTA  304

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             GA+  QAVALR GSDLS FY C  + YQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  305   GAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNA  360



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   281 bits (718),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 160/366 (44%), Positives = 228/366 (62%), Gaps = 18/366 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTI---KIAETNRANVQKLVVSTTNYT  892
             T Y  LC S+LA+ P ++ K   Q  +I  ++ +T+   K + +N  +++K    +   +
Sbjct  62    TLYKSLCLSTLATFPNLASKTLPQ--IISSTVSHTVLEVKASSSNCTSIKKQF--SKKLS  117

Query  891   KREKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLD  712
               ++ A  DCLE +D  + +L +A+ DL    +  S   +  DLK L+SAAMTNQ+TCLD
Sbjct  118   SLQQWALDDCLELLDNTIDELKSAISDLSXNKTLNSNRYY--DLKALLSAAMTNQDTCLD  175

Query  711   GFS-HCKADHNARKPIFNGQVH-----VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLK  550
             GFS +  A  ++   I   ++      + +  SN L +++ +         +   +    
Sbjct  176   GFSANGTAPRSSNXGIVRSEIEGRINTISQHVSNALVMLKKIPGAHKYEYSETMKSEMFP  235

Query  549   EV-EGGCEWPEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRY  379
             +      ++P W+S+ DRRLLQS+      ++VVA DG+GN+ T+SEAV  AP+ S+ R+
Sbjct  236   DFGPAKKKFPTWVSSKDRRLLQSSTNETKYDLVVAKDGTGNFTTISEAVDVAPNSSATRF  295

Query  378   VIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFL  199
             VI IKAG Y ENV+V K KTN+MF+GDG G T++  +RNV+DG TTF SATVAVVG+ F+
Sbjct  296   VIYIKAGAYFENVEVVKKKTNLMFLGDGIGNTIVKASRNVVDGWTTFRSATVAVVGBGFI  355

Query  198   ARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVD  19
             A+ ITF+N AG SK QAVALR G+D SAFY C    YQDTLYVHS RQFY +C + GTVD
Sbjct  356   AKGITFENGAGPSKHQAVALRSGADFSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVD  415

Query  18    FIFGNA  1
             FIFGNA
Sbjct  416   FIFGNA  421



>ref|XP_010069896.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=561

 Score =   280 bits (716),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 168/359 (47%), Positives = 221/359 (62%), Gaps = 9/359 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVS-TTNYTKR  886
             T YPDLC S+LAS P+++ K  S  ++I  ++  T   A +  ++   L           
Sbjct  50    TLYPDLCVSTLASFPDLASK--SVPEIISSTVNLTSAQARSASSSCSALERRLAAKLGPL  107

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGF  706
             E+ A  DCLE + + + +   A+ DL       +  AH  DL+TL+S AMTNQ TCLDGF
Sbjct  108   ERRALDDCLELLARTVDEFGKAISDLSSANGPTAPAAHFHDLQTLLSGAMTNQYTCLDGF  167

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE-  529
             ++ K     R  I +   ++ +  SN L +++ +     +     +   ++    G    
Sbjct  168   AYSK--QKVRDAIQSNLFNISRHVSNSLVMLKKLPGVKGRPSGSPAAAGEVFPEYGRMRN  225

Query  528   -WPEWLSAGDRRLLQS--TAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
              +P WLS  DRRLLQ+  +A + NV VA DG+GN+ TVS AV  AP+ S+ R+VI IKAG
Sbjct  226   GFPAWLSPKDRRLLQAPVSATSYNVSVAQDGTGNFTTVSAAVAAAPNASTTRFVIYIKAG  285

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
             +Y ENV+V   KTNIMF+GDG GKT I GNRNV+DG TTF SATVA VG  F+A+ I+F+
Sbjct  286   SYFENVEVISKKTNIMFLGDGIGKTWIKGNRNVVDGWTTFRSATVAAVGSGFIAKGISFE  345

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             N AG SK QAVA R GSDLSAFY+C    YQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  346   NYAGPSKHQAVAFRSGSDLSAFYSCSFIGYQDTLYVHSLRQFYRECDIYGTVDFIFGNA  404



>gb|KCW73020.1| hypothetical protein EUGRSUZ_E01454 [Eucalyptus grandis]
Length=480

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 160/356 (45%), Positives = 215/356 (60%), Gaps = 37/356 (10%)
 Frame = -2

Query  1056  YPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKI  877
             YP  C   L   P+    ++ + D +++S++  ++ A+   +N   L    +N  + EK 
Sbjct  3     YPQPCEYFLTHDPK-QASIKQKSDFLKVSMQLALERAQMAHSNTHSLGSKCSN--EHEKA  59

Query  876   AFGDCLETIDQALFQLN-TALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSH  700
             A+ DCL+  +  + +LN T + D              D+ +T +S A+TN ETC  GF  
Sbjct  60    AWADCLQLYEYTILRLNRTIVHDCT-----------QDEAQTWLSTALTNLETCQAGFVE  108

Query  699   CKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWPE  520
                  N    + N   +V KL SN L+L  N       N  K              ++P 
Sbjct  109   LGVSGNVLPLMSN---NVSKLISNTLAL--NYAPYTTPNYTK--------------KFPT  149

Query  519   WLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKS-SKRYVIRIKAGTYK  349
             W+  GDR+LLQS++A    N++VA DGSGNY+T+SEA+  A  +S + RY+I IKAGTY 
Sbjct  150   WVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKAGTYS  209

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV+V     NIMF+GDG GKT+ITG+++V  GSTTFNSATVAVVG+ F+A+DITF+NTA
Sbjct  210   ENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRNTA  269

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             GA+  QAVALR GSDLS FY C  + YQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  270   GAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNA  325



>ref|XP_010056335.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 160/356 (45%), Positives = 215/356 (60%), Gaps = 37/356 (10%)
 Frame = -2

Query  1056  YPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKI  877
             YP  C   L   P+    ++ + D +++S++  ++ A+   +N   L    +N  + EK 
Sbjct  38    YPQPCEYFLTHDPK-QASIKQKSDFLKVSMQLALERAQMAHSNTHSLGSKCSN--EHEKA  94

Query  876   AFGDCLETIDQALFQLN-TALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSH  700
             A+ DCL+  +  + +LN T + D              D+ +T +S A+TN ETC  GF  
Sbjct  95    AWADCLQLYEYTILRLNRTIVHDCT-----------QDEAQTWLSTALTNLETCQAGFVE  143

Query  699   CKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWPE  520
                  N    + N   +V KL SN L+L  N       N  K              ++P 
Sbjct  144   LGVSGNVLPLMSN---NVSKLISNTLAL--NYAPYTTPNYTK--------------KFPT  184

Query  519   WLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKS-SKRYVIRIKAGTYK  349
             W+  GDR+LLQS++A    N++VA DGSGNY+T+SEA+  A  +S + RY+I IKAGTY 
Sbjct  185   WVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKAGTYS  244

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV+V     NIMF+GDG GKT+ITG+++V  GSTTFNSATVAVVG+ F+A+DITF+NTA
Sbjct  245   ENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRNTA  304

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             GA+  QAVALR GSDLS FY C  + YQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  305   GAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNA  360



>ref|XP_004290811.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 168/364 (46%), Positives = 224/364 (62%), Gaps = 25/364 (7%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTN-YTKR  886
             T Y DLC S+L S P +S K   Q  +I  ++  T+     + +N   +     N     
Sbjct  62    TLYKDLCVSTLTSFPNLSSKTVPQ--IISSTVNKTMYEVIASNSNCTGIKKHNKNKLAAV  119

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVA-HADDLKTLMSAAMTNQETCLDG  709
             ++ A  DCLE  D  + QL   + +L    SKKS  A H + L+TL+SAAMTNQ TCL+G
Sbjct  120   QQQALDDCLELFDDTVAQLKVTMSELS---SKKSPAAKHYNHLRTLLSAAMTNQYTCLEG  176

Query  708   F-SHCKADHNARKPIFNGQVHVE-KLCSNCLSL---IRNMTDTDAQNEIKASGNRKLKEV  544
             F S   +   A K     +++   K  SN L +   IR + + ++ +E  A  N      
Sbjct  177   FDSSTSSTVKAVKAELESRLNTTCKHFSNALVMLKKIRGVVERESTDEFGAMKN------  230

Query  543   EGGCEWPEWLSAGDRRLLQSTAATP---NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVI  373
                  +P W+ +  R+LLQ+++A     +++VA DGSGN+ T+++AV  AP+ S+ R+VI
Sbjct  231   ----GFPTWVGSKARKLLQTSSANQTKYDLLVAKDGSGNFTTITDAVAAAPNSSATRFVI  286

Query  372   RIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLAR  193
              IKAG Y ENV+V   KTN+MF+GDG GKTV+  +RNV+DG TTF SATVAVVG  F+A+
Sbjct  287   YIKAGAYFENVEVVSKKTNLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGGGFIAK  346

Query  192   DITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFI  13
              ITF+N+AG SK QAVALR GSDLSAFY C    YQDTLYVHS RQFY +C I GTVDFI
Sbjct  347   GITFENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFI  406

Query  12    FGNA  1
             FGNA
Sbjct  407   FGNA  410



>ref|XP_008242331.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=554

 Score =   279 bits (713),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 153/358 (43%), Positives = 225/358 (63%), Gaps = 22/358 (6%)
 Frame = -2

Query  1056  YPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKI  877
             +P LC+++LAS  +      +   ++E ++  T+   E+ R +++ L+     Y + E+ 
Sbjct  55    HPSLCFTALASA-KTHDHFTTFHHLLEANINQTVASVESTRQSIKGLLKLQDLYLQ-ERN  112

Query  876   AFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHC  697
             A  DCLE +DQ L++L  A+ DL  +      V++ + LKTL+SAAMTN+ TC+DGF   
Sbjct  113   ALKDCLEMLDQTLYELGQAVDDLHGFR-----VSYGN-LKTLLSAAMTNENTCIDGFFEL  166

Query  696   KADHNARKPIFNGQVH-----VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGC  532
             +   +  +    G +      + +L S+CL++IR      A NE K    +K K+     
Sbjct  167   EEFDSENQIGLKGHLQGLLAPISELMSDCLAMIR--YQEQALNEQKRLVTKKPKK-----  219

Query  531   EWPEWLSAGDRRLLQ-STAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
              +P W+  GDR L+Q       ++VVAADG+G+Y T+ EA+K AP+ S  R+VI+IKAG 
Sbjct  220   RFPMWMLPGDRNLMQREPTMKADIVVAADGNGDYETIGEALKMAPNMSRTRFVIKIKAGV  279

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y E V++ + K NIM +GDG   T+ITG+++  DG +TF +AT+ V+G+RFLARD+T  N
Sbjct  280   YNETVEISREKANIMLVGDGMNTTIITGSKSFADGFSTFATATLTVIGDRFLARDLTVTN  339

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             TAG+ K QAVA RV S+ SAFY+C   +YQDTLYVHS RQFY  C+I GT+DFIFGNA
Sbjct  340   TAGSKKFQAVAARVTSN-SAFYHCNFSSYQDTLYVHSLRQFYRDCIIEGTIDFIFGNA  396



>ref|XP_004494389.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cicer arietinum]
Length=549

 Score =   278 bits (712),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 162/361 (45%), Positives = 225/361 (62%), Gaps = 23/361 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLV--VSTTNYTK  889
             T YP+LC S+L++  +++ K   Q  +I  +L +TI   +++  N  +L    S   Y +
Sbjct  48    TLYPNLCVSTLSTFQDLASKSVPQ--IICSTLNSTINEVKSSSFNCTRLKKRPSLHPYDQ  105

Query  888   REKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHA-DDLKTLMSAAMTNQETCLD  712
             R   A  DCL   D  + +L + + DL    S+  I +    + +TL+S AMTN  TCLD
Sbjct  106   R---ALDDCLNLFDNTIEELKSTINDL----SQTKITSKPYHNCQTLLSGAMTNVYTCLD  158

Query  711   GFSHCKAD--HNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEG  538
             GF++ K +  H   K ++    HV    SN L+L+  +     ++  ++    +  EV G
Sbjct  159   GFAYSKTNLRHKIEKKLYKISNHV----SNSLALLMKVPGVKNKSS-ESEAFPEYGEVNG  213

Query  537   GCEWPEWLSAGDRRLLQSTAATP--NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIK  364
             G  +P W++  DR+LLQ+  +    N+VVA DG+GN+ T+ EA+  AP+ S+ R+VI IK
Sbjct  214   G--FPSWITRKDRKLLQAAVSETHFNLVVAKDGTGNFSTIGEALAAAPNSSTTRFVIHIK  271

Query  363   AGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDIT  184
              G Y ENV+V K K N+M +GDG GKTV+  +RNVIDG TTF SAT AVVG  F+A+ IT
Sbjct  272   EGAYFENVEVIKKKINLMLVGDGIGKTVVKASRNVIDGWTTFQSATFAVVGSNFIAKGIT  331

Query  183   FQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGN  4
             F+N+AG SK QAVA+R G+D SAFYNC   AYQDTLYVHS RQFY +C I GTVDFIFGN
Sbjct  332   FENSAGPSKHQAVAVRSGADFSAFYNCSFVAYQDTLYVHSLRQFYRECDIYGTVDFIFGN  391

Query  3     A  1
             A
Sbjct  392   A  392



>ref|XP_010271269.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   277 bits (709),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 161/357 (45%), Positives = 225/357 (63%), Gaps = 22/357 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP++C S + S P ++    +Q    + +L +T+  A+     +  + VS+  + ++ 
Sbjct  37    TPYPEICESFMGSKP-LATLDETQFSFRDAALGSTLDQAQRAYGLISAMDVSS--FDEKA  93

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             +IA+ DC+E     + QLN AL       SK  +     D +T +SAA+TNQ+TC +GF 
Sbjct  94    RIAWDDCVELYADTVTQLNRALG------SKNPL--SWSDAQTWLSAAITNQQTCQNGFI  145

Query  702   HC-KADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
                K+ + +  P      +  K+ SN L++ +    + A    K  GNR+L   +G   +
Sbjct  146   ELGKSSYLSSFPFM--LSNFSKMVSNSLAINKEAASSAASLLGKQGGNRRLLS-DG---F  199

Query  525   PEWLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             P W+SA DR+LLQS +A    +VVVAADGSGNY+T+S+AV  +P +S KR+VI +K G Y
Sbjct  200   PTWVSAADRKLLQSPSAASQADVVVAADGSGNYKTISQAVAASPKRSGKRFVIYVKRGVY  259

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
             +ENV++  S  NIM IGDG   T +TG++NV DGSTTF +ATVAV G+ F+ARD+TF+NT
Sbjct  260   RENVEITAS--NIMLIGDGIDATTVTGSKNVQDGSTTFRTATVAVTGDGFIARDMTFENT  317

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG  K QAV+LR GSDLS FY C  K YQDTLYV+S RQFY  C I GTVDFIFG+A
Sbjct  318   AGPQKHQAVSLRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDA  374



>ref|XP_003519757.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Glycine max]
Length=562

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 156/357 (44%), Positives = 218/357 (61%), Gaps = 13/357 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YPDLC S+LA+ P+++ K   Q  VI   + +T+    ++  N   L     N    +
Sbjct  59    TLYPDLCVSTLATFPDLATKSVPQ--VISSVVNHTMYEVRSSSYNCSGLKKMLKNLNPLD  116

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVA-HADDLKTLMSAAMTNQETCLDGF  706
             + A  DCL+  +    +L   + DL    SK +I +    DL+T++S AMTN  TCLDGF
Sbjct  117   QRALDDCLKLFEDTNVELKATIDDL----SKSTIGSKRHHDLQTMLSGAMTNLYTCLDGF  172

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
             ++ K     R  I    + +    SN L+++  +         ++    +   ++ G  +
Sbjct  173   AYSKG--RVRDRIEKKLLEISHHVSNSLAMLNKVPGVKKLTTSESVVFPEYGNMKKG--F  228

Query  525   PEWLSAGDRRLLQSTAATP--NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             P W+S+ DR+LLQ+       +++VA DG+GN+ T+ EA+  AP+ S+ R+VI IK G Y
Sbjct  229   PSWVSSKDRKLLQAKVKETKFDLLVAKDGTGNFTTIGEALAVAPNSSTTRFVIHIKEGAY  288

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
              ENV+V + KTN+MF+GDG GKTV+ G+RNV+DG TTF SATVAVVG  F+A+ ITF+N+
Sbjct  289   FENVEVIRKKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVVGAGFIAKGITFENS  348

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG  K QAVALR G+D SAFY C    YQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  349   AGPDKHQAVALRSGADFSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNA  405



>ref|XP_002265217.1| PREDICTED: pectinesterase 3 [Vitis vinifera]
Length=578

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 162/417 (39%), Positives = 243/417 (58%), Gaps = 27/417 (6%)
 Frame = -2

Query  1206  KKMARTQEFLTLLASLVLISGDMVAGVAAG--------EANsldvsssiikssc----gS  1063
             K+  R +  + +++S+VL++  ++ G  AG        E+NS+  S     +S       
Sbjct  22    KRKTRKRLIILIISSVVLVA--VIIGAVAGTLIHKSKSESNSVPASPVSPATSIKAVCSV  79

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T+YPD C SS++S    +      +++  L+L+  + IAE ++ +     +S  +   + 
Sbjct  80    TQYPDSCVSSISSLD--TSNTTDPEELFRLTLR--VAIAELSKLSSLPRQLSAKSNDAQL  135

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVA-HADDLKTLMSAAMTNQETCLDGF  706
             K A G C    + A+ +LN ++  + V   +K + A   DD+KT +SA +T+QETCLD  
Sbjct  136   KKALGVCETVFEDAIDRLNDSISSMEVREGEKLLSASKIDDIKTWLSATITDQETCLDAL  195

Query  705   SHCKAD--HNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGC  532
                 +   +  +  + N  V      +    LI  + D D Q       +RKL       
Sbjct  196   EELNSTLLNEVKTAMQNSTVFASNSLAIVAKLIGILHDLDIQV------HRKLLSFSNSD  249

Query  531   EWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             ++P+W+ AG+RRLLQ T  TP+V VA DG+G+Y T+ EAV   P KS KR+VI +K G Y
Sbjct  250   QFPDWVGAGERRLLQETKPTPDVTVAKDGTGDYVTIKEAVAMVPKKSEKRFVIYVKEGNY  309

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
              EN+ + KSK N+M  GDG+ K++++GN N IDG+ TF +AT A VG+ F+A+ + F+NT
Sbjct  310   SENIILDKSKWNVMIYGDGKDKSIVSGNLNFIDGTPTFATATFAAVGKGFIAKYMRFENT  369

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AGA+K QAVA R GSD+S FY C   A+QDTLY HSNRQFY +C I+GT+DFIFGNA
Sbjct  370   AGAAKHQAVAFRSGSDMSVFYQCSFDAFQDTLYAHSNRQFYRECDITGTIDFIFGNA  426



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 160/362 (44%), Positives = 227/362 (63%), Gaps = 21/362 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVV-STTNYTKR  886
             T Y DLC S+L++ P+++ K   Q  +I   L NTIK  + + +N   L +   +  +  
Sbjct  52    TLYQDLCVSTLSTLPDLTSKTVPQ--IICSVLNNTIKEVKQSSSNCTGLRIRGRSAQSIL  109

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHAD--DLKTLMSAAMTNQETCLD  712
             ++ A  DC+   D  + +L T + DL      ++ VA +   D +TL+S AMTN  TCLD
Sbjct  110   DQRALEDCVNLFDTTIDELKTTISDLS---QTQTTVASSSKRDCQTLLSGAMTNVYTCLD  166

Query  711   GFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE---VE  541
             GF++ K+    RK I      +    SN L++++ +       + KAS +    E   V+
Sbjct  167   GFAYSKS--KLRKKIEAKLNDISSHVSNSLAMLKKVPGV----KTKASESETFPEYGKVK  220

Query  540   GGCEWPEWLSAGDRRLLQSTAATP--NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
              G  +P W+S  DR+LLQ+       ++VVA DG+GN+ T+ EA+  AP+ S+ R+VI I
Sbjct  221   DG--FPSWVSPKDRKLLQAAVNQTKFDLVVAKDGTGNFATIGEAIAAAPNSSATRFVIHI  278

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             KAG Y ENV+V K KTN+M +GDG G+TV+  +RNV+DG TTF S+T AVVG++F+A+ I
Sbjct  279   KAGAYFENVEVIKKKTNLMLVGDGIGQTVVKASRNVVDGWTTFQSSTFAVVGDKFIAKGI  338

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             TF+N+AG SK QAVA+R G+D SAFY C   AYQDTLYVHS RQFY +C + GTVDFIFG
Sbjct  339   TFENSAGPSKHQAVAVRNGADFSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFG  398

Query  6     NA  1
             NA
Sbjct  399   NA  400



>ref|XP_009594432.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Nicotiana tomentosiformis]
Length=543

 Score =   276 bits (705),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 151/354 (43%), Positives = 216/354 (61%), Gaps = 18/354 (5%)
 Frame = -2

Query  1047  LCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFG  868
             LC S + S  +    +R    ++  +++N++  A+    ++ K   ST + + R+++A  
Sbjct  54    LCLSHIQSNLDNHGHIRDPHSILRAAIRNSLNQAKLAIQSITKF--STLSASSRDQMAIE  111

Query  867   DCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKAD  688
             DC E +D ++ +L  +L ++R          +  +LK  +SAA++NQ+TCL+GF     D
Sbjct  112   DCQELLDFSVTELAWSLGEMRKIRDGLKNFHYEGNLKAWLSAALSNQDTCLEGFE--GTD  169

Query  687   HNARKPIFNGQVHVEKLCSNCLSL---IRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEW  517
              +    I      V +L SN L+L   + ++     +NE     N K         +PEW
Sbjct  170   RHLENFIKGSLTQVTQLISNVLTLYVQLHSLPFKSPRNETIKYENPK---------YPEW  220

Query  516   LSAGDRRLLQSTAATPNV--VVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKEN  343
             ++ GD+ +L S+    +V  VVA DGSG+YR++++A+  APS SS+RYVI +K G Y EN
Sbjct  221   MTNGDKEMLTSSPNKMHVDAVVALDGSGHYRSIAQAIYEAPSYSSRRYVIYVKRGIYHEN  280

Query  342   VDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGA  163
             VD+ K KTNIM +GDG G TVITGNRN + G TTF +ATVAV G+ F+ARDITF+NTAG 
Sbjct  281   VDMKKKKTNIMLVGDGIGATVITGNRNFMQGWTTFRTATVAVSGKGFIARDITFRNTAGP  340

Query  162   SKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
                Q VALRV SD SAF+ C M+ YQDTLY HS RQFY +C I GT+DFIFGN 
Sbjct  341   KNFQGVALRVDSDQSAFFRCSMEGYQDTLYAHSLRQFYRECNIYGTIDFIFGNG  394



>ref|XP_006658118.1| PREDICTED: pectinesterase 3-like [Oryza brachyantha]
Length=577

 Score =   276 bits (705),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 167/361 (46%), Positives = 212/361 (59%), Gaps = 13/361 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T + D+C S+LA+ P +++K    +DVI   +         + AN    +  +     R+
Sbjct  66    TLHRDVCVSTLATIPNLAQK--PLRDVISEVVGRAASAVRASSANCSSYLQRSQQLRVRD  123

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             ++A  DCLE     L QL TA  +L      +S       ++T++SAAMTNQ TCL+GF+
Sbjct  124   RLALSDCLELFGHTLDQLGTAAAELSA--GNRSAEESIAGVQTVLSAAMTNQYTCLEGFA  181

Query  702   HCKADHNAR-KPIFNGQV-HVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLK---EVEG  538
                A  + R +P   G++ HV  L SN L+++R +                L+    V  
Sbjct  182   GPSASEDGRVRPYIQGRIYHVAHLVSNSLAMVRRLPQQRRGRGRGLRSKEPLEGYGRVRR  241

Query  537   GCEWPEWLSAGDRRLLQSTAATPNVVVAA-DGSGNYRTVSEAVKNAPSKSSKRYVIRIKA  361
             G  +P W+S  DRR LQ   A    VV A DGSGN+ TVSEAV  AP+ S  RYVI IKA
Sbjct  242   G--FPSWVSGSDRRRLQQQVAPAANVVVAKDGSGNFTTVSEAVAAAPNNSETRYVIYIKA  299

Query  360   GTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAV-VGERFLARDIT  184
             G Y ENV+V   KTNIMF+GDG  +TVI  +RNV+D STTF SAT+AV  G  FLARDIT
Sbjct  300   GGYFENVEVGSEKTNIMFVGDGMWRTVIKASRNVVDNSTTFRSATLAVGGGTGFLARDIT  359

Query  183   FQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGN  4
              +N AG SK QAVALRV +DLSAFY C    YQDTLY HS RQFY  C I GTVDFIFG+
Sbjct  360   VENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDIYGTVDFIFGD  419

Query  3     A  1
             A
Sbjct  420   A  420



>ref|XP_010271268.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   274 bits (701),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 162/357 (45%), Positives = 221/357 (62%), Gaps = 21/357 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP++C S ++S   ++    +Q    E +L  T+  A   RA+     +  +++  + 
Sbjct  36    TPYPEICESFISSNKPLATLEETQFSFRESALSFTMDQAL--RAHGLISAMDLSSFDDKA  93

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K+A+ DC+E     + QLN      R   SK  +     D +T +SAA+TN++TC +GF+
Sbjct  94    KVAWADCVELYADTVTQLN------RTMGSKNPL--SWSDAQTWLSAAITNEQTCQNGFT  145

Query  702   HCK-ADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
                   + +  P      +  K+ SN L++ +    + A    K  GNR+L   +G   +
Sbjct  146   ELNLPSYLSSFPFM--LSNFSKMVSNSLAINKAAASSVASLMGKQGGNRRLLS-DG---F  199

Query  525   PEWLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTY  352
             P W+SA DR+LLQS++A    +VVVAADGSGNYRT+S+AV  +  +S KR+VI +K G Y
Sbjct  200   PTWVSAADRKLLQSSSAASQADVVVAADGSGNYRTISQAVAASSKRSGKRFVIYVKRGVY  259

Query  351   KENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNT  172
             KENV++  S  NIM IGDG   T++TG++NV DGSTTF SATVAV G  F+ARD+TFQNT
Sbjct  260   KENVEIKAS--NIMLIGDGIDATIVTGSKNVQDGSTTFRSATVAVTGGGFIARDMTFQNT  317

Query  171   AGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             AG  K QAVALR GSDLS FY C  K YQDTLYV+S RQFY  C I GTVDFIFG+A
Sbjct  318   AGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDA  374



>ref|XP_011092101.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Sesamum indicum]
Length=537

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 153/347 (44%), Positives = 214/347 (62%), Gaps = 32/347 (9%)
 Frame = -2

Query  999  RSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQLNTA  820
            RS   V+  +L++T+  A +    + K   +T + + RE++A  DC E +D ++ +L  +
Sbjct  60   RSPDSVLRAALQHTLNEASSASEALTKF--TTLSISPREQMAIDDCKELLDFSVSELAWS  117

Query  819  LQDL-RVYPSKKSIVAHAD-DLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQVHV  646
            + ++ R++   KS   H++ +LK  +SAA++NQ+TCL+GF     D      I      V
Sbjct  118  VDEMNRIHAGLKS--PHSEGNLKAWLSAALSNQDTCLEGFE--GTDRRLEHFIRGSLSQV  173

Query  645  EKLCSNCLSLIRNM----------TDTDAQNEIKASGNRKLKEVEGGCEWPEWLSAGDRR  496
             +L  N L+L   M            T A NE +  G            +P+W++ GD+ 
Sbjct  174  NQLIGNVLTLYTQMHSLPFRPPRNNSTAADNENRNKG------------FPQWMTEGDKE  221

Query  495  LLQSTAATPNV--VVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSK  322
            LL S+    +V  VVA DGSG YR++++A+  APS S++RYVI +K G YKEN+D+ K K
Sbjct  222  LLVSSQNGMHVDAVVAVDGSGQYRSIAQAIYEAPSYSNRRYVIYVKKGVYKENIDMKKKK  281

Query  321  TNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVA  142
            TNIM +GDG G+T++TGNRN + G TTF +ATVAV G+ FLARDITF+NTAG    Q VA
Sbjct  282  TNIMLVGDGIGQTIVTGNRNFMQGWTTFRTATVAVSGKGFLARDITFRNTAGPESHQGVA  341

Query  141  LRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
            LRV SD SAFY C M+ YQDTLY HS RQFY +C ISGT+DFIFGN 
Sbjct  342  LRVDSDQSAFYRCSMEGYQDTLYAHSLRQFYRECSISGTIDFIFGNG  388



>ref|XP_009592542.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=568

 Score =   274 bits (700),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 164/362 (45%), Positives = 218/362 (60%), Gaps = 24/362 (7%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T +P+LC S+L+S P + +K  S  ++I  ++K  +     +  N   L          E
Sbjct  64    TLHPELCVSTLSSFPNLHRK--SIAEIISSTVKIAVGEVRASAHNCSDLRRHVPKLEPIE  121

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A  DC+E + + + +L TAL DL     KKS   H +D++TL+SAAMTN++TCLDG  
Sbjct  122   KRALQDCVELLGETIAELRTALSDLS---PKKSASKHYNDIQTLLSAAMTNEDTCLDGLF  178

Query  702   HCKADHNARKPIFNGQVH-VEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV--EGGC  532
             +   ++  R       +H +    SN L+++         N+IK +      EV  E G 
Sbjct  179   YSTKNNLTR--YVEDNLHTIAHHVSNSLAML---------NKIKRTSVSSSDEVFPEYGA  227

Query  531   E---WPEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
                 +P+WL   +R LLQ        ++ VA DGSGN+ T++EA+  AP+ ++ R+VI I
Sbjct  228   MKNGFPKWLKRRERALLQVPVNETKFDLAVAKDGSGNFTTINEALSAAPNSTNTRFVIYI  287

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             K G+Y E V+V K K  IMF+GDG GKT I GNRN +DG TTF SATVAVVG+ FLA+ I
Sbjct  288   KEGSYFEYVEVDKKKNMIMFVGDGVGKTKIKGNRNHVDGWTTFRSATVAVVGKGFLAKGI  347

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             TF+N AG SK QAV LR  SDLSAFY C   AYQDTLYVHS RQFY +C I GTVDFIFG
Sbjct  348   TFENYAGPSKHQAVTLRSSSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDIYGTVDFIFG  407

Query  6     NA  1
             NA
Sbjct  408   NA  409



>emb|CDP03036.1| unnamed protein product [Coffea canephora]
Length=595

 Score =   275 bits (702),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 149/362 (41%), Positives = 223/362 (62%), Gaps = 14/362 (4%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIK-IAETNRANVQKLVVSTTNYTKR  886
             T Y  LC+++L+S P  +  V +   V+E ++  T + + +T  A+V        N   +
Sbjct  82    TLYSSLCFTTLSSIPPSNTTV-TFHHVLEFAINQTKEHVLDTQVASVAHFENQELN--AQ  138

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADD-LKTLMSAAMTNQETCLDG  709
             ++ A  DC+E +DQ  ++L  A+ DL  +PSK+  +  +   LK L+SAAMTN  TC+DG
Sbjct  139   QQNALRDCMEMLDQTTYELEQAIDDLHKFPSKRGYIPRSYGYLKILLSAAMTNGYTCIDG  198

Query  708   FSHCK-----ADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV  544
              S  +        + +    N    +  + SNCL++I  +     +  +       +K  
Sbjct  199   LSDLEELGSDGQKDLKGHFENLLTPISHMISNCLAMIAEVEREMRKETLNNPRMLSMKVQ  258

Query  543   EGGCEWPEWLSAGDRRLLQS-TAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
             E G  + +W++  DR+L+++ T  +PNV+VA+DGSG+Y  + EA+ NAP  S+KRYVI+I
Sbjct  259   EDG--FLDWMTVADRKLMETPTELSPNVIVASDGSGDYTRIGEAIANAPDFSTKRYVIKI  316

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
              AG Y ENV +P+ K N+M  GDG   T++ G++N +DG +TF SAT+ V G++F+A+ +
Sbjct  317   NAGIYGENVVIPREKINLMLTGDGMNSTILIGSKNFVDGYSTFASATLTVAGDKFIAQHL  376

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             +  NTAGA K QAVALRV S+ +AFY CEM +YQDTLY HS RQFY +C I GTVDFIFG
Sbjct  377   SIINTAGAEKHQAVALRVTSN-AAFYRCEMISYQDTLYAHSLRQFYRECSIGGTVDFIFG  435

Query  6     NA  1
             NA
Sbjct  436   NA  437



>ref|XP_010035249.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Eucalyptus grandis]
Length=596

 Score =   274 bits (701),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 161/371 (43%), Positives = 220/371 (59%), Gaps = 31/371 (8%)
 Frame = -2

Query  1059  RYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREK  880
             RYPDLC SSL   P     V S++D+I +S   T++    NRA  Q    S  NY + E 
Sbjct  81    RYPDLCVSSLLDFP--GSMVASEQDLIHISFNMTLQ--HFNRALYQS---SGMNYLQMEP  133

Query  879   IA---FGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDG  709
             IA   + DCLE +  ++  L+ +L  +          A A+D+ T +SAA+TNQ+TC +G
Sbjct  134   IARSAYDDCLELLGASVDALSRSLSAV----GGSGSPAPAEDIVTWLSAALTNQDTCGEG  189

Query  708   FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGC-  532
              +   A    +  +  G   +E+L SNCL++            +     R+L +V GG  
Sbjct  190   LA--DASGGVKDRMAAGLKDLEELVSNCLAIFAASDGGGDFAGVPIENRRRLMDVAGGGG  247

Query  531   ----------EWPEWLSAGDRRLLQSTAA--TPNVVVAADG-SGNYRTVSEAVKNAPSKS  391
                       E+PEWL   +R LL   AA    ++VVA DG SG Y+T++EA+K AP  S
Sbjct  248   GVPKPDGGGGEYPEWLGERERELLDMPAAEVQADIVVAKDGASGTYKTIAEAIKKAPESS  307

Query  390   SKRYVIRIKAGTYKE-NVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVV  214
              +R +I ++AG Y+E N+ V K KTN+MFIGDG+G+TVITG ++V D  TTF++A+ A  
Sbjct  308   GRRIIIYVRAGRYEEDNLKVGKKKTNLMFIGDGKGRTVITGGKSVADKMTTFHTASFAAS  367

Query  213   GERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLI  34
             G  F+ARD+TF+N AG  K QAVALRVG+D    Y C +  YQDTLYVHSNRQF+ +C I
Sbjct  368   GAGFIARDMTFENYAGPEKHQAVALRVGADHGVVYRCSIVGYQDTLYVHSNRQFFRECDI  427

Query  33    SGTVDFIFGNA  1
              GTVDFIFGNA
Sbjct  428   YGTVDFIFGNA  438



>ref|XP_010264199.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   271 bits (694),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 161/358 (45%), Positives = 211/358 (59%), Gaps = 32/358 (9%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YPD C SS+   P  S   + + +  ++SL+  ++ A    ++ + L     N  KRE
Sbjct  42    TPYPDTCKSSMNPDPR-SNAPKRKHEFRKMSLQAAMERALRAESHTKWLGPKCRN--KRE  98

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K+A+ DCL+     + QLNT L     Y           D++T +S A+TN ETC  GF 
Sbjct  99    KVAWADCLQLYQNTVLQLNTTLNPYSRYTDV--------DVQTWLSTALTNLETCKTGFI  150

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWP  523
                   +   P+ +   +V KL SN L++  N T T  QN+    G            +P
Sbjct  151   ELGVS-DFMLPLMSN--NVSKLISNTLAINNNATTT--QNQSYTGG------------YP  193

Query  522   EWLSAGDRRLLQST--AATPNVVVAADGSGNYRTVSEAVKNAPSK--SSKRYVIRIKAGT  355
              W+SAGDR+LLQS+  A+  N+VVA DGSGN+RT+ EA+  A  +   S R+VI +K G 
Sbjct  194   SWVSAGDRKLLQSSSPASQANIVVAQDGSGNFRTIKEALSAASQQRTGSGRFVIYVKKGA  253

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y EN+++  S  NIM +GDG   T+ITGNR+V  GSTTFNSATVAV G+ F+A  ITF+N
Sbjct  254   YIENLEIGSSLQNIMLVGDGMRNTIITGNRSVGGGSTTFNSATVAVTGQGFIAMGITFRN  313

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             TAG    QAVALR GSDLS FY C  + YQDTLYVHS RQ Y +C I GTVDFIFGNA
Sbjct  314   TAGPENHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQLYKECYIYGTVDFIFGNA  371



>ref|XP_010056336.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 157/358 (44%), Positives = 213/358 (59%), Gaps = 41/358 (11%)
 Frame = -2

Query  1056  YPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKI  877
             YP  C   L   P+    ++ + D +++S++  ++ A+    +   L    +N  +REK+
Sbjct  38    YPQPCEYFLTHNPK-QAPIKQKSDFLKISMQLALERAQLAHDHTHSLESKCSN--EREKV  94

Query  876   AFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAH---ADDLKTLMSAAMTNQETCLDGF  706
             A+ DCL+  +  + +LN               + H    D+ +T +S A+TN ETC  GF
Sbjct  95    AWADCLQLYEHTVLRLNRT-------------IGHDCTQDEAQTWLSTALTNLETCRAGF  141

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
                    N    + N   +V KL SN L+L  N       N  K              ++
Sbjct  142   VELGISDNVLPLMSN---NVSKLISNTLAL--NYAPFTTPNYTK--------------KF  182

Query  525   PEWLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKS-SKRYVIRIKAGT  355
             P W+   DR+LLQS++A    N+VVA D SGNY+T+SEA+  A  ++ + RY+I IKAGT
Sbjct  183   PTWVRPSDRKLLQSSSAVSKANIVVARDSSGNYKTISEAITAASKRTGTARYIIYIKAGT  242

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y EN++V     NIMFIGDG GKT+ITG+++V  GSTTFNSATVAVVG+ F+A+DITF+N
Sbjct  243   YNENIEVGSKLDNIMFIGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRN  302

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             TAGA+  QAVALR GSDLS FY C  + YQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  303   TAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNA  360



>ref|XP_008653464.1| PREDICTED: pectinesterase-like [Zea mays]
 tpg|DAA64103.1| TPA: hypothetical protein ZEAMMB73_876271 [Zea mays]
Length=605

 Score =   273 bits (699),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 159/367 (43%), Positives = 222/367 (60%), Gaps = 20/367 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTK-R  886
             T + D+C S+L S P++++K    ++VI   +         + +N    +       + R
Sbjct  89    TLHRDVCASTLGSIPDLARK--PAREVISAVVARAASAVRASASNCSAYLRRPAGALRVR  146

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRV--YPSKKSIVAHAD--DLKTLMSAAMTNQETC  718
             +++A  DC+E +   L QL TA  +L    + + ++ V       ++T++SAA+TNQ TC
Sbjct  147   DRLALADCVELLGHTLAQLGTAEAELSAGNFTAAEAEVESESLAAVQTVLSAALTNQYTC  206

Query  717   LDGFSHCKADHNAR-KPIFNGQV-HVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEV  544
             LDGF+   A  + R +P   G++ HV  L SN L+++R +     + + + +      E+
Sbjct  207   LDGFAGPSASEDGRVRPYIQGRMYHVAHLVSNSLAMLRRLPQRRRRRQGRGA-----LEL  261

Query  543   EGGCE----WPEWLSAGDRRLLQS--TAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKR  382
             EG       +P W+S  DRR LQ       P++VVA DGSGN+ TV EAV  AP+ S  R
Sbjct  262   EGYGRVRRGFPSWVSGADRRRLQQQQVVPGPDLVVAKDGSGNFTTVGEAVAAAPNNSETR  321

Query  381   YVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERF  202
             +VI IKAG Y ENV+V   KTN+MF+GDG  +TVI  +RNV+D STTF SAT+AVVG  F
Sbjct  322   FVIYIKAGGYFENVEVGSEKTNLMFVGDGMWRTVIKASRNVVDNSTTFRSATLAVVGTGF  381

Query  201   LARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTV  22
             LARD+T +N AG SK QAVALRV +DLSAFY C    YQDTLY HS RQFY  C + GTV
Sbjct  382   LARDLTVENAAGPSKHQAVALRVNADLSAFYRCAFAGYQDTLYAHSLRQFYRDCDVYGTV  441

Query  21    DFIFGNA  1
             DF+FG+A
Sbjct  442   DFVFGDA  448



>gb|EPS67019.1| pectinesterase, partial [Genlisea aurea]
Length=335

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  WPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
            WPEWLSA DR+LLQ+     +V VAADG+GNYRTVSEAV  APS  S RYVIRIKAG Y 
Sbjct  4    WPEWLSAADRKLLQAPDVAADVTVAADGTGNYRTVSEAVAAAPSGYSGRYVIRIKAGVYS  63

Query  348  ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
            E V +P +K N+MF+GDG   T+ITG++N +DGSTTFNSATVAVVG  FLARDITFQNTA
Sbjct  64   EYVQIPSAKKNLMFVGDGASNTIITGDKNDVDGSTTFNSATVAVVGANFLARDITFQNTA  123

Query  168  GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
            GA K QAVALRV +DL+AFY C + AYQDTLY HS RQFY  C I+GTVDFIFGNA
Sbjct  124  GAVKHQAVALRVSADLTAFYRCGINAYQDTLYAHSLRQFYTNCTITGTVDFIFGNA  179



>ref|XP_010556724.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=547

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 164/362 (45%), Positives = 221/362 (61%), Gaps = 24/362 (7%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIK---IAETNRANVQKLVVSTTNYT  892
             TR+ DLC+S L+S P  +    S  ++I  ++  TI    I+ +N + +Q+ +    + +
Sbjct  54    TRFKDLCFSPLSSLPPGNSS--SVPELIAATVNETISEVMISSSNCSGLQRRL--GPDLS  109

Query  891   KREKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLD  712
              R+  A  DCLE +      L+ AL DL       S      DL+TL+SAAMTNQ TCLD
Sbjct  110   PRDSRALEDCLELLGDTAGDLDDALADLH----SPSAAREFYDLQTLLSAAMTNQYTCLD  165

Query  711   GFSHCKAD--HNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEG  538
             GF+  + +  +  R  I +   ++ +  SN L++++ +         K     +   VE 
Sbjct  166   GFAFNERNRKYRVRDSIKDSLFNISRHVSNSLAMLQEI-------PAKPGVFPEYGRVEN  218

Query  537   GCEWPEWLSAGDRRLLQSTAATP---NVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
             G  +P W+S  DRRLLQ+ A      ++VVA DG+GN+ TVS AV  AP+ S+ R+VI I
Sbjct  219   G-GFPTWVSRSDRRLLQAPANDTKLFDLVVAKDGTGNFTTVSAAVAAAPNSSTTRFVIYI  277

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             K G Y ENV+V + KT +M +GDG GKTV+  NRNV+DG TTF SATVAVVG  F+A+ I
Sbjct  278   KEGAYFENVEVGRKKTMLMLVGDGIGKTVVKANRNVVDGWTTFRSATVAVVGNGFIAKGI  337

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             TF+N AG +K QAVALR GSD SAFY C    YQDTLYVHS RQF+ +C I GTVDFIFG
Sbjct  338   TFENFAGPTKHQAVALRSGSDHSAFYLCSFVGYQDTLYVHSFRQFFRECDIYGTVDFIFG  397

Query  6     NA  1
             NA
Sbjct  398   NA  399



>ref|XP_010056337.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 169/403 (42%), Positives = 229/403 (57%), Gaps = 46/403 (11%)
 Frame = -2

Query  1200  MARTQEFLTLLASLVLISGDMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLAST  1021
             M   Q+F+T +  L L+     +G + G+A S                YP  C   L   
Sbjct  1     MDLLQKFITFVF-LSLVISPSTSGFSTGDAKSWCSKMP----------YPQPCEYFLTHN  49

Query  1020  PEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQA  841
             P+ +  ++ + D +++S +  ++ A    +N   L     N  +REK  + DCLE  +Q 
Sbjct  50    PK-NIPIKQKSDFLKVSKQLVLERALRAHSNAYSLGSKCRN--EREKAVWADCLELYEQT  106

Query  840   LFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFN  661
             + +LN  + DL+            +D++T +S A+TN ETC  GF            + N
Sbjct  107   ILRLNRTV-DLK---------CTQEDVQTWLSTALTNLETCRTGFVELGVSDYVLPLMSN  156

Query  660   GQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQST  481
                +V KL SN L+L          N +      K      G  +P W+  GDR+LLQS+
Sbjct  157   ---NVTKLISNTLAL----------NHVP----YKPPSYTNG--YPNWVRPGDRKLLQSS  197

Query  480   AATP--NVVVAADGSGNYRTVSEAVKNAPSK-SSKRYVIRIKAGTYKENVDVPKSKTNIM  310
             + +   N+VVA DGSG Y+T+ EA+  A  +  + RYVI +KAGTYKEN++V     NIM
Sbjct  198   SPSSKANIVVAKDGSGKYKTIKEAITAASKRFGTARYVIYVKAGTYKENIEVGSKLKNIM  257

Query  309   FIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVG  130
             F+GDG GKT+ITG+R+V  GSTTF SATVAVVG+ F+ARDITF+NTAGA+  QAVALR G
Sbjct  258   FVGDGIGKTIITGSRSVGGGSTTFKSATVAVVGDGFIARDITFRNTAGAANHQAVALRSG  317

Query  129   SDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             SDLS FY C  + YQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  318   SDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGNA  360



>ref|XP_010273808.1| PREDICTED: pectinesterase 3 [Nelumbo nucifera]
Length=590

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 155/359 (43%), Positives = 223/359 (62%), Gaps = 11/359 (3%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNR-ANVQKLVVSTTNYTKR  886
             T+YP+ C+SSL+S    ++K    +++ +LSL+  + + E ++ A++   ++   N    
Sbjct  85    TQYPNSCFSSLSSL--AAQKTTDPEELFKLSLQ--VALTELSKLASLPTKLIPKVNGDPL  140

Query  885   EKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVA-HADDLKTLMSAAMTNQETCLDG  709
               +   DC    + A+ QLN ++  ++V   +K + A    DL+T +SAA+TN+++CLDG
Sbjct  141   LVLTLRDCQTQFEDAIDQLNMSISSMQVSQGEKLLSASKISDLRTWLSAAITNEQSCLDG  200

Query  708   FSHCKAD--HNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGG  535
                  +    N  + +     +  +  SN L+++  +       +I    +RKL +V   
Sbjct  201   LQELNSTTAANVLEELRVAMKNSTEFTSNSLAIVSKILTLLENLDIPI--HRKLLDVGSD  258

Query  534   C-EWPEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
               E+P W+   DRRLLQ T  TP+VVVA DGSG Y+T+ EAV   P KS KR+VI +KAG
Sbjct  259   SDEFPAWMHPDDRRLLQETGVTPDVVVAKDGSGKYKTIEEAVVVVPKKSVKRFVIYVKAG  318

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              Y ENV V KSK N+M  GDG GKT+++G  NV DG+ TF++AT AV G+ F+A+D++F 
Sbjct  319   MYVENVVVDKSKWNVMMYGDGIGKTIVSGRSNVKDGTPTFSTATFAVAGKGFIAKDMSFI  378

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             NTAG  K QAVALR GSDLS FY C    YQDTLY HSNRQFY +C I+GT+DFIFGNA
Sbjct  379   NTAGPEKHQAVALRSGSDLSVFYRCSFDGYQDTLYAHSNRQFYRECDITGTIDFIFGNA  437



>ref|XP_006344697.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22-like 
[Solanum tuberosum]
Length=502

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 151/354 (43%), Positives = 218/354 (62%), Gaps = 19/354 (5%)
 Frame = -2

Query  1047  LCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFG  868
             LC S + S  +     R    +++ +++N++  A+    ++ K   ST + + R+++A  
Sbjct  14    LCLSHIQSNLD-DPVHRDPNSILKAAIQNSLNQAKLTIQSITKF--STLSASSRDQMAIE  70

Query  867   DCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKAD  688
             DC E +D ++ +L  +L ++R   +    V +  +LK  +SAA++NQ+TCL+GF     D
Sbjct  71    DCQELLDFSVTELAWSLGEMRKIRAGSKNVHYEGNLKAWLSAALSNQDTCLEGFE--GTD  128

Query  687   HNARKPIFNGQVHVEKLCSNCLSL---IRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEW  517
              +    I      V +L SN L+L   + ++     +NE     N+K         +PEW
Sbjct  129   RHLEHFIKGSLTQVTQLISNVLTLYVQLHSLPFKPPRNENITYENQK---------YPEW  179

Query  516   LSAGDRRLLQSTAATPNV--VVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKEN  343
             ++ GD+ LL S     +V  VV+ DGSG YR++++A+  APS S++RYVI +K GTY EN
Sbjct  180   MTNGDKDLLVSNPNGMHVDAVVSLDGSGRYRSIAQAINEAPSYSNRRYVIYVKRGTYHEN  239

Query  342   VDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGA  163
             +D+ K KTNIM +GDG G TVITGNRN + G TTF +ATVAV G+ F+ARDITF+NTAG 
Sbjct  240   IDLKKKKTNIMLLGDGIGATVITGNRNFMQGWTTFRTATVAVSGKGFIARDITFRNTAGP  299

Query  162   SKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
                Q VALRV SD SAF+ C M+ YQDTLY HS RQFY +C I GT+DFIFGN 
Sbjct  300   KNFQGVALRVDSDQSAFFRCSMEGYQDTLYAHSLRQFYRECNIYGTIDFIFGNG  353



>ref|XP_010266280.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   270 bits (691),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 158/356 (44%), Positives = 218/356 (61%), Gaps = 18/356 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP++C S + S P V+    +Q +  E +L  T+ + +  RA+     +   ++  + 
Sbjct  35    TPYPEICESFITSKPLVTLD-ETQFNFRETAL--TVTLDQAQRAHGLISAMDLGSFDDKS  91

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K+A+ DC+E     + QLN      R   SK  ++    D +T +SAA+TN++TC +GF 
Sbjct  92    KMAWADCVELYADTVSQLN------RSMASKNPLIW--SDAQTWLSAAITNEQTCRNGFI  143

Query  702   HCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWP  523
                +        F    ++ K+ SN L++ +    T + +     G    + +  G  +P
Sbjct  144   ELSSSSQLSSFPFM-LTNLSKMVSNSLAINKAAASTSSASLFGKQGANNRRLLSDG--FP  200

Query  522   EWLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYK  349
              W+SA DR+LLQS+ A    +VVVAADGSGNY+T+SEAV  +  +S  R+VI +K G YK
Sbjct  201   TWVSAADRKLLQSSGAASQADVVVAADGSGNYKTISEAVAASSKRSGSRFVIYVKRGVYK  260

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             ENV++  S  NIM IGDG   T++TG+RNV DGSTTF SATVAV G  F+ARD+TF+NTA
Sbjct  261   ENVEIKAS--NIMLIGDGIDATIVTGSRNVQDGSTTFRSATVAVTGGGFIARDMTFENTA  318

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G  K QAVALR GSDLS FY C +K YQDTLYV+S RQFY  C I GTVDFIFG+A
Sbjct  319   GPQKHQAVALRSGSDLSVFYRCSLKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDA  374



>ref|XP_008451545.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=595

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 166/362 (46%), Positives = 233/362 (64%), Gaps = 23/362 (6%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIK---IAETNRANVQKLVVSTTNYT  892
             T +P+LC+S L+S P+++    S + +   +L  T +   +A  N  N++  +    N T
Sbjct  90    TLFPNLCFSKLSSFPQLAS--LSPEKLAGSALNFTTREVLLAYANCTNLKTHLYCGLNPT  147

Query  891   KREKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLD  712
              R   A  DCLE +D ++ +L  ++ DL   PS+ S   H+ DL TL+SAAMTN  TC+D
Sbjct  148   DRH--ALDDCLELLDDSIAELKASILDLG--PSQ-SAARHSHDLLTLVSAAMTNHRTCVD  202

Query  711   GFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKE---VE  541
             GF +      +R  ++ G++   +  S  L++++ +   +   +++      L E   V+
Sbjct  203   GFYNSSGTVRSRVELYLGKI--GQHLSIDLAMLKKIPGVNRATKVE----EVLPEYGAVK  256

Query  540   GGCEWPEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
             GG  +P+W+S  DRRLLQ+       N+VVA DGSGN+ TV+EAV  AP+ S+ R+VI I
Sbjct  257   GG--FPKWVSVKDRRLLQAAVNETKFNLVVAKDGSGNFTTVNEAVAAAPNSSTTRFVIYI  314

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             KAG Y ENV++ ++K+N+MF+GDG GKT+I G+RNV+DG TTF SATVAVVG  F+A+ I
Sbjct  315   KAGAYFENVEIGRAKSNLMFVGDGIGKTLIKGDRNVVDGWTTFRSATVAVVGTGFIAKGI  374

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             TF+N AG SK QAVALR  SD SAFY C    YQDTLYVHS RQFY +C I GT+DFIFG
Sbjct  375   TFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRECDIYGTIDFIFG  434

Query  6     NA  1
             NA
Sbjct  435   NA  436



>ref|XP_010271267.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   270 bits (691),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 159/360 (44%), Positives = 220/360 (61%), Gaps = 25/360 (7%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTI---KIAETNRANVQKLVVSTTNYT  892
             T YP++C S   S    S K  +  D  + SL++      + +  RA      +  +++ 
Sbjct  31    TPYPEICESYFMS---YSNKPLATLDETQFSLRDAALGSTLDQAQRAYGLISAMDVSSFD  87

Query  891   KREKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLD  712
             ++ K+A+ DC+E     + QLN A+       SK  +     D +T +SAA+TNQ+TC +
Sbjct  88    EKAKMAWADCVELYSDTVTQLNRAMG------SKNPL--SWSDAQTWLSAAITNQQTCQN  139

Query  711   GFSHC-KADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGG  535
             GF    K+ + +  P      +  K+ SN L++ +    + A    K  GNR+L   +G 
Sbjct  140   GFVELGKSSYLSSFPFM--LSNFSKMVSNSLAINKEADSSAASLLGKQGGNRRLLS-DG-  195

Query  534   CEWPEWLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKA  361
               +P W+SA DR+LLQS +A    +VVVAADGSGNY+T+SEAV  +  +S KR+VI +K 
Sbjct  196   --FPTWVSAADRKLLQSPSAASQADVVVAADGSGNYKTISEAVAASSKRSGKRFVIYVKK  253

Query  360   GTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITF  181
             G YKENV++  S  NIM IGDG   T++T ++N  DGSTTF +ATV V G+ F+ARD+TF
Sbjct  254   GVYKENVEIKAS--NIMLIGDGIDATIVTDSKNAQDGSTTFRTATVGVTGDGFMARDMTF  311

Query  180   QNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             +NTAG  K QAVALR GSDLS FY+C  K YQDTLYV+S RQFY  C I GTVDFIFG+A
Sbjct  312   ENTAGPQKHQAVALRSGSDLSVFYSCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDA  371



>ref|XP_011090444.1| PREDICTED: pectinesterase 2 [Sesamum indicum]
Length=531

 Score =   270 bits (691),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 169/398 (42%), Positives = 227/398 (57%), Gaps = 38/398 (10%)
 Frame = -2

Query  1191  TQEFLTLLASLVLISGDMVAGVAAGEANsldvsssiiksscgSTRYPDLCYSSLASTPEV  1012
             T+  LTLL + +L+    V+G ++            IK+ C  T  P  C       P+ 
Sbjct  16    TRTILTLLFASILVFSPAVSGGSSA----------AIKAWCSQTPNPQPCEYFFTHNPKY  65

Query  1011  SKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQ  832
                ++++ D  +LS +  +      ++N+  L     N  +REK A+ DC+E  +  + +
Sbjct  66    KVPIKNKSDFFKLSTQLALDRCMHVQSNLHLLGPKCRN--EREKAAWADCVELYEHTIHK  123

Query  831   LNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQV  652
             +NT +      P+ K   A   D +T +S A+TN ETC  GF       +   P+ +  V
Sbjct  124   INTTVD-----PNTKCTPA---DAQTWLSTALTNLETCKSGFVDFGITDDYMFPMMSNNV  175

Query  651   HVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQSTAAT  472
              +  L SN L+L +           K          EG   +P W+  GDR+LLQS+  T
Sbjct  176   SL--LLSNTLALNKGPYANGPAGSYK----------EG---FPSWVKPGDRKLLQSSTPT  220

Query  471   PNVVVAADGSGNYRTVSEAVKNAPSKS-SKRYVIRIKAGTYKENVDVPKSKTNIMFIGDG  295
              NVVVA DGSGNY+TVSEAV  A  +S S R+VI +K GTY+ENV++  +  NIM +GDG
Sbjct  221   ANVVVAQDGSGNYKTVSEAVAAAGKRSGSGRFVIHVKQGTYRENVNI--AAKNIMLLGDG  278

Query  294   RGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSA  115
              GKT+ITG+R+V  GSTTF SATVA VG+ F+AR ITF+NTAGA   QAVA R GSDLS 
Sbjct  279   IGKTIITGSRSVGGGSTTFKSATVAAVGDGFIARGITFRNTAGAQNHQAVAFRSGSDLSV  338

Query  114   FYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             FY C  + YQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  339   FYQCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNA  376



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   270 bits (691),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 173/397 (44%), Positives = 235/397 (59%), Gaps = 30/397 (8%)
 Frame = -2

Query  1173  LLASLVLISGDMVAGVAAGEANsldvsssiiksscgSTRYPDLC---YSSLASTPEVS-K  1006
             L+   V IS  +V GV   E          I SSC  T YP++C   + S ++ P  +  
Sbjct  4     LVLGFVCISLALVIGVVNSET---------ISSSCSQTPYPEICESYFMSYSNKPLATLD  54

Query  1005  KVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQLN  826
                +Q    E +L  T+  A   RA+     +  +++  + K+A+ DC+E     + QLN
Sbjct  55    DHETQFSFREAALSFTMDQAL--RAHGLISAMDLSSFDDKAKVAWADCVELYADTITQLN  112

Query  825   TALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQVHV  646
                   R   S K+ +  +D  +T +SAA+TNQ+TC +GF+                 + 
Sbjct  113   ------RTMGSNKNPLRWSD-AQTWLSAAITNQQTCQNGFTELNLSSYLSNSFPFMLSNF  165

Query  645   EKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQSTAAT--  472
              K+ SN L++ +    + A    K  GNR+L   +G   +P W+SA DR+LLQS++A   
Sbjct  166   SKMISNSLAINKAAASSVASLMGKQGGNRRLLS-DG---FPTWVSAADRKLLQSSSAASQ  221

Query  471   PNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGR  292
              +VVVAADGSGNYRT+S+AV  +  +S KR+VI +K G YKENV++  S  NIM IGDG 
Sbjct  222   ADVVVAADGSGNYRTISQAVAASSKRSGKRFVIYVKRGVYKENVEIKAS--NIMLIGDGI  279

Query  291   GKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAF  112
               T++TG++NV DGSTTF SATVAV  +RF+ARD+TF+NTAG  K QAVALR GSDLS F
Sbjct  280   DATIVTGSKNVQDGSTTFRSATVAVTRDRFMARDMTFENTAGPQKHQAVALRSGSDLSVF  339

Query  111   YNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             Y C  K YQDTLYV+S RQFY  C I GTVDFIFG+A
Sbjct  340   YRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDA  376



>sp|P83218.1|PME_DAUCA RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase [Daucus carota]
Length=319

 Score =   263 bits (672),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = -2

Query  489  QSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIM  310
            QS+  TPNVVVAADGSG+Y+TVSEAV  AP  S  RYVIRIKAG Y+ENVDVPK K NIM
Sbjct  1    QSSTVTPNVVVAADGSGDYKTVSEAVAAAPEDSKTRYVIRIKAGVYRENVDVPKKKKNIM  60

Query  309  FIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVG  130
            F+GDGR  T+IT ++NV DGSTTFNSATVA VG  FLARDITFQNTAGA+K QAVALRVG
Sbjct  61   FLGDGRTSTIITASKNVQDGSTTFNSATVAAVGAGFLARDITFQNTAGAAKHQAVALRVG  120

Query  129  SDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
            SDLSAFY C++ AYQD+LYVHSNRQF++ C I+GTVDFIFGNA
Sbjct  121  SDLSAFYRCDILAYQDSLYVHSNRQFFINCFIAGTVDFIFGNA  163



>ref|XP_010056338.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   269 bits (688),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 156/358 (44%), Positives = 212/358 (59%), Gaps = 41/358 (11%)
 Frame = -2

Query  1056  YPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKI  877
             YP  C   L   P+    ++ + D +++S++  ++ A+    +   L    +N  +REK 
Sbjct  38    YPQPCEYFLTHNPK-QAPIKQKSDFLKISMQLALERAQLAHDHTHSLESKCSN--EREKA  94

Query  876   AFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAH---ADDLKTLMSAAMTNQETCLDGF  706
             A+ DCL+  +  + +LN               + H    D+ +T +S A+TN ETC  GF
Sbjct  95    AWADCLQLYEHTVLRLN-------------RTIGHECTQDEAQTWLSTALTNLETCRAGF  141

Query  705   SHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
                    N    + N   +V KL SN L+L  N       N  K              ++
Sbjct  142   VELGISDNVLPLMSN---NVSKLISNTLAL--NYAPFTTPNYTK--------------KF  182

Query  525   PEWLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKS-SKRYVIRIKAGT  355
             P W+   DR+LLQS++A    N+VVA DGSGNY+T+SEA+  A  ++ + RY+I IKAGT
Sbjct  183   PTWVRPSDRKLLQSSSAVSKANIVVARDGSGNYKTISEAITAASKQTGAARYIIYIKAGT  242

Query  354   YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
             Y EN++V     NIMF+GDG GKT+ITG+++V  GSTTF SATVAVVG+ F+A+DITF+N
Sbjct  243   YNENIEVGSKLDNIMFVGDGIGKTIITGSKSVGGGSTTFKSATVAVVGDGFVAQDITFRN  302

Query  174   TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             TAGA+  QAVALR GSDLS FY C  + YQDTLYVHS RQFY +C I GTVDFIFGNA
Sbjct  303   TAGAANHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNA  360



>ref|XP_009766961.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Nicotiana sylvestris]
Length=574

 Score =   270 bits (691),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 158/359 (44%), Positives = 217/359 (60%), Gaps = 17/359 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRAN---VQKLVVSTTNYT  892
             T YPD C SSL+        ++ Q D+ ++S+   + + E + A+    Q       N  
Sbjct  77    TLYPDSCISSLSPYAAKGNNLKPQ-DIYKMSV--LVALNELSGASDKFFQSEAFKNINDP  133

Query  891   KREKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLD  712
                K A   C E +  AL  LN  L       ++ S++   DDL+T +S+A T Q+TC+D
Sbjct  134   AAAK-ALESCHELLSLALDHLNDTLS-----VAENSLLDGFDDLRTWLSSAGTYQQTCID  187

Query  711   GFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGC  532
              F +  +   ++    N +   E   SN L+L+ ++  +   + + A G R+L E  GG 
Sbjct  188   SFENVTSIALSKAAGQNLKNSTE-YTSNSLALVTSLEQS--VSSLGAIGRRRLMEFSGGD  244

Query  531   EWPEWLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAG  358
             E+P WLS+ DR+LLQ +A     N VVA DGSG Y+++  A+K AP KS KRYVI +K G
Sbjct  245   EYPSWLSSNDRKLLQKSAPKIKVNAVVAKDGSGKYKSIKAALKAAPEKSKKRYVIYVKKG  304

Query  357   TYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQ  178
              YKENV + K+K NIM IGDG+  T+++GNRN IDG+ TF SAT AV G+ F+ARD+ F 
Sbjct  305   IYKENVRIEKTKWNIMIIGDGKDATIVSGNRNFIDGTPTFQSATFAVFGKGFMARDMGFV  364

Query  177   NTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             NTAGA+K QAVAL   +D S FY C+M A+QDTLY HSNRQFY  C + GTVDFIFGN+
Sbjct  365   NTAGAAKHQAVALMSTADESVFYRCKMDAFQDTLYSHSNRQFYRDCNVYGTVDFIFGNS  423



>ref|NP_001146685.1| pectinesterase precursor [Zea mays]
 gb|ACL54524.1| unknown [Zea mays]
 tpg|DAA54385.1| TPA: pectinesterase [Zea mays]
Length=563

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 159/367 (43%), Positives = 215/367 (59%), Gaps = 19/367 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP+LC S+LA  P++ KK     DVI  ++  T  +     +N     +   + + R+
Sbjct  47    TLYPELCLSTLADIPDLHKK--PLPDVICAAVNRTEDVVVATSSNC-SYYLQDRSLSARD  103

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHA---------DDLKTLMSAAMTN  730
             ++A  DCLE +   + +L  +  DL     + S  A           + + T++SAA+TN
Sbjct  104   RLAINDCLELLSTTMDELRASTADLASPAGRGSASAGVSQGARRATMEHVMTVLSAAITN  163

Query  729   QETCLDGFSHCKADHNAR--KPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRK  556
             Q TCLDGF++       R  +P F+   HV ++ SN L++ + +    A           
Sbjct  164   QYTCLDGFAYQSGGRVRRYIEPTFH---HVSRMVSNSLAMAKKLPGAGASAAPAPPRQPF  220

Query  555   LKEVEGGCEWPEWLSAGDRRLLQSTAATPNVVVAA--DGSGNYRTVSEAVKNAPSKSSKR  382
                 +    +P W+  GDRRLLQ+ A+          DGSG+Y TV+ AV  AP+ S KR
Sbjct  221   TGYGQMVKGFPRWVRPGDRRLLQAPASAVAADAVVAKDGSGDYTTVAAAVAAAPTNSKKR  280

Query  381   YVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERF  202
             +VI IKAG Y ENV+V K   N+MF+GDG GKTVI  +RNV+DG TTF SATVAVVG  F
Sbjct  281   HVIYIKAGAYMENVEVGKKHVNLMFVGDGIGKTVIKASRNVVDGYTTFRSATVAVVGNNF  340

Query  201   LARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTV  22
             LARD+T +N+AG SK QAVALRVG+DLSAFY C    YQDTLYVHS RQF+  C + GT+
Sbjct  341   LARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDVYGTI  400

Query  21    DFIFGNA  1
             DF+FGNA
Sbjct  401   DFVFGNA  407



>gb|KHN43496.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=481

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 198/305 (65%), Gaps = 20/305 (7%)
 Frame = -2

Query  891  KREKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSI-VAHADDLKTLMSAAMTNQETCL  715
            K E+ A  DCL   D  + +L T + DL    S+ +I      D +TL+S AMTN  TCL
Sbjct  32   KLEQRALDDCLNLFDDTVSELETTIADL----SQSTIGPKRYHDAQTLLSGAMTNLYTCL  87

Query  714  DGFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMT----DTDAQNEIKASGNRKLKE  547
            DGF++ K   + R     G + +    SN L++++ +        ++NE+   G  K+K+
Sbjct  88   DGFAYSKG--HVRDRFEEGLLEISHHVSNSLAMLKKLPAGVKKLASKNEV-FPGYGKIKD  144

Query  546  VEGGCEWPEWLSAGDRRLLQSTA--ATPNVVVAADGSGNYRTVSEAVKNAPSKSSKR-YV  376
                  +P WLS  DR+LLQ+       N++VA DG+GN+ T++EAV  AP+ S+ R +V
Sbjct  145  -----GFPTWLSTKDRKLLQAAVNETNFNLLVAKDGTGNFTTIAEAVAVAPNSSATRQFV  199

Query  375  IRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLA  196
            I IKAG Y ENV+V + KTN+MF+GDG GKTV+  +RNV+DG TTF SATVAVVG+ F+A
Sbjct  200  IHIKAGAYFENVEVIRKKTNLMFVGDGIGKTVVKASRNVVDGWTTFQSATVAVVGDGFIA  259

Query  195  RDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDF  16
            + ITF+N+AG SK QAVALR GSD SAFY C   AYQDTLYVHS RQFY  C + GTVDF
Sbjct  260  KGITFENSAGPSKHQAVALRSGSDFSAFYKCSFVAYQDTLYVHSLRQFYRDCDVYGTVDF  319

Query  15   IFGNA  1
            IFGNA
Sbjct  320  IFGNA  324



>ref|XP_009348912.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=545

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 150/362 (41%), Positives = 215/362 (59%), Gaps = 25/362 (7%)
 Frame = -2

Query  1056  YPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKI  877
             +P LC S+LAS P       +    +E ++  T     T + +++ L+     Y + E+ 
Sbjct  41    HPSLCSSALASAPS-HNHFTAFHHFLETNINRTAASIGTTQQSIRALLRLQELYVQ-ERN  98

Query  876   AFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHC  697
             A  DCLE +DQ L++L   ++DL        +     +LKTL+SAAMTNQ TC+DGF   
Sbjct  99    ALRDCLEMLDQTLYELGQVIEDLH------GLRVSYGNLKTLLSAAMTNQNTCIDGFFEL  152

Query  696   KADHNARKPIFNGQVH-----VEKLCSNCLSLIRNMTDTDAQNEIKASGNR---KLKEVE  541
             +   +  +    G +      + +  SNCL++IRN      Q +I  S  R      +  
Sbjct  153   EELDSENQKGLKGHLQGLLSPISESMSNCLAMIRN------QEQILNSQKRVSSSTTKKS  206

Query  540   GGCEWPEWLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
                 +P+W+  GDR L+Q        ++VVAADGSG+Y T+ EA+K AP+ S  R+VIRI
Sbjct  207   SKKRFPKWMLPGDRNLMQRLVPRIRADIVVAADGSGDYETIGEALKVAPNFSMDRFVIRI  266

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
              +G Y E V++ + K+NIM +G+G   T+ITG+++  DG +TF +AT  V+G++FLARD+
Sbjct  267   NSGVYNETVEIARVKSNIMLVGEGMKSTIITGSKSFADGFSTFATATFTVIGDKFLARDL  326

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             T  NTAG+ K QAVA RV S+ SAFY C   +YQDTLYVHS RQFY  C+I GT+DFIFG
Sbjct  327   TITNTAGSEKFQAVAARVTSN-SAFYRCNFSSYQDTLYVHSLRQFYRNCIIEGTIDFIFG  385

Query  6     NA  1
             NA
Sbjct  386   NA  387



>gb|KHN21591.1| Putative pectinesterase/pectinesterase inhibitor 6 [Glycine soja]
Length=521

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 210/356 (59%), Gaps = 19/356 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP +C   + +T  +S    S     +L+L+ T++ A      V K+ ++     KR 
Sbjct  28    TPYPRVCMHYIETTNTLSTLDASSSSFHDLALRVTMEQAIVAHKLVSKMDLNNFK-DKRA  86

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A+ DCLE  +  L+QL  ++   ++           +D  T  SA++ N +TC +GF+
Sbjct  87    KSAWEDCLELYEDTLYQLKRSMNSNKL-----------NDRLTWQSASIANHQTCQNGFT  135

Query  702   HCK-ADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
                   H    P  +   +  KL SN LS+ + M  T   +  K SG R+L   +G   +
Sbjct  136   EFNLPSHLNYFP--SMLSNFSKLLSNSLSISKTMMMTLTTSSTKQSGGRRLLLSDG---F  190

Query  525   PEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSK-RYVIRIKAGTYK  349
             P WLS  DRRLLQ T    +VVVA DGSGNY+T+SE V  A   S K R V+ +KAG YK
Sbjct  191   PYWLSHSDRRLLQETTPKADVVVAQDGSGNYKTISEGVAAAAKLSGKGRVVVHVKAGVYK  250

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             +++D+ ++  N+M IGDG G T++TGN N  DGSTTF SAT AV G+ F+ARDITF+NTA
Sbjct  251   DSIDIKRTVKNLMIIGDGMGATIVTGNLNAQDGSTTFRSATFAVSGDGFIARDITFENTA  310

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G  + QAVALR G+D S FY C    YQDTLYV++NRQFY  C I GT+DFIFG+A
Sbjct  311   GPQQHQAVALRSGADHSVFYRCSFMGYQDTLYVYANRQFYRDCDIYGTIDFIFGDA  366



>ref|XP_006580436.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=521

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 210/356 (59%), Gaps = 19/356 (5%)
 Frame = -2

Query  1062  TRYPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKRE  883
             T YP +C   + +T  +S    S     +L+L+ T++ A      V K+ ++     KR 
Sbjct  28    TPYPRVCMHYIETTNTLSTLDASSSSFHDLALRVTMEQAIVAHKLVSKMDLNNFK-DKRA  86

Query  882   KIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFS  703
             K A+ DCLE  +  L+QL  ++   ++           +D  T  SA++ N +TC +GF+
Sbjct  87    KSAWEDCLELYEDTLYQLKRSMNSNKL-----------NDRLTWQSASIANHQTCQNGFT  135

Query  702   HCK-ADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEW  526
                   H    P  +   +  KL SN LS+ + M  T   +  K SG R+L   +G   +
Sbjct  136   EFNLPSHLNYFP--SMLSNFSKLLSNSLSISKTMMMTLTTSSTKQSGGRRLLLSDG---F  190

Query  525   PEWLSAGDRRLLQSTAATPNVVVAADGSGNYRTVSEAVKNAPSKSSK-RYVIRIKAGTYK  349
             P WLS  DRRLLQ T    +VVVA DGSGNY+T+SE V  A   S K R V+ +KAG YK
Sbjct  191   PYWLSHSDRRLLQETTPKADVVVAQDGSGNYKTISEGVAAAAKLSGKGRVVVHVKAGVYK  250

Query  348   ENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTA  169
             +++D+ ++  N+M IGDG G T++TGN N  DGSTTF SAT AV G+ F+ARDITF+NTA
Sbjct  251   DSIDIKRTVKNLMIIGDGMGATIVTGNLNAQDGSTTFRSATFAVSGDGFIARDITFENTA  310

Query  168   GASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             G  + QAVALR G+D S FY C    YQDTLYV++NRQFY  C I GT+DFIFG+A
Sbjct  311   GPQQHQAVALRSGADHSVFYRCSFMGYQDTLYVYANRQFYRDCDIYGTIDFIFGDA  366



>ref|XP_009343376.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=545

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 152/362 (42%), Positives = 217/362 (60%), Gaps = 25/362 (7%)
 Frame = -2

Query  1056  YPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKI  877
             +P LC S+LAS P       +    +E ++  T     T + +++ L+     Y + E+ 
Sbjct  41    HPSLCSSALASAPS-HNHFTAFHHFLETNINRTAASIGTTQQSIRALLRLQELYVQ-ERN  98

Query  876   AFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHC  697
             A  DCLE +DQ L++L  A++DL        +     +LKTL+SAAMTNQ TC+DGF   
Sbjct  99    ALRDCLEMLDQTLYELGQAIEDLH------GLRVSYGNLKTLLSAAMTNQNTCIDGFFEL  152

Query  696   KA----DHNARKPIFNGQVH-VEKLCSNCLSLIRNMTDTDAQNEIKASGNR---KLKEVE  541
             +     +    K  F G +  + +  SNCL++IRN      Q +I  S  R      +  
Sbjct  153   EELDSENQKGLKGHFQGLLSPISESMSNCLAMIRN------QEQILNSQKRVSSSTTKKS  206

Query  540   GGCEWPEWLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
                 +P+W+  GDR L+Q        ++VVAADGSG+Y T+ EA+K AP+ S  R+VIRI
Sbjct  207   SKKRFPKWMLPGDRNLMQRLVPRIRADIVVAADGSGDYETIGEALKVAPNFSMDRFVIRI  266

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
              +G Y E V++ + K+NIM +G+G   T+ITG+++  DG +TF +AT+ V+G++FLARD+
Sbjct  267   NSGVYNETVEIARVKSNIMLVGEGMKSTIITGSKSFADGFSTFATATLTVIGDKFLARDL  326

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             T  NTAG+ K QAVA RV S+ SAFY C   +YQDTLYVHS  QFY  C+I GT+DFIFG
Sbjct  327   TITNTAGSEKFQAVAARVTSN-SAFYRCNFSSYQDTLYVHSLSQFYRNCIIEGTIDFIFG  385

Query  6     NA  1
             NA
Sbjct  386   NA  387



>ref|XP_004247400.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=562

 Score =   268 bits (686),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 160/361 (44%), Positives = 222/361 (61%), Gaps = 23/361 (6%)
 Frame = -2

Query  1056  YPDLCYSSLASTPEVSKKVRSQK-----DVIELSLKNTIKIAETNRANVQKLVVSTTNYT  892
             Y  LC S+LAS P++ +K  SQ      +V  + +K + K     R ++ KL        
Sbjct  57    YKQLCVSTLASIPDLPQKSISQIISSTINVTVVEVKASAKNCTDIREDLPKL-------E  109

Query  891   KREKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLD  712
               EK A  DC++ +D  + +L ++L  L      +S+  + +DL+TL+SAAMTNQ TCLD
Sbjct  110   PYEKRALEDCIQLLDDTIIELKSSLVALH---PNRSLSQNYNDLQTLLSAAMTNQATCLD  166

Query  711   GFSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGN--RKLKEVEG  538
             G    ++  N R+ +      +    SNCL++++ +  + +  + + S     +   V  
Sbjct  167   GLG--RSTKNLRRFVQRRLHTISHHVSNCLAMLKKLKKSSSSLKTRKSLEIYPEYGVVHD  224

Query  537   GCEWPEWLSAGDRRLLQST--AATPNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIK  364
             G  +P W+   DR LLQ+       +++VA DG+GN+ T+++A+  AP+ S  R+VI IK
Sbjct  225   G--FPNWIKRRDRALLQTPINQTKIDLIVAKDGTGNFSTINDALSAAPNSSKTRFVIYIK  282

Query  363   AGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDIT  184
             AG Y E V+V K K+ IMF+GDG GKT+I GNR+V+DG TTF SATVAVVG  FLA+ IT
Sbjct  283   AGAYFEYVEVVKKKSMIMFLGDGIGKTLIKGNRSVVDGWTTFRSATVAVVGNGFLAKGIT  342

Query  183   FQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGN  4
             F+N AG SK QAVA+R GSDLSAFY C   AYQDTLYVHS RQFY  C + GTVDFIFGN
Sbjct  343   FENYAGPSKHQAVAVRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFGN  402

Query  3     A  1
             A
Sbjct  403   A  403



>ref|XP_011036906.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Populus euphratica]
Length=538

 Score =   268 bits (684),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/353 (41%), Positives = 220/353 (62%), Gaps = 17/353 (5%)
 Frame = -2

Query  1044  CYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGD  865
             C S+L +  E+ K       ++  +L+ T+  A      + K    + +Y  RE++A  D
Sbjct  49    CLSNLQA--ELKKSGPPANSILHAALRATLDEAMRAIDMITKFNALSVSY--REQVAIED  104

Query  864   CLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADH  685
             C E +D ++ +L  +L+++    +    V +  +LK  +SAA++N +TCL+GF     D 
Sbjct  105   CKELLDFSVSELAWSLKEMNNIRAGMKNVHYEGNLKAWLSAALSNPDTCLEGFE--GTDG  162

Query  684   NARKPIFNGQVHVEKLCSNCLSL---IRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEWL  514
             +    I      V +L  N L+L   + ++     +N+   + N       G  ++PEW+
Sbjct  163   HLENFIRGSLKQVTQLIGNVLALYTQLHSLPFKPPRNDNATTTN------SGSDKFPEWM  216

Query  513   SAGDRRLLQSTAATPNV--VVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENV  340
             + GD+ LL+ ++   ++  +VA DG+G+YRT++EA+  APS S+KRY+I +K G Y+EN+
Sbjct  217   TEGDQELLKGSSLGMHIDAIVAGDGTGHYRTITEAINEAPSYSNKRYIIYVKKGVYRENI  276

Query  339   DVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGAS  160
             D+ + K+NIMF+GDG G+TV+TGNRN + G T+F +ATVAV G+ F+ARD+TF+NTAG  
Sbjct  277   DMKRKKSNIMFVGDGIGQTVVTGNRNFMQGWTSFRTATVAVSGKGFIARDMTFRNTAGPL  336

Query  159   KEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
             K QAVALRV SD SAFY C M+ YQDTLY HS RQFY +C I GT+D+IFGN 
Sbjct  337   KHQAVALRVDSDQSAFYRCSMEGYQDTLYAHSLRQFYRECEIYGTIDYIFGNG  389



>ref|XP_010043041.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Eucalyptus grandis]
Length=535

 Score =   268 bits (684),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 203/330 (62%), Gaps = 13/330 (4%)
 Frame = -2

Query  984  VIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKIAFGDCLETIDQALFQLNTALQDLR  805
            V+  +L+ T+  A     ++ +    + +Y  RE++A  DC E +D ++ ++  ++ +++
Sbjct  68   VLSAALQATLNEARAAVESISRFTALSVSY--REQVAIEDCKELLDYSISEIAWSMGEMK  125

Query  804  VYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHCKADHNARKPIFNGQVHVEKLCSNC  625
               +      +  +LK  +SAA++NQ+TCL+GF     D      +      V +L  N 
Sbjct  126  RIQAGSKNSHYGGNLKAWLSAALSNQDTCLEGFE--GTDGRLENFVRGSLKQVTQLIGNV  183

Query  624  LSLIRNMTDTDAQNEIKASGNRKLKEVEGGCEWPEWLSAGDRRLLQSTAATPNV--VVAA  451
            L++   +               +     G  E+P W++ GD+ LL+++    +V  VVA+
Sbjct  184  LTMYCQLHSLPFPPP-------RTNSSHGASEFPAWMTEGDQELLKASPVGMHVDAVVAS  236

Query  450  DGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGTYKENVDVPKSKTNIMFIGDGRGKTVITG  271
            DGSG YRT+SEAV +APS S++RYVI IK G Y EN+D+ + KTNIMF+GDG G T+ITG
Sbjct  237  DGSGRYRTISEAVIDAPSYSNRRYVIYIKKGVYSENIDLKRKKTNIMFVGDGIGATIITG  296

Query  270  NRNVIDGSTTFNSATVAVVGERFLARDITFQNTAGASKEQAVALRVGSDLSAFYNCEMKA  91
            NR+ + G TTF +ATVAV G+ F+ARD+TF+NTAG    QAVALRV SD SAFY C M+ 
Sbjct  297  NRHFMQGWTTFRTATVAVSGKGFIARDMTFRNTAGPRNHQAVALRVDSDQSAFYRCSMEG  356

Query  90   YQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
            YQDTLY HS RQFY +C + GT+DFIFGN 
Sbjct  357  YQDTLYAHSLRQFYRECDVHGTIDFIFGNG  386



>gb|KDP23440.1| hypothetical protein JCGZ_23273 [Jatropha curcas]
Length=538

 Score =   267 bits (683),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 134/298 (45%), Positives = 193/298 (65%), Gaps = 10/298 (3%)
 Frame = -2

Query  888  REKIAFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDG  709
            RE++A  DC E +D ++ +L  +L+++    +    V +  +LK  +SAA++NQ+TCL+G
Sbjct  100  REQVAIEDCKELLDFSVSELAWSLEEMEKIRAGDMNVRYEGNLKAWLSAALSNQDTCLEG  159

Query  708  FSHCKADHNARKPIFNGQVHVEKLCSNCLSLIRNMTDTDAQNEIKASGNRKLKEVEGGCE  529
            F     D      +      V +L  N L+L   +      + +    +R         E
Sbjct  160  FE--GTDRRLENFMRGSLNQVTQLIGNVLALYTQL------HSMPFKPSRNGTVTNRSPE  211

Query  528  WPEWLSAGDRRLLQSTAATPNV--VVAADGSGNYRTVSEAVKNAPSKSSKRYVIRIKAGT  355
            +PEW++ GD+ LL++++   ++  +V+ DGSG+YRT++EA+  APS S++RY+I +K G 
Sbjct  212  FPEWMTEGDQELLKASSVGIHIDAIVSLDGSGHYRTITEAINEAPSHSNRRYIIYVKQGV  271

Query  354  YKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDITFQN  175
            Y+EN+D+ K KTNIM +GDG GKTV+TGNRN + G TTF +ATVAV G  F+ARD+TF+N
Sbjct  272  YRENIDMKKKKTNIMLVGDGIGKTVVTGNRNFLQGWTTFRTATVAVSGRGFIARDMTFRN  331

Query  174  TAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFGNA  1
            TAG    QAVALRV SD SAFY C M+ YQDTLY HS RQFY +C I GT+D+IFGN 
Sbjct  332  TAGPQNHQAVALRVDSDQSAFYRCSMEGYQDTLYAHSLRQFYRECNIYGTIDYIFGNG  389



>ref|XP_008392665.1| PREDICTED: pectinesterase-like [Malus domestica]
 ref|XP_008344188.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=545

 Score =   268 bits (684),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 150/362 (41%), Positives = 215/362 (59%), Gaps = 25/362 (7%)
 Frame = -2

Query  1056  YPDLCYSSLASTPEVSKKVRSQKDVIELSLKNTIKIAETNRANVQKLVVSTTNYTKREKI  877
             +P LC S+ AS P       +    +E ++  T     T + +++ L+     Y + E+ 
Sbjct  41    HPSLCSSAHASAPX-HNHFTAFHHFLETNINRTAASIGTTQQSIRALLRLQELYVQ-ERN  98

Query  876   AFGDCLETIDQALFQLNTALQDLRVYPSKKSIVAHADDLKTLMSAAMTNQETCLDGFSHC  697
             A  DCLE +DQ L++L  A+ +L        +     +LKTL+SAAMTNQ TC+DGF   
Sbjct  99    ALRDCLEMLDQTLYELGQAIDBLH------XLRVSYGNLKTLLSAAMTNQNTCIDGFFEL  152

Query  696   KADHNARKPIFNGQVH-----VEKLCSNCLSLIRNMTDTDAQNEIKASGNR---KLKEVE  541
             +   +  +    G +      + +  SNCL+ IRN      Q +I  S  R      +  
Sbjct  153   EELDSQNQKGLKGHLQGLLSPISESMSNCLAXIRN------QEQILNSQKRVSSSPTKKS  206

Query  540   GGCEWPEWLSAGDRRLLQSTAAT--PNVVVAADGSGNYRTVSEAVKNAPSKSSKRYVIRI  367
                 +P+W+  GDR L+Q        ++VVAADGSG+Y T+ EA+K AP+ S  R+VIRI
Sbjct  207   SKKRFPKWMLPGDRNLMQRLVPRIRADIVVAADGSGDYETIGEALKMAPNFSXDRFVIRI  266

Query  366   KAGTYKENVDVPKSKTNIMFIGDGRGKTVITGNRNVIDGSTTFNSATVAVVGERFLARDI  187
             K+G Y E V++ + K+NIM +G+G   T+ITG+++  DG +TF +AT+ V+G++FLARD+
Sbjct  267   KSGVYNETVEIAREKSNIMLVGEGMKSTIITGSKSFADGFSTFATATLTVIGDKFLARDL  326

Query  186   TFQNTAGASKEQAVALRVGSDLSAFYNCEMKAYQDTLYVHSNRQFYVKCLISGTVDFIFG  7
             T  NTAG+ K QAVA RV S+ SAFY C   +YQDTLYVHS RQFY  C+I GT+DFIFG
Sbjct  327   TITNTAGSXKFQAVAARVTSN-SAFYRCNFSSYQDTLYVHSLRQFYRNCIIEGTIDFIFG  385

Query  6     NA  1
             NA
Sbjct  386   NA  387



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3025133731368